GenomeNet

Database: RefSeq
Entry: NC_016459
LinkDB: NC_016459
Original site: NC_016459 
LOCUS       NC_016459            4786945 bp    DNA     linear   CON 29-NOV-2019
DEFINITION  Thermothielavioides terrestris NRRL 8126 chromosome 3, complete
            sequence.
ACCESSION   NC_016459
VERSION     NC_016459.1
DBLINK      BioProject: PRJNA79337
            BioSample: SAMN02744067
            Assembly: GCF_000226115.1
KEYWORDS    RefSeq.
SOURCE      Thermothielavioides terrestris NRRL 8126
  ORGANISM  Thermothielavioides terrestris NRRL 8126
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothielavioides; Thermothielavioides terrestris.
REFERENCE   1  (bases 1 to 4786945)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4786945)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.-C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.H.,
            Baker,S.E., Magnuson,J., LaBoissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4786945)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4786945)
  AUTHORS   Otillar,R., Salamov,A., Grimwood,J., Reid,I., Ishmael,N., John,T.,
            Darmond,C., Moisan,M.-C., Henrissat,B., Coutinho,P.M., Lombard,V.,
            Natvig,D., Lindquist,E., Schmutz,J., Lucas,S., Harris,P.,
            Powlowski,J., Bellemare,A., Taylor,D., Butler,G., de Vries,R.P.,
            Allijn,I.E., van den Brink,J., Ushinsky,S., Storms,R., Powell,A.J.,
            Paulsen,I.T., Elbourne,L.D.H., Baker,S.E., Magnuson,J.,
            LaBoissiere,S., Clutterbuck,A.J., Martinez,D., Wogulis,M., de
            Leon,A.L., Rey,M.W., Tsang,A., Berka,R.M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003011.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043154
            The DNA was provided by Paul Harris (paha@novozymes.com)
            The strain is available from the Northern Regional Reaearch
            Labortories (USDA) in Peoria, IL under NRRL 8126 and from the
            American Type Culture Collection under ATCC 38088
            Contacts: Randy Berka (RAMB@novozymes.com)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Thielavia terrestris NRRL 8126
            GOLD Stamp ID         :: Gi01746
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Thielavia terrestris V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 10.15x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4786945
                     /organism="Thermothielavioides terrestris NRRL 8126"
                     /mol_type="genomic DNA"
                     /strain="NRRL 8126"
                     /db_xref="taxon:578455"
                     /chromosome="3"
     gene            complement(<4361..>12418)
                     /locus_tag="THITE_53646"
                     /db_xref="GeneID:11519007"
     mRNA            complement(join(<4361..7290,7366..11852,11919..>12418))
                     /locus_tag="THITE_53646"
                     /product="polyketide synthase"
                     /transcript_id="XM_003653687.1"
                     /db_xref="GeneID:11519007"
     CDS             complement(join(4361..7290,7366..11852,11919..12418))
                     /locus_tag="THITE_53646"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003653735.1"
                     /db_xref="GeneID:11519007"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Thite2_53646"
                     /translation="MAHSTAFPKLLIFGSQILSFDADSARRLRDRLVDGHSLAWAASV
                     IRELPRLWKTVSQAVPTLQSLPGEDLLGNLDAWLRTGLFPEAVYPLPNILLTPLVVLF
                     HLAQYQQSVELGIHGHSSGDDDLPQSCRRSTEALGLCTGLLSAAAVASSSSGAELQHY
                     AAVAVRLAMVIGAVVDAKNRSQRQARSFSVSWSSQPLANRMSEILGRHPDAYISVLQD
                     HARATVTVSGDQLGPLQAALEEAGFSVTSVPLLGRFHCPDHHEEVQLLAKLCDTCPWF
                     QFPDTSQLAFPLRFDAEGHFVTNGKLHHLILHSMLAAQSDWASAFARVQDAVSSNEQL
                     QVLCFGPENCVPVSLIRKLGQRFTHLADLNVAQSSLFVRLSGLDGPPEYRSRVLDNGV
                     AVIGMACQLPGAADLDEFWSILCAGRSQHTEVPQERFQFDTAFRDIEPSRKWYGNFVQ
                     DHDAFDHKFFKKSPREMSSTDPQHRLMLQVAYQAVEQSGYFNRPHRDAVDKHIGCYIG
                     VGLVDYERNIACAPANAYSATGNLKSFAAGKISHYFGWTGPSLTVDTACSSSAVAVHM
                     ACRAILSGECTGGALAGGVNVMTSPEWFQNLAGASFLSPTGQCKPFDAKGDGYCRAEG
                     VGAVFLKKLSSAIADGDQIFGVIASSTVYQNQNCTPITVPNAPSLADLFSKAVTDAGL
                     RPGDITYVEAHGTGTPVGDPAEYAGIRRVLGGPSRSVTLSLGSVKGLVGHTESASGIA
                     ALLKTLVMINKGAIPPQASFETINPAIETAPEDRITISTVLEPWNVDFRAALINNYGA
                     SGSNACLVVTQGHKVNWKPRALSEGETQTRMKYPFWFCGNDEKSLRAYCARFRQFLAS
                     QQLGAAGRATALLPTLSFQLSRQSNRSLPSSLIFNCTSVEDLQDKLAAFEQGTSQESA
                     GRPAGNLQPAVVLCFGGQNSTCVGIDRAIYDQVSVFRSHLDACDAMCRSLGLESIYPD
                     IFQRTPASDVVKLQTMLFATQYACARSWIDCGLEPAAVVGFSFGELTALCVAGVLNLE
                     TAIGMVAGRARVIQEKWGRDPGAMIAIEAEQSQVEELLSDAAAAGSSEDRATIACFNG
                     PTSFTLAGSTRAIGSVTETLESKAAFRGVRWKRIDVTNAFHCSLVDPLVPDLERIGMG
                     LRFEAPKIPVEHATETELSFDRLDSRFVANHMRQPVYFSHAARRLAKKYQACVWLEAG
                     SNSSVTSIAYRAIGGNASSKNSHKFQSFNITADNSLDFLAEATVQLWNWGVDVTFWPH
                     HASQRAQYPPLMLPPYQFEKSRHWIELKPPPKANSELAVPPATVAARPVGLWSFVGQD
                     QGKHRRCVRFRVHTTSAEFEEHVSGHIIAQAAPLCPSTLQLHIAIDALMSVRVDASLQ
                     PRLRGMTSHTPLPLGLQDPVWLDAEAQDPDLRIWTWKMSSSVHSSASNGPHTLYVSGT
                     IVFLAPDDADWRDEFSRFERLVGWERCERLLNDLDPDEVIKGPKIYNRFAEIVQYGDL
                     YKGVLKLVGKGDESAGRVVARKTSTTTSNSSSKSWLDTGLADSFCQVAGIFVNTMTDR
                     SPSDIYISDRIDQWVRSPAGVDNMNPTERTEWEVLALHHRQSEKEYVSDVFIYDQRTS
                     RLAEVILGIHYRRVPKAALAKAISKCLPPTAEPIPPASTNGQTKLPNGCTPHDRRENE
                     REKKKKSESGVSVRVRDIIVNLSGLEPEQITNDADLVELGIDSLMGMELAREIESAFE
                     IVLSTDELMALTDFRSLVTCVQKHAALPDTDEEPEESDKMAEGLGNGSHERVEITQPN
                     GVKQVNGSAVPNHLFGNTVLEVFAECKQATDDFIRDHKMGDYVDKVMPRSTELCVAHI
                     VDAFEELGCKIRSAKPGQKLDRIQHLPRHRQFVDWMYELLEKEARLVDLDGPDIIRTA
                     VSLPSRPAETLWQDLTRNFPDHVYDHNLTYLVGRKLADCLIGRMDGLQLIFGTPEGRE
                     IVSGMYGKSPINLVWVKQMEHFLKQLLGRVHLPPGGEPIRILEMGAGTGGTTAKMLPL
                     LAGLGVPVRYTVTDLSSSLVAAARKRFSKEYPFVDFRTFDIEKPPTGDLVHSQHIVLA
                     TNCVHATHSLVQSTANIHNVLRPDGFLMMLEMTTPVPWVDLTFGLIEGWWLFDDGRRH
                     ALASPDLWETTLRSVGYGYVDWTEGRLPESEVQRIIIAMASGPRYDRPSRPSAPESDP
                     GSMRPHTQDLAADIATRQAIVDAFVEQYTRDFQFPPALDEQSQHLGVLEQEEDRRATI
                     LVTGATGSLGSHLVAHLATLPSVKEVICLNRRSTTNNNDPTARQHQAMRSRGISLSAE
                     ALAKLRVLAADTSKPKLGLPDDEHNLLKRTVTHIVHNAWPMSITRGIHAFASQFQTMA
                     NLIALAAAAAAAAAASSSPARRRPRAITFQFISSIATVGCYASQPSGQACPTRVPEER
                     MSVSSVLPTGYGDAKLVCERMLDATLHKYPDRFRAMVVRIAQIAGSAVSGYWNPVEHF
                     AFVVKSAQTLRALPGLTGTLSWCPVTDVATVLGELMLSGDDREVFPIYHIENPSRQPW
                     EDMIRVLADALNVPRENIVSFDEWLRRVRRFPGSIETDNPAGRLVDFLEHHFVRMSCG
                     NLVLDTAHSTAHSATLRQRGPVSPDLVRKYVRAWKEMGFLHS"
     gene            <13257..>15138
                     /locus_tag="THITE_53797"
                     /db_xref="GeneID:11518844"
     mRNA            join(<13257..13580,13654..14019,14094..14314,14387..14831,
                     14897..14986,15040..>15138)
                     /locus_tag="THITE_53797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653688.1"
                     /db_xref="GeneID:11518844"
     CDS             join(13257..13580,13654..14019,14094..14314,14387..14831,
                     14897..14986,15040..15138)
                     /locus_tag="THITE_53797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653736.1"
                     /db_xref="GeneID:11518844"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_53797"
                     /translation="MAHLVQEIALAAGTISPAGGGILVLLATLCSWHLLRKFWKLRDI
                     PGPFWAKLTDLYRAGIVKTGRSHEIFQAYHQKHGALLRLGPNMVSVADPAEIPVIYPM
                     RPGFPKGEFYDAFIPYIKGGSAPPAIFTARDEELHKRIKSPVAPLYSLSNAVKSEPFI
                     DEVLDVLFDQLDARFEKSQATFDLADWLQFFAFDVMGTMTFSRRYGFLETGRDVQGIL
                     ATIWNFMLTVGPMTQVPWLDKLLHKNAVMASFRKASGNVIFQIAADNVARRKAEANDA
                     PRATEGAKTDFLAEFLKIQAENPSIPQWSPLVWTFSNVIAGSDSTAVVMRTTMYNLLA
                     HPSSLARLHRELTDPAITLSRPYPRWAEVANLPYLDACVNEAVRLHPPFCLPLERVVP
                     TGGVTICGRFFEQGTVVGMNPYVVNRHRATFGDDADDWRPERWLEGDEERRRRMEAAI
                     MTFGAGRRTCLGKHVALLEIKKIVTALVLNYEFKLVDPKAYVVENSYFFRQRGIMVQI
                     KRHERS"
     gene            complement(15424..16779)
                     /locus_tag="THITE_2116297"
                     /db_xref="GeneID:11516365"
     mRNA            complement(join(15424..15986,16052..16779))
                     /locus_tag="THITE_2116297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653689.1"
                     /db_xref="GeneID:11516365"
     CDS             complement(join(15550..15986,16052..16541))
                     /locus_tag="THITE_2116297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653737.1"
                     /db_xref="GeneID:11516365"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Thite2_2116297"
                     /translation="MSQLLVVFGATGQQGGSVARFVAASPELSKRYRIRGVTRDPSKA
                     AADALRAEGVEVVQADMDDEQSIRSALEGAHTVFAMTRTIYDDQSKEREVRQGKAIAD
                     AAVAAGAQYIIFSSECHAETVSGGKYPVGSYDSKAEVEDYIRTLPIKSAFFAPATFMQ
                     NLSGMMAPRPVGDGTYAIANFFAGTALFPWIDVVEDTGKFVGAILANPDKYSGQVLYA
                     ASCIHSLDEVAKLISERTGKTVKYTVMPEEKYRSYLPPAAADTIVNMFLYIQDFGYYG
                     PETAERVKWSAEQALGKLTTLEDFISRAVKLA"
     gene            <17515..>18927
                     /locus_tag="THITE_2029366"
                     /db_xref="GeneID:11516366"
     mRNA            join(<17515..18745,18830..>18927)
                     /locus_tag="THITE_2029366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653690.1"
                     /db_xref="GeneID:11516366"
     CDS             join(<17515..18745,18830..>18927)
                     /locus_tag="THITE_2029366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653738.1"
                     /db_xref="GeneID:11516366"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Thite2_2029366"
                     /translation="SARTQEVVHYGQTATVEVATRAVDSAAATFRTYKRTPVHERRRM
                     LLRAADLFEQKVVEMGEMQMRETSCDEAWARFTAMQTSTFCREVAGAVSAALVGDIQP
                     SYFGYTHLVFKEPVGPVLLIPPWNAAVVLSVRGVANALAAGCTVVLKASELCPATHQL
                     VARTFHEAGFPPGAVNVIMADRPHAALVTETVIAHPALRKIEFIGSAAVGKAIGTLAA
                     KHLKPVFMELGDQSPAIVLDDADLEEAARLIAHGSMFHHGQVCFSTERIIVQRAVQDE
                     FCRLLSAAIDRLAPAWMAVTRSHAERAKATVDDAVNRGAQFVYGSSELKGPAQLAPSI
                     LVGVNRDSLMSCGEAFAPTAFLVAVDTEEEAVNEANSRLGGLSAAVFTRSHERGLRLA
                     RELEFGMVQVNNSTIFAEPSGPATNFKGSGWGSNNGKYGIENFLYCKAVSL"
     gene            complement(<19131..>20077)
                     /locus_tag="THITE_52934"
                     /db_xref="GeneID:11516071"
     mRNA            complement(join(<19131..19850,20000..>20077))
                     /locus_tag="THITE_52934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653691.1"
                     /db_xref="GeneID:11516071"
     CDS             complement(join(19131..19850,20000..>20077))
                     /locus_tag="THITE_52934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653739.1"
                     /db_xref="GeneID:11516071"
                     /db_xref="JGIDB:Thite2_52934"
                     /translation="PTPVPDSRPRILCLHGGGTSAAIFRAQCRVLVRHLPHFRLVFAD
                     APFPSEPGPDVLPVYGNWGPPFRRWLRWKPSHPAVEDAEAAQAIIRSLELCKAQDDWL
                     CAKEGGSGGEWVGVLGFSQGAKIAASLLFDQDAVEMGQHGGVSGSRSTGYKFGVLMAG
                     RGPLVALRPENFGEPALMAPGEMSLQCSESRHKPPHMLRLPTVHVHGTRDEGLQWHRR
                     LAQQYCDPETTTIVQWDGGHRVPIKASVVAQIAAEIYRVARECGVTV"
     gene            <24054..>26112
                     /locus_tag="THITE_2144780"
                     /db_xref="GeneID:11516072"
     mRNA            join(<24054..24075,24660..24925,25111..>26112)
                     /locus_tag="THITE_2144780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653692.1"
                     /db_xref="GeneID:11516072"
     CDS             join(24054..24075,24660..24925,25111..26112)
                     /locus_tag="THITE_2144780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653740.1"
                     /db_xref="GeneID:11516072"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2144780"
                     /translation="MLQLCNMSEKINGVASADTSTAAHNTSADDFPDGGLQAWFAVLG
                     GWCGMFCTFGLLNCVGVFEEYYVRGPLAAFGLSTVSWITSTQLWLMIFGGVVFGPVFD
                     TYGPRWLLILGTLSYVFGLMMTSLSSAYYQFFLSQSIVAGAGSSAIFNSLVSSVATWF
                     SRRRAAAFGIMISGASVGGVVLPIMLTQMIPTVGFPWTIRVLGFLFLVLLAVTCATVR
                     PRIPPQPRPFAWATFLAGFTDAPFALTVTASFLFVWGLFLPFTYIALQAQQRGMDITL
                     TNYLLPIINAVSIVGRILPGIVADRLGRFNVMIFITALCALIVLALWIPGRSNTALII
                     FAMVFGFSSGSFISLGPSLVAQISDIRQIGVRTGNAYALQSLAALTGSPLAGAIVKAN
                     GGDFLGLQVFCGVCMAAGSVVFVAARWVQVGWSLRKV"
     gene            complement(<26414..>27735)
                     /locus_tag="THITE_2116299"
                     /db_xref="GeneID:11516073"
     mRNA            complement(join(<26414..26882,26995..27567,27624..>27735))
                     /locus_tag="THITE_2116299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653693.1"
                     /db_xref="GeneID:11516073"
     CDS             complement(join(<26510..26882,26995..27567,27624..27732))
                     /locus_tag="THITE_2116299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653741.1"
                     /db_xref="GeneID:11516073"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="JGIDB:Thite2_2116299"
                     /translation="MMLVELGILDALVGSEAQTTTSSELAKASGCNEGVVVRLMRLAC
                     SLCFCDEVGEQTYRANKLTSLLVQPGWRGAMRWMEIIYPVAADMRRFLTSTNFGRVLD
                     PPVTAFEFVHKRSMWQVLENQPEQRTNFDLWMRERKRHEETLWHRRYPACTALSHDNL
                     KSGPDAVLMVDVGGANGSQLINFKKQFPHLPGRYVLQDLPESLAAMRQPPDGIEVMAY
                     DFFSPQPIKGARFYYFRAVFHNWPEQKCIEILRNLVPAMDPEYSTLLIDDYVLPNTGV
                     QLHSAVADIHMMCMFNSSERTKKEYDTILEKAGLEIVAIYPAGVNEECVLEVRVSSSR
                     GRPVLNGFKKAAPSRED"
     gene            28519..30185
                     /locus_tag="THITE_2116300"
                     /db_xref="GeneID:11516074"
     mRNA            28519..30185
                     /locus_tag="THITE_2116300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653694.1"
                     /db_xref="GeneID:11516074"
     CDS             28678..30090
                     /locus_tag="THITE_2116300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653742.1"
                     /db_xref="GeneID:11516074"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="JGIDB:Thite2_2116300"
                     /translation="MVSLRFLISVFSSLPATIAAACADQFDPSCYASADVLTRNVAVI
                     GGGSSGTYAAVKLRDAGRSVVVIEKQDKLGGKTETYTVPGTGTTIDYGVQVFWNTSVV
                     TDFFSRLNVPIAPFQPSGGATTTVYVDLKSGQFLSNFTPPSSDLSAYRQQLDKYPYLS
                     WGYDIPTPVPEDLSLPFGRFITKYGLQDVAFTIFHHSATGGLGNILQRSTVSVLKALS
                     EPVFQESQGKIVVTAAHNNHQLYDKALEALGRDVLLNSTVVAASRPANSSASTGVRLV
                     VKTPTGNKLVIASQILFTAPQTIDNLSPFDLDRTERLVFSQFNATGFYAGLLNNTGLP
                     TGHSFINAGLSTQYHIPSTPGLYHIQPTAVQGIWSFWYTSDSVLPEATVKREVLAAVN
                     VLTNSSSSSGVEILAFANHSPYLLYPPAEQISQGFYSNLESLQGYRNTWYTGGLFEPA
                     AGPLWVFTQALIEKIAATVQ"
     gene            31189..33272
                     /locus_tag="THITE_2116301"
                     /db_xref="GeneID:11516075"
     mRNA            join(31189..31730,31794..33272)
                     /locus_tag="THITE_2116301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653695.1"
                     /db_xref="GeneID:11516075"
     CDS             join(31325..31730,31794..33070)
                     /locus_tag="THITE_2116301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653743.1"
                     /db_xref="GeneID:11516075"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2116301"
                     /translation="MPQATQLQRLPGFNVANHLEKRKLLIAINCIAGLSIFFFGYDQG
                     MMGGVNNAKHYIDLMGFGYVDPETGEPVVTDSLLQGGIVSVYYLGTLFGCLLGGWVGD
                     KTGRIRTIAFGSLWAIVGASLQCSAQNANWMICARAVNGIGTGILNAIVPVWATETAE
                     YTSRGQFISIEFTLNILGVVVAYWLEFGLSFIDGGASAFRWRFPIAFQIIPLLFLLAA
                     VWFFPESPRWLAKMDRDDEALFILQRLRGTDAAGLAQAQAEYHDIRNVVALEREEANM
                     NSYWRLFTGIGSGELHVGRRVQLVIWLQIIQEWVGIAGVTVYAPTIFRIAGFGTEKSQ
                     WISGLNNIFYMFATLICVFTLDRIGRRWTLYWGAVGQGIAMFLAGGFSRLGEDARAAG
                     DLSKAGSYGAAAASFVFIFTSVFGATWLTVPWLYPAEIFPLQIRARGNALGVFGWSIG
                     NGWLTLLCPVMFNAIGEKTLYIFGACNVVAIPIVWALYPETNQRTLEEIDLLFSAPTP
                     WTWDAEAAFARMKQERPDLIEAAHRGQGVLGVKKLADSDGGHVENSNSSSIA"
     gene            complement(<33653..>41338)
                     /locus_tag="THITE_125678"
                     /db_xref="GeneID:11516076"
     mRNA            complement(join(<33653..40132,40190..>41338))
                     /locus_tag="THITE_125678"
                     /product="polyketide synthase"
                     /transcript_id="XM_003653696.1"
                     /db_xref="GeneID:11516076"
     CDS             complement(join(33653..40132,40190..41338))
                     /locus_tag="THITE_125678"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003653744.1"
                     /db_xref="GeneID:11516076"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Thite2_125678"
                     /translation="MSCRFGGDATSPSKLWELCKAAKDAYSPIPDERFDLAGFYDERK
                     GRSGKFHVKGGYFLKDISRFDSAFYNLTTDVADAMDPQVRMLLESVYESAEDAGIPLH
                     KLAGSNTAVFAGSFGRDYNDMLVRDTESMHASTITGNGIAMLSNRISHFYDLRGASMT
                     IDTGCSTGLVALHQAVHALRSGESDMAIVGSALVCLGPELFIELMGAGVLGPTGKCFA
                     WDHRAEGYGRGEGVASLMLKPLDAALRDGDHIHAVIRETGLNQDGKTTTITSPSAAAQ
                     IDLILDVYRRAGLDPVDTGYVEAHMTGTPTGDPIEAEALAQTFAKHRSPEDPVWVGGV
                     KPNIGHTEPVSGLAAIIKTIFVLKEGVIPPNVNYEKPNPKIPLSDWRLKVPVALTPWP
                     AGKPRRASINNFGYGGTNAHVILEAAPDVFGYGGAGLNGRKRSYLNGYASSVNGTGTS
                     TPLVSEALDSFVYVVSAKESGAAQQMNQNLAQHIRDAGLELAPRARDLAFTLAERRSR
                     LTWVTALRAGDLAELAEKLDKARASRASKKPRLGFVFNGQGAQWYAMGRELIAAYPVF
                     RRSLMAADAILRDYGATWSLREELMRDEKTTRVHEISISQPCSVALQLCLVDLLASWG
                     ITPSAVVSHSSGEIAAAYCVGALSFQQALGVVFYRGELAAQHAAHSSVAGSMLAAGVG
                     AERAAEYVKNTEKGRVVVACHNSPESVTLSGDAPAIEEVRERLAQDGLFARKLNVPLA
                     YHSHHMEPMAQDYSDRLREIVPPASAAKWNGTLYASPVTGDIVTSPKVLGPDHYCRNL
                     VSPVLFAEAFERMCFSDLASDGTRNPSTDANVDMIVEIGAHGTLAGPIRQVLGKDHPM
                     PYVSCLKRGANAVHTIQDAVCALLAQGYPVQLAGVNGHQRGHYVPGLPTYAWNHTHEH
                     WTESRLSREFRHKRFPPHELLGSPVPGINRQSPTWRNILRTADIPWLVEHKLGSDVVL
                     PGAGYIAMAIEAIRLVTDPNEATVAGYRLREVDFLNALVIPDRGVETQFVLRPLSDKE
                     LDSKGWYEFEVWSVSVGDDDSWTQHCKGTIAAEFSSEAKEAATRAAVPAPRTDAFFSA
                     ADLSVNDVHPESFFAVLRSMKLFHGPLFRNMVSSRASTEKSVTTLAVSPAAGQGEPKP
                     YVLHPTTMDSLVHAAYVSIPAATMRGSMVVPRSVRHLYVPRTVNRLVGDKMTAFVNLQ
                     HADRRGALLSGVAVNGRGNDHDVSAPRLELDGLYCQAVPLETDSSDARQASPMCSTNR
                     WEVDIAHGVPPAFTASLRVSLDENDAVFEKKLDRVSFNYVLDAVRDLSVDDEKIARPP
                     HLAQLYTWMKAIVARAETGELVPGSRVWAKTNAGLKQRLADEVASENAAGKLTVRVGQ
                     QLAAIVRGHVDAKALLTREELDQYYESLPRLAKRSYEQVYKIAVQLAVNRPNARVLEV
                     GGRSGALTVRVLEAFAAKAPEGTLGTLLGHYDFTSLNGSALDVVRQRCVPWDALMDFK
                     TLDISKDPAEQGFTSRYDLVIVNASALGPDPAKSLSHVRTLVEGAGGKLVLILEHARP
                     RLDTHVVFGGLAGFQFGEVHDWHELLTAAGFAGVELEVGDCDDAQFQASSVILSSAVE
                     AHGKPPAYPTAVSVVHADNVRPEQQWLTALEASIAEELGATVAVAAVSQVEARPDVTY
                     VFVPEMVSPFLDVMDEAAFNQLRALLVRGQGLLWLSRSGLMTADKPVFAQSSGLLRTA
                     RQEDPSKRYVLLDFDAEDGAGIWPLSAVEYVVRALRQSFDARLSNAEVEHEYAVKEGV
                     MYVSRLYPNPAADSASSETPEETAPEEQPFWQAGRPLVWDTTKTIGTLSNLYFTDDAA
                     RPELPSGFVEIRTHAMGLNFRDVMCAMGQIDESRYMHDAAGVVTRLGPDTEASGLAVG
                     DRVTGVLNGKFATHPSTHWTCLTKIPNDMSWEEAASLPIVFLTSYMCLFDLARLQRGE
                     RVLIHAGAGGVGQSAIMLARLAGAEVFATCSSDAKRQLLMTRFGLDADHIFSSRDTSF
                     APAILARTSGKGVDVVINSLSGPMLKASWDCVARFGRFCEIGKVDMEAARRLDLSPLT
                     RNATIMGFDLIQHCQFNRPAVHRAWKALMKLWSAKVIRAVHPVVSYPLSDMETAMRQM
                     QRGAHIGKLVLIPGEDTRVRVLAAPSSGLKAQLNDPTATYLIVGGLGGIGLAFAHRMM
                     ESGAKHILIISRQAESHAKAKSLIASGRAQGCTVWIRNCDVAREDQLVQVLANCTAAG
                     MPPVRGVIQAALSLHDTILESLTFEQWQAGIRSKVAGTLNLHRHLTDVRFFIMLSSTA
                     GVIGLASQSAYAAGNTFQDALARHRVSKGLPAVAIDLGGVDEVGFVAENGGAVRERVE
                     RTLGKIIPIARVLRLIEAAVCEPMPPTPEASQVITGIIDYDRLPAGAAVKQDPRFSTL
                     KLGSSAGLRASSSAGAAATHSPDDALKQGLVAAATSPEARAAVVMAGLMHKLAALFNL
                     AEAEIDATGSLAAVGVDSLVAVELRNWLSSVVQAHVTVFEILQAATLREFAALVARRS
                     TLVA"
     gene            <42681..>44562
                     /locus_tag="THITE_160963"
                     /db_xref="GeneID:11516077"
     mRNA            join(<42681..42962,43015..44383,44444..>44562)
                     /locus_tag="THITE_160963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653697.1"
                     /db_xref="GeneID:11516077"
     CDS             join(42681..42962,43015..44383,44444..44562)
                     /locus_tag="THITE_160963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653745.1"
                     /db_xref="GeneID:11516077"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_160963"
                     /translation="MATARKLLALTLGPVLAAARSFDYVIVGGGTAGLVVANRLSENP
                     GVSVAVIEAGGYIEDVVGNLSAVPAYVGQVQAAAGQNLDVGWGFSTVPQTGMNGAVAA
                     YPRAKALGGCSTINELVYSRSSKGAFDLFADRVGDNSWKWDAVLPYYKKSMNFSAPAA
                     TRFANATPDYDTSQTARGGPLSIIFPAYAEAWSTWVKEGAEAFGLSPSGGFLDGNLAN
                     QSSWFLVTANQATGERATSETAFLEPVKHRRNLFIYTHTMAERILFNNRKAATGVEVS
                     ANNGTFNITATKEVILSAGVFQSPQLLMVSGVGPASVLQNHGIPVIANLSGVGQNMQD
                     HVITFATFQVKLDNVLDLVSSPEAVTEFNTRAAGPLTNTGGDFGALLKIPPALRANWS
                     DETKQQLAALPADWPEGGFSVLSYNFTPIAGAQPGSAFAAFIPFLQAPKSVGSVSISS
                     ASMHDKPVLNPNWLTAQADIDVLVALIKVARQMAASKPMSDIVVQEVMPGPSVQTDEE
                     IAAYIRGASGTMSHPHSTNAMGKRSDPMAVVDSTGKVYGVSNLRVVDASTFPFLLPGS
                     APQSHIYMLAEKLADAIKASSSY"
     gene            complement(<46342..>52869)
                     /locus_tag="THITE_2050784"
                     /db_xref="GeneID:11516078"
     mRNA            complement(join(<46342..47270,47329..48590,48720..52201,
                     52264..>52869))
                     /locus_tag="THITE_2050784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653698.1"
                     /db_xref="GeneID:11516078"
     CDS             complement(join(46342..47270,47329..48590,48720..52201,
                     52264..52869))
                     /locus_tag="THITE_2050784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653746.1"
                     /db_xref="GeneID:11516078"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="JGIDB:Thite2_2050784"
                     /translation="MIQSGNTLPARAGAARADGSLDEATAVAVIGMACRFPDADSIEE
                     FWELLSAGKSAVRALPTHRFKPSDLTREPRDAGYHGNFLRNPDHYDHRFFGMSGREAK
                     NMDPQQRLVLQVAYETLESAGYFGVNTPHAERDVGCYLGVGAVDYQDNVASHDANAFS
                     ALGTLRAFVSGRISHYFGWSGPSITYDTACSSGAVAIHSAVNAIRSGECAMALAGGVN
                     VITSPALWQNLAAASFLSPTGASRAFDASADGYCRGEGAGLVLLKPLSRATADGDAIL
                     AVITGSAVNQGANCTPITVPHSDSQSALYKKALSQAGTDPQDVTFVEAHGTGTPVGDP
                     IEVESIRKTFGGPNRVHELFLGSVKDNIGHTEAASGAAALIKTVLMMQKRAVPKQANF
                     KRLNPKIPALEPDRITIPTATQPWTIPRPIALVNNYGAAGSNAALVVQYHGAPAVASL
                     GLRNAALPFFISAKTPESLLGYCTVLKAAVSRMQKGHASLAYNLSVKQNRSFDYNYTF
                     IASSLDQVAAALDRAQVTRVEAKRSVVLCLGDQDGRAVGLDEALFQNSKLLQKHLGDC
                     ERACQALRLPSLFPAIFGPAPAQDLVTLHSRLFSLQYSSAKAWLDCGLTVDTIVGQGF
                     GLLTALAVAGVLSVPDALRFISSRARLIQSSLGQDSGAALTGQGNQWLGSGLLESIAP
                     GLRQVAATLEYRQPSIPIEAPSMVDAETLVQYSRMSDHFEDAIQRIVRRLGPCVFLEA
                     GSASPIVSLAQRALATNADGKHLFQSIDIRSPGAGVRLAEAVARLWAAGVRVQYWPFH
                     RIQKNDFSWINLPPYQFQKNSFWIDYVAPKTASTLGTAPTTPLLEPFESGEEGAVTFL
                     LHTTHEVFRHCTQGHAVLGQSLCPASMYVETALRAAELLRESPVQSSASVKDLRISSP
                     LTVGTTRTVLVQLTPKSSVEWAFTVLSRAQPDATASIEHASGVIDVGPDPRRVQFLRR
                     LVGPAKCDELAHSSGVKSLSGADIYQVFGQVVDYASYYRGVDRIVSKVSEAAAKVRAP
                     ARHPIMNEASCDPITLDNFLQVAGIHVNCLSERSANEVFVCTELGELFLTDGFLANRR
                     EARLYKVYSSSTTQTAKSIVNDILIFDSETGDLVVVFSGAIFQAVSTKSLEKTLRKLN
                     SDVDSTELSEEHSVPSAPDVVDSKPQQDQELAQPTVNGISTATVEPEDGSALPRVCEL
                     FSQVIEIPIEDVKPTSSLEELGVDSLMSTEVLNEIKKQFHVVIPADVFLSLGDIQSVA
                     QFLSHRGPPVATAQQKPQPRLSGTSQTVNGSAQNPAPAAETRHIPTYEAVVDEPLVNP
                     SIVSSNAPEILANSETKSGISILSEELPDLPDVLAAALRCQASGAEPKSFAAIAHSSF
                     VQVQRDIEPIQEQLKFAGFYSAVYPAQMELIVRYIVEAFGAMGCSLDALKPGDRVPDI
                     SVLAQHGKVKRQLYHILEVEGIVEQDAAGGFIRTATAVPGRPSEQLLQEILAKFPQHT
                     FEYKLLASTGSKLAECLTGRANPLEILFGSAQARTLMEDVYTYAPMLEAGTVNLGRYL
                     VKVFENFTESRPIRILEIGAGTGGTTKHLIEQLVATRKRFEYTFSDLSSSLVAAAKKK
                     FAQHDFMRYAIFNVEQEPTSQFAHQYDIIISSNCIHATKNLTQTCSNINKCLQPDGVL
                     CLVELTRNLYWFDLVFGLLEGWWLFDDGRRHALADEGLWRKNLIQAGFRWIDWTVGTS
                     RESNVLRVITASPAQVEGASEPVTMETVTFKQEGSVALQADLYYPQESGNGNKARPIA
                     LMIHGGGHVMLSRRDIRPPQTEMLLAAGFLPVSVDYRLAPEVTLVDGPMRDVCDALAW
                     ARDTLPHLSLKRPDIRADGTQVVAVGWSTGGHLALTLGFTAPARGIRPPEATLAFYCP
                     TDYEDPFWTRPNLPFGSRAQLGEYDLLEGVSATGPITAYNPPKRALGGWMSPSDPRSR
                     IALHMNWTGRSLRVLLNGLSRHGHSIGHGDPTDTLPEPSPEQVRAVSPLAQIRRGNYK
                     VPTFLIHGTKDDLIPWQQALRTHEALRQANVEAEIRILDGALHLFDMFRTYEGDSNAK
                     AAVREGYEFLSKHVRFSQ"
     gene            <53304..>55124
                     /locus_tag="THITE_2144786"
                     /db_xref="GeneID:11516079"
     mRNA            join(<53304..53349,53389..53603,53672..54037,54089..54315,
                     54375..54813,54875..54964,55026..>55124)
                     /locus_tag="THITE_2144786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653699.1"
                     /db_xref="GeneID:11516079"
     CDS             join(53304..53349,53389..53603,53672..54037,54089..54315,
                     54375..54813,54875..54964,55026..55124)
                     /locus_tag="THITE_2144786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653747.1"
                     /db_xref="GeneID:11516079"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2144786"
                     /translation="MDFWRWGSSGAQAILVYWRLRHIPGPFWAKFSDVQRVLWVTTRN
                     AHVFHQRAHERYGDAVRFGPNMVSLADPAWIPTVYPIRPGFPKSNFYRTLMPYTRSGG
                     ALPAVFNTRDEELHKKIKSPIAPLFSLSNTLRLEPFVDRTIDVMTAQIDRRFADKDVT
                     FDLANWLQFFAFEVMGTLTFSKRYGFLEEGRDINNMLSTIWDYMSTAAPYTQIPWFDE
                     FWNKTALMTSIKGKTTGMGILGYVGRFIAERKEAQAAGGKNGDGPGDRDMLSQFMELT
                     EKNPSLPPWAVTAWTFSNVIAGSDSTAAVMKEVMYNLLAHPDTLKRLRAELLESGPLS
                     KPYPSWKDICDLPYLDACVQEGVRLHPPFCLPLERVVPEGGIMIGGRFYPGGTVVGMS
                     PHVINRHKPTFGEDADVWNPDRWMVSKELRKKREDAILTFGSGRRVCLGRHIAMLELK
                     KIVSALILRYDFDLVDPKRYWKENGWFFRQGGIDVTVKKRVEA"
     gene            <55539..>56666
                     /locus_tag="THITE_2050139"
                     /db_xref="GeneID:11516080"
     mRNA            <55539..>56666
                     /locus_tag="THITE_2050139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653700.1"
                     /db_xref="GeneID:11516080"
     CDS             55539..56666
                     /locus_tag="THITE_2050139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653748.1"
                     /db_xref="GeneID:11516080"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="JGIDB:Thite2_2050139"
                     /translation="MASSIAPYLARPKTPPELNVPPSTATVTVRVIDSTTSLWLDGPL
                     FWQPAMAGFDGIDVPIYCFLISHGDRHVLFDLGVRKDWHHYAPKTVDLIRRTTRCRTD
                     KNVSEILDEHAALTGVRSADIEAIIWSHHHFDHIGDPSTFPASTDLVVGPGVKAACWP
                     AYPTNPHSLILDADAAGRTVREVDFGAAPLRIGRFDAVDYFGDGSFYLLDAPGHSVGH
                     LTALARVTAAGDGGDDASFVFMGADACHHPGVLRPTKYLPLPAQVSLSQPPPRICCPG
                     EALQRIHRSGDPAEPFFHVSTVLFPDHEAAMDTVEKITELDANDNVFVILAHDESLRG
                     HIDLFPQAINDWKARGLRPRTRWLFCKDFAAALDISKSLRD"
     gene            <58963..>59542
                     /locus_tag="THITE_2027678"
                     /db_xref="GeneID:11516081"
     mRNA            join(<58963..59152,59302..59375,59438..>59542)
                     /locus_tag="THITE_2027678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653701.1"
                     /db_xref="GeneID:11516081"
     CDS             join(<58963..59152,59302..59375,59438..>59542)
                     /locus_tag="THITE_2027678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653749.1"
                     /db_xref="GeneID:11516081"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Thite2_2027678"
                     /translation="WRELAKHIPGRSNKDCRKRWWNSLVGGTAKGAWSPEEDRKLVEA
                     VGKYGTNWSRVAAAVGTRSGDQCSSHWRQVLNPNINYCDWTKEEDDRLLEAVRICGTN
                     WSNIASFHVPQRTTLALKNRY"
     gene            complement(60491..>63161)
                     /locus_tag="THITE_165582"
                     /db_xref="GeneID:11519033"
     mRNA            complement(join(60491..60777,60848..61857,61929..62211,
                     62268..62299,62371..62572,62670..>63161))
                     /locus_tag="THITE_165582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653702.1"
                     /db_xref="GeneID:11519033"
     CDS             complement(join(60721..60777,60848..61857,61929..62211,
                     62268..62299,62371..62572,62670..63161))
                     /locus_tag="THITE_165582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653750.1"
                     /db_xref="GeneID:11519033"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_165582"
                     /translation="MQAMQSQHRSRRARVPLSCDPCRARKLKCNREWPCQNCSARDEP
                     AAAAVACKFRGVAPKNESGSAAAAAAAATAAAGAAVSTTRPAPSSDGSLRQRINDLEA
                     LVKRLIESHSPNIPSPKSSNGPNTPESARLVAEAGGDGRTVLDRDGHSVYHGGDALYA
                     ILEEINGLKDHVIDSGYVPAISNTVDGPSLLFTQPKPIERLISDLPPKPQVDALVSHF
                     FSLTQQASPLGVPPILHQPTFMREYNENWKDLSRVSFIWLGLLFSVLGISMLAYREYG
                     EPPEYEGKSEALLQLYRKRAAQCLQSGDIAKCLPYTVETLRLNAVAEGHRRDDNQRGL
                     WIMAGVIVRTAINMGYHREPSPAIPVLQAEYRRRIWYSVISMDEIFSFNGGFPYMTPV
                     RYSDTAEPRNLHDWELTEDMTELPPSRPLSEPTPVTYQIVKSRLTQALGRVADYNWGP
                     GSYESLVEIDHILQSTYHNFPPQMKVSALDDGGAVCTMADFSNLSLLVNFLKGSCILH
                     RRSLTKSRVDARYCFSRDRCVSAALDILSLQQRLAHPFYKTSQVRQIFTLGAMVLFLE
                     LGLRQKVPDPNASPASGVLLQALEECCASWAKAASAGHTEAARIHRFLARLLSGFRPD
                     DPNAQSSAQAMSFQPVPLSEGEAAVPAWLNMSNGIFDFGKELSNVDFDWMSWDAFIGE
                     AGMEPSPAY"
     gene            63443..65023
                     /locus_tag="THITE_2116303"
                     /db_xref="GeneID:11519034"
     mRNA            63443..65023
                     /locus_tag="THITE_2116303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653703.1"
                     /db_xref="GeneID:11519034"
     CDS             63692..64684
                     /locus_tag="THITE_2116303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653751.1"
                     /db_xref="GeneID:11519034"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2116303"
                     /translation="MPPAGSFLYGQLFAKIPVPTASFASKTIVITGGSGVLARETTKH
                     LIRLGAPRVILGVRNLEKGRLAKKEIETATRCKSDIIQLWDLDIESPASIKSFVEKVN
                     TLDRVDVVINNAGLGTKFAIHEAYDCNRIMAVNVVGTLLFAVQMIPKLKETAARYNTT
                     PVMTTITSALYDIAKWPKIPPGEDVLSVSKNPKGFNIQTQYNLSKLLVLYGVIKLAQL
                     VDPPGTLNPHPIVINQMNPLFLKTDLAREAAGIEKAFFKVFEAALARTGEEGARLVVA
                     ALASGRETHGRYMERKLEEYHPIAKDDKKINAFWDALCERLERVQPGVLENLKA"
     gene            <66004..>67609
                     /locus_tag="THITE_2129321"
                     /db_xref="GeneID:11515913"
     mRNA            join(<66004..66053,66130..>67609)
                     /locus_tag="THITE_2129321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653704.1"
                     /db_xref="GeneID:11515913"
     CDS             join(66004..66053,66130..67609)
                     /locus_tag="THITE_2129321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653752.1"
                     /db_xref="GeneID:11515913"
                     /db_xref="InterPro:IPR003480"
                     /db_xref="JGIDB:Thite2_2129321"
                     /translation="MSVPELTHVPLGPFDHWVPRGYFHVAHYLPLKTGVTVAQAFDLL
                     HEGLHRVFVEQPWLDGQVGAQAPSTPGWRPGQLEIRHRPTITADGPRPRQLRLKELAT
                     DLDYETLRELGFPLDAFSDAELAPYGPDSFATDPATAPCDVFAAQANFLPGGCLLVAA
                     IHHVVCDEGSFFRILNLWGGHCASLQTGAPPPEPLPAGSLDRRILREIWEKEKPAKTD
                     PEGWRLIGLDPRGFQADAQLHAEQPPLPPPPAKPAHVTNTGGERKMKSGVFYVSPERF
                     AALGKDVAGEVGAESRVTVNDAIAALLWRCLMRARAAAMRAQGVSIADARGVLLQIND
                     GRGNYSPAMPQTYIGNLAYHAISTLPLEKLVDPKTPLGTVAALLRRNWEAVSSADLLN
                     MFSLVDALSSYDELGRAHPAMGAADGTLLQFISSLIGVSMDSMCFGDGPVFANRGFVE
                     ALRPLLDAYIPAARLCNILPRHMTGGVEIVTNLYQDEYELLLLDDEFSRYVLCLCWPE
                     D"
     gene            <67916..>69385
                     /locus_tag="THITE_2088904"
                     /db_xref="GeneID:11515914"
     mRNA            <67916..>69385
                     /locus_tag="THITE_2088904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653705.1"
                     /db_xref="GeneID:11515914"
     CDS             67916..69385
                     /locus_tag="THITE_2088904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653753.1"
                     /db_xref="GeneID:11515914"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2088904"
                     /translation="MGLVQTLLSIGSLNAAALAVAALLFAVAFYRLHLHPLSHIPGPW
                     FAAVSSVWMHAICYFGVEGHVLLDYHRKYKTAVLRIGPDSVSIADGEALHQVYVAGGG
                     LPKDARYSNFRVEGHDTIFSAVDQNYRDRRAKAVLPLFAPSRIQSAYETDGVMEPLVA
                     KFVAQLQEARAKPDAKIDVLDLCSRLSIDILTAYLFGCVYGGLDEPRRRPQDKLSATP
                     FVLTIVALSRFSLLSNRLFTLLFSVLFHHRMRSDPELAPSLQAVSRFAESVVDGPSSK
                     ADTYQSRLRDAGIDREETLVQCKAVMFAGADSTAVVLATILFHLVQNPQVRERARAEA
                     STAADPQSLPYLRAIVREGLRVAMANPARLTRLVPTGGLRLADGTYLPAGTKVGAAAY
                     VLHHDPAVYPDPFVFRPERWLAAGQASTDAQARNAFAFGLGPRACLGRNLANHQLHAV
                     VKAVLASGVLEGARTCTDRIRLIEWFNAEIKGHELEIAW"
     gene            complement(<69452..>70645)
                     /locus_tag="THITE_53079"
                     /db_xref="GeneID:11515915"
     mRNA            complement(<69452..>70645)
                     /locus_tag="THITE_53079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653706.1"
                     /db_xref="GeneID:11515915"
     CDS             complement(69452..70645)
                     /locus_tag="THITE_53079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653754.1"
                     /db_xref="GeneID:11515915"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="JGIDB:Thite2_53079"
                     /translation="MTSNGTDPLTEFLGAIEGVNRTSFAEDGDRIRALQAAYALVSRL
                     ETSWDTVARLVLTEPALGAALKVARDLQLFEKWASEAGQESARTSAQLAELTTCDEML
                     LARILRHLSATNMLDEVQPGLYKQTAFTKSLLEPVFGAWVDYLYDATLPCFYKMPIYL
                     AQHGYQNPTDPTNGVFQYAKGFKGSLFDYYDTHPVEGAVFNYMMGGVMAKQAGMLDLY
                     PIERLLDEPESPSPPPLLVDVGGNVGHDINKFLAKQPGLASRLVLQDRPDVVKVAKCP
                     STVRVMAHDFFQPQPVRGARAYYLHGVIHDWADEPARRILGHLRDAMTRGYSRLLVHD
                     HVLPASRPHPQATAYDLTMMVKVSAFERTEKMWEDLLGSVGFVIVKIWSSPLATQSVI
                     EAELA"
     gene            <70900..>72261
                     /locus_tag="THITE_160953"
                     /db_xref="GeneID:11515916"
     mRNA            join(<70900..71582,71653..72156,72216..>72261)
                     /locus_tag="THITE_160953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653707.1"
                     /db_xref="GeneID:11515916"
     CDS             join(70900..71582,71653..72156,72216..72261)
                     /locus_tag="THITE_160953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653755.1"
                     /db_xref="GeneID:11515916"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Thite2_160953"
                     /translation="MPLDVIIIGAGLAGLVAAIALRRAGHGVLVLEKSAFATEIGAAI
                     NLSPNALLILAHLGFDLERARACRIRTTYLLRETDLAKLHAIPSPNPGNHTLHRVDLH
                     RELLRLATDAGAEIRLATTVVRVDETGVVVLKGGTELRADLVVAADGVHSLAREYVLN
                     GRPTKAVHSGLAAFRFLIDTETCRKDDFLRSLLDVTGPAAVNIIADKETAATEDPSMI
                     RQIVWYACRDGELQNVAGVHPCSSTTVDDGEELKDAMMAEFSHFDPRLGRMVKLSSHV
                     KRWPLYVHDPLPTWVRGRVVLIGDAAHPMLPFLGQGACQAIEDGAGLGLAFQDESQSV
                     EVSLARFEALRKNRAARIQILSKVKESCDTPSVVVEELKPYLDAQAPEAPASLAERLT
                     HARSYDLYASYSEIVGKN"
     gene            complement(<72491..>74507)
                     /locus_tag="THITE_125668"
                     /db_xref="GeneID:11515917"
     mRNA            complement(join(<72491..72664,72704..72941,73020..73939,
                     74005..74220,74319..>74507))
                     /locus_tag="THITE_125668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653708.1"
                     /db_xref="GeneID:11515917"
     CDS             complement(join(72491..72664,72704..72941,73020..73939,
                     74005..74220,74319..74507))
                     /locus_tag="THITE_125668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653756.1"
                     /db_xref="GeneID:11515917"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Thite2_125668"
                     /translation="MVRWLASSLAGAASLCWFALPTDALPAHHQTSAPIVKVKNGSYA
                     GIYSAEYNQDFFLGMPYAQVAPRFTVSQPLNSSWEGVRNATAYPPHCVGYGGDEVGYP
                     MSEDCLYLNVIRPAGISNTAGLPVAVWIHGGGLYMGGSADRRYNLSFIVQNSVEQGTP
                     MIGVSLNYRLSAFGFLCGKEAMDAGVVNFGFKDQRLALRWIHENIAAFGGAPDKVTIW
                     GESSGAESVSAQTLAYGGRDDGLFRGVIAESGYGGFIGRYAGGLNASDAMQNTYDTLV
                     RNTSCAHTVGTPASLSCLRDLPLDEMHKALNSTAANPWPPVLDGDFISDYPSKQLSEG
                     RFPKVPILIGCNSDEGSSFGVGYGPNGGGVNTDDEMRAAIASIVGPDVEKMTGKTVKQ
                     VVDELMFLYPNIQAVGDPSLDKWPVIQPGDDVAQSMGAQYRRTAALFGDFTMQYSRRR
                     ASLAFAKQGIPSWSYRFDVVLPSLPGYIGATHFQEVAFVFDNTRGEGYAQNPFANNTR
                     VLTALAKTMSTAWGLGLPGGATWPPYNASAGGGVGQNLVWTDKGSYVEMDSWRAEGIN
                     YFIENSLAVFGM"
     gene            complement(75520..>77022)
                     /locus_tag="THITE_165581"
                     /db_xref="GeneID:11515918"
     mRNA            complement(join(75520..75645,75703..>77022))
                     /locus_tag="THITE_165581"
                     /product="glycoside hydrolase family 7 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003653709.1"
                     /db_xref="GeneID:11515918"
     CDS             complement(join(75571..75645,75703..77022))
                     /locus_tag="THITE_165581"
                     /EC_number="3.2.1.4"
                     /note="CAZy_ID 269745"
                     /codon_start=1
                     /product="glycoside hydrolase family 7 protein"
                     /protein_id="XP_003653757.1"
                     /db_xref="GeneID:11515918"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001722"
                     /db_xref="JGIDB:Thite2_165581"
                     /translation="MGQKTLHGFAATALAVLPFVKAQQPGNFTPEVHPQLPTWKCTTA
                     GGCVQQDTSVVLDWNYRWIHNADGTASCTTSSGVDHTLCPDEATCAKNCFVEGVNYTS
                     SGVTTSGSSLTMRQYFKGSNGQTNSVSPRLYLLGSDGNYVMLKLLGQELSFDVDLSTL
                     PCGENGALYLSEMDATGGRNQYNTGGANYGSGYCDAQCPVQTWMNGTLNTNGQGYCCN
                     EMDILEANSRANAMTPHPCANGSCDKSGCGLNPYAEGYKSYYGPGLTVDTSKPFTIIT
                     RFITDDGTTSGTLNQIQRIYVQNGKTVASAASGGDIITASGCTSAQAFGGLANMGAAL
                     GRGMVLTFSIWNDAGGYMNWLDSGNNGPCSSTEGNPSNILANYPDTHVVFSNIRWGDI
                     GSTVQVSGGGNGGSTTTTSTTTLRTSTTTTTTAPTATATHWGQCGGIGWTGPTVCESP
                     YACKELNPWYYQCL"
     gene            <78277..>79860
                     /locus_tag="THITE_2129327"
                     /db_xref="GeneID:11515919"
     mRNA            join(<78277..78310,78354..78419,78456..78528,78572..78733,
                     79046..79145,79274..79339,79388..79576,79724..79780,
                     79837..>79860)
                     /locus_tag="THITE_2129327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653710.1"
                     /db_xref="GeneID:11515919"
     CDS             join(78277..78310,78354..78419,78456..78528,78572..78733,
                     79046..79145,79274..79339,79388..79576,79724..79780,
                     79837..79860)
                     /locus_tag="THITE_2129327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653758.1"
                     /db_xref="GeneID:11515919"
                     /db_xref="JGIDB:Thite2_2129327"
                     /translation="MTQVARPLCKIRRHKDIVNNLKTSNSSPMFDVLRPLKDQLCWGL
                     VHEPGAEKCSAKQTREETPRFPVVRLMFFVYGGTASQHSLRAPSRLPHEGEEEAQPLI
                     DDDIRTRTWGAYAASTAGIYPCLPRDPVEAGLRNIKILQLDIQVVLFIWNRVYAEEPE
                     GLQLASRQHLYDGFSGSGTRLLEANHAGLPGQSLGEERMLEYAPPGKVPSSLSSRRCD
                     WARLARNPELGHHQQGTNIALVSCHRVVATLLQSPRYE"
     gene            80602..82972
                     /locus_tag="THITE_2116305"
                     /db_xref="GeneID:11515920"
     mRNA            join(80602..80836,80990..81108,81235..82972)
                     /locus_tag="THITE_2116305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653711.1"
                     /db_xref="GeneID:11515920"
     CDS             join(80698..80836,80990..81108,81235..82938)
                     /locus_tag="THITE_2116305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653759.1"
                     /db_xref="GeneID:11515920"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2116305"
                     /translation="MAASHLSEHRHMRSGSLNIPPHGGRSGGGMMGPPHGARFDGPRS
                     PPNTSHVPCKFFRQGACQAGNACPFSHDISAASETICKYFAKGNCKFGPKCANIHVLP
                     DGRRINYGKNGVTIGAPPGVTLGVRVNPTTYHPPSNSALTNSFLRAGSAVPPYAAPTS
                     AYAPQDDPYGHQLGRQPSMENGLPVIDTTYSSNPASAYGSPRDEDTNRLGLGLSPVNT
                     AGLSVLDAPLPASFDSNGISLAARYGPFPASVPAKFGLESPSPSLHAARDGRTSETLK
                     MLHNSAFGSSEHLSPSALGAADANGFGSSPSVGSAAPGSAYGSDEYFGKRTMHSTSLR
                     YAKPRLVSSSVPKIDRDWEAEFMFEEDYVPGSLANEVLTPAEKARRGSNTANTMRMTD
                     TLEPAVESLPAGATKFGSPGMAASPSRWGPLFQRHKDDDLDVGSPARSMKHVSAFGHV
                     GSPLRNSSLASAITAESRADTAAGSDTHGEKENGMESISALTRQLRETRLAEGGSGSA
                     GPGPQTHPTVPRSSSKTGGTGGSGGAGIIGREREKDRALERHVSSGSTSSGPTGRFAT
                     PIDEEDSSFVFRMEEEDDAQQARTTQSRAARKRASGGNPGVASPLSGVWSYANVVASN
                     RGSTGAGTSANGGGKPAAGSGAVEAAGAR"
     gene            complement(83909..84951)
                     /locus_tag="THITE_2116306"
                     /db_xref="GeneID:11515921"
     mRNA            complement(join(83909..83964,84070..84118,84183..84263,
                     84353..84370,84525..84951))
                     /locus_tag="THITE_2116306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653712.1"
                     /db_xref="GeneID:11515921"
     CDS             complement(join(83918..83964,84070..84118,84183..84263,
                     84353..84370,84525..84707))
                     /locus_tag="THITE_2116306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653760.1"
                     /db_xref="GeneID:11515921"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="JGIDB:Thite2_2116306"
                     /translation="MRPVPSAAARRAAVVALPRTAPSFVPKPLAWQAVRCYASGSGLD
                     RTEVYERIKQLLSGFDKVNDPANITETAHFANDLGLDSLDTVEVVMAIEEEFSIEIPD
                     KDADTIHSVDKAVEYILSQPDAN"
     gene            complement(85422..86867)
                     /locus_tag="THITE_2116310"
                     /db_xref="GeneID:11515922"
     mRNA            complement(join(85422..85688,85751..86042,86151..86178,
                     86262..86867))
                     /locus_tag="THITE_2116310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653713.1"
                     /db_xref="GeneID:11515922"
     CDS             complement(join(85612..85688,85751..86042,86151..86178,
                     86262..86536))
                     /locus_tag="THITE_2116310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653761.1"
                     /db_xref="GeneID:11515922"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="JGIDB:Thite2_2116310"
                     /translation="MLASSAVSMASRQMPLVRVPSTLLRTLPSQVLVARRGYATPAGP
                     PPKNFRLKPPASWDQEKESTFDKVGKYFLMTEMLRGMYVLLEQFFRPPYTIYYPFEKG
                     PISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDM
                     TKCIYCGFCQESCPVDAIVESPNAEYATETREELLYNKEKLLANGDKWEPELAAAIRA
                     DAPYR"
     gene            complement(110489..113041)
                     /locus_tag="THITE_2116314"
                     /db_xref="GeneID:11515923"
     mRNA            complement(join(110489..112487,112559..113041))
                     /locus_tag="THITE_2116314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653714.1"
                     /db_xref="GeneID:11515923"
     CDS             complement(join(110647..112487,112559..112697))
                     /locus_tag="THITE_2116314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653762.1"
                     /db_xref="GeneID:11515923"
                     /db_xref="JGIDB:Thite2_2116314"
                     /translation="MAARPRLEARSLSTVNYLAANPPQYPYHPELRESLTLYISRVPG
                     TQDIILSTFRPHKKNVTGEDITNSLYYVHLDSPEDELLAAAQRADAVAPVRTSVESAR
                     SVIPRKPLPASGQAAKLNPQSRTPADAAAPSAPPPMLHEPSPQAPASESKTQSASETV
                     EGYRENPMFRKRRSGVPSDSPAPPAQPVSSAGMIQRKALGSNLPSSQDRAYMATPPMP
                     PNSTAQGRPATPTQPPTPAQYPTGQVASLASPVSPMNLGRTPSPGKPGRRPASVSFSL
                     TLIRRDPSSGTQCNVGKVSGFQTNVPTPDNADPDLDPDNMGGLATHAQSIDIRLETSG
                     YAKYRDMPSRADVEGYRPAPGSSFAQQGPHGAVGDATQVGKPAATLKPAWHPAEEGFS
                     RQVVMSYGQSWKSNLKRALQRKDRPGSPTHDGRTAAEDLLSARPFHTRQGSTSTIGSV
                     DSADGRHSPTLITHPGPGLKPKGYVFLSPWNGRCEFRTSTNGRSLKCRHILDPTSAAR
                     LDPREVAQSIRDAQAMGRSRGDELTSALVGAKPVSELRFNLPSSGASRAEGGGRHRDA
                     NHLSAKFSKLLHHRSRSSSSDSDEDFDDEEGGGDHGVDAPMDLSLGREHAGGGSRGRR
                     VKLGKLIIHDEGLKMLDLVVAANVGVWWTTWGRML"
     gene            complement(<113172..120856)
                     /locus_tag="THITE_132390"
                     /db_xref="GeneID:11515924"
     mRNA            complement(join(<113172..113187,113225..113452,
                     113569..113624,113726..114841,114923..120051,
                     120152..120856))
                     /locus_tag="THITE_132390"
                     /product="polyketide synthase"
                     /transcript_id="XM_003653715.1"
                     /db_xref="GeneID:11515924"
     CDS             complement(join(113172..113187,113225..113452,
                     113569..113624,113726..114841,114923..120051,
                     120152..120431))
                     /locus_tag="THITE_132390"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003653763.1"
                     /db_xref="GeneID:11515924"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Thite2_132390"
                     /translation="MGSHKRRLAAIIGIGSRLPGDISTLSDLYQMLSRKRTGWSEVPA
                     DRFNAGAYHHPNPDRKGCFNSQGGYFISGDVSEFDAGFFDITKKEVESMDPAMRLLLE
                     CVYEALENGGVPKESISGKKVGVFVGANYSEHRTSNLRDLDHIPTFDATGNQGAFLAG
                     RVSYYFNLRGPAVAVDTACSSSLHALHLAVQSIHAGESDLAIVAASHLLTDPDIWVSM
                     GKLHLFSDAGKTYAFDHRAKSGYARGEGAACLILKPLASAEADNDYIYAVITHTGLSH
                     NGRTVGIAAPSPEEQERLLRKVFAEARIDPREIGFFEAHGTGTKKGDPIEARAIYRAV
                     SHLFDPEDPLHIGSVKPNVGHLECASGLVSVIKAALILSYRFILPNADFERANESIPL
                     SQWNMKVATAQRPWPPKRKYVCVNNFGFSGSNSMAVLSAAPKPKGYEVSEKSRESPLR
                     LYVLSAADETALRNTISRLSVWIERHAELYQSTLPKNLAYTLCQRRSHLPWRVAVVAD
                     MCGGVAAALNSRDTTMARAPSDPPRLAFVYTGQGAQWWAMGRELLRTHPVFLDSILRA
                     DEALWPIADFSIYTELTRDREESRVGLAHISQPLCTAVQLALTDLLHSFGIQPIAVTG
                     HSSGEIAAAYAAGALGFKAAISAAFYRGRMITELKARHPTLRGSMMAVGAGASDLAPV
                     LATVTDACVVVACENSPSSCTLSGDEAALDRVAVIMQQRGIFYRKLFVDVAYHSPHIQ
                     LIAESYLRRVGHIHPLIERGAAPVQFFSSLYGRRVAFKELGARYWVDNLTQAVRFSTA
                     LQGLCIEHKPDILIEVGPHAALQGPIKQILQAMGIAGKTTYLPTLIRDQDATRTCLET
                     AGQLFVRGHPLNFYEVNHHHEENESPQLIPSPYTYPWTRQKYWYESRVSRLHRLKPFA
                     RHDLLGTMADWSSDLEPTWRNVFTTADLPWLRWCRVQSRMVFPAGGFVSMVIEAATQM
                     AALKGTHAAQFDIWNLKIAENLFVDDDREYELVLTTRSSSWPNTDGSYDFHISSHECS
                     RGWMSHCTGTLVAAPRRTPCAKAAVARAAQATSARARRRMLFRSAAMRAHKIYVSPGD
                     WRGPHAVPFRATLAGVYQRLVAAGMVYPFSFQSFVAVEVDESEASGQLLVQDGAPEMP
                     MSHEARYELRPSVVEAMFQLPVFSYQLDAWGKTTVPYLPSFIRHMTVHSSLAKAFRAG
                     ESAAARATPEPEPGSFMVELWKATDTTDPAAICMSGLKFAALEPSRPEIPMPRELCYK
                     ASWSYLVDCIPDGTAELCHNPSRRIVLVVRDMLQAKDPLVVALSSLLKSKTGVAPKVR
                     HLGEILVWSPFFFIVLSEVWTPVLASMGEEIFYRVKALLSQAPGLLWVTKGATRFPTC
                     PKASLASGLLRTVRSERCIVAATLDLDPDSWLDAAAQAALIWEAFATSVLSEGPGPTE
                     MEFAEADGTLTVPRIVPDKQANVEVQRNLGESAPYWQNFHQPGRPLSLAPQRGGSGSS
                     GGNEEVYFEDAPKTPLGEDEVEIAVTACTLSAEDVAAGNTGRVTRGCCGRVTRVGRSA
                     IMYWPGDRVLALVEGRFSSRVRAKLGNFICLPRWITREQAASIPDAVIPAIYALEHLI
                     DIHPKERVLIDMSGPIGLAAIQVTRARGAIPLVLIRNKEQARAAQRAGVPDHRILDAR
                     SAYLRKHVHAATRGRGADAALVLAGPNTAVAVKCLADFGRLVEIRRGSHPRTRVELGS
                     VNAAFASVDMYDLATQQPESMQRTLMATIENMRFGLLDPLPAKKVVPVSKLARGLRLV
                     RKGAVEPVVVRVDGRGRVKAVHRRPKSVFRSDATHIVVGGTGGLGRSVAKYMMENGAR
                     HIVLVSRSGLHSGVVEALKPETERYRAMLTVMKCDVADMRQVTEFVEDCRRHLPPICG
                     VVHAAMVLRDTLLDNLTYDDYRRVIRPKVDGAWNMHMALEARYVPLEYFVVFSSTAGI
                     IGSRGQGAYAAANAFLDALIQHRVRIGLPGAALDLTAVTNAGYLAENKGRQESVFRNF
                     GHETISEREVLALLSAAVRGVGGPQYLTGLKLRPACDGDWPYYAAHDRRFDMLKAASL
                     AQAKDGSEAFNAPMPTGQAFQEAGSEEEATSVAAQGLIKKLSDVLSISPDDLDVARDI
                     TAFGLDSLTAIEIRNWVSKEYRVTLEIMQLLSSGTLMDLAASIIGPLVGWPVALGGNF
                     GGGRAAIKQNETLCKVGPGGRPLATAGLGPANFIFVLFLTHGTYLRYQGTALESRERS
                     WDREQASRDMLLAYMHAMHAAAPRAA"
     gene            <121100..>122115
                     /locus_tag="THITE_125661"
                     /db_xref="GeneID:11516339"
     mRNA            join(<121100..121141,121227..121658,121738..>122115)
                     /locus_tag="THITE_125661"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003653716.1"
                     /db_xref="GeneID:11516339"
     CDS             join(121100..121141,121227..121658,121738..122115)
                     /locus_tag="THITE_125661"
                     /note="Contains conserved domain FSH1[pfam03959], Serine
                     hydrolase."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653764.1"
                     /db_xref="GeneID:11516339"
                     /db_xref="JGIDB:Thite2_125661"
                     /translation="MQFLCLPGAFGSAKNFRVQLGPLAQEIERRGLASFVYTQGRHEV
                     EPPKGWENYFGARPCYRFIDTRHGDVFDHLRRIIQMPRGLDAEDAMRMFQNLSTDESW
                     QKEVLTEAVDDVFNTIDENPDVDAILGYSEGALIGASLVVEEAMRAERTGRPRRIKFA
                     VFISGSPPFKQLDDGSVICLLADEVGTAIDIPTLHIWGCDDAFLTSAVALFNVCDPSK
                     SELFDHGLGHIVPRDAENIRLISDILEDMIRKVEEENGRGVETSSNAGSLTDGDGPAG
                     LFPQLED"
     gene            <123526..>123883
                     /locus_tag="THITE_2088916"
                     /db_xref="GeneID:11516340"
     mRNA            join(<123526..123647,123688..>123883)
                     /locus_tag="THITE_2088916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653717.1"
                     /db_xref="GeneID:11516340"
     CDS             join(123526..123647,123688..123883)
                     /locus_tag="THITE_2088916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653765.1"
                     /db_xref="GeneID:11516340"
                     /db_xref="JGIDB:Thite2_2088916"
                     /translation="MRTEIERSMILTTSHLVRAPAWRPGSPPSDALHDDWGTRAMTVA
                     VLSLPPRELASGKLFRFLVLRQTHQHRQQQQQQQQQQEQEQQHWQHPVFLCGAVPGRP
                     LLA"
     gene            <123944..>127096
                     /locus_tag="THITE_2144801"
                     /db_xref="GeneID:11516341"
     mRNA            join(<123944..124104,124180..124234,124317..124835,
                     124906..125091,125258..126652,126692..>127096)
                     /locus_tag="THITE_2144801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653718.1"
                     /db_xref="GeneID:11516341"
     CDS             join(123944..124104,124180..124234,124317..124835,
                     124906..125091,125258..126652,126692..127096)
                     /locus_tag="THITE_2144801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653766.1"
                     /db_xref="GeneID:11516341"
                     /db_xref="InterPro:IPR005330"
                     /db_xref="JGIDB:Thite2_2144801"
                     /translation="MAARRDLAQHLGQILPFNLEPALVVLSYVISLVGAASTLELINR
                     RTSRRGYYNNLLLFGASITMGGVAIWSMHYIGNRATIMLDGEPELQISYSAGFTVASF
                     FLPIIVLLVAFFVVTGTTTSRSKISWWRVGVWGLLSGGAISGMHYLGNTSISNYRCDY
                     VPSFVAGSVVIAVVASTVALALFFVFRSAWTNSWWKRIGCAVVLAGAVSGMHWCAVMG
                     TRFTLMRVNLNADTSSRNTTVIVTACLSFAACLIMAGLAIYQARVHKGYANRAHRIAL
                     AAAVFDERGRVLVTPDGFLPSEVVTSKFLHKMKLHLARLPHHGRSMRTGIDLVDSEGH
                     VIDDYDTIFCELFCVAASALANQMHETLVDVGVLWDEILATGGHSVADSISQTSTPTR
                     SRGSLQRIKHDLSDMVEKGVAANIRGGHGHLMFLVRRVDSGHVDHLAAAGYCFAEPRQ
                     VAHIIRSKMQIRTAKVEEKLRDMERYACGAMLKPGIHVGLFAVRTQVHQSGFDVLVRR
                     LARNMLPSVQLPLDRLEPGHTEFLRRLDGMSIGALLRRLEHANELPPRDAHFAGLLLD
                     ALRNLRTSVQHPVFDSAKLATKVSQVPCSPPAHETRPSTCSLIAFTIMIPIHIRVDSP
                     TYEFIPLPFFKTQQLVYQNSPHNAAFARSVHRSIAPVLDSASPPGSALPPSSRLRELV
                     TMPRVLRFPRSGRLSALAAHPPSQLRPRRGDAVRLVSLSREHMALTPSGGGSVSSLPL
                     YGGEPPDHAAAAAAADREPQAPSEVSSTDSAPQQQHPTKMSFGGIMVSQEITVDVEDA
                     AAAEPVHDDMPEMPAAAHHRQDSFGSGDGAHVLARHQSQGERAGAQGGAGGGGQNPPP
                     RYERAIELREVSTAMCPGVSKVVVNKEGDDAVETFVDDLFSVCINVPRRM"
     gene            <129543..>130997
                     /locus_tag="THITE_2050923"
                     /db_xref="GeneID:11516342"
     mRNA            <129543..>130997
                     /locus_tag="THITE_2050923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653719.1"
                     /db_xref="GeneID:11516342"
     CDS             129543..130997
                     /locus_tag="THITE_2050923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653767.1"
                     /db_xref="GeneID:11516342"
                     /db_xref="JGIDB:Thite2_2050923"
                     /translation="MVFRNRALVRYIWFCIELDAYDCSECEPQSRDPETWGFSDEDNV
                     RIVNGFEALFSTLGTWEPRPSGEMLQLDISIHSPSDSEHWFKYLTFEPDLPPEECALP
                     SAEQQSVLIRSEHDDLRHGWRAGRQVSLPPWKVFQKVFAEIMIGGPFKDEEQEMEWWR
                     QLPLVPAVTSVLLRQQTRRRWNPQALAQLFSRFPRLQEIHYEPWREWDATQDILTDRL
                     FPELFRSLASSQQPLERLVIFENFSPDYAAAVNEESWVPPDWAPPHWIPLIRPARFEF
                     CSPSRIASPDVSHAVCSASLRLEQLSASFIVEASHFFDCANKHTSWAWANLTSVALTT
                     QLLVPGASLTRIEEMLREAAATALRMLKLENMEIWNGQKEFAMLFRYQHRRPHPLPGT
                     RRSAVITWKGTWTRAQLSRLRPPVTDAWEAVARQQNSNGVTTVEEVLSESDAAEIKSH
                     GDAIRYLDLSSSVIRPISLRQIQMEQMIRDGGHD"
     gene            <132518..>133794
                     /locus_tag="THITE_2088919"
                     /db_xref="GeneID:11516343"
     mRNA            join(<132518..132614,132711..132811,133513..>133794)
                     /locus_tag="THITE_2088919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653720.1"
                     /db_xref="GeneID:11516343"
     CDS             join(132518..132614,132711..132811,133513..133794)
                     /locus_tag="THITE_2088919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653768.1"
                     /db_xref="GeneID:11516343"
                     /db_xref="JGIDB:Thite2_2088919"
                     /translation="MAAAHAAWLVYGGMIKKTTKTMQAFAAELIQNLINEIVTMQGRQ
                     SNPRAETERLAHCPAQDFHVKPLAAFLDFLATAAAVTISLPSGVTLPSGVTLPSGVTV
                     VTAGATTSTTPVVKRQTAALSALSGLTVLSGFTLATLQQTPAPATATRTALAAPTRA"
     gene            <157101..>159057
                     /locus_tag="THITE_2088921"
                     /db_xref="GeneID:11516344"
     mRNA            join(<157101..157310,157385..158019,158069..158109,
                     158176..158188,158250..158703,158791..>159057)
                     /locus_tag="THITE_2088921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653721.1"
                     /db_xref="GeneID:11516344"
     CDS             join(157101..157310,157385..158019,158069..158109,
                     158176..158188,158250..158703,158791..159057)
                     /locus_tag="THITE_2088921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653769.1"
                     /db_xref="GeneID:11516344"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2088921"
                     /translation="MAAGSDSATRLPETSLWANRKCLMICAIVAVANMQYGLDSACLA
                     SLQAMPGFLKVFGYPDPTLAGGYGIDGTFQQLIGSLLTLGAFLSSIFAGAFAHFFGRK
                     PALWLACLLTAVGAAIQIGTTSWGVVYLGRLVLGIGNGFLVTFSNIYCAEAAPAHLRA
                     VLVALFSEWVNIGSIIGAAVTNATSKVLDKSSYQIPLGIQFIVPFVLAVGLFIVPESP
                     RYLVNKGKLDQARRALAVLRSDSLTEEQFELEWVEMVKGIDEEKKLASSVGPLDMVRG
                     TSSVIDNLRRTLLCFAVIATQTGSGAWFLISYSTYFMIVSGLTVDESFRYSVMNTCLG
                     FVGVNFGIYLMRHVVGRRSIMMIGAAAQGLCLLLVAVTATTMPGTLVARNCLIAFTAL
                     YLFSYNAFVGAASYPVATELVSTRLRSWTVGAAISLGYFLAWLTGFCSPYFINPQNLN
                     WGAKYGYIWAGSNLICGIFFFLFLPELKGRTLEEIDELFERRISAWKFKSTRTNIMDE
                     ALKEVRNREAPLVEAKEPVELAENTGKTEES"
     gene            complement(<159367..>162851)
                     /locus_tag="THITE_2049581"
                     /db_xref="GeneID:11516345"
     mRNA            complement(join(<159367..161518,161576..161651,
                     161720..161956,162035..162284,162393..>162851))
                     /locus_tag="THITE_2049581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653722.1"
                     /db_xref="GeneID:11516345"
     CDS             complement(join(159367..161518,161576..161651,
                     161720..161956,162035..162284,162393..162851))
                     /locus_tag="THITE_2049581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653770.1"
                     /db_xref="GeneID:11516345"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="JGIDB:Thite2_2049581"
                     /translation="MDSQKTPAQPTAYGKRLFVDIIDDRARNEPHREWVSIPNSSDPK
                     DGWKKITYKQAANAINRVAHKLVNVAGLPADGEFPTVAYIGPNDVRYLVFALGVIKAG
                     YKALFISPRNTLEGQLNLFEQTDCHFIWFDAAYKDTVQSWLQERDMRAFMTFPVAGWF
                     SEEHVEPYPYNKTFEQAEWDPWVVLHTSGSTGLPKPIVVRQGMLAIGDKYHNLGEWKG
                     RRIWVDEISRRSKRILNPMPMYHAAGLYLSSLMVHYWDLPIAFGIGDRPLSADMAVEC
                     LRCSDTDAVFLPPAILEELSQLEEGVAALKQLKLVCFGGGNLAGEAGDRLVNRGVTLM
                     NLISATEFTPFPFYWQPDQKLWRYFIFNSELFGCEWRESAEPNVYELVVVRKDKHPGY
                     QGFFYTFPDANEYRTKDLYMPHPSLPDHWIYHGRADNIIVFSNGEKLNPVDIEVRMMD
                     HPGVKGALVVGSNRFQPALILEPAQHPGSEKEVKEFIDSVWPLVVKANKETVAHGQIG
                     RQMIGLSKPDMPFLRTSKGTIQRAATVRMYKDEIDKLYERAGEVASSEAPKMDLRSRE
                     ALTQSIETLFEKWLHAPKLEPDTDFFTAGIDSMQVINASRLLRAGLEAAGVRVDASAL
                     ATRVIYGHPTARRLAEYLFSVVNKDSQDATTGEAEQEDHAMEAILQKYTRDMPPARED
                     KPPPADEGQVIVITGTTGALGSYMLDLALSSPRVKKVICLNRSDDAETRQSKGNAERG
                     LSTDFSKAEFLRADMSRSDLGLGRETYDRLLGEVDRVIHNQWPVNFNMPVESFEPHIR
                     GVRNLADFSCRAAKRVPVVFISSIGAVDAWTAPEPVPERPLHDLGLSRGGYGRSKLVS
                     SLVLERASEVSGVPAEIIRVGQIAGPSSAKGAWNRQEWLPSIIASSLYLGVLPDSLGR
                     MSTVDWTPIEGIAKLVLEVSGVTCSVPLEDINGYFHGTNPATTEWATLAQAVREFYGD
                     RIKKLVSLDEWVAALEESQARTEDISKNPGVKLLDTYKAWAKAAREGQRYVAMDTART
                     TSCSPTMREMKAITPELMKNWCRQWGF"
     gene            <162979..>165913
                     /locus_tag="THITE_160936"
                     /db_xref="GeneID:11516346"
     mRNA            join(<162979..163052,164103..164258,165733..>165913)
                     /locus_tag="THITE_160936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653723.1"
                     /db_xref="GeneID:11516346"
     CDS             join(162979..163052,164103..164258,165733..165913)
                     /locus_tag="THITE_160936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653771.1"
                     /db_xref="GeneID:11516346"
                     /db_xref="JGIDB:Thite2_160936"
                     /translation="MGFGIVGFPSRREEDERTGYPTNRHETALNTTDDTTDRSAAVTT
                     CDGSSYENRASPASPLVEDCLKFRDIVSGPGTCGRDGEASYFKVGNNNIRALIADSID
                     QFRWADNGVDRVAAKGFMSCDPDGLQSGWGIYHT"
     gene            complement(167528..168636)
                     /locus_tag="THITE_2116317"
                     /db_xref="GeneID:11516347"
     mRNA            complement(join(167528..168058,168153..168265,
                     168333..168636))
                     /locus_tag="THITE_2116317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653724.1"
                     /db_xref="GeneID:11516347"
     CDS             complement(join(167828..168058,168153..168265,
                     168333..168441))
                     /locus_tag="THITE_2116317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653772.1"
                     /db_xref="GeneID:11516347"
                     /db_xref="InterPro:IPR006696"
                     /db_xref="JGIDB:Thite2_2116317"
                     /translation="MSADETSPLIHTEATADTAETAETDTMSSSILWKTGAVFGATGV
                     MLGAFGAHGLKKHITDPNKLANWSTAAHYQLIHSVALLVASSNPVAGSLFTAGMTMFS
                     GSLYALTLDTERFRFLGPVTPLGGMCLIAGWLALAFGKRGAGLRWPRS"
     gene            191149..193406
                     /locus_tag="THITE_2170542"
                     /db_xref="GeneID:11516348"
     mRNA            join(191149..191521,192490..192694,193232..193406)
                     /locus_tag="THITE_2170542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653725.1"
                     /db_xref="GeneID:11516348"
     CDS             join(192581..192694,193232..193378)
                     /locus_tag="THITE_2170542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653773.1"
                     /db_xref="GeneID:11516348"
                     /db_xref="JGIDB:Thite2_2170542"
                     /translation="MSDSDKCTPSECGLFVGRCRADTPASPPAGLDSDDRQSVAIKVE
                     SEAEADSGQHPLRPRPFRPQPLRPRPCRPRSCRHSPCRHSPR"
     gene            193540..194721
                     /locus_tag="THITE_2116318"
                     /db_xref="GeneID:11516349"
     mRNA            join(193540..193790,193889..194721)
                     /locus_tag="THITE_2116318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653726.1"
                     /db_xref="GeneID:11516349"
     CDS             join(193596..193790,193889..194068)
                     /locus_tag="THITE_2116318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653774.1"
                     /db_xref="GeneID:11516349"
                     /db_xref="JGIDB:Thite2_2116318"
                     /translation="MHRAVRQAVVQDTGKMRRDHIDDTRRLRSDVHGLRSLVRAMRDN
                     QHRHQQQTDPLVQELQKQNAELRQANELLIEQNKLLIEQNNLHLLQLEKGKQQIENTK
                     QQLEQGKQQLEKSMQMLSRPSN"
     gene            194833..195579
                     /locus_tag="THITE_2116319"
                     /db_xref="GeneID:11516350"
     mRNA            194833..195579
                     /locus_tag="THITE_2116319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653727.1"
                     /db_xref="GeneID:11516350"
     CDS             194940..195515
                     /locus_tag="THITE_2116319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653775.1"
                     /db_xref="GeneID:11516350"
                     /db_xref="JGIDB:Thite2_2116319"
                     /translation="MHSVPTTREVLPGALVNIVLKADQPTGRTVQGTVAQLLTRGNHP
                     RGIKVRLADGRVGRVQSMARDSAATVSLFQPGETVQELLEPEAEMATGPGSAGVSGRR
                     GRHRNRPGRGSEEQPLPTQLVGLDAYIKPARKRGKASKSAGADAASSAGDDQTTKTPS
                     LEPEEPTCPVCGDFRGDVAAMTHHVQSHFDD"
     gene            complement(196971..198020)
                     /locus_tag="THITE_2116320"
                     /db_xref="GeneID:11516351"
     mRNA            complement(196971..198020)
                     /locus_tag="THITE_2116320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653728.1"
                     /db_xref="GeneID:11516351"
     CDS             complement(197167..197814)
                     /locus_tag="THITE_2116320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653776.1"
                     /db_xref="GeneID:11516351"
                     /db_xref="JGIDB:Thite2_2116320"
                     /translation="MGPKFILDHADYGPQLNVLVWLLLSLSGLFLFTRLYLKHSQKRG
                     LWWDDWILLASWLALAAEAGLTAYLVSLGYGRQLIPLKNLARFGLPSNVLSTLLIISN
                     LWGKTSFGMTLLRIPVRRMRVCVWFILTSLTAIFTLSVVLVWVDCLPFRTPKACVPID
                     VSTRYNVFSCGKGVSQCGLAARGKGWLTPRSRQYIRLWWMWRSPSSLGNTCWVCR"
     gene            complement(<199202..>200959)
                     /locus_tag="THITE_2049603"
                     /db_xref="GeneID:11516352"
     mRNA            complement(join(<199202..200618,200679..>200959))
                     /locus_tag="THITE_2049603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653729.1"
                     /db_xref="GeneID:11516352"
     CDS             complement(join(199202..200618,200679..200959))
                     /locus_tag="THITE_2049603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653777.1"
                     /db_xref="GeneID:11516352"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Thite2_2049603"
                     /translation="MEEGCDVYRRDLFLDGLLVLTSSEHGGHDPATEFRRHLEVLGAS
                     WLHVRSDKGLLHRLPPGPYMYIDKALKPVYRLYDDVQGSFLTALKPRLTWHDTVPYSQ
                     LRAAGTSYDCLSVAVPARFPGSVQSCAPRLRVVVKDLYRMKGLKTSLNNRAYYDFSEP
                     ADSTAAVISSLARDGAHILGMTKLSSMIAREEPLDAVDFHTAFNPRGDGYQSPAGSSS
                     GSAAAVAAYDWVDCGIGSDTSGSGRRPALANGVWQFRPSHDRVDLRGMVVTYAQFDTP
                     CIFARELRHLKTALRSWIPESGGGQTHADQRMPADVPSYEIVYPLDYLPVPNQEQMAL
                     IDSFLSDAASHLPATVRKISIRETWKSSHPVGTPDDVDEYLRDVVTRTYYYAFYHSSD
                     EFRNKYAQAHDGRPPYVIPFVQRRWAKGAAVTAAQHQEATDRLKEYKEWLLRTVFYQG
                     GQNEKEKQKQVLVLLPIGNVVPNYRDTPSPSPEEQSALDELFLPPILGAPDIAVPIGD
                     VPYQSRITGQTEHLPVVVNFVAAPGRDWELIAAVEKIMALSARPTVVRTGKRMFEAS"
     gene            <202343..>204189
                     /locus_tag="THITE_125655"
                     /db_xref="GeneID:11516353"
     mRNA            join(<202343..202541,202751..>204189)
                     /locus_tag="THITE_125655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653730.1"
                     /db_xref="GeneID:11516353"
     CDS             join(202343..202541,202751..204189)
                     /locus_tag="THITE_125655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653778.1"
                     /db_xref="GeneID:11516353"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_125655"
                     /translation="MDNATYAQQRAENAERQPLLGGAYNSQQHEPTAADPDHDELSST
                     RLAVVFGSIWVRIASAVVPLMANSTIVATLTAVISTSFSSFNNLSWIGTAYLVGTAAT
                     QPLAGRWTDIYGRRRGLLAAGVVFGIGTLLCGIASQEWVFILGRAIAGAGGGATTATS
                     TFVGADLVPLRRRGVVQGINNIAMGCGTGLGGLVGGLLNKWFGWKMAFLAQLPIVVLG
                     LVLCAVVPDIPSQPSKKDHGSRLDYAGSVSLVLAIVLLLVGLNAGGNEVAWTHPLVWS
                     TMVLAAALFALFLLIELRHAAQPIIPLGLLMHRNVWSACLTYFFAHMAAFATMYYIPI
                     YLQVRGSDPTHASLRFIPQSMGTAIGAYGAGVLIKVTGNYVYLSAAAHVFLVTASALA
                     ATLDGQTPSWCPFFYLGMVGLGFGAMLVTTMLALISSVEHSEHAIATSASFAFRAVGS
                     STGITLASVVFQNTLIADLHRRLGGGGEIDKLIERIRRNFDAVWELDPPTRAAVQGGY
                     LESLRFVFITILIMSVASMACSLVMRQNKLHNNLARR"
     gene            <204683..>205897
                     /locus_tag="THITE_2050501"
                     /db_xref="GeneID:11516354"
     mRNA            join(<204683..205012,205105..205194,205249..205358,
                     205441..205676,205752..>205897)
                     /locus_tag="THITE_2050501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653731.1"
                     /db_xref="GeneID:11516354"
     CDS             join(<204683..205012,205105..205194,205249..205358,
                     205441..205676,205752..205897)
                     /locus_tag="THITE_2050501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653779.1"
                     /db_xref="GeneID:11516354"
                     /db_xref="JGIDB:Thite2_2050501"
                     /translation="DLDQEEVLAELGFLSRLDHYFEVKPYGLRFQPPGNLAQSNIEGH
                     MQLIRVRNARLRGTNVGFDQCGFFLAPFSTSMDYADFQDFLKVKDVYCAEVEEAVKAG
                     IPAARHTRGTYQIRRRDINFPTSTGVDFEHAQPANMAHTDFPLADFTPDIAISMIRTL
                     YGPRADEVISQGWAIVNAWRPLKHPVQDWPLAVCDSRTFDAEHDGVATDVVYPDWISE
                     DVLVHYNENQEWWFFPEQRPDEILIFKSVDSEKGLNAACPHAAFANPEAPRSAPLRES
                     IDCRIIVFFTDAPALPPEVGKLYGAKK"
     gene            <207051..>208268
                     /locus_tag="THITE_2088932"
                     /db_xref="GeneID:11516355"
     mRNA            join(<207051..207398,207462..207543,207624..207698,
                     207786..208031,208120..>208268)
                     /locus_tag="THITE_2088932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653732.1"
                     /db_xref="GeneID:11516355"
     CDS             join(207051..207398,207462..207543,207624..207698,
                     207786..208031,208120..208268)
                     /locus_tag="THITE_2088932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653780.1"
                     /db_xref="GeneID:11516355"
                     /db_xref="JGIDB:Thite2_2088932"
                     /translation="MASANESESVHATMYFLQRSSIYDEEKPYSLRFPPGDGLAQSNI
                     LREAHLIQVASMRGRSDLRLETCGFEVMAFSSPLSYEDYEDANKIAHVLLPALCRKLK
                     QHLSAQHVVALDFSVRRRHASFPVSTGKDYDHDQPTNMAHIDFTPEEGERMLRVMYPD
                     QADEIIAGDWYSTWFPLRGPLNDWPLAICDARTVDREADLMPGDIVYTDWATENLQVH
                     HSDRHKWYYLPDQTVDEVLIFKSGESSSAKVQAVPHGSFYNPRVQAGEPPRESIDSRF
                     FVLFAPLEKYPRVQGNVFSQRPD"
     gene            <209327..>213378
                     /locus_tag="THITE_2144808"
                     /db_xref="GeneID:11516356"
     mRNA            join(<209327..209647,210235..211667,211726..212097,
                     212295..212313,213349..>213378)
                     /locus_tag="THITE_2144808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653733.1"
                     /db_xref="GeneID:11516356"
     CDS             join(209327..209647,210235..211667,211726..212097,
                     212295..212313,213349..213378)
                     /locus_tag="THITE_2144808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653781.1"
                     /db_xref="GeneID:11516356"
                     /db_xref="JGIDB:Thite2_2144808"
                     /translation="MHYSRYSQLLVSISGLVFLGTPHLLEGVGNHAFGERLVSIMKLD
                     DAPGLLSNKCLTRLKESSHILADLAHRFNRTNLRVDMLSVFEQKVTRIRESAALRRSK
                     TKKIILPVPVSSYPSNPNTSTYVNLGSSSRGEIESLLDSFSIKQADPRIPCFMMETLV
                     RNKSFFGRQKVLEDLDKCLLPSRDLLVSSQPDRIRVGLLCGMGGLGKTEVAVEYAYSR
                     QDAFDAIFWVRAEDTSKLESDLAQIAVRLGIQDPNEPDDKVINRGLAIEWLCNPFKVD
                     HGASNPGRVAASWLVIFDNADEPDILAPYRDIVASGAVLITSRSPLARTSLSPQTTEI
                     DIQSFSTDEAAEFVQSLTGIAGHLDEARQIGARLGGLPLALAQMAGIIRLEFLSYAEF
                     LELYDDKEEAADVHGTVLQPLRESARGSLSTVWAIEKLSASARAVLEVASFLDPDCIQ
                     ESLLTHEAGAIDNLIPEFPTKRLAFFAARKQLIGSSLIRHNKELAEYWLHRVTQDVVR
                     GKMAPARLHHVFANAVAIVSAAWPATAVGGHDVRLWELSEKLYQHVTSLSDMYVRYIE
                     PGDETLDMAFATLLNRAGWYQHERGESRIQIPLLELALELCQGIDNIDTRDLESDIRY
                     ALGAVANETNDAASCRLHTERFFEIRREIAAETGTVDERLARSYNQMGIVWMMAGEYK
                     KAEESFATSAREYEKIPGYTKDKRSLATGRFLHPYNAHVYEP"
     gene            <213637..>215812
                     /locus_tag="THITE_2050978"
                     /db_xref="GeneID:11516357"
     mRNA            join(<213637..213794,213870..214441,214533..215071,
                     215351..>215812)
                     /locus_tag="THITE_2050978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653734.1"
                     /db_xref="GeneID:11516357"
     CDS             join(<213637..213794,213870..214441,214533..215071,
                     215351..215812)
                     /locus_tag="THITE_2050978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653782.1"
                     /db_xref="GeneID:11516357"
                     /db_xref="JGIDB:Thite2_2050978"
                     /translation="TARDYAIRVRSHAATTASHSLYSGDSFRNLADFLWQPYIQRAPQ
                     LPLTHSRPSSRFAVLYHVSSQKVVNIPFGTVREFEALGDSALPGAGSFALLLLQGYPS
                     PEWLNTLGARFGIDPEFFQRHLLFSSASVKGSVGGCIRKRTATHILPSCHGDMVSLQI
                     TKIASRQSVSPRHTDLDQEGLDQLRRQTSEEMTAYMSKLASLNSPGVAAADSIIREFS
                     VHGLDYFSLEQTISIGFHACGQGWLGIIWHDAGSPLDQGLRGPWQTRAIRSNSFDVTY
                     LPTPVHTPGVALRSKRRKAGTRAHADNDSPHGGLHAGTSNRAPPGNETTMERILDDYA
                     HLVDLDRAVNDPFYALSPLFSFAVFSEMEILDLIAAKVRDELDHSRLTGDGAATTSPT
                     LSNLLYNQQILQRHIRNLQSPISYMEALCSSDGNTSASHAAPRSVKSDTVKAMLADYR
                     FALAYAEALAADCVQGMSIMAHHAAIRESQKAIAEARGVTRLTRLATLFVPLGLVTSV
                     FSMNVREINAGDGPPLWVWAVVSLVVGAMSWVWVSHDSSAAVRRWWWRWRNSPGDGLR
                     GRLAMTGQSL"
     gene            complement(216919..219408)
                     /locus_tag="THITE_2116324"
                     /db_xref="GeneID:11516358"
     mRNA            complement(join(216919..217070,217153..218547,
                     218606..218922,218975..219408))
                     /locus_tag="THITE_2116324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653735.1"
                     /db_xref="GeneID:11516358"
     CDS             complement(join(217032..217070,217153..218547,
                     218606..218922,218975..219155))
                     /locus_tag="THITE_2116324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653783.1"
                     /db_xref="GeneID:11516358"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2116324"
                     /translation="MRLVAAAVLSLAALAGAARRPSANLKRQVSQLRDKYDFVIVGGG
                     TSGLTVADRLTAAFPAKTLLVVEYGDIHYAPGVFDPPTDWITANPDSPPAWSFTSLPC
                     PDMGNQTAFVQAGQVVGGSSAVNGMFFDRGSRFDYDAWAEVGGPEFANSSTTWNWDTL
                     FPYFKKSVTFTPPSPDIAQRYNYTWNLSAYGGDTPIYASFSSFQWADQPVLAKTWTEM
                     GLEHAQECAGGDKQGICWVPASQDPVTARRSYSRLGHYTDVQPRANYDLLVNHQAVRV
                     VYPNGLASGPPLVEVRTLADGSLFNVTVRGEVVLSAGALHTPTVLQRSGIGPSAFLTS
                     AGIRPLLDLPGVGSNLQDHSGPPVTWNYSKPYDFFPLPSEMASNATFKADATAAFNAT
                     PARGPYTLAGGNSAIYVSLPRMDPDGYTTIVSDIRAMVANGSAASFLPADLRGDRAMA
                     AGYDAQLLAIANLLANPAAPSLETPWATTEVPYATAWSFLLHPLSRGTVRLNLSDPLA
                     QPVLDYRAGSNPVDMAVHLAQVRFLRGLLGTPTMRALGAVEVGPGAAVAASDALLADY
                     VRQQITLSFMHPCCTAAMLPRDRGGVVGPDLRVHGAAGLRIVDMSVMPMLPGTHLSAT
                     AYAVAEKAADIIIQAWRRQ"
     gene            complement(219409..219865)
                     /locus_tag="THITE_2116326"
                     /db_xref="GeneID:11516359"
     mRNA            complement(219409..219865)
                     /locus_tag="THITE_2116326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653736.1"
                     /db_xref="GeneID:11516359"
     CDS             complement(219673..219852)
                     /locus_tag="THITE_2116326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653784.1"
                     /db_xref="GeneID:11516359"
                     /db_xref="JGIDB:Thite2_2116326"
                     /translation="MPQFCHPCLRSFNSPVVESPDRGLEGKVHGRSAGTSTPAAVPGS
                     LSPATPPNQRICPVR"
     gene            complement(219866..220954)
                     /locus_tag="THITE_2116327"
                     /db_xref="GeneID:11516360"
     mRNA            complement(join(219866..220388,220444..220814,
                     220885..220954))
                     /locus_tag="THITE_2116327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653737.1"
                     /db_xref="GeneID:11516360"
     CDS             complement(join(219884..220388,220444..220814,
                     220885..220902))
                     /locus_tag="THITE_2116327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653785.1"
                     /db_xref="GeneID:11516360"
                     /db_xref="JGIDB:Thite2_2116327"
                     /translation="MTDFWKASYFDTLSYNFSLCCTKISILLLYLRVLTPDYIRKVIW
                     VAFGIVVLYNAWAFAMELTICIPLAKEWDPSLPGYCHPTSVWWALTYIHIATDFMLFV
                     IPIPVVVTMTIPTRRKAGLLFVFTLGLFVCLISVVRTIILSRLLDSADPMWDYVVIAN
                     WTSAETNAAIICACMPTLRPVLAALLKRLFPHFDQSLEDPSSNRPRTIGSMPIQAPRF
                     GRGSSNNQRTLPPLSDSSWALAHGGTASVTTVETRQSTGRRQDGVSKVVSTADGEPSD
                     VELESGLAPTPTVPAKPRNSR"
     gene            complement(<237574..>238374)
                     /locus_tag="THITE_2129349"
                     /db_xref="GeneID:11516361"
     mRNA            complement(join(<237574..237747,237812..237869,
                     237921..238200,238251..>238374))
                     /locus_tag="THITE_2129349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653738.1"
                     /db_xref="GeneID:11516361"
     CDS             complement(join(237574..237747,237812..237869,
                     237921..238200,238251..238374))
                     /locus_tag="THITE_2129349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653786.1"
                     /db_xref="GeneID:11516361"
                     /db_xref="JGIDB:Thite2_2129349"
                     /translation="MVKAPPVSYQRLFTATSVPATDPLGRARPGLVGPNWFPGVAGGH
                     SRDVPASRVLLRIVAASVPRGPDVFDGFTGCHLVVFLSSEHHPPARTPVWAVARTPIL
                     RRSPKLLVQDRLGGLQVQHGDASIARRRRIVTDASHGAWRRARPSTAWWRPSPAFCFN
                     GITDHRIVPLDGMRADDGKITPMRKHTQRGRPLHVMTTSLKKEEAYGGGLR"
     gene            complement(<238591..>239741)
                     /locus_tag="THITE_160920"
                     /db_xref="GeneID:11516362"
     mRNA            complement(join(<238591..238871,238948..239123,
                     239614..>239741))
                     /locus_tag="THITE_160920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653739.1"
                     /db_xref="GeneID:11516362"
     CDS             complement(join(238591..238871,238948..239123,
                     239614..239741))
                     /locus_tag="THITE_160920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653787.1"
                     /db_xref="GeneID:11516362"
                     /db_xref="JGIDB:Thite2_160920"
                     /translation="MQAVLRLGTTHISLEPGKGLARLASIVTVCLPSTPAAAASLAKG
                     DLTWVELQARMHSTLGLSIPDSTSPRRTPAIMAATIHDAASASLIDTDAETASPTLSC
                     DLTSPAQGDWASPRPESTPSHPKATPMSTAPSPRSFWDSYRALRAVNALPAGALIVYV
                     LREGEGCVSSGTVGNLDVKDGQGPDEEEGYVASK"
     gene            240615..242386
                     /locus_tag="THITE_2116328"
                     /db_xref="GeneID:11516363"
     mRNA            240615..242386
                     /locus_tag="THITE_2116328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653740.1"
                     /db_xref="GeneID:11516363"
     CDS             240692..242125
                     /locus_tag="THITE_2116328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653788.1"
                     /db_xref="GeneID:11516363"
                     /db_xref="JGIDB:Thite2_2116328"
                     /translation="MRLPPGVLDHPLRLFSHRATRALVVCVVLWLVGFTYGRFFLWRD
                     PHSAYFRSETVYDLDYSAARQREARAFIANVTRIEDDRDDADTREGKRWPKTGATPAV
                     CAAFVTVRRESEAARLYLADAIGSMLAGLDPRERAALNVSLLFADTDPARHPDWHAPW
                     VRALVDTAAGYTGLPELERAGLRQAEEDRDLQLKGVYDYLYVLERCLADTASPFIAVF
                     EDDIIFAADWMARTMRGLQYLVRDYRSAAGGADGKAADDWLYLRLFYTETHLGWANEG
                     DWWYRYLPLTLLLAGGATAALLGMLRAQACGGRTRLDWPTIAVLAFLVVPGFTVLIFM
                     AGKHNLPLPGFSLHHNLPFASSTGGVVPMDRHGCCTQALVFHRPALPGLIRYLRERQR
                     GQTDSMIEDYCTEHGVKRFALNEQVVQHVGLVSSRGMAAVDTQSVWAFWFEANKPDEV
                     EKRHREAVEQVDWAMFDQLSASDKPAS"
     gene            <242592..>244452
                     /locus_tag="THITE_160918"
                     /db_xref="GeneID:11516364"
     mRNA            join(<242592..243610,243675..>244452)
                     /locus_tag="THITE_160918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653741.1"
                     /db_xref="GeneID:11516364"
     CDS             join(242592..243610,243675..244452)
                     /locus_tag="THITE_160918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653789.1"
                     /db_xref="GeneID:11516364"
                     /db_xref="JGIDB:Thite2_160918"
                     /translation="MASARWVRLAGRAFSVLFALLLASRVASAPVTSGTVTSGSVTIS
                     GPGVSDHGQPNLVCFPTKATDVLLFFLSNYVAHAATVKTAPGAQTLEVMVGMLISLFF
                     PVLGMSRAFEVILGWSWKLSPKFPFLQFEADTLQTALKAGALVVAVRNQMWKPAATDG
                     MLRDLRRPTEDDYLLGDISHDVQTRAGERSEAQTPLAPGDDSVKASASSGRSGGFKCS
                     VRTLPGYPENDPGWFMFGTPNVHGGFKLPKGYDWLRLPRNTRVLPYGRPLIESQPASG
                     ETAEVRLPTSFSVAQPIIAIFQTVSAGWTLYKASGDQIDQFGFAAFGLTVTPYLLMSI
                     INFLAQLAVPQHSSVYIVYSEVLAEAAARVGNPNVTGIVGQLTPDTSASPEYLNGWVS
                     EEGERGVNVELQSNPEPAEEDGERQESTSAAAGVEREASISQPKEKQVEEILVPSHPR
                     FERHHPPRDAKWKKWLTDPELAGASAVVVSLLLACTPLAVNGSLSKFRPGQKSTAAQR
                     GVIIAWIICTALSQLTMSGLLMILMLAFMVPYAIRYDLRGEGFPFDVDDLKRIAMRTY
                     AGLLIVGSAIPLAMFVTVGQELMQYGNCQYIG"
     gene            complement(244418..246716)
                     /locus_tag="THITE_2116329"
                     /db_xref="GeneID:11516036"
     mRNA            complement(join(244418..244681,244754..244900,
                     244998..245403,245471..246146,246211..246247,
                     246326..246716))
                     /locus_tag="THITE_2116329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653742.1"
                     /db_xref="GeneID:11516036"
     CDS             complement(join(244634..244681,244754..244900,
                     244998..245403,245471..246146,246211..246247,
                     246326..246595))
                     /locus_tag="THITE_2116329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653790.1"
                     /db_xref="GeneID:11516036"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2116329"
                     /translation="MDSGRTTEPAPAEYLTMADIQNIWGAFGAKLPLILPTLVALLVV
                     LLVQNVWSRRPLANIPVVGEELGGDQKRRQAYLSRAADLYLEGYKKFKDSVFRIVTPN
                     KFTVVVVPPKYLRELRKLPDDVVSFDGAIEQSMHAKYTGILTGQSMIPHTIKTSLTPA
                     LVRLNPSIAEEVQHSIRQELPSCDDWTPVNINRKLLRIVALVSGRVFIGTELSRSEEY
                     LDAAINYTVELMEARRALDAVRPWLRPLLGNRLPEVRRLNARIAQADRFLRPIVRARQ
                     QMREGDAPDDMLQWLLGSQDQFKQYTTEELARMQLGLTFAAIHTTTLTTTNVFYNLAA
                     YPQYIPELRDEIRTVLAEHGGVFTSAALQAMKKVDSFLKETMRFTPAGAVSFQRKVTK
                     SFTLSNGQVIPEGVVIEVPAAAASHDPDVFPDADKFDPWRFSRLREQARAAGEVEASA
                     LNQFVSVSPNILTFGFGRHACPGRFFAANEIKMIVANFVLNYDMALPEGVHERYKNLS
                     FGSSSVPDPTKELLFKRIV"
     gene            <250297..>251776
                     /locus_tag="THITE_2144812"
                     /db_xref="GeneID:11516037"
     mRNA            join(<250297..250362,250475..>251776)
                     /locus_tag="THITE_2144812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653743.1"
                     /db_xref="GeneID:11516037"
     CDS             join(250297..250362,250475..251776)
                     /locus_tag="THITE_2144812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653791.1"
                     /db_xref="GeneID:11516037"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2144812"
                     /translation="MARLRLGYTKSRTGCLRCKQRRCDETRPSCRACVRHGLECSLAA
                     QPNTQPASAPTPLPGPTSPPATAPHPAPAPPRRSRARPADSKPKKFEPHVPPPGPSTD
                     AGGSETGPSPNASSATFAGSPSVAASPDPFPYLSKFVTGPSEGDAANWVMDLELMHHF
                     TTCTFRTFQMDEREELCRLWQVEVPKQAFVHVFLLHQILAVSSYHLAHLHPHSRQAYS
                     LRASQHQNAGIRAMRIALSDISPANCHALFASSTLLFIGSLAASSAAVGSDAPPPTVD
                     DLVDVMILVKGIGSVLDSSQALLRSGPLSALFAQRGSLGQTNPALDRVVLAVGDFLVE
                     VAEAEPDDRVRAVIHADAYRLVTVIRDALLKSPVAEYRVVAAWPIQMSDDLIPLLRQR
                     NQAALALLSYYCVVFHAAQLQGYWFMQGWAPGVILDISRSMAGPWQRHSAWALGWITG
                     HTSTG"
     gene            complement(251946..253150)
                     /locus_tag="THITE_2116332"
                     /db_xref="GeneID:11516038"
     mRNA            complement(join(251946..252555,252679..253150))
                     /locus_tag="THITE_2116332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653744.1"
                     /db_xref="GeneID:11516038"
     CDS             complement(join(252235..252555,252679..253068))
                     /locus_tag="THITE_2116332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653792.1"
                     /db_xref="GeneID:11516038"
                     /db_xref="InterPro:IPR012312"
                     /db_xref="JGIDB:Thite2_2116332"
                     /translation="MYRPALRAPTALAQPLIRQTLASTHARPLFASSIRFQSTEPRGT
                     PTGAKMAASAATRVSDRIKHDHDELKQYYGNIKNAPRDDDKVKWQNQFVWELARHSVA
                     EEIVVYPAMEKHVPGGAKMAEKDRSEHQQVKEKLYEFQSMKPSDPTFLPAIDSLWETL
                     SQHITEEERDDLPALERALDADASGAMARSFDRTKHFVPTRSHPAAPDRPPYETAVGM
                     LATPLDKLMDMFRKFPEK"
     gene            complement(253593..255443)
                     /locus_tag="THITE_2116333"
                     /db_xref="GeneID:11516039"
     mRNA            complement(join(253593..253930,254018..254852,
                     254912..255443))
                     /locus_tag="THITE_2116333"
                     /product="glycoside hydrolase family 10 protein"
                     /transcript_id="XM_003653745.1"
                     /db_xref="GeneID:11516039"
     CDS             complement(join(253854..253930,254018..254852,
                     254912..255244))
                     /locus_tag="THITE_2116333"
                     /note="CAZy_ID 269874"
                     /codon_start=1
                     /product="glycoside hydrolase family 10 protein"
                     /protein_id="XP_003653793.1"
                     /db_xref="GeneID:11516039"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001000"
                     /db_xref="JGIDB:Thite2_2116333"
                     /translation="MRSQAVWAAILAPATVSATLNDLAVRAGLKYFGTCLSESYINSD
                     SQYAALINDKTEFGGLVPENGMKWDATEPSQGQFSFSQGDITANTAKKNGQVLRCHTL
                     VWYSQLPGWVTSGSWTRSTLQSVMQTHITNVMGHYKGQCYAWDVVNEAIADDGTWRTS
                     VFYNTFSTDYIPLAFNIAKTADPNAKLYYNDYNLEYNGAKTDTAVQLVQLVQSAGAPI
                     DGVGFQGHLIVGSTPGRSSLATALKRFTALGLEVAYTELDIRHSSLPPSTSALATQGN
                     DFANVVGSCLDVAGCIGVTVWGVTDKYSWIPQTFPGAGDALLYDDNYNKKPAWTSVSS
                     VLAAKATSPPASSSTTLTTVITTAPTSTPTSTTAPTTTSSSNGAQQTHWGQCGGIGWT
                     GATQCQSPYTCQKLNDWYYQCL"
     gene            <258055..>259214
                     /locus_tag="THITE_2088947"
                     /db_xref="GeneID:11516040"
     mRNA            join(<258055..258186,258420..>259214)
                     /locus_tag="THITE_2088947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653746.1"
                     /db_xref="GeneID:11516040"
     CDS             join(258055..258186,258420..259214)
                     /locus_tag="THITE_2088947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653794.1"
                     /db_xref="GeneID:11516040"
                     /db_xref="JGIDB:Thite2_2088947"
                     /translation="MAPRGKNNGSEAEPTPAETILSRFTQREQNIMLHTIIALPGFPA
                     GTEIDYAKVARRLGLQNPRSVSNAWSEIKKKVAQLEKDEREELGLSTDDEADTNAAKG
                     GAAKRPRKRARTSAAAAKGAAPAPPAPATPDESALAPPPKRRRRSRVARAASPASSAT
                     AVGTTPASPADAPSPPGYGDLLPLPSPGGPQQQQLGGYAVYPSQRAAIKAHGGSLFAP
                     ELPPPTGEELLARLEVERRRAAREALEAAKRVAAARAAVAATVARPAARAAADDMAED
                     DDEEEDKKAAGMIKLERIVEEDGREAYISGEI"
     gene            <260326..>261023
                     /locus_tag="THITE_2129356"
                     /db_xref="GeneID:11516041"
     mRNA            join(<260326..260679,260754..>261023)
                     /locus_tag="THITE_2129356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653747.1"
                     /db_xref="GeneID:11516041"
     CDS             join(260326..260679,260754..261023)
                     /locus_tag="THITE_2129356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653795.1"
                     /db_xref="GeneID:11516041"
                     /db_xref="JGIDB:Thite2_2129356"
                     /translation="MKSAILAVTLAFGIIGASATIKYEYDQDGSVTVAYVVRDSPAPA
                     TARAKAARSASGGCSRCRDQCLRGVLSAASAAPDFCASFLAATYTAAGDFAPVQTQCA
                     TDAGRVSSACSCLVQPTSSASSVSSSVPTTSTVSSSTSTSASVTESSSTESSSTATPT
                     PTAPACAPLGASCDLAHPELCCSMACHAGGSDGGYCFDLGGGPGYQE"
     gene            complement(<261245..>261996)
                     /locus_tag="THITE_2129357"
                     /db_xref="GeneID:11516042"
     mRNA            complement(join(<261245..261440,261566..261882,
                     261934..>261996))
                     /locus_tag="THITE_2129357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653748.1"
                     /db_xref="GeneID:11516042"
     CDS             complement(join(261245..261440,261566..261882,
                     261934..261996))
                     /locus_tag="THITE_2129357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653796.1"
                     /db_xref="GeneID:11516042"
                     /db_xref="JGIDB:Thite2_2129357"
                     /translation="MCWHSGCCETEGTNEWPRLLPLALSSHTTAETRAPQAGQNKASI
                     HTKCIEHSPLFGPHPQPQGRHGPRQNLSKPFVIRLVENRQPCHQQPREKQFKTLPAGI
                     VPLPAPRLNFPGSQANNTAFIASASRRRDKQQVPDAHIKILELDLTSVASVKNYEPVG
                     VDGRASAMAQDDELASRLREWTARELEGHCC"
     gene            complement(<262410..>263572)
                     /locus_tag="THITE_2051196"
                     /db_xref="GeneID:11516043"
     mRNA            complement(join(<262410..262484,262603..262875,
                     262938..263117,263198..>263572))
                     /locus_tag="THITE_2051196"
                     /product="carbohydrate esterase family 5 protein"
                     /transcript_id="XM_003653749.1"
                     /db_xref="GeneID:11516043"
     CDS             complement(join(262410..262484,262603..262875,
                     262938..263117,263198..263572))
                     /locus_tag="THITE_2051196"
                     /note="CAZy_ID 269815"
                     /codon_start=1
                     /product="carbohydrate esterase family 5 protein"
                     /protein_id="XP_003653797.1"
                     /db_xref="GeneID:11516043"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR000675"
                     /db_xref="JGIDB:Thite2_2051196"
                     /translation="MWPTPKVAFLLLWAHALLVKGSPLAADAEVLGKRACPDIHVFGA
                     RETTAPPGYGTAGTVVNLILQAYPGATAEAINYPACGGQASCGGVQYGDSARQGTAAV
                     ATAVNNFYQQCPTTQLVLVGYSQGAQIMDNAVCGGPDNGAGITTTASPISAGALAQIK
                     AVIEMGSPRFVAGLPYDVGTCTAQGFDARPSGYVCGGNQGSKIQSYCDSTDPYCCTGN
                     DANSHQQYANKYGQQALAFIESKLGSSSSGGSGGSTGGSGGSTGGSCSALWGQCGGQG
                     WTGPTCCSQGTCKAQNQWYSQCLN"
     gene            complement(<265393..>266511)
                     /locus_tag="THITE_2088950"
                     /db_xref="GeneID:11516044"
     mRNA            complement(<265393..>266511)
                     /locus_tag="THITE_2088950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653750.1"
                     /db_xref="GeneID:11516044"
     CDS             complement(265393..266511)
                     /locus_tag="THITE_2088950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653798.1"
                     /db_xref="GeneID:11516044"
                     /db_xref="JGIDB:Thite2_2088950"
                     /translation="MAQQEFHLFPRLPPELREMIWAESLEPRVVGVNPVHKLRPRAGK
                     SKISWRIRAPMPALFSVSVEARRVAMPLYKKLYFACPAAVRGVAPPVVFVYFHPELDV
                     LSQDFEAIVVWPPMGVNRIRRPGILARVSLPGNFDDVVQPIAPPVPRGRFDPLRDLRH
                     VNLDIHVLRSSLTHLAMQTLPLTRDFVHSVLSGPGSVHIQTVTVRITDGLGAALNSWP
                     RVYRIVRSPAIHPGTTLVYSDMHAKLLHPNKCGIDPSFPKFRYALENDGVVIAKPRPS
                     TWAAFRVIDPRSPYSEFDDDGGQWSGPVQELLWQTMLYDGMKSNDNSVATWLDRVLGA
                     PDWMHACISPWGICGVHYGMGDAKPFRHLTDPMLWNWP"
     gene            complement(<268597..>269681)
                     /locus_tag="THITE_2144816"
                     /db_xref="GeneID:11516045"
     mRNA            complement(join(<268597..269032,269125..>269681))
                     /locus_tag="THITE_2144816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653751.1"
                     /db_xref="GeneID:11516045"
     CDS             complement(join(268597..269032,269125..269681))
                     /locus_tag="THITE_2144816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653799.1"
                     /db_xref="GeneID:11516045"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="JGIDB:Thite2_2144816"
                     /translation="MSSPTTLVPPKGVFVPSPTFFHPAASDSKALQAAVDTESQINHS
                     IFLAKAGITGITLLGSTGEAVHLTRTERRDLVSAVRKGLTDAGFPDYPLMAGVLTNGE
                     LEETLQWLEDYAEAGAQWGLVLTPGYFGPAVGQDSLVEWYKLVADRSPIPILVYNYPG
                     VTNGVQVLPETYRTLAQHPRIVGCKMSHGNVSHHVHVSLDPAIDHNKFRVYSGFGNQL
                     GPIVQFGAAGVIDGMAAFYPKTVVRLMNLMLSRDVSPETQEEIRRLQFAVSQGEEFVM
                     RYGVIGIKEAVCRVAGFGNLEGGRLPLRGKLPEGAWDKAKGLFLETIEKTEAAL"
     gene            <270559..>271302
                     /locus_tag="THITE_2144817"
                     /db_xref="GeneID:11516046"
     mRNA            join(<270559..270859,270924..271194,271299..>271302)
                     /locus_tag="THITE_2144817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653752.1"
                     /db_xref="GeneID:11516046"
     CDS             join(270559..270859,270924..271194,271299..271302)
                     /locus_tag="THITE_2144817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653800.1"
                     /db_xref="GeneID:11516046"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="JGIDB:Thite2_2144817"
                     /translation="MATATALFVIDIQNDLATDPQTRIPHAERIREAGAKILSTARAI
                     INAQRASAEELPAIIVFVQHEEEPENGPLVRGSEPWKLVFEPDDAAPSERLVAKWTRD
                     TFKSNPELASTLKAAGVQEIIVFGIQSECCVEATCNGALAAGFEVVLLSGAHSTYDNG
                     STAAEEIEKEVEDRLRAKGAKVVTWEEAVAT"
     gene            <272073..>273725
                     /locus_tag="THITE_2027419"
                     /db_xref="GeneID:11516047"
     mRNA            join(<272073..272212,272273..272513,272595..>273725)
                     /locus_tag="THITE_2027419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653753.1"
                     /db_xref="GeneID:11516047"
     CDS             join(<272073..272212,272273..272513,272595..>273725)
                     /locus_tag="THITE_2027419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653801.1"
                     /db_xref="GeneID:11516047"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="JGIDB:Thite2_2027419"
                     /translation="SRAHSLAYHSPPLLSSPEARTALLEWFTKASTLRPMPWRKPWLD
                     PATRPPPVPALRAALAQRAYEVWVSEVMLQQTRVPVVVGYWTRWMARWPTLRDLARAR
                     EEDVLAAWQGLGYYARARRLWRAARGKSGLLLDGMLPGSEGELMRTLPGVGRYTAGAI
                     AAIVFGVPAAMVDGNVLRVLSRQMGLLADVKGDKRAVDLLWEAAEALVRAVARDGQPA
                     AEGDELPPSDRPGRWGQALMELGSTICTPTPKCSLCPITRTCRAYAEGLSLAAKRGIA
                     GDTDDIEDICSLCAPFDETAEGDEEDISGKGSRDVLKSSNGTLSRFFAATPTEPSPPK
                     ASDTPDAQAMETIIHHAKKFPLRKPKKKVREEETLVCAVRRSSNGQFLICRRPEKGLL
                     AGLWELPSHTLPDPNDSTAKSRTKKAKAYVSELVEHGKPRRPGSPSLKHIGELGSVPW
                     LFSHLKLAMHVHLFELDDSMGAAEFEDSQRWATVEEIDRESMGTGMKKCWSLVK"
     gene            complement(<273999..>275310)
                     /locus_tag="THITE_2129363"
                     /db_xref="GeneID:11516048"
     mRNA            complement(join(<273999..274874,274954..275072,
                     275124..>275310))
                     /locus_tag="THITE_2129363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653754.1"
                     /db_xref="GeneID:11516048"
     CDS             complement(join(273999..274874,274954..275072,
                     275124..275310))
                     /locus_tag="THITE_2129363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653802.1"
                     /db_xref="GeneID:11516048"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="JGIDB:Thite2_2129363"
                     /translation="MRRQAPQVRRLRPSAFTPSARARPGFVCRQCRAIQISVSPTTDS
                     RPAADAFGAYPGSQRDSADARFEVLGSPYSLLSVTLSASQRLYTRRGTLVSVAGKVEN
                     AQSTLSLLPPLRRAFLGIPFLYQRISSTTPITALIATKSPHTSLSVLHLDGTTDWVVA
                     QRNALLAWTGHTLTPTPRVQRGLPPAHWGSTHLTGRGLAALAAPGQVYELALGDGEEI
                     VLHPSHVVAYAVTRNPPLPFRLRSTTRLSLQVPALPASVSGAAGRLVPERAARFWRAM
                     RDTETYKAVARLLFGLRTAARRTIWGDRLFLQFSGPMTVLMSTRGVRVRDVLSREDVN
                     EIADTEAGVVPAAVERASKPRVSEEKRPEEKPVTIHVANVGKDGKVSFEDAKDLNDFV
                     R"
     gene            <276123..>278480
                     /locus_tag="THITE_2144820"
                     /db_xref="GeneID:11516049"
     mRNA            join(<276123..276333,276418..>278480)
                     /locus_tag="THITE_2144820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653755.1"
                     /db_xref="GeneID:11516049"
     CDS             join(276123..276333,276418..278480)
                     /locus_tag="THITE_2144820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653803.1"
                     /db_xref="GeneID:11516049"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Thite2_2144820"
                     /translation="MSVRVVARIRPLLEKELGKDVIVRPDRVEEGKPFTVVKIPNPKN
                     ETEEFSFAFNSVYDQTTTQEELFTAEVAPHIKALFQGLDLTIFAYGVTGTGKTHTMRG
                     GLRLADRGVIPRLLSNVFRRGKKLMKDTNGRTTVDVALSYYEIYNDKVYDLLEPPEKR
                     TAAGLPLREKDGKTIVVGLSERSCGDLKDFERLYIEANNNRVTAATKLNAHSSRSHAI
                     LRVKVTQTTGDVVKESTASAIDLAGSEDNRRTDNGKERLVESAAINKSLFVLSQCIDA
                     ISRGDKRIPYRESKMTRILSLGQNNGITIMILNLAPVRSYHLDTLSSLNVSSRAKRIE
                     VREIENEVVFKQPPRPNAALGGANIQRQPLRPLHNAHNVHTGALAAKAAEKAEKPDKP
                     AKAFSVYPDKMPAASTARPAVTTANTSQPRQPALTKRASEAADGVSSRPSKLARPAPP
                     SLLRPPQPVAASSGQQQLSITAEQIEAMVEKKVAEILASRLAEATSAPQPQTAPETSA
                     AAQHQHDISEEVKRRLEALERRIESEARHDDSRSEGLRLLLQARQAKESGDDESALRF
                     YERALPYFPGQARLLGKIERLRVKLGKADTAQPEKAAPRKARRQRKSRGDNEDDDGDG
                     DYQEGTEADVEDDAADEKPARARASRKKTTTTSSHKTSAGEGEESAFDDPASPHAKRL
                     LDIVNSRDPALIRSLHGFGAKKAQDLVDYLNLRGHDGSGRVESLAQLRLLPGMGGRTV
                     ERAYEGLVAASNGRSGP"
     gene            <279595..281649
                     /locus_tag="THITE_2066678"
                     /db_xref="GeneID:11516050"
     mRNA            <279595..281649
                     /locus_tag="THITE_2066678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653756.1"
                     /db_xref="GeneID:11516050"
     CDS             279595..281376
                     /locus_tag="THITE_2066678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653804.1"
                     /db_xref="GeneID:11516050"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_2066678"
                     /translation="MKEMSRYLWPKDSWRDKMRVLLAVGLLVGGKVLNVQVPFYFREI
                     VDSLNVDFAATGGTVATVAGAMIFAYGAARIGAVVSQELRNAVFSSVAQKAIRRVATR
                     TFGHLLNLDLSFHLSKQTGGLTRAIDRGTKGISFLLTSMVFHIVPTALEISMVCGILT
                     YQFGWEFAAITALTMTAYTAFTIWTTAWRTKFRRQANAADNKASTVAVDSLINYEAVK
                     YFNNETYEIGRYDKALQQYEKSSIKVATSLAFLNSGQNIIFSSALTLMMWLGAKGIVA
                     GSLSVGDLVLINQLVFQLSVPLNFLGSVYRELRQSLLDMETLFNLQKVNVSIREKPGA
                     APLVLPKGGEIRFENVTFGYYPDRPILNDLTVTIPAGKKVAVVGPSGCGKSTLLRLLF
                     RSYEPQAGRILIDDQDIRDVTLDSLRRSIGVVPQDTPLFNDTVELNIRYGNLDASPER
                     VRAAARRAHIHDRIESWPHGYQTMVGERGLMISGGEKQRLAVSRLVLKDPPLLFFDEA
                     TSALDTHTEQALMANINEVLREKRRTSVFVAHRLRTIYDADLIIVLKEGRVVEMGSHR
                     ELMERNGLYAELWMAQEMLMQGNEKGE"
     gene            complement(<281823..>283816)
                     /locus_tag="THITE_2051832"
                     /db_xref="GeneID:11516051"
     mRNA            complement(join(<281823..282065,282168..282938,
                     283032..283283,283396..283615,283722..>283816))
                     /locus_tag="THITE_2051832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653757.1"
                     /db_xref="GeneID:11516051"
     CDS             complement(join(281823..282065,282168..282938,
                     283032..283283,283396..283615,283722..283816))
                     /locus_tag="THITE_2051832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653805.1"
                     /db_xref="GeneID:11516051"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2051832"
                     /translation="MASWREAFALSKSEVNERMPPGTVRILGQSQLTDGRLVRSPKPS
                     RSAKDPLNWPFWQKVAALLVASIYAFIANFTSSVIAPVLQLWFVAYPQEPKSFSDLSY
                     LIAVSSLLLGSSNIWWVPLSNWAGRRPVLLLATLLMTLCTVWCAVAKSFGSLLAARIL
                     QAAGGGAADSVAPALIGDMYFVHERGRAMAVYTIFLSSGAITGGLCGGYLGYAHGWTN
                     IFWVSTALAGFVFLGVVFFVPETLFDRVAEDTSSSSGDAKEAGAKDVETVETRAASPP
                     ELQGSFTYLESLGLRRPRGSLVRYFVQPWRTLALPGTWVVMLHYAGLVGGIVTLSVIG
                     PQILSAPPYLWGENAGLINVGGLIGTLVGYLYTFVLADSRLKRQAKHQGHGLAEPESR
                     LPIMFFPLFIATSGFFVFGFCSQYPGGSRWVGMEIGYGMISFGLTQVPSVGFNYLIDA
                     YQHLAADCFTMVTILRAIVAFAWSFFVASWVEDRGAAEPFGIFGMLMGLFALLTVPLW
                     LFGKRMRIATSSLVLKQE"
     gene            <285424..>288151
                     /locus_tag="THITE_125640"
                     /db_xref="GeneID:11516052"
     mRNA            join(<285424..285478,285562..285617,285680..285805,
                     285867..285941,286016..286466,286577..286786,
                     286857..287042,287184..>288151)
                     /locus_tag="THITE_125640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653758.1"
                     /db_xref="GeneID:11516052"
     CDS             join(285424..285478,285562..285617,285680..285805,
                     285867..285941,286016..286466,286577..286786,
                     286857..287042,287184..288151)
                     /locus_tag="THITE_125640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653806.1"
                     /db_xref="GeneID:11516052"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_125640"
                     /translation="MASAEQQPRPLKVLIVGAGIAGLTAALGLRKNGHEVTLFERSQL
                     ARETGAAIHLAPNCHGILRRLGVLPETFGANPVQGMTTYDGNGNITVDVDLRKSLLIW
                     QHPWMLAHRVRLHEELKRQATAAEGEGKPAVLKTSSCVASVDPDTATVTLEDGSSFSG
                     DLVLGADGVSSVTRRSVTLQDIKPFDSGKSAFRFMIPVAQIRANPATEKFVQRDGYMR
                     IWIGKDRRLVMYPCSDNTMMNFVAIHPSELSASKGEGWNRAATKEMLVDVFSAFDPAV
                     RALLEMADTSSLKVWTLLDMDRIPTWHRGRVALVGDAAHPFLPHQGQGGGIAIEDAAS
                     ICVLFPRDTPVEEIPERLALYEKIRDERAHKVQELTRTAGMDPTDANRGSFRMMEFRD
                     YNFGHDEWHHSTHMLRKHLWSRHGPVRLRAPLSFGPMPSPRQDHFGRAIPAHDSAFTT
                     CSVRLRSSATYLRTLFPSPAFGFVAPGTVAEATLRCTELRDMRWLGGGGYRFVGLWVH
                     GVQYVKRDGGSVVGSFLVVLMESLSDAVTTGREELGMPKVFCDVGIEDQGGSVKVECS
                     WRGASYLRMYLDGLKEEPVEAAAVEGSGSAVGERPAPPGMGLPPKEEGTLVYRYVPAV
                     GKPGEADAEYAVLVREGAKTPPRVEKRRRSAEARLEFSPGTWDSLPTLHHIASALAEM
                     PIYGVVEAKVEEGHGVDDLSSAQRIE"
     gene            complement(<288513..>291782)
                     /locus_tag="THITE_2051103"
                     /db_xref="GeneID:11516053"
     mRNA            complement(join(<288513..288797,288921..290825,
                     291006..291314,291672..>291782))
                     /locus_tag="THITE_2051103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653759.1"
                     /db_xref="GeneID:11516053"
     CDS             complement(join(288513..288797,288921..290825,
                     291006..291314,291672..291782))
                     /locus_tag="THITE_2051103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653807.1"
                     /db_xref="GeneID:11516053"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2051103"
                     /translation="MSTIEVAGSSTRADGQGLFQCGACKRHYNRLDHLARHAPGRVTQ
                     ACRACATNHVRCTETKPCRRCADRGLECVFVRTDDAMTSPAPAPAADFQPSHLMMSPS
                     SMPSSLDVQVEEPMRLSVSGSDAAEGPLSQPVPPSLQQLPTGYCTPAFTEWNFLPGLW
                     SDTDGVGIGQPFPGIELDDLDLRFLGTYNTTVPFEFAYAPQPVSPQRPSVPRRSSDAD
                     AGDPASWASEAFRNHHWRFRPNPKDHGGAEEHNLSLPSDARDHPSPDSHISFARRVTP
                     ARLGARARDNILTIVIKSCRPENLPKAVACFPSAELLDTLIQFYLTSPQARADSFIHA
                     ATFDPNEKKPELLLAMAAAGAVLTSDPTLAKLGYAMQECVRTAIPAVWETNNSLVRNL
                     ELTQAFLINLEIGLWSGLSRKVEITESFLQSPLTMFRRGGRFRRSSYPPVVLDAADQT
                     AAAAEAAWRAWVQQESFKRTAFRLLQHDLNSSMYLMVNPLVSYAELSLPLPCSPCLWS
                     ATSAQQWRSLLLQCPSLAHQPPTVADYLDDPGAFQNPRATPILLDVAGANEAFLACAW
                     SLAWECIQLAALQRTTASSPSTTSSSNNLTPQPPNRRWNPFLLASRREELLKLLAHFR
                     LTLPPIPHPSPNPNLFPPPSPTTTTTPFPPHQPGTTDTHTLLALHTRLDLIHLHLHAP
                     FDEIQTLAGAEGPEAARGAYAGVADWARTEAARKAVCHAGQVLRFARRAARGMLHGPA
                     AAGIYQAGLVLWVWGLLEARRAGGGGPPPPGKGGARVCLDGGEEEGLAVQRFTCFGVG
                     RPCLRGGGGAADEVVWLADPEAVLGAILGILRDNYEGLPRPHLVERLLQLMEALQRAS
                     AGMMEFHGQLDKQ"
     gene            292062..293491
                     /locus_tag="THITE_2116350"
                     /db_xref="GeneID:11516054"
     mRNA            join(292062..292306,292375..292508,292568..293491)
                     /locus_tag="THITE_2116350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653760.1"
                     /db_xref="GeneID:11516054"
     CDS             join(292303..292306,292375..292508,292568..293302)
                     /locus_tag="THITE_2116350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653808.1"
                     /db_xref="GeneID:11516054"
                     /db_xref="InterPro:IPR004183"
                     /db_xref="JGIDB:Thite2_2116350"
                     /translation="MAPLTPVYLFSHGSTMMLGEESESADYWKKAGDEALANGIKGVI
                     MMGAHWDAPGDEIHVATNPNPGKSPVAYVHPSKYVDYKLNPDLATAERCIGLLRDAGF
                     AASGDATFDWIHDTYLILIRMFPGGCPPTTLISSNQLYDPHFHVRVGAALRPLRRENY
                     LLIGSGGAVHNLYRNRWMPMLRYSDNFAQERPPEPWALEFRQAVEDVIRNNSGPRLRR
                     AMTRLMKHPLYRDAHATDDHFMAAMFVAGAVGDEEDEGVTGELAAETWELTNMCNSQF
                     VWGRWPKTPALTAA"
     gene            complement(293492..295853)
                     /locus_tag="THITE_2116352"
                     /db_xref="GeneID:11516055"
     mRNA            complement(join(293492..293777,293843..294881,
                     294942..295136,295201..295466,295524..295853))
                     /locus_tag="THITE_2116352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653761.1"
                     /db_xref="GeneID:11516055"
     CDS             complement(join(293681..293777,293843..294881,
                     294942..295136,295201..295466,295524..295714))
                     /locus_tag="THITE_2116352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653809.1"
                     /db_xref="GeneID:11516055"
                     /db_xref="InterPro:IPR000383"
                     /db_xref="InterPro:IPR013736"
                     /db_xref="JGIDB:Thite2_2116352"
                     /translation="MPNKLRDLHTVDDVNFPYIFEQNASVPLKLGGVVRCNVYRPKTA
                     ERVPVLVTYGPYGKDIHYKDFIDKYAEVNPRQKSAHSAWETPDPGFWTAHGYAVVRAD
                     EVGLGQSPGILDTMSRATTDAFVDVVEWAADQPWSSGKVGLLGISYYAGSQWRVAARK
                     PKGLSAIIPWEGMSDYYRDRCRHGGILSNGFIKFWWNRQVITNQYGRPGRAASNWGPD
                     TIEGDLSEEELAANRRDQTIDNQVHRFRDEPYYASKEYDLGDIEVPLLSVGNWGGILL
                     HLRGNIEGYTHAGSKFKYLRMITGRHDLPFYYDEEVEVQRSFLDAFLKGEDRVGWSQE
                     GKVPPVSLVLRKGNVGFNNAEAEKAYARREENEWPLARTQYTRFYLTPDLTLLPTVPS
                     QPLPTKKLTYRALGTMTNPQLLQFTTPPFTAETEITGHIVAHLHVSVSPDPASATTPS
                     DIDLFLTLRHLGPDGREIFYTGTAGDPVPVTKGWLRTSLRRVNTEHHRHRPWLPQRDY
                     TSKDVLPVIQGEVYAVDVEVWPTNVVVEEGGRLVLEVASGDTQGSGIFTHDDPVDRSK
                     EVFEGFNHIHFGPRFENYITLPIIPPKED"
     gene            complement(296072..297731)
                     /locus_tag="THITE_2116354"
                     /db_xref="GeneID:11516056"
     mRNA            complement(join(296072..296791,296863..297210,
                     297268..297731))
                     /locus_tag="THITE_2116354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653762.1"
                     /db_xref="GeneID:11516056"
     CDS             complement(join(296232..296791,296863..297210,
                     297268..297628))
                     /locus_tag="THITE_2116354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653810.1"
                     /db_xref="GeneID:11516056"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR015377"
                     /db_xref="JGIDB:Thite2_2116354"
                     /translation="MASPEYAHHFSDRNVPFGIASSKKHPEPRAVTRLGNSVIFLHDC
                     LTSGLFAGVSGLPGEVFANDTLNQFAALPKSVQRSVRQEIQNQYRKRGDVSSFPPGSV
                     EDITEVQMHMPVSVGDFADFSCSLAHVKNAGRIIINDARPPPAFFNMPIAYQGRASSV
                     VVSSTDVERPMGQYRDKTAPAVANEPPPVVFGPSRAVDYELEFAAIVGKPLPMRQRLN
                     AVDADEHIFGFVILNDWSARDIQGFEMTPLGPFNGKNFGTTISPWVVTLDALEPFQTA
                     GPPPAVAIPPHLQDPSLRTYAVRMQVEILAGNDDGGSEATVAGTSWVQDMYWSARQML
                     AHAASAGSALRTGDIMATGTVSGDGEDARGCMLELTEGGTRPFRLRDGSERRFLEDGD
                     VVRMTAVAGGEQSGVGFGECVGRLVASRLS"
     gene            297771..298907
                     /locus_tag="THITE_2116356"
                     /db_xref="GeneID:11516057"
     mRNA            297771..298907
                     /locus_tag="THITE_2116356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653763.1"
                     /db_xref="GeneID:11516057"
     CDS             298037..298588
                     /locus_tag="THITE_2116356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653811.1"
                     /db_xref="GeneID:11516057"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="JGIDB:Thite2_2116356"
                     /translation="MALQGKLPHPNRFITTHDASGKAIIDESIPAPAPFYSLGPGDAA
                     FAQCYVTSQFPVELNGGADTAVYQDFLRSPPGLVVSGGTVLRYVDMPPGATSPMHRTV
                     SLDYGVVLEGEVELELDSGDKRVLKRGDICVQRGTMHLWRNCSQTEWARMLYVLQPCK
                     PVVAGGVELKEDYGDMKGVKASE"
     gene            299576..301596
                     /locus_tag="THITE_2116360"
                     /db_xref="GeneID:11516058"
     mRNA            join(299576..300086,300161..300693,300765..300857,
                     300920..301035,301093..301596)
                     /locus_tag="THITE_2116360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653764.1"
                     /db_xref="GeneID:11516058"
     CDS             join(299694..300086,300161..300693,300765..300857,
                     300920..301035,301093..301448)
                     /locus_tag="THITE_2116360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653812.1"
                     /db_xref="GeneID:11516058"
                     /db_xref="JGIDB:Thite2_2116360"
                     /translation="MPRPFSKIRSAAIDGRALNPIFRKLQLKQLHDALSDKAAEIQEA
                     IATDTGHTRAEVQIEYWLALRQLSQAHAALDPKKALHDEYAVSRGESASQREAVGIVV
                     IHPAKHAFFSCLMSALVPALASGNCVVVETEQSLLRTPPLVLDLIAHALDQDIFDTAP
                     APISEADLGHPHVRVLQNGSDDAAPRLAHRLVSDPEARVVAVVERDADLDLAARELVR
                     ARFALRGRSPYAPDVVLVNEWVKREFLEAALRHAVRVGGPGGGGGGGGGEKTGLRMGL
                     GPQGPVADAVKKERGVSVLSWSAAGAVVDVEDRKSPLLQRKVQESCLLVHAVTSIDDA
                     IDFSQGNRRLGAAYVFTKPSAAKYICQFLDSPMSFVNHVPTSLLFLTMAPSNTPVDPI
                     SYAPYSEETFTRPKAQFASPSAQETVLAGLLLQQQGASEQLAALVHESTAKLPVFKRS
                     KVALTHFFNQGILTGGLLLLSTMLGVTGVCTYYGFGLVRSRLLHGL"
     gene            <302973..>304864
                     /locus_tag="THITE_2088966"
                     /db_xref="GeneID:11516059"
     mRNA            join(<302973..303340,303406..>304864)
                     /locus_tag="THITE_2088966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653765.1"
                     /db_xref="GeneID:11516059"
     CDS             join(302973..303340,303406..304864)
                     /locus_tag="THITE_2088966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653813.1"
                     /db_xref="GeneID:11516059"
                     /db_xref="JGIDB:Thite2_2088966"
                     /translation="MLGLKESDADTYAQLTTRSLRPVGPTDSGLANQQMGQIFSRPPG
                     NRDLFWLVPPAVEARRRRRHRRRRKARNQSNFKPSSNGSRRNGRTKHPTTCCHEASFW
                     PDYSMPTSPFNLEQDPTHWSVMPDLTQPADAARGPLNTWIIEDVQVRKVIHIDKPDGP
                     SSYMPSSPPFPPPNTNPTTAAASGTVPSAFPTPSAQNSNSSTKCRTTSAPRAMPPTGS
                     CTVCKDHHFHPARAALHPQIPTANNADRTTTTSRVTSATLGLDPSSYYRDRVQDATDS
                     LERQALREQQRREAELREERERERRVRLELERERARLEVERAAAVAEEVRRVRERLER
                     ERAEAAERERAAREQAAREAEVKTQTKQRELEAAAARARRARELEDAAVARAVEESIL
                     SEAARSLKVAAEEEERGRKRVAAAAAAAAREKAMMEAEAVAMEERLWRLVGRKQEWGG
                     LRMAGGLAEHGGLFGPALRPLGPRLADLRTLDDHGGKHMPSSPSAASPLAGCAGHKGP
                     VRQSSESTWANSPTSISSGPTLRASSSTSEAFGLGPWDRELDIGRLGETEAHIWRNGR
                     EDGWGWRETTTERHETIICREEGRNGVGCCCRDVSKPTSGFL"
     gene            complement(304832..305702)
                     /locus_tag="THITE_2116361"
                     /db_xref="GeneID:11516060"
     mRNA            complement(304832..305702)
                     /locus_tag="THITE_2116361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653766.1"
                     /db_xref="GeneID:11516060"
     CDS             complement(305194..305556)
                     /locus_tag="THITE_2116361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653814.1"
                     /db_xref="GeneID:11516060"
                     /db_xref="JGIDB:Thite2_2116361"
                     /translation="MTSVKQAAMNPSAEGKSPKTKKSLYQRYVDAKTSRNVKISDADL
                     QKYTGMNREQLNAWAKDRPGVAGNQLAGKLAMGQASGFGGLETSQGYGGWGPSAEGKA
                     KFPPAPRNETKGSDEEED"
     gene            <309415..>310911
                     /locus_tag="THITE_160890"
                     /db_xref="GeneID:11516061"
     mRNA            join(<309415..309816,309899..310071,310199..310439,
                     310619..310772,310871..>310911)
                     /locus_tag="THITE_160890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653767.1"
                     /db_xref="GeneID:11516061"
     CDS             join(309415..309816,309899..310071,310199..310439,
                     310619..310772,310871..310911)
                     /locus_tag="THITE_160890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653815.1"
                     /db_xref="GeneID:11516061"
                     /db_xref="JGIDB:Thite2_160890"
                     /translation="MKWLSLALVLAGPSEAALRFGCSTVSIQRLDPLVEPGKIPSAHL
                     HQIVGGNAFNATMVGDISEKATCTTCTFSEDFSNYWTAVMFFRHTNGSYKRVPLMQNT
                     ALPNGINGGMTIYYTQQDFTSNGNQKITAFKPGFRMTVGSPTYSAAPSSSGNPGLRFV
                     CLDNKATRFPELPTFPTKPCKGGIMTVHHFPACWDGKNLDSPDHQSHMYNTVREAFTP
                     AGPCPASHPVRMPQLAYETLWDTTQFNDMWPTDGSQPFVLSFGDHVGYGTHADYVFGW
                     KGDSLQRAMDSSCMFTACENGRPLKSQSVADMNKCSVKSTVHENIDGWLTSLPGQPSM
                     SM"
     gene            complement(311257..312769)
                     /locus_tag="THITE_2170544"
                     /db_xref="GeneID:11516062"
     mRNA            complement(311257..312769)
                     /locus_tag="THITE_2170544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653768.1"
                     /db_xref="GeneID:11516062"
     CDS             complement(311953..312351)
                     /locus_tag="THITE_2170544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653816.1"
                     /db_xref="GeneID:11516062"
                     /db_xref="JGIDB:Thite2_2170544"
                     /translation="MGLNLLDRIQAKIELFRLEQRYTRRRHRRSTFVSNAIYVDGEYI
                     YQSPNTTGSSSSTSRSAASTVTTAAASAARHVVGAGESTSKQQKRLNRWSSMPGFGSS
                     AKPEVMGAMPTVREQGEWRNRVSFHDERGY"
     gene            315596..317359
                     /locus_tag="THITE_2116365"
                     /db_xref="GeneID:11516063"
     mRNA            join(315596..316045,316100..316465,316518..317359)
                     /locus_tag="THITE_2116365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653769.1"
                     /db_xref="GeneID:11516063"
     CDS             join(315791..316045,316100..316465,316518..317150)
                     /locus_tag="THITE_2116365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653817.1"
                     /db_xref="GeneID:11516063"
                     /db_xref="JGIDB:Thite2_2116365"
                     /translation="MLGAEHYHPLVGAIHNILSTDLAETTFAQLFDGLPDVHTVWDTR
                     GAFLLKGHPLIEHDRLCDGAIENFKVFRDGFDPAVLTFNAWVMQRYQNASPGSREFKM
                     RLCELVAASIHQIAVLIFQSPTKLHSKEYIDFVDSWKRESRWVQYDGCPPYLEKAIEP
                     FPTLFFHCDYVDDDQYPHGVADVAGYWAEDRVLGGIVLFDRGQSGTECKDIYFHSGRR
                     RTTFRVWRLQDTQFDQMVDFLLSEDGSAPSPFPLLASSENRHRHDPWDAIVLHRVFRD
                     PWERKVPPTKPEERDVVAAGDYPELDDMVNQVQLAVQREPHMVFNWNAEMEAQAFPWL
                     PRRHGGGDVGDGESPLESELSDDEPNSLCALSPPSTPPPPSRIGISLQADAVPDSNTP
                     LGQEGHDGSPAEAARDSEPVGQGCG"
     gene            <318297..>319426
                     /locus_tag="THITE_2144844"
                     /db_xref="GeneID:11516064"
     mRNA            join(<318297..318795,318879..>319426)
                     /locus_tag="THITE_2144844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653770.1"
                     /db_xref="GeneID:11516064"
     CDS             join(318297..318795,318879..319426)
                     /locus_tag="THITE_2144844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653818.1"
                     /db_xref="GeneID:11516064"
                     /db_xref="JGIDB:Thite2_2144844"
                     /translation="MPPMPQWQAISGSAAEADLAASSPFDVCGLRVLLPAQNGSFRRL
                     CPGDDVFDCVASLASLALDLLECKSSILALKAITRDVAKVSLEVPGLRNLEETDIEPT
                     ILEYLGAIRTSFPHVVVSNQHGMEGKNGRTHKKDCQDAFQPKSAAVIELNATVRGYPT
                     DPRAFLAKSTRRFRNLHLRLSITLAHELVHIFVLFLVRIGSEHTPPQVSFGPFGTRTV
                     GESGRSWESKLFGGYIDMRHNTEGVEAIALCDETKQNCWRIKTVVIDDLLVRNFNRWL
                     QPGVPLSDKEEYPQGQATERLTGLQWKVKYDDVFPPLPPTAQGAQKPGQEAQELSPAQ
                     IAELTAGKIMDMPQ"
     gene            complement(<320656..>323492)
                     /locus_tag="THITE_118127"
                     /db_xref="GeneID:11516065"
     mRNA            complement(join(<320656..321315,321354..322280,
                     322346..322918,323001..323063,323103..>323492))
                     /locus_tag="THITE_118127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653771.1"
                     /db_xref="GeneID:11516065"
     CDS             complement(join(320656..321315,321354..322280,
                     322346..322918,323001..323063,323103..323492))
                     /locus_tag="THITE_118127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653819.1"
                     /db_xref="GeneID:11516065"
                     /db_xref="JGIDB:Thite2_118127"
                     /translation="MAQTKPPEAGHYEYLNPELDCPSWWSYFFAGGYLWRWLSSPHLY
                     FLGGLEYRANPSPFTVIDGLGGEKIYERPFECYIDPFTGKIRRLYVQAPNSLCRLFPK
                     NANATWRRTPIRNASSIWFRLANLPFRLPRDWLVVIPMWAVTVVLFLFGWVLSLISGA
                     VSPNERKDKTKYLPLLYSGLRYPRLARNMLENREAVLRRLKAQEADNRTAAISNYRTF
                     RPRFLNYLVEVENNGQKMVGYERLPVRPDDLTPYVLVAFSSEHYHIPDENEALNDDRK
                     SDLEALLAMATKAAETYFSPSSEDLEKKTKAFWLSANCMPFNELADEHGVVHEVDECD
                     RERLMNQDTYSISDIVRAAEHVIVVAGNIDRPWDDGALRVWGRRVWTLPEILLSKGDS
                     VTVMQCGMRKSDNQREPELHIEFREIRKAVFPSVAWPDPLTSRQLIEHYSNLHLSRLE
                     LVKIALECLMNRSLQVKYRGDRSYALMGLLRSRPPIDRSDSAFQAFARLSLPQDSDRL
                     MERLICLLPEEPEQSWELMKDKYEASLWDIYLDTQVCAIGENDTVVIDGAYGAQIQWS
                     MFSSVRVRRRLTIRRLVCFYTITFSPWIFIIGLILAASARREQTQYTNSLPQNPFGLD
                     IPPTSDSTPDSVKKKYKAGVALTVLTLLYTGKLWEVEPCFFGIEGYVPLDLIEERLLG
                     TRSVRHRRLRWSAYGSPLSRHTEGPPHYERAPAAAADEADTLLPTYPVTPLDPTAPCP
                     ACATPTAAPRFCEHHPTPASLHKMSRSPMGALKPFTLVDTLNMTATLFYAARPPTVLV
                     VGGSEGGMKRALACSFDLATGTLVRETVLRIPTRSVGCMERLPRVRIGLGRVVRSGDV
                     EPLGAMGGAGVVKW"
     gene            <336166..>337806
                     /locus_tag="THITE_2144834"
                     /db_xref="GeneID:11516066"
     mRNA            join(<336166..336183,336230..336233,336307,336467..336618,
                     336684..337204,337268..337333,337399..>337806)
                     /locus_tag="THITE_2144834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653772.1"
                     /db_xref="GeneID:11516066"
     CDS             join(336166..336183,336230..336233,336307,336467..336618,
                     336684..337204,337268..337333,337399..337806)
                     /locus_tag="THITE_2144834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653820.1"
                     /db_xref="GeneID:11516066"
                     /db_xref="JGIDB:Thite2_2144834"
                     /translation="MAVSAIAVIAPLDGAFSEGSADYEAVTSLYDIPDEFVWERERGV
                     THVYGRRLGGAGRETLWMHFLAVVPAADIPGRQPNWQKWGFVLIWIPKTEKPQTDNPP
                     PYPAAAPEKTYTVAAIVFEPPVETLQRLISFGQSANWTDAAVDPFVLVDIALASWYHR
                     VDDVAWRVTHLVREDEVDIFRRTGMLRSTDDAAVTDLDLHRIHTSAKNAIFMEEALRA
                     AIRLVDLAVSDHESLFHSTRLRILSCQARIKNTVDLAFHINMAHDSAVNLEHSRSVRL
                     MSILGLVFIPFSAVTSVFGTQFFSPADDGRHMQVSADFWMLWTTALPLTLVILAVWCA
                     TERREPLKWPAPARFPLPRWWPEAAARKGMAAARGSGGGMLAAATELRNLGSQIV"
     gene            complement(<340625..>341194)
                     /locus_tag="THITE_160883"
                     /db_xref="GeneID:11516067"
     mRNA            complement(<340625..>341194)
                     /locus_tag="THITE_160883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653773.1"
                     /db_xref="GeneID:11516067"
     CDS             complement(340625..341194)
                     /locus_tag="THITE_160883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653821.1"
                     /db_xref="GeneID:11516067"
                     /db_xref="JGIDB:Thite2_160883"
                     /translation="MNPYPTPPAPCARFDGIVHIQPSKEAAVLYAEWAANCPSTDTYI
                     HMNLFCDASKSPEQDKGGIAVTFSQWLPGEPVNRPVIRAAWPVTPLYDRRLGEFLALS
                     ECLFVATQEILQFSNCPLLAGKTVVVRIFNDNMYNLEYLQGTRVLDQAIMTLARPVLD
                     LIATQSVVIQKCGVSVRLEAHWIPGHEHN"
     gene            <343101..>343838
                     /locus_tag="THITE_2129383"
                     /db_xref="GeneID:11516068"
     mRNA            join(<343101..343153,343282..343346,343458..343633,
                     343677..>343838)
                     /locus_tag="THITE_2129383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653774.1"
                     /db_xref="GeneID:11516068"
     CDS             join(343101..343153,343282..343346,343458..343633,
                     343677..343838)
                     /locus_tag="THITE_2129383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653822.1"
                     /db_xref="GeneID:11516068"
                     /db_xref="JGIDB:Thite2_2129383"
                     /translation="MPSNPTDLKVPTSSRASSCRVGILETTSRHRRIIVAFLQAVLKG
                     NHQASSSDSCSFVSGATVAGLASGVLCMEKRTFSTGSMQFSTFVAVLSILSRWKPRPP
                     VPHISTAEGGYTARNTVFIIVEVSMRVTSRSGSTVPLRGSSSPSSSSPS"
     gene            complement(<344607..>348586)
                     /locus_tag="THITE_53748"
                     /db_xref="GeneID:11516069"
     mRNA            complement(join(<344607..344765,344874..345192,
                     345277..345581,345698..345781,345839..>348586))
                     /locus_tag="THITE_53748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653775.1"
                     /db_xref="GeneID:11516069"
     CDS             complement(join(344607..344765,344874..345192,
                     345277..345581,345698..345781,345839..348586))
                     /locus_tag="THITE_53748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653823.1"
                     /db_xref="GeneID:11516069"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Thite2_53748"
                     /translation="MFRPGCGPTPPCSQARLYVSTPGSLTLTDPPQPESPTSPADTPG
                     RLPLPSAHRHHGRQGFRLDVKDALTPDPTNEDLFVVQDNKFAFSPGQLSKLLNPKSLD
                     AFYALGGLAGLEKGLRTSRNAGLSNDETTLDGAVAFEDVVPRGTPKYGAHGDTEPLLK
                     SARPATPTPAAHPAAGPFADRRRVFGANRLPEKKSKSLLELAWIAYNDKVLILLTVAA
                     VVSLALGLYQTFGVPQPDGEPRVEWVEGVAIIIAIVIVVAIGTLNDYQMQRQFNTLNK
                     KAGDRTVKVVRSGRSAEISVFDVMVGDVMHLFTGDVVPADGVFISGHGVKCDESSATG
                     ESDLLKKVAADDVFAVLQQVASGATPPADIEKLDPFIISGSKVHEGTGIFLVTAVGVN
                     SSYGRIMMSMTDEQDDTPLQKKLNVLADWIAKFGGGAGLLLFLVLFIKFLAQLPNNHD
                     SPGQKGQAFLRLFITSVTVIVVAVPEGLPLAVTLALAFATTRMLKDNNLVRQLMACET
                     MGNATTVCSDKTGTLTQNKMTVVAATLGKSLSFGGTDAPVDEYAAGGPPPAINIPNVS
                     LGDFVRGLSMTTKQLVVQANAVNSTAFEGVVDGEKTFVGSKTEVALLTFCSQHLGARP
                     IQEERANADVVQVVPFDSKVKFSATVVKLPNGKFRAYVKGASEILLSRCTKVIAHPGN
                     DRLTITDMTENDRAMFSHTITSYAGQTLRTIGSSFRDFESWPPAELAGQQELTAAEFD
                     KIHRDMTLLAIFGIKDPLRPSVKDAIKDCRRAGVTVRMVTGDNILTGRAIARECGIYD
                     PASGGIAMEGPEFRRKSEQELKALVPRLQVLARSSPEDKRILVRTLKELGETVAVTGD
                     GTNDAPALKMADIGFAMGIAGTEVAKEAASIILMDDNFASIVKGIAWGRAVNDSVKKF
                     LQFQLTVNLTAVVLTFVSAVASDEEQSVLNAVQLLWVNLIMDTFAALALATDPPAPSV
                     LDRQPDKKTASLITTRMGKMIVGQALCQLAITLLLNFAGARLLGYDTSDAAQATHLRT
                     LVFNTFVWLQIFNEVNNRRLDNNLNILEGATRNPFFLAITLTIVGGQILIIFLGGAAF
                     QITPLSAREWGLSVGLGALSLPWGALIRLFPDAWADAAVRGLAALWPFGRPAAGDGSF
                     AAPADDAPPPPPPLRTLTGLRGKRAATHIRRGFREYIHDQKERVMVKAFGGSRTDVSA
                     "
     gene            complement(<350754..>352650)
                     /locus_tag="THITE_2144836"
                     /db_xref="GeneID:11516070"
     mRNA            complement(join(<350754..352468,352542..>352650))
                     /locus_tag="THITE_2144836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653776.1"
                     /db_xref="GeneID:11516070"
     CDS             complement(join(350754..352468,352542..352650))
                     /locus_tag="THITE_2144836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653824.1"
                     /db_xref="GeneID:11516070"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2144836"
                     /translation="MLFSAGVAALLALAVPVRSSGSSAFPAPGDASYEYVVVGGGTAG
                     LAIAVRLAASGKSVAVVEAGGWATEMGNITTVPGYAFSDPVLAPVEDFPPVPLLDWEL
                     LSQPQTGANNRSIHYAAGKTLGGSSSINTMAYHRPTKQTHQRWADVAGHESYTWDNML
                     QFFEKSTTLTPPDWQKRATPNATFTFDPTVFCLSGKSSSCGPLQVSYSNWVDPTNTWF
                     AVALNAVGLGSNSTGFNSGYLSGGAYTTETVDPSTATRSSSQTSYLDWGLRNTQIKVY
                     NGTLASKVLFTSGKATGVSVSTNGTAYTLTATREVILSAGTFHSPQLLMLSGIGPRAL
                     LSSLGIPVISDLPGVGQNLQDPIFFSVQNGVTTPSLASELANPNQAAAILAEYVSNKT
                     GPYSSPGGYIAFEKLPAASRANFSARTSALLAALPSDAPEIEYLAGSFAGTGDGVTTI
                     GDLSAAILHPFSRGSVTIRSANISDPPVIDMGWLTDAADAEVAVAAFKRVRQAWSSPL
                     LDDWKVGPEVKPGVSVQTDAQILDYVRENAIPIWHACATNAMGTNASAGAVVDWRAKV
                     FGVDGLRVVDASALPFALPGHPQATIYAFAEKIAASILAGN"
     gene            <354906..>355721
                     /locus_tag="THITE_2129386"
                     /db_xref="GeneID:11515999"
     mRNA            join(<354906..355149,355207..355274,355356..>355721)
                     /locus_tag="THITE_2129386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653777.1"
                     /db_xref="GeneID:11515999"
     CDS             join(354906..355149,355207..355274,355356..355721)
                     /locus_tag="THITE_2129386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653825.1"
                     /db_xref="GeneID:11515999"
                     /db_xref="JGIDB:Thite2_2129386"
                     /translation="MALLEWAVLAARQTTGDSQSLPSGTRAPTLYGFMGSFGPLALCA
                     VVLRFYSRYRFARIGWDDITIAIGLVLYTGLIVATVFAIRYGLGVHIWEVPQDTEVQM
                     QKCGFTSQVLYPSSLGVVKLSLLLFFLRVLPADHTWRKALFCLAAWVVTSESAFTIAL
                     FLQCRPLNFYWDKTVDGTCFDQPKFYYVDAALNMTTDLVILSLPWFIFRGECAFITSS
                     ILFVIGD"
     gene            <372219..>373115
                     /locus_tag="THITE_118121"
                     /db_xref="GeneID:11516000"
     mRNA            join(<372219..372236,372281..372298,372461..372534,
                     372600..372667,372739..>373115)
                     /locus_tag="THITE_118121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653778.1"
                     /db_xref="GeneID:11516000"
     CDS             join(372219..372236,372281..372298,372461..372534,
                     372600..372667,372739..373115)
                     /locus_tag="THITE_118121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653826.1"
                     /db_xref="GeneID:11516000"
                     /db_xref="JGIDB:Thite2_118121"
                     /translation="MAVSAIYIGRLMEHPVSLNLSRRKKYELLTVCSVGVFTLIASVI
                     RLPYLHHLNQSTDPTWDVVNIAMWSIAELGSAITLTSVPAIRPLVGHYFPHLMGSLVG
                     KSTGDHANSDRTPVFGGSSRSKKTTEFSATETMPADNTKAKQDWHQYIELDDQDDART
                     KRSADMESQEHILPPSAQNPARAK"
     gene            <374130..>377108
                     /locus_tag="THITE_2050159"
                     /db_xref="GeneID:11516001"
     mRNA            join(<374130..374292,374348..374422,374487..374724,
                     374789..374941,375000..375309,375374..375949,
                     376006..376194,376265..376985,377071..>377108)
                     /locus_tag="THITE_2050159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653779.1"
                     /db_xref="GeneID:11516001"
     CDS             join(374130..374292,374348..374422,374487..374724,
                     374789..374941,375000..375309,375374..375949,
                     376006..376194,376265..376985,377071..377108)
                     /locus_tag="THITE_2050159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653827.1"
                     /db_xref="GeneID:11516001"
                     /db_xref="InterPro:IPR005593"
                     /db_xref="JGIDB:Thite2_2050159"
                     /translation="MPGEQIPVSNPPPLPSQLPDSVLELSVRLQEKPLAENVRQSLRA
                     FQRAAEYIAAAMIFLSDNVLLESELRLEHVKPRLLGHWGTCPGLILVWAHLNLLIRNH
                     DLDMIFVVGPGHGAPAALASLWLEGSLERFYPREYGRTAEGLRNLITRFSVPGGFPSH
                     INAETPGAIHEGGELGYALAVSFGAVMDNPDLIVTCVVGDGEAETGPTAAAWHAIKYL
                     DPRESGAVIPILHANGFKISERTIFGCMDDKELVCLFSGYGYQVLIVEDLEHIDDRLQ
                     NALEWALAEIKKIQKAARSGKPIVKPRWPMLVLQTPKGWTGPKEVEGKIIEGSFHSHQ
                     VPLPKANSDDTQLKALQDWLASYRISEIIKDGKPTETVLSILPTNDEKKLGQVKAAYD
                     PYVGLKAVDWTEFGVDKGTDQSCMKVTGKFLDKVFQENPNTIRLFSPDELESNKLDAV
                     LDHTQRNFQWDEYSRANGGRVIEVLSEHNCQGFMQGYTLTGRTAIFPSYESFLGIVHT
                     MMVQYSKFVKIAREVKWRGDLPSINYIETSTWARQEHNGFSHQNPSFIGAVLNIKPEA
                     ARVYLPPDANCFLSTVHHCLKSRNKTNLIIGSKQPTAVYLTPAEAAEHCRQGASIWRF
                     ASSPSSSSPGNDDADDQPDVVLAGIGVEVTFEVVKAAELLRALCPALRVRVVNVTDLM
                     ILAAPASGHPHALSEQAFERVFAAADHCPVLFNYHGYPAELRGLLFGRAARHLARVSV
                     AGYAEEGSTTTPFDMMLVNGVSRFDLAQRALKAGAEANPKVRRVLEECLAQVRERVEE
                     VKRFIGEHGKDPDDIYDLPQFV"
     gene            complement(<383190..385297)
                     /locus_tag="THITE_2078336"
                     /db_xref="GeneID:11516002"
     mRNA            complement(join(<383190..383583,384100..384377,
                     384680..385003,385117..385297))
                     /locus_tag="THITE_2078336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653780.1"
                     /db_xref="GeneID:11516002"
     CDS             complement(join(383190..383583,384100..384377,
                     384680..384865))
                     /locus_tag="THITE_2078336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653828.1"
                     /db_xref="GeneID:11516002"
                     /db_xref="JGIDB:Thite2_2078336"
                     /translation="MSRLPPSPGSGSVSAANPSTSTPSTPASLPSIQLRPGYAVAGRR
                     THKKSRTGCSTCKARKIKTHTTLAADSTLWEFWRDDVVQMGLACDYIMRAVLAVSALH
                     LAYHRPDRRDFYTESGILLHQKAARSAMRVMAADHKIDKDQAANLFVFSMLTIASSTT
                     ASGEPGRPDHLLHTYTHAVDELELALVAQRDPAAPRDVLDAMVWLWEVSDSLVPLLRV
                     PTQEAVAIFAHFCVLLKHHESHWWLQGWADHIMARAHEILDAEHREWIEWPIREIGRM
                     GLPRTGPER"
     gene            385922..387341
                     /locus_tag="THITE_2116369"
                     /db_xref="GeneID:11516003"
     mRNA            join(385922..386430,386519..387081,387154..387341)
                     /locus_tag="THITE_2116369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653781.1"
                     /db_xref="GeneID:11516003"
     CDS             join(386190..386430,386519..387081,387154..387324)
                     /locus_tag="THITE_2116369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653829.1"
                     /db_xref="GeneID:11516003"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="JGIDB:Thite2_2116369"
                     /translation="MSTTTTIPPGWRPTYETCHEVSVLCPVKATTLGYYPNRGLNIFF
                     AVAYALAAVVTLIFGVWKRTWGFSIAVTAGCILECVGYVGRTQLSTNPWNDTAFKTQI
                     VAIILGPTLICIGLYLTLKHTVTALNRSLSRVAPRVYPLFFVPADVSCLVVQAIGGGI
                     AASAGYNNYKLLQNGNRTIIAGVALQVVVLGAFGLMAGDYLFRARRYFRQPAAVAPEF
                     RSGAALWADRKFKMFLWAMGAAYALLLIRCIYRIAEMAGGWGSPIMQDEPSFIALESF
                     MVVIACALLAAFPPGIFFPQMSHKFVPIEEEKQPQTESDSAGFEMGRV"
     gene            388811..390525
                     /locus_tag="THITE_2116371"
                     /db_xref="GeneID:11516004"
     mRNA            join(388811..389413,389488..390525)
                     /locus_tag="THITE_2116371"
                     /product="glycoside hydrolase family 93 protein"
                     /transcript_id="XM_003653782.1"
                     /db_xref="GeneID:11516004"
     CDS             join(389122..389413,389488..390338)
                     /locus_tag="THITE_2116371"
                     /note="CAZy_ID 269687"
                     /codon_start=1
                     /product="glycoside hydrolase family 93 protein"
                     /protein_id="XP_003653830.1"
                     /db_xref="GeneID:11516004"
                     /db_xref="InterPro:IPR002860"
                     /db_xref="JGIDB:Thite2_2116371"
                     /translation="MRWSTLVLSLLPIVSAAPKEKTPKTFSQRVVFTPPSNYTIPRVL
                     YARTAQFKDGTLLATWENYSPEPPPVYFPIFQSTDGGYNWNEIARVQDTANGLGLRYQ
                     PFLYILEEPFAGFPKETVLLAGNSIPTDLSSTHIDLYASTDRGRTWQFLSHIAAGGEA
                     VPDNGLTPVWEPFLMRYKDTIICYYSDQRDNATHGQKMSHQTTRDLKNWGPVITDVAY
                     PTYTDRPGMPTVARLPNGKYIMTYEYGGGPAIPTSYSFPVYYKVVADPETFGAATGTS
                     LQTTDGYVPTSSPYVVWSPVGGKNGTIIVSAGSSGDVYINTGLAEPGTPWTRVATPEP
                     SAYTRNLRVLNDPTKLLIMGAGQLPPSTTNKVELSVMDISKLKAAL"
     gene            complement(<390707..>392206)
                     /locus_tag="THITE_2050280"
                     /db_xref="GeneID:11516005"
     mRNA            complement(join(<390707..391500,391669..>392206))
                     /locus_tag="THITE_2050280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653783.1"
                     /db_xref="GeneID:11516005"
     CDS             complement(join(390707..391500,391669..392206))
                     /locus_tag="THITE_2050280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653831.1"
                     /db_xref="GeneID:11516005"
                     /db_xref="JGIDB:Thite2_2050280"
                     /translation="MSAAPPAPPDFPVAAGADEPSYIDYEAFLSPTFHAPTFANTLVL
                     ATNNPSDSPLDLSTPLARVLFDVQEVSAHIDRLTARAAEPLLARTAARDAAAARLLAA
                     LEPQLRALNESHAQLARAVAPRYAEAVEVRRVAENAWRAQRLARAVARLLGLARQLEA
                     QFAELVGPGAGSGGAVSGGGQLERVAVVRSVRDGVVAPVEKAVRETAERVVREFSLGS
                     ATGSGVTFAQGEEVRGRTVAALTTLWLLTPVPSSSGKAAEKWAPTLMLQALEAYLRSA
                     LQSSIAGLSRALSTLPSLERTLAEVSARCQNIVALEAVLEGSKAPQHPLLPQGKQAQA
                     GGNMLQPLLSYLETGSLASYFWRTMAGSMAPRVQEIMAKGGVPARTLRTNRQSVSEAI
                     RECVIRGSQLPGPMAAAARGKPKATERDTGAKQWEREVAVMVGSIVNSIGR"
     gene            392715..394931
                     /locus_tag="THITE_2116372"
                     /db_xref="GeneID:11516006"
     mRNA            join(392715..393737,393806..394931)
                     /locus_tag="THITE_2116372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653784.1"
                     /db_xref="GeneID:11516006"
     CDS             join(393063..393737,393806..394777)
                     /locus_tag="THITE_2116372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653832.1"
                     /db_xref="GeneID:11516006"
                     /db_xref="JGIDB:Thite2_2116372"
                     /translation="MPLLDAREILAFPGGDNSSDTVIGNVHFNLTTLQHWNYTLYSNG
                     TLSNGSWCLLTFEPYTPALVLPNGTFINVTWCWSPTEPIGVRGGVAIAYAVLFGIALV
                     LILVNLKKHGRLHLPTEKRFFPIGRRWQWYWSSWVCATAVISLLTSIDVDRYFLPELP
                     IVLTSFFWFLMQWGVMAVVWEAVRHWGSWMERQFIDPDPFVLRNDDRRSKVEFYLPLV
                     FYLFLWLNFFMIVPRNWTGIELQRYPQQVIDDAAPTATDARFKTAAFMLAVCWLITVF
                     SLWHSIKHYCPRNRGAFNRLRGLVRYTPLRFMLLLPLAAVIPAYQALVAWYFDYSPLK
                     VGGPLASIYAGAYTPTLLILYVQILFGFFNPNEDLELQRQRRVRAQELDREMGIVHKP
                     SWWRRVNGEHLDPNESMRDRLARNVREIHGTKRSAPDAEVTLSPPAGAPATSVEMTPV
                     SPPPPSAPYSSRSERRRQERAMELAAGVLFSGAPEQSAATAARRREELMMDGPPPPSY
                     RDTVENIRAAPASNVARSISAESSSSTNHPPQQIRSMLDV"
     gene            complement(397018..399641)
                     /locus_tag="THITE_2116375"
                     /db_xref="GeneID:11516007"
     mRNA            complement(join(397018..398689,398752..399641))
                     /locus_tag="THITE_2116375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653785.1"
                     /db_xref="GeneID:11516007"
     CDS             complement(join(397069..398689,398752..399242))
                     /locus_tag="THITE_2116375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653833.1"
                     /db_xref="GeneID:11516007"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2116375"
                     /translation="MAAAFRPVNNRLSAGEHTEEATVASPMTPRPTTAPAEPTKPLDE
                     AKTPTRTSFGASASAMASQRPLPTSPFPESVQVPEPAAGAPPRDHSQHSRRSKESSED
                     VDMDDTDGEAHAADDGAGSDEESVDADGTKNKKKKSQRFYCTDYPPCNLSFTRSEHLA
                     RHIRKHTGERPFQCHCSRRFSRLDNLRQHAQTVHVNEDIPIDSLAATGTRFQRQIRTD
                     RVRQPGRARASTAGSVGPGGRGHAKSLSTSSIASVSSIASTYSINEARRRPPALIMAE
                     SRPRLESYRAPDGQYYRPPSPSDFSTPTSATFSTGQNSPHWGPVMSPNSSHSRSHSMY
                     AGVRTPGRRLSVPSGGNNPFQSPHGPGVRGPIFGPSGLLNSSNSGTLSPSQSSLLSSP
                     TASTSAWSRRDSFSSVADEAWRRRTWHPDTRDYNGASRLSQVITPPQFPPDTVTVPNP
                     PPPAGQPPQQLRLPGIESFDEITPLPPPRRIPSPMVVDSNAPNPPTLPRPGDLAADER
                     QVPASQWDTHLHRGLTRLDINTPPRDSAGAWASEANQALLARAEQARVRFEPEVKEVP
                     VAPAPMVPAHAPAPPPMLVPRHQHTVSAPVFNTPRETKRHGWYNGPVTPHPAGEAAVQ
                     ESRPHVDRIVHPNISSFQGFPSREPQPALSQQPGPGMERMERIPERPPNHQGTTSPES
                     LKRLEALVAVATSEGSATTAY"
     gene            complement(<403422..>405390)
                     /locus_tag="THITE_2129395"
                     /db_xref="GeneID:11516008"
     mRNA            complement(join(<403422..404794,404883..>405390))
                     /locus_tag="THITE_2129395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653786.1"
                     /db_xref="GeneID:11516008"
     CDS             complement(join(403422..404794,404883..405390))
                     /locus_tag="THITE_2129395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653834.1"
                     /db_xref="GeneID:11516008"
                     /db_xref="JGIDB:Thite2_2129395"
                     /translation="MPIRIDISDIAIAKDEPQHRLHLWGLHTSAWDDNCIECGNDPVS
                     DAGVAKPGLRCECGEGVYCSEACKQMYTRDATIKCALFRGASLGSRPTRKHRRALIVV
                     PSNSTSTFKLTWLKVKGCRITIDHPAFDGYFGHVGADKCWLDLAVVNPALAGSEAALF
                     TKLGHGIAIGFASNLMNPAPEVAVDLSWANTAWYHDAIQHHGVLWPGPVVFFCFGYDL
                     RDYVKVSPAEPADVERGAEASMSDAEIWRELDTLRRAWYHPGSQPNSDGSSNRGEAKA
                     SQSGPMVWKWKIKERGTSIKILDFSRRDLSTVLHYLTLSQLNPAPAVYKRCPTATPAC
                     KVVDPNHPARRQLWCRFHPDPQRAERETAAPSAPPASAPDASNDPAELIYAGGVYFPA
                     WPHSARPMAGAFAVGLPWYVHYSMDINPPFRHGLRGAPNNRDKPPGLRPRRSWLQPLL
                     WTVHFAPTDPTRLALAEPQEAACSDNNDDDDVAAVLVRPDGRAIAPHHARALHKYLRY
                     TRPREWARHGPRGFEAYWRTYARVLHAGAGADELGPAGAVPSPYELESEAEFGGGSGA
                     VPPALRPPPPRSLVCYTERALAYMTLEGLGPEEWRRAELERERERILVAIEMYERAGH
                     GF"
     gene            <408085..>408330
                     /locus_tag="THITE_2049896"
                     /db_xref="GeneID:11516009"
     mRNA            <408085..>408330
                     /locus_tag="THITE_2049896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653787.1"
                     /db_xref="GeneID:11516009"
     CDS             <408085..408330
                     /locus_tag="THITE_2049896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653835.1"
                     /db_xref="GeneID:11516009"
                     /db_xref="JGIDB:Thite2_2049896"
                     /translation="ITPNNAGAKNVGNGKGEQFITGGCVNDADCSSGCCANASGVGVC
                     SAEAAQFQNGKQGCHFVDPNAAATIAAAKAQVQKQGF"
     gene            complement(<409045..>410419)
                     /locus_tag="THITE_2052176"
                     /db_xref="GeneID:11516010"
     mRNA            complement(join(<409045..409792,409865..409976,
                     410079..410188,410244..>410419))
                     /locus_tag="THITE_2052176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653788.1"
                     /db_xref="GeneID:11516010"
     CDS             complement(join(409045..409792,409865..409976,
                     410079..410188,410244..410419))
                     /locus_tag="THITE_2052176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653836.1"
                     /db_xref="GeneID:11516010"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="JGIDB:Thite2_2052176"
                     /translation="MGKIASMAYFRVPPRWLFVKITDEQGNVGWGEASLEGHTQAVEG
                     CLDAWFERYQGMEADDIEHIWQMSWRTSFYRGGPVFMSALAGIDIALWDLKARKLGVP
                     IYQLLGGKLRDKLKVYAWIGGDRPGDVEAQALARKAQGFQAVKMNATEDVGWLDSPAA
                     LQGCVERVRTVKRLGMDAAVDFHGRVHLPMAKQLARALEPHAPLFIEEPLLSEHLPGI
                     RALHGLTTCPVALGERLHSRWDVRPFLEAGCVDILQPDISHVGGISEMRRIAAMAEAY
                     DVALAPHCPLGPIALAANVQVDAVSANFAIQEMGLGIHYNDTGHDITSYIWNPEVWHV
                     KDGYIAVPTGPGLGIEVDEELVRSLSKDAKPWVSPGFIGPGGEIREW"
     gene            complement(<410805..>412689)
                     /locus_tag="THITE_160867"
                     /db_xref="GeneID:11516011"
     mRNA            complement(join(<410805..411363,411443..>412689))
                     /locus_tag="THITE_160867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653789.1"
                     /db_xref="GeneID:11516011"
     CDS             complement(join(410805..411363,411443..412689))
                     /locus_tag="THITE_160867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653837.1"
                     /db_xref="GeneID:11516011"
                     /db_xref="JGIDB:Thite2_160867"
                     /translation="MSSIRADQHPYQRRSQRLDRAKSAEHGRPAAHTRTETVGAETRG
                     RSARSGDAGYILGLVSAHGSLSFLFCVALVVLCLLFLGAHRGRPREWTDDPDINGPIS
                     NWDPRGVRIVSAPFPVAELVSVAESYAAAARHIKDPQSVSNISLRLEAPGIRRVDLRS
                     WILNLPRDPTFRKITGVNETSPRLLRLAENPAALIAETNISLTISMIESLWRRLVDEG
                     LAVLALGLGENHPEYAALTGPLASPPIPVSSSLNSAAALWTSLQREAYVWPAQSLAWL
                     QKMAWRLDGWGIGPVAGKDQELQPLPRLGRRAPTLSELLEYDRARPAFAGRSRTLPQL
                     LDGLQLSRNATSLLGRFHISPALGINGLSGTICTDPGLLDAVARGRCDDNLTAVIEKP
                     LGYRNLAAALKSDRLTLEGLRDALSAFSRLDSLASHFRDGLARRMGKLERAIDAFHPL
                     YSSLKLQRQILAGAARNLQHACFLQESLLERAGSLLSDPSARWKIGRDVDGSRRVVVT
                     FATVPELDDAIAYLKSEYSRILARYRRLRQPWYTASDAISLLHRSISGGWMERLGVQR
                     DISWKTKLSLGPCRDFRPLIRPAFTWSKFYCYLLL"
     gene            <416159..>417640
                     /locus_tag="THITE_53349"
                     /db_xref="GeneID:11516012"
     mRNA            <416159..>417640
                     /locus_tag="THITE_53349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653790.1"
                     /db_xref="GeneID:11516012"
     CDS             416159..417640
                     /locus_tag="THITE_53349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653838.1"
                     /db_xref="GeneID:11516012"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_53349"
                     /translation="MEPIPGPAGWPLIGNLLDIDLNNTVQSFVGLAEKYGPIFKLRLG
                     GSDRIFLSNHVLVNEVCTRKEFVKHIMGAVGALAQVLPDGLFTAPTAKRSWGQARRTL
                     QPTFAPVRIRSMFPEMLDITSQLVLKWARHGPRTPIDLSADFTRLTLDTLALTAMDTR
                     FNSFYHDELHPFVRHFGAMFAELQRRSNLPAWSSWLRWTANREFDENNAFIRAFCADV
                     LAHRRARESEDGGGELAGRQDVFTAMLHRRDPVTGEQLADSVIIDNMITFLFAGHDTT
                     AGLLSFLVYHLIRNRDAYEKLQAEIDRVLGGGAMTADHLDQLPYAKACVLEALRLESP
                     AQAFAVTPQMDDDGGDSDKPILLGGRYPIRRGQTAIVLTPALHRDRGVFGDDAASFRP
                     ERMAEDKMKQLPKNSFKPFGNGMRSCIGKDFAMQEAMIAAVVLFQKFDFELVDPDYEL
                     QYQPSLNRKPKDLFVYARLRPGVNVLSLHRDLFVPAKQDQQAE"
     gene            419496..420465
                     /locus_tag="THITE_2116379"
                     /db_xref="GeneID:11516013"
     mRNA            419496..420465
                     /locus_tag="THITE_2116379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653791.1"
                     /db_xref="GeneID:11516013"
     CDS             419657..420232
                     /locus_tag="THITE_2116379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653839.1"
                     /db_xref="GeneID:11516013"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Thite2_2116379"
                     /translation="MAAKITRDGLYRITYGETPGLSRDEYVARQPWKFETMLPGHPKP
                     DEYKVINLSPYRMHQRCAPKFRVGRILLAADAAHLCNPWGGLGITGGFVDVGGLYECL
                     AGIWDGKADESILDIYSEKRIEKWKTIINPISSENFRRVSDKDPATRFERDEFMQQVK
                     RGETDRAYLKELLLAPMEVRYDFAQHYKKTE"
     gene            complement(420466..422386)
                     /locus_tag="THITE_2116382"
                     /db_xref="GeneID:11516014"
     mRNA            complement(join(420466..421145,421225..421337,
                     421402..421588,421658..421731,421824..422386))
                     /locus_tag="THITE_2116382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653792.1"
                     /db_xref="GeneID:11516014"
     CDS             complement(join(420606..421145,421225..421337,
                     421402..421588,421658..421731,421824..421953))
                     /locus_tag="THITE_2116382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653840.1"
                     /db_xref="GeneID:11516014"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="JGIDB:Thite2_2116382"
                     /translation="MKKGIAAAIEMTPRRQPSGKFKEIETDYQPVNWKRLFLTPKYLV
                     LWIICIIVVVLTIIITIKHEQVVAALRPFSEKVRDLPAGWLIPIAILIIISFPPLFGH
                     ELIALLCGVVYGLWIGFGIVAAGTFLGELATWFAFKRLFRKKAEKLERTNLNYGALAR
                     ITRDGGFWIVLIIRFSAIPSHFSTAVFSTCGVNFWVFAIATLLTLPKQIFLVYLGVLL
                     LQDKPDNSAKNIVFGIAFALTIVMAIYIGYKMKKVKKVLLEEQAQRRKARLEQEADEC
                     EEGQFLMETQGPRERDYDAVAQEEVDIGVAGAGSYGPPREPLGPRYHSDFEYQGAGKL
                     DMGREPVREQAWV"
     gene            complement(423674..424297)
                     /locus_tag="THITE_2116386"
                     /db_xref="GeneID:11516015"
     mRNA            complement(423674..424297)
                     /locus_tag="THITE_2116386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653793.1"
                     /db_xref="GeneID:11516015"
     CDS             complement(424018..424209)
                     /locus_tag="THITE_2116386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653841.1"
                     /db_xref="GeneID:11516015"
                     /db_xref="JGIDB:Thite2_2116386"
                     /translation="MESWGVLVGGLRVVVFFVPFFRYRGMEPERTAARPKRDSYVRWS
                     AVHDSYPKLVQGSNGGDTR"
     gene            complement(424299..425399)
                     /locus_tag="THITE_2116387"
                     /db_xref="GeneID:11516016"
     mRNA            complement(424299..425399)
                     /locus_tag="THITE_2116387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653794.1"
                     /db_xref="GeneID:11516016"
     CDS             complement(424326..424625)
                     /locus_tag="THITE_2116387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653842.1"
                     /db_xref="GeneID:11516016"
                     /db_xref="JGIDB:Thite2_2116387"
                     /translation="MKRIFWACGCALPPIVWRACAAAGTPDCQRRHLLDRIRMAEPCP
                     AHRPVSAAPAGVAASSPRRRVANGRRRGLPRLPRVVFIHRGSGSGCGNCGTVNGV"
     gene            <427509..>427937
                     /locus_tag="THITE_125611"
                     /db_xref="GeneID:11516017"
     mRNA            <427509..>427937
                     /locus_tag="THITE_125611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653795.1"
                     /db_xref="GeneID:11516017"
     CDS             427509..427937
                     /locus_tag="THITE_125611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653843.1"
                     /db_xref="GeneID:11516017"
                     /db_xref="JGIDB:Thite2_125611"
                     /translation="MPLFVEFAEPLRRPTAERVGFHTSNLEMELFHDLGHSTSLSGCN
                     GGEIRNSLAPPKQNSRRTHAKMKLRAVFESAVLPISMRPQSRTASPRPAPTPPPPRRR
                     RPAAVEHRVGITRQGSYETRARFCPSGWAGCHPQTALMLL"
     gene            427971..430112
                     /locus_tag="THITE_2116393"
                     /db_xref="GeneID:11516018"
     mRNA            join(427971..428202,428260..428391,428462..428640,
                     428695..428731,428805..428872,428967..429370,
                     429496..429563,429634..430112)
                     /locus_tag="THITE_2116393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653796.1"
                     /db_xref="GeneID:11516018"
     CDS             join(428196..428202,428260..428391,428462..428640,
                     428695..428731,428805..428872,428967..429370,
                     429496..429563,429634..430010)
                     /locus_tag="THITE_2116393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653844.1"
                     /db_xref="GeneID:11516018"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="JGIDB:Thite2_2116393"
                     /translation="MRDCLLDAVGQSSCSPTNVTCICNDTRLNNMATACITSSCTVKE
                     SLTAKNLTSQLCGLPDHGDDSLIPIYSVFIGLAVVAVALRLVARVVTHAYFWWDDLAC
                     FIGFLCAAGFTGVNIKAIQLGQSKDIWFVPFDNITLVVELFYYEMLLYTITRFFVRAS
                     IILFYMRVFPPTKRDGKINLGRLVQATFVFNVVYNVSFLLAVVFQCYPIADFWRQWEG
                     PLVEGHCGNANVLAWVAAATGIVFDLWLLALPFSQLWTLNLHWKRKVMGGLMFFVGVA
                     VMIISLVRLKTINQFTRAVNPTKDIVQVCLWSGIELDVGVICPCLPSFRLLLRRLLPR
                     AMGTTGRYEMDPMSNANSGMRSGLRRSLGGAPGGRIVVENTVDVKYGGSDDSNDSASV
                     SGLVRGRASSAKDEESGPGNGHDNSGRGRAR"
     gene            430098..431205
                     /locus_tag="THITE_2116400"
                     /db_xref="GeneID:11516019"
     mRNA            430098..431205
                     /locus_tag="THITE_2116400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653797.1"
                     /db_xref="GeneID:11516019"
     CDS             430474..430977
                     /locus_tag="THITE_2116400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653845.1"
                     /db_xref="GeneID:11516019"
                     /db_xref="InterPro:IPR015075"
                     /db_xref="JGIDB:Thite2_2116400"
                     /translation="MVVINLGYTAPVNRPGQQPVLTLQQVWEGLQHKMRRADKFVPII
                     TACEVLAEEEPSSPADGGPRAVVTRRVTFQPDTGPWGKSTVVEVCRLYPPCRIDFVQE
                     DGATIGNYVTQGPSGDPADLLMTYVFQWNVPQVAEGSAEAKELEEKYRKVRFVDGLVS
                     RVICCGC"
     gene            complement(<431330..>432320)
                     /locus_tag="THITE_2032272"
                     /db_xref="GeneID:11516020"
     mRNA            complement(join(<431330..431783,431852..431915,
                     431993..>432320))
                     /locus_tag="THITE_2032272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653798.2"
                     /db_xref="GeneID:11516020"
     CDS             complement(join(431330..431783,431852..431915,
                     431993..>432320))
                     /locus_tag="THITE_2032272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653846.1"
                     /db_xref="GeneID:11516020"
                     /db_xref="JGIDB:Thite2_2032272"
                     /translation="AFAAQNRKDLCGLSIHTADFPGVGNFSAIEATWTIPGVRPRPDI
                     SGMNPPYVFYGVSLCCGENCSSRVSAGMMAAPWAWNETGYSFTAIPIYQLSPDFPQRQ
                     VPQEHNFYFNSSDTLWTRLTIESPTRAHITFSKFITDDTNLTVTADIDIGNDGEQPLA
                     NVVTRGNGVEVHDPISSRWRNISVAPLCGESAWWFVSDKFDPGEDTERWDPLPRFSPI
                     LIAGHGLETTQGKSFPRDLPLSGQARFWTMVRDEAGRTEELCTVKGFVDTGMTMVHAP
                     NAWGI"
     gene            complement(<432957..>435064)
                     /locus_tag="THITE_2129403"
                     /db_xref="GeneID:11516021"
     mRNA            complement(join(<432957..433606,433692..434096,
                     434155..434323,434387..434457,434518..434692,
                     434767..434837,434897..434946,435024..>435064))
                     /locus_tag="THITE_2129403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653799.1"
                     /db_xref="GeneID:11516021"
     CDS             complement(join(432957..433606,433692..434096,
                     434155..434323,434387..434457,434518..434692,
                     434767..434837,434897..434946,435024..435064))
                     /locus_tag="THITE_2129403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653847.1"
                     /db_xref="GeneID:11516021"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2129403"
                     /translation="MSPQQPGGRHLVHSHAKEGDVPGTVDLTAKEGDDTGYGQALYPV
                     PAEDPNDPLQWSNTRKSLILVVCSLYSFLSNSALLGPSVYIGIYAEEFGIDANTASNL
                     VSYANLAFGFGSLVLVPAYHKFGRRPVMLLSLLTYCAGLLACSQVTTYGGLMAARVIH
                     GFGSSVCEALPVQLVNDIFFLHERGKRLGYYTVCLCFGATGPLYAGYMLAGGYSWRLF
                     FYVEFAFGCALFILAFFVVEETLYHRVPRTEAALDSSSSQNGEKGSSEAHAVAAESSS
                     DAVAYVPPRKTFLQTLKFWGAYDKDTEYFLMMARSFTYYLVPHVLWVVTTYGIYIGLG
                     ALTFNYTFPLKITAPPYNWTQTNSGLIAVGSFLGYLLAIPFTTTSDRLAAHLTRRNNG
                     IREAEMRLGAMLPVMLLGPAGLIVYGFSAQRDLHWVGYFAGVAMTNFCSYFYFTFTLA
                     YAIDSYTANISEMLIAMNLGKQAISFGMGLDLLDWVLQHGYAVMIAGVFCAILLANNL
                     ALIVFMVWGKKIRRFMATTWLARVHRASVREIATH"
     gene            <437830..>440714
                     /locus_tag="THITE_2144859"
                     /db_xref="GeneID:11516022"
     mRNA            join(<437830..438107,438158..438271,438335..>440714)
                     /locus_tag="THITE_2144859"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003653800.1"
                     /db_xref="GeneID:11516022"
     CDS             join(437830..438107,438158..438271,438335..440714)
                     /locus_tag="THITE_2144859"
                     /note="CAZy_ID 269864"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003653848.1"
                     /db_xref="GeneID:11516022"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Thite2_2144859"
                     /translation="MRMHSALLKQTQASAYSLALQALLAAGSSCPSSGSNGTGPYNAS
                     ISYLGCYPDYTTRVLQGGVIYVGVGNTPQYCADLCGSHGYRYAAVEYYTQCFCGNTIV
                     GNPPKADESQCDAPCHLEPSLACGGTYYHMNLYNISNPAPTITPLNKFTPVCQTSPLC
                     SSPACNTSLPIADRVRWLVGQLTLQEKITNLVDGASGSARVGLPPYEWWSEALHGVAA
                     SPGVTFAGPNGTAFSYATSFPMPITISAAFDDDLVSQIAAVVGREGRAFANHGLSGFD
                     FWTPNINPFRDPRWGRGPETPGEDAFRIQQYIRHLIPGLQGSDPLDKQIIATCKHYAV
                     YDVETGRYEYDYDPQPHDLAEYYLAPFKTCVRDVGIGSVMCSYNAVDGIPACASEYLL
                     QSVLRDHWGFTEPYQYVVSDCDAVRFIYSPHNFTDSPAAAAAVALNAGTDLECGSTYL
                     NLNQSLASNMTTEAALDRALTRLYTALHTIGFFDGSARYGGLGWDAVGTGDAQVLAYQ
                     AAVDGAVLLKNEKSLLPLDSKRLRKLAVIGPWANATTQMQGNYFGQAAYLVSPLAAFQ
                     SAWGADNVLFANGTGIAGNSTAGFAAALAAAKAADAVVFLGGVDNSVESESLDRTAIS
                     WPGNQLDLIAQLAAVGKPLVVVQCGGGQLDDSALLANPRVGALLWAGYPGQAGGAAIA
                     DLLTGKQAPAGRLPVTQYAASYTSEVSLFDPSLRPRRSGGSKSHSTFPGRTYKWYTGK
                     PVLPFGYGLHYTTFRTAWADEPRGRAYDIAGLFPANTTTTSSAFSAADTYPVLNVSVT
                     VTNTGRGASDYVGLLFLRTRNAGPAPYPNKWLVGYARARGLAPGSSARLELAVALGSL
                     ARADEDGRRVVYPGDYELLFDVDGALPPARFALRGPSRTVDALPLPAKSYAFSVPVHT
                     EPPTYGGGR"
     gene            complement(<441607..>442597)
                     /locus_tag="THITE_2089002"
                     /db_xref="GeneID:11516023"
     mRNA            complement(join(<441607..441846,442029..442296,
                     442362..>442597))
                     /locus_tag="THITE_2089002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653801.1"
                     /db_xref="GeneID:11516023"
     CDS             complement(join(441607..441846,442029..442296,
                     442362..442597))
                     /locus_tag="THITE_2089002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653849.1"
                     /db_xref="GeneID:11516023"
                     /db_xref="JGIDB:Thite2_2089002"
                     /translation="MTRDPLLTAELAIYAILALPVLYLLFRHSTAGLLGWFYLFAFCS
                     LRIVGGALTSSSAGIISSIGLSPLLLAASGILHEARTHHGLRNTKPEWIAVALFHVLV
                     ATSVALVGTGSSALEGDHPTAKDLSLVDAGVGLLTASWVLLCIGTAISFLPSQQNTAA
                     PAHRQGTILLHATALSNPLIGIRVLYTLAALTTRRASLNPVTGSLAVRVVLGFLPELL
                     ATLVFVVAGARTRHAGRVGKGGLGQRPGY"
     gene            <443331..>444748
                     /locus_tag="THITE_2051079"
                     /db_xref="GeneID:11516024"
     mRNA            join(<443331..443420,443518..443541,443618..>444748)
                     /locus_tag="THITE_2051079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653802.1"
                     /db_xref="GeneID:11516024"
     CDS             join(443331..443420,443518..443541,443618..444748)
                     /locus_tag="THITE_2051079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653850.1"
                     /db_xref="GeneID:11516024"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2051079"
                     /translation="MEAARRIARPRLHHKKSRTGCTRCRARRVKCNEAKPVCNNCYRH
                     NVPCYYDRVPRPAATTPANQLRPPSSSGTNDSSGDTGRTLETPSRTPLSASLHDAYWE
                     LRAFHHFAVATSETLPGSHLPGVRKSWSEQVPVLALSYKPLWNQLVALSALHLLASSN
                     HAEDPALLACRADAHSAALQSYRPALGQLGPDTAEAACFTSILLLVDTFASLQQRRPR
                     LDGYDPPVHWLRVTQGTRAVFEAAETSSGSSSNPASGIMTVIASSNHNQAVSSGGDSG
                     SREFAYLLGPLPGDLEAEAEPEPEQRRDIARAYEETVDRLRLIRAAVEAGEPLLALCR
                     RFMSFACLVPPLFVDLVERKAPRALAVLGHFFALAACARELWWVGDTPAREVHAIRDG
                     LPPELRHLMEWPCEFVADQGDG"
     gene            complement(<445161..>446414)
                     /locus_tag="THITE_2129407"
                     /db_xref="GeneID:11516025"
     mRNA            complement(join(<445161..445394,445806..>446414))
                     /locus_tag="THITE_2129407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653803.1"
                     /db_xref="GeneID:11516025"
     CDS             complement(join(445161..445394,445806..446414))
                     /locus_tag="THITE_2129407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653851.1"
                     /db_xref="GeneID:11516025"
                     /db_xref="JGIDB:Thite2_2129407"
                     /translation="MDPAKIASCPPSRGNPPRDPLLETDAHTEVVFVPAAGRTVFVPA
                     AGTKTTNPAQITGSMRRYPCLPRTMAPRPSDKFILSQALTNLELRVSCRRNEINLNYG
                     IDQQSELYKLHQSTQDLKILRSMRPDLDELNFLRRENVILRYQVDLWQYLVSVWATRA
                     TAVSDVMAVCGFSQDTPCRAILDALPLEAPPGLSLRDVALGLPASYALGMFSWEDPNR
                     ENSFAITNVLVASTTYGLAAFLIWTVCDSKQRQERKNAGRVKSPGKLFQQEETWHGRT
                     DKEG"
     gene            <447854..>449151
                     /locus_tag="THITE_160853"
                     /db_xref="GeneID:11516026"
     mRNA            join(<447854..448132,448984..>449151)
                     /locus_tag="THITE_160853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653804.1"
                     /db_xref="GeneID:11516026"
     CDS             join(447854..448132,448984..449151)
                     /locus_tag="THITE_160853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653852.1"
                     /db_xref="GeneID:11516026"
                     /db_xref="JGIDB:Thite2_160853"
                     /translation="MTSIPENFGSGTLSKKRLPDESDSGPARHTTSWKGLNNTGMWLT
                     SLRSTISRTSGNTTTKASRHTAIRSPRTQEAERPASPDLFRGGVTVTSEAAPQADKSA
                     PPAIAPEILENKRLCEEPCFDAGRLLVTGRELLKGVGLAPTKWKEF"
     gene            450167..452099
                     /locus_tag="THITE_2116403"
                     /db_xref="GeneID:11516027"
     mRNA            join(450167..450655,450730..451346,451424..452099)
                     /locus_tag="THITE_2116403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653805.1"
                     /db_xref="GeneID:11516027"
     CDS             join(450247..450655,450730..451346,451424..451996)
                     /locus_tag="THITE_2116403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653853.1"
                     /db_xref="GeneID:11516027"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2116403"
                     /translation="MTLAPEHDGLRRTDESSMSGFQPPVPGDAEKGPAQSSPASGSLS
                     LPQDDEKRSVGQAGRTSSETAQTEDLGGGGESRRPASRQRTRDEAQSQPGGDVAGGNG
                     LLSRAVSRVLTHASTKSSWNPGPPPDGGLQAWMAVVCTHLVVMNTWGIVGSFGLFQTH
                     YTAALGRSPSDVSWIGSIQIFLLFFVGALTGRLTDAGYFRHIFALGVALQLVGIFTTS
                     AASQYWQVLLAQGICLGLANGCLFCPCISTLSTYFSARRSLAMGLAACGTATGGLIFP
                     SMVRQLLPVQGFPATMRAIGYLQVATFAVAFVGLKQRIPPRRSGPLVDWASFREGEYT
                     LYAMGSFSFFLGLYFAFYYISSFSRDIIGLSYTDSLNLLLVLNGVGLPGRLLPNHLAD
                     RFGALNMMMPTATIAGVCMFCWMAVKSTTSLYVWCVFYGLTGGGIQSLFPAVLSSLNT
                     DLRKAGVRMGMVFTIVSFATLAGPPIAGAIITAEGGTYYGAQAFAGACLLLGAALMVA
                     ARTVKVRRLMRETDAPGSAWRVKV"
     gene            <452881..>454316
                     /locus_tag="THITE_2050866"
                     /db_xref="GeneID:11516028"
     mRNA            join(<452881..453098,453224..453987,454078..>454316)
                     /locus_tag="THITE_2050866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653806.1"
                     /db_xref="GeneID:11516028"
     CDS             join(452881..453098,453224..453987,454078..454316)
                     /locus_tag="THITE_2050866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653854.1"
                     /db_xref="GeneID:11516028"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="JGIDB:Thite2_2050866"
                     /translation="MAARYLLLGVVTAGCVTATSVTCSASAPLSCHNTTSYDTCCLNY
                     PGGHLLQTQFWDTNPATGPSDSWTIHGLWLILSPGDGTYDSSCDPSRAYTNITQILQA
                     AAPSTLQYMQTYWKDINGNDESFWEHEWGKHGTCISTLNPSCYINYQPTQEAVDFFDR
                     TVSMFQSLPSYSWLSAAGIVPSTTTTYTLSAIQSALTSKFGYAVTINCNSNNELNELW
                     YHYNVQGSVQSGTFEPTSPVGSGSTCPSTGIKYLPKPGGTTVTTATTMTTATASTPVS
                     SASPTTTAPGGALSGKGYLNVITGGAQKGCIISSGTWYTTGTCATFTATPSGSGGFTL
                     TSSKGKCAISSSNALTCSSSVTSPTVFTYDGTYVDYAGSSAFYAASVPSGTTQAAVYT
                     TPNTVSLKLTWQAI"
     gene            complement(<454657..>455647)
                     /locus_tag="THITE_2051711"
                     /db_xref="GeneID:11516029"
     mRNA            complement(join(<454657..455138,455269..>455647))
                     /locus_tag="THITE_2051711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653807.1"
                     /db_xref="GeneID:11516029"
     CDS             complement(join(454657..455138,455269..455647))
                     /locus_tag="THITE_2051711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653855.1"
                     /db_xref="GeneID:11516029"
                     /db_xref="JGIDB:Thite2_2051711"
                     /translation="MFGRAKRPADIESGLKDLSSPEVLDFDDDSWVIDHHRNNLIEKI
                     SKPGNTWYDALLGDWRRKKSGRIRSSSNNEPQGEIEHSYIINLAELQRLRLRQLQRRL
                     VQHVVDLRYNAEEPAGWADDLRDYVQALRDHDYMCQHIWQPNDPFYVTGERYVERMML
                     QSAMRGMEHDVDPLRWAKSRRAWTTASDKPVPIGGTRDGNYWEAWFAGFRRRLGVAAV
                     GAAFLIAPMWLMVLRRTLYTALVSTTVFVAVFGLLMALWLEKLTEVMSATAAYAAVLV
                     VFVGLTTDSG"
     gene            <456138..>456703
                     /locus_tag="THITE_160849"
                     /db_xref="GeneID:11516030"
     mRNA            join(<456138..456527,456686..>456703)
                     /locus_tag="THITE_160849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653808.1"
                     /db_xref="GeneID:11516030"
     CDS             join(456138..456527,456686..456703)
                     /locus_tag="THITE_160849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653856.1"
                     /db_xref="GeneID:11516030"
                     /db_xref="JGIDB:Thite2_160849"
                     /translation="MAPLRLNATISDRRITIIFSHKASAINYDKYLQSLDDSFYEKHN
                     CELAKSGDRISLDLPADITAETNNRFKDVTLVFADAEAALTWERKMILWRERLPQANK
                     RRLSRAFAVELFSGELARARPQADLEFLTVSGQ"
     gene            complement(<463125..>463397)
                     /locus_tag="THITE_2051073"
                     /db_xref="GeneID:11516031"
     mRNA            complement(<463125..>463397)
                     /locus_tag="THITE_2051073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653809.1"
                     /db_xref="GeneID:11516031"
     CDS             complement(463125..>463397)
                     /locus_tag="THITE_2051073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653857.1"
                     /db_xref="GeneID:11516031"
                     /db_xref="JGIDB:Thite2_2051073"
                     /translation="IYAYIDDIIIVNKNIEEYLKYIKIVLDILDKVYVYISIEKSFVA
                     YLLVRLLSYIVNGKGVAKIDDRIAIFKKLKFPDTLKTLEQYFSIAR"
     gene            <466152..>475118
                     /locus_tag="THITE_2089010"
                     /db_xref="GeneID:11516032"
     mRNA            join(<466152..466313,475020..>475118)
                     /locus_tag="THITE_2089010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653810.1"
                     /db_xref="GeneID:11516032"
     CDS             join(466152..466313,475020..475118)
                     /locus_tag="THITE_2089010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653858.1"
                     /db_xref="GeneID:11516032"
                     /db_xref="JGIDB:Thite2_2089010"
                     /translation="MPRSHPNPRDPPRHPAQPSEHASAPGTTLGPTTSPYIRHPAQPS
                     QPQGTTQVICDPPRYLAQPSERASAPSTTLGPTTSPYIRHPA"
     gene            <482531..>482797
                     /locus_tag="THITE_53229"
                     /db_xref="GeneID:11516033"
     mRNA            <482531..>482797
                     /locus_tag="THITE_53229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653811.1"
                     /db_xref="GeneID:11516033"
     CDS             <482531..482797
                     /locus_tag="THITE_53229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653859.1"
                     /db_xref="GeneID:11516033"
                     /db_xref="JGIDB:Thite2_53229"
                     /translation="PRILNYFPQYKPNLVGDQYKDFYYIKLILSYIYRNPNKLKTIDN
                     IVFKKYSEAYIYCLNIYKHPNNYYNKVVVPNLDKEFKEGLNKEL"
     gene            complement(491687..492894)
                     /locus_tag="THITE_2116407"
                     /db_xref="GeneID:11516034"
     mRNA            complement(join(491687..492355,492421..492894))
                     /locus_tag="THITE_2116407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653812.1"
                     /db_xref="GeneID:11516034"
     CDS             complement(join(491843..492355,492421..492810))
                     /locus_tag="THITE_2116407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653860.1"
                     /db_xref="GeneID:11516034"
                     /db_xref="JGIDB:Thite2_2116407"
                     /translation="MPTSQPPPSSGAVRLRAALLRPVQGIASHVVRALTSAAYPIRGI
                     WYFLRHPEFYPLFVGRLLPLSIISFLVYFLLFTFTFLPQFLFLLIFQGRAGALINTTV
                     LVLGEGLVIIQGLFEGFFVDECRVDIFDATLINHELIDLIVPHRVLFLEAPNAVRMLG
                     KPTSRAEYQPWSLVQIIELIVFLPLNLVPFVGTPAFIMITGSRLGKLSHHRWFKLRGL
                     DKKQIKRELKARRWEYLWFGTVAMILELVPILSFFFLLTTAAGAAMWVAKMEGNARIR
                     VGRPISHEDRVYDEEDGPVYEDQV"
     gene            <501959..>503910
                     /locus_tag="THITE_2089013"
                     /db_xref="GeneID:11516035"
     mRNA            join(<501959..502010,502065..503546,503627..503790,
                     503866..>503910)
                     /locus_tag="THITE_2089013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653813.1"
                     /db_xref="GeneID:11516035"
     CDS             join(501959..502010,502065..503546,503627..503790,
                     503866..503910)
                     /locus_tag="THITE_2089013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653861.1"
                     /db_xref="GeneID:11516035"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2089013"
                     /translation="MAHTVANKTEFDFIVVGGGTAGCVVAGRLAENPKVNILVIEAGI
                     SNPGDVDAITTPARAFELRDSKHDWAYKTTMIDRPEYTRVEKPNTRGKVLGGSSCLNY
                     YTWIPGSAATYNDWAEFGGDEWTWDKCREYLYKPATYHDDQGLYRPELEYIGQGGPIP
                     VSHSDLVPDIQDFRVALTSAWASKGHPLTDDVHNGTMRGLWKSVNSIYNGKRSSSWLY
                     IVGKPNVAVMAKTHSKRLLIDGGKAVGVEVIGPDGKDYSFRAKHEVIVASGVFESPKL
                     LLLSGIGPKASLAPFGISPVVDSPHVGQNLLDHPILAHVFRLNDGYGLDQHLLRAGLE
                     RDAAVSAYRWKNKGPLTSGLLELVGLPRIDERLNRIPEYVAAKQANGGRDPFGPAGQP
                     HFEIDFVPMFADAFQWHIPTPRQGDYLTVIVDLVRPLSRSGTVTLNSANPLDQPKVNI
                     NFFENELDIVALREGIRWVDDILMTGDGMKDIIGEDYPWPMPRHSDEAMNKMILERSQ
                     TGFHPCGSARMGKDINQGVVDSQLRVHGVQNLRVIDASVIPVIPDCRIQMSVYMIGER
                     GADFIKAAHPDLYA"
     gene            <504544..>509540
                     /locus_tag="THITE_125601"
                     /db_xref="GeneID:11515962"
     mRNA            join(<504544..504723,504977..505062,507503..507539,
                     507593..507625,507688..507799,507900..508066,
                     508129..508165,508233..509053,509148..>509540)
                     /locus_tag="THITE_125601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653814.1"
                     /db_xref="GeneID:11515962"
     CDS             join(504544..504723,504977..505062,507503..507539,
                     507593..507625,507688..507799,507900..508066,
                     508129..508165,508233..509053,509148..509540)
                     /locus_tag="THITE_125601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653862.1"
                     /db_xref="GeneID:11515962"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_125601"
                     /translation="MLLVLLLPGVAVAAVVAAGVFQAKRSSAVRQWPSWPQWKKGMAT
                     WRARGRAKKASNQSPRIVGYLALDDLQPGVQGVDVERRRPASLGLPPPQLHPQTRHLS
                     NQPQHLTGVKLVVIVASVTMAVFLMLLDTSIVGTATPYITDEFHALQDIGWYAAAYQV
                     ASAPLQLLTGKIYQKFPLKWTFLGFFALFELGSVLCGAAQSSTMLVVGRAVAGMGSSG
                     LFNGAMVILVASVPLHRRPPIMGMFMGISQLGVVCGPLIGGALTEYVSWRWCFYINLP
                     VGGAFALFLMILHVPEQAPKPSFVSALPTLFRDLDLIGFSLMSPAAIMLLLALEYGSG
                     TYPWSSSVVIGLFCGAGATCIVWLVWNWRRGDKALVPVSMARRRVVWSGAITQALMLA
                     PMFMISYFLPIYFQAVKGVSPSKSGAYVLPNIMGQLLTAFLSGFMVQRTGYILPYVMF
                     ACATTAVGTGLLALLSPSTPTGEWVGFQLISGLGRGFGLQMCLLAVQTVLKPAEVPLA
                     ISLLMFTQFLTSSVFLVVGNAIFDVVLRAQLAAHAPAVDAQAVIDAGTTGFRAGVVGP
                     ADLAGVVLAYANSCKPVFALAAAAPAAAFFVAPFLGMVDVRKGKKAAPPKGDEKA"
     gene            510523..511291
                     /locus_tag="THITE_2116411"
                     /db_xref="GeneID:11515963"
     mRNA            510523..511291
                     /locus_tag="THITE_2116411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653815.1"
                     /db_xref="GeneID:11515963"
     CDS             510670..511110
                     /locus_tag="THITE_2116411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653863.1"
                     /db_xref="GeneID:11515963"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Thite2_2116411"
                     /translation="MEVACQCGTVRFTTPTPAPLAVYHCQCTECRKQSASAFGTSAVL
                     PARGLFPLPAELATKLAVWTRPSNAGRSVDGYFCHVCGVRVMHRIREADGAERDVVSV
                     KGGLVKGLDWKSGVHIFTRSAVVPVPEGAEAWEAEPPAMVGRRG"
     gene            511482..512992
                     /locus_tag="THITE_2116415"
                     /db_xref="GeneID:11515964"
     mRNA            join(511482..512024,512079..512838,512899..512992)
                     /locus_tag="THITE_2116415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653816.1"
                     /db_xref="GeneID:11515964"
     CDS             join(511672..512024,512079..512817)
                     /locus_tag="THITE_2116415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653864.1"
                     /db_xref="GeneID:11515964"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Thite2_2116415"
                     /translation="MGSAPVPAGVPPSGLSSDVLLVIVPFPRDEKWTAHLQARHPGLQ
                     VRWVTRQFMSPPAPLPEETLDGVSLLLTVWPPPMEPLPKVRFVQLVSAGADRWITHEL
                     YQKPDVIFCTMNGVHAPQIAEWVIGSWLMMRHHFLDYAEQQKREKFARLNDVTAEDSP
                     GLRMGVLGYGAIGRQCARLAQALGMEVYAYTRSEKSTPESRKDDSYCVPGTGDPDGVI
                     PARWFHGESREAVNEFLAQDLDILVLSLPLTESTEYILGREQFEILSKRKTFVSNIAR
                     GKHIDSDALLDALREGKIRGAALDVTDPEPLPDNHPLFTAPNVFITPHVSWQTPQLFA
                     RIQAVVEKNLENLSEGKPLINVINRQHHY"
     gene            complement(<516055..521520)
                     /locus_tag="THITE_2095917"
                     /db_xref="GeneID:11515965"
     mRNA            complement(join(<516055..516243,516343..516516,
                     518785..520897,520968..521520))
                     /locus_tag="THITE_2095917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653817.1"
                     /db_xref="GeneID:11515965"
     CDS             complement(join(516055..516243,516343..516516,
                     518785..520897,520968..521419))
                     /locus_tag="THITE_2095917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653865.1"
                     /db_xref="GeneID:11515965"
                     /db_xref="JGIDB:Thite2_2095917"
                     /translation="MDPLSALSIAAAGVQFVDFATRLLSDTVEMHKSATGQTDRAALL
                     KRVASDLDFLTSRIQEKRSQFLDTAPAGSPDAIFLEACKQCNEISKELAGVLQTLAVE
                     ELPQRRRRSAKALGAAIRGILSDRKITELTTKLETVQRQMQMAALISLWEKAQEHGSA
                     LSLASQQQADMVAALDRVDATTRDTANYLRDLASEDSTRLQRQDRQQLIRAMWSAKWS
                     PRARHLDAGPVDTTFTELARVHIVDSLRFPSLEDREDAIPRAHARTFEWLFQPHADRG
                     PDPAPSWSDFPAWLEADTREIYWITGKPGSGKSTLMKFVTRHPRLREHLSVWAGSQQL
                     LAASFYFWNAGTELQKSHEGLLRTILVQCMTQRPDLIPRVCERRWACLEMFGLGAASD
                     LPPWEWDELMECLKGVASQAGREYRLVLFIDGLDEFAGDHTKLVNLVNEVSLWDGVKA
                     CVSSRPWNVFNDAFHKKPSLVTQNLTKNDIDKYVKDNFESLPAFNELRGMQPTVAARL
                     LQDIASRAQGVFLWVAVVVRALVSRLTEGDQLAELQATLDELPQDVEELFEAIRRQIN
                     ARHRAHLARYILLKLASSASGDNVKLPAVTMLLADEDEEGPIHQGLSPMDEAKEASMI
                     AVMRRRLYSRTMGLLEIGPRGEVQFFHRTVLEWVTRNENLAALTSDASADFDPHLELL
                     KALTTEFTSLKLGWMYERLGFVFPGPPTMGIEASVFWHLFEHRLLHAALVIRNPRNDA
                     RVVRTLQKLVDYAYKTARLNRYDESQVLQMLLGSPPNQPRRVNDQLDMVRLAARSAVF
                     PFVAAKIDKFVLRNHEDLFALLLNDIVFGYTQFSDTRWRFRNVRLREAGYILFQEDLE
                     GKCDSSSSSGQSTSKHKGSSTSSKQPCVCKGSPSCKDPRHCKSTTGSSAELQCSACRA
                     AGCPSASTSTYPPGNSGSYGAGSGTDTDYDTGYATGLSAGYDAGYAAGYGAVYGLDNY
                     SAY"
     gene            <523229..>525637
                     /locus_tag="THITE_2050481"
                     /db_xref="GeneID:11515966"
     mRNA            <523229..>525637
                     /locus_tag="THITE_2050481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653818.1"
                     /db_xref="GeneID:11515966"
     CDS             523229..525637
                     /locus_tag="THITE_2050481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653866.1"
                     /db_xref="GeneID:11515966"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR002192"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="JGIDB:Thite2_2050481"
                     /translation="MSASNEDANPLVCDFKHLLRSDVGLVGGKNSSLGEMLSALSSKG
                     IAVPPGFATTSHAYWHYVDANGIRDKIGPLISEWQAGHASLAETGQAVRRLFLRGSWP
                     ADAAEAITTAYQKLSAKTGVENLRVAVRSSATAEDLPDASFAGQLESYLNIWGKDRLL
                     DACRRCYASLFTDRAISYRQAKGFDHMSIALSVGVQRMVRSDAWGSGVMFSIDTESGF
                     DKIVLINAAWGLGENIVQGTVNPDEYQVFKPLLDDPSLVPIIQKKRGEKAMKMILGRS
                     HHHHPHAPTRNVPTSKAERAAFVLANDEILQLARWACAIEKHYGCAMDMEWAKDGTTG
                     ELFIVQARPETVHSRQDSAVFKTYTVKNKSRVLATGLSIGDAAVSGQLCLIEDVKDIG
                     KFVDGSILVTVSTDPDWVPIMKRAAAIITDHGGRTSHAAIVSRELGVPAVVGTGDATY
                     VLHTGQDVTVSCAEGDVGFVYAGISDIVATTIDLKGLPAVRTNVMLNLANPSAAYRWW
                     RLPADGIGLARMEFVVTNAIRVHPMALVRFDRLQDQAAKAEIARLTAGYEHKPDYFVD
                     KLAHGLAALCATVYPKPAIIRMSDFKTNEYAGLVGGAEFEPAEENPMLGFRGASRYYS
                     PRYAEGFGLECRAIKLLREEMGFANAVVMIPFCRTVGEAEKVLRVMEQNGLKRGEKGL
                     KVYVMCEIPSNVILAERFTEHFDGFSIGSNDLTQLTLGVDRDSGELAELFDEQDEAVK
                     WMIAKVIEVARKKGCKIGICGQAPSDHPEFAKFLVQAGIDSISVSPDSFLAVKRHVVD
                     SEKA"
     gene            complement(<526114..>527194)
                     /locus_tag="THITE_2051934"
                     /db_xref="GeneID:11515967"
     mRNA            complement(join(<526114..526537,526615..526855,
                     526921..>527194))
                     /locus_tag="THITE_2051934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653819.1"
                     /db_xref="GeneID:11515967"
     CDS             complement(join(526114..526537,526615..526855,
                     526921..527194))
                     /locus_tag="THITE_2051934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653867.1"
                     /db_xref="GeneID:11515967"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="JGIDB:Thite2_2051934"
                     /translation="MPPAHTKACSRIAIVGVGQVGGAAAYALILSGVASELLLVDVKI
                     ELRDAQVRDLSDVAYGIGGGTRVRAATHSEAAQCDIVVITAGSKYFLGETSIQHMHRN
                     IGVMRSVMGSMTSFRPDAIILVVANPVDLLTTLVQELCRLPKFQVFGTGTFLDSVRLR
                     GLLAEKTGVRPSSIQLSVIGVHGDTQVAAWSSATINGVPIDQFLPPEQCNHADLANEC
                     KHISEDIFRAKGATPFGIGSVVASICTSILLDKGDVQPISHFQSEHRCCFSLPVVLGR
                     KGIMRTVQLPLSSDEKAHLARSAERLKETLERIKHH"
     gene            complement(<528399..>528773)
                     /locus_tag="THITE_2089022"
                     /db_xref="GeneID:11515968"
     mRNA            complement(<528399..>528773)
                     /locus_tag="THITE_2089022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653820.1"
                     /db_xref="GeneID:11515968"
     CDS             complement(528399..528773)
                     /locus_tag="THITE_2089022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653868.1"
                     /db_xref="GeneID:11515968"
                     /db_xref="JGIDB:Thite2_2089022"
                     /translation="MRHDLTASLPVAPRASRQWVPGSQEYIRQGTIAVKEEPELHYFS
                     QQRLGDINEDTCSGREENTPGLPSPVPEVGIDPSKSVVGCKRCLKNTLVNIVDLIDTR
                     RQANKSWYGSALKSSAPMPSKT"
     gene            <529186..>530671
                     /locus_tag="THITE_2144873"
                     /db_xref="GeneID:11515969"
     mRNA            join(<529186..529211,529792..529927,529991..>530671)
                     /locus_tag="THITE_2144873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653821.1"
                     /db_xref="GeneID:11515969"
     CDS             join(529186..529211,529792..529927,529991..530671)
                     /locus_tag="THITE_2144873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653869.1"
                     /db_xref="GeneID:11515969"
                     /db_xref="JGIDB:Thite2_2144873"
                     /translation="MEKIPQVLTSAAKKAASLSVEELWKLQTTIWDNFLYPANVKQIQ
                     SINSTLFAPNIQGRVDITRTFDGAELNTEYIFGLFADPTKLSLIGVPVSYNITKFAAT
                     DNIVSASTVFMFNATMFGKLIPITIDTFTTFDPETKQLTQYDATFKWMDFLFAELYAE
                     IGTLIHANSTDQVDAYLTNIMAQTLCEAHSAHCTGADQQYADATSCYNYLTTQVRLGQ
                     VYELGRNTLWCRLMHAEMLQYRPSVHCPHVGPSGGGMCVDDQTYAEKVLQNYFTNSPF
                     IPSL"
     gene            <532549..>533093
                     /locus_tag="THITE_2089025"
                     /db_xref="GeneID:11515970"
     mRNA            join(<532549..532813,532930..>533093)
                     /locus_tag="THITE_2089025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653822.1"
                     /db_xref="GeneID:11515970"
     CDS             join(532549..532813,532930..533093)
                     /locus_tag="THITE_2089025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653870.1"
                     /db_xref="GeneID:11515970"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Thite2_2089025"
                     /translation="MAIAHSGIKAPAAQHAAVVRWFEAALAPLGYTRAMEFLDGLVVG
                     FADSAGNIDWWVTSTAAAPPGVPAPESAAAAAAVLPTHTAFVAKDRASVDAFHKAAVA
                     AGGKCNGVPGVRPHSGPTYYAAFVLDPAGNNIEAVCTAAV"
     gene            complement(<538783..>538950)
                     /locus_tag="THITE_2036203"
                     /db_xref="GeneID:11515971"
     mRNA            complement(<538783..>538950)
                     /locus_tag="THITE_2036203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653823.1"
                     /db_xref="GeneID:11515971"
     CDS             complement(<538783..>538950)
                     /locus_tag="THITE_2036203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653871.1"
                     /db_xref="GeneID:11515971"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="JGIDB:Thite2_2036203"
                     /translation="LKKALYSLKQSLRLWYKYLSNILNKLSFKAILYNEGAFINYNYK
                     MILLCYIDDLII"
     gene            complement(<544711..>545078)
                     /locus_tag="THITE_2089027"
                     /db_xref="GeneID:11515972"
     mRNA            complement(join(<544711..544914,545010..>545078))
                     /locus_tag="THITE_2089027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653824.1"
                     /db_xref="GeneID:11515972"
     CDS             complement(join(544711..544914,545010..545078))
                     /locus_tag="THITE_2089027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653872.1"
                     /db_xref="GeneID:11515972"
                     /db_xref="JGIDB:Thite2_2089027"
                     /translation="MSPSNEAITNLAALEGYRAISPTILACHIASRIACYIACRIAYR
                     IAQILAHHIAYRIAYRIAYRLACRIAQILAYRLAYRIASHIAYYIA"
     gene            <548034..>548270
                     /locus_tag="THITE_2049628"
                     /db_xref="GeneID:11515973"
     mRNA            join(<548034..548088,548122..>548270)
                     /locus_tag="THITE_2049628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653825.1"
                     /db_xref="GeneID:11515973"
     CDS             join(<548034..548088,548122..548270)
                     /locus_tag="THITE_2049628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653873.1"
                     /db_xref="GeneID:11515973"
                     /db_xref="JGIDB:Thite2_2049628"
                     /translation="LGDYITIYLDNILIYLNKILYRLRGIGLNLDLKKYTFVVKEVKY
                     LRYIIEIEVYIRLNPKKIKAIYK"
     gene            complement(<557925..>558838)
                     /locus_tag="THITE_2089029"
                     /db_xref="GeneID:11515974"
     mRNA            complement(join(<557925..558254,558309..558375,
                     558432..558653,558720..>558838))
                     /locus_tag="THITE_2089029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653826.1"
                     /db_xref="GeneID:11515974"
     CDS             complement(join(557925..558254,558309..558375,
                     558432..558653,558720..558838))
                     /locus_tag="THITE_2089029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653874.1"
                     /db_xref="GeneID:11515974"
                     /db_xref="JGIDB:Thite2_2089029"
                     /translation="MPSSARLAALEKARAAKAAKNKPPPLPATPTKAGAGASKKTPAT
                     PKTPSKRAAPPSSSSSSSEDEEEEGALREQPCLGCLKSAMRGKSSGECREAPGKAARC
                     ARCARGKKCRSIVLPAAKHFLALMQGRQEPKANLDQKTLRATLRALLAMECEDADAED
                     DDDDDDERAPAPAKGKGKGKAKAAAPTKKSKKAKKAKKEESEEEDEDEDESEEEAAPG
                     FDPEALARGVAAAVLAAMTPKKKKGGK"
     gene            561692..563710
                     /locus_tag="THITE_2116429"
                     /db_xref="GeneID:11515975"
     mRNA            join(561692..562288,562369..562683,562754..563710)
                     /locus_tag="THITE_2116429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653827.1"
                     /db_xref="GeneID:11515975"
     CDS             join(561964..562288,562369..562683,562754..563577)
                     /locus_tag="THITE_2116429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653875.1"
                     /db_xref="GeneID:11515975"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Thite2_2116429"
                     /translation="MKCRSVQKLGLLASLGVGAAVATPDGVVQLAIQRRNVADSRPIL
                     PRASSSPVLEQLQNDRSEGAYMAEVKVGTPPQTLTLQLDTGSSDTWVVSSGAEICEQG
                     QCDHGSFDRSQSNSYTVLAKDAFSTQYADKTSAQGDYFNDVFSIGSVTLQNLTMGIGL
                     ETDIPFGLVGVGYPSNEAGVAEGTIDAYPNLPLQLVKEGFTNTVAFSMWLNDLDASAG
                     NILFGGIDTAKFEGPLTRVKLYPTHRQSAVDEFAVALTSVTAVSKSGSDKLGSASFPA
                     PVILDSGTTVSFLPEDLVAEIYREANVITDDSGTGAVPCSYANAQGYFSFGFGGPGGA
                     VVNVSMSELVLGVAGTITGGSHKGQDACTFGIQAVSSNDTFILGDTFLRSAFVVYDLV
                     NNEAALAQTKFNVSDSNVIAFASLSATVPSSTPAPSQDAISQGVVTATPASYAAAAAF
                     TASSGAAGPLGPGGGVAGVALATLVSFGVGVFSFFVL"
     gene            563711..564434
                     /locus_tag="THITE_2116430"
                     /db_xref="GeneID:11515976"
     mRNA            563711..564434
                     /locus_tag="THITE_2116430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653828.1"
                     /db_xref="GeneID:11515976"
     CDS             563860..564045
                     /locus_tag="THITE_2116430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653876.1"
                     /db_xref="GeneID:11515976"
                     /db_xref="JGIDB:Thite2_2116430"
                     /translation="MLPKPRIPSPRKKESTKPREQMPERIEDPQLHTVSQVPVVNPAS
                     KVPTYVGDGGRCPHSGS"
     gene            complement(<564571..>565746)
                     /locus_tag="THITE_2129426"
                     /db_xref="GeneID:11515977"
     mRNA            complement(<564571..>565746)
                     /locus_tag="THITE_2129426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653829.1"
                     /db_xref="GeneID:11515977"
     CDS             complement(564571..565746)
                     /locus_tag="THITE_2129426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653877.1"
                     /db_xref="GeneID:11515977"
                     /db_xref="JGIDB:Thite2_2129426"
                     /translation="MAHVGSIPPASTQDTPSPEARQVMNAKADEQLLRFILLVHILKT
                     AGLTTGEVNACLMKYIETLSPEDLESLTSKLPHVKEDLGGDWTANAEAIARLSHNRSM
                     PVQVVALYARKAKVHLLDDPAWAHGANGWLRALLHALARDAAAKQQDSAPAWTSNPDC
                     ALWLPIMARVRLALSEGEWVARLSKAVRQAYHIGWLGVFGVSPDSEEGLAVLNRATPT
                     PINRSAKTTTFPERPLVVRMAIDKRLRNPKPTITTPPPTSTPTPTANSTATTSKRTTP
                     LPPPILTPSFFAAQTHNKAYLSAIKALPTLADRTAFHLCIQAGLPKIPRGAGNKSQPP
                     RQEGKKNTEEAAAKKASDTAAGKKKTFTSGKKNLGLGKKGAAAGKKGAAGKKGEAGK"
     gene            <566772..>568446
                     /locus_tag="THITE_2050253"
                     /db_xref="GeneID:11515978"
     mRNA            join(<566772..566875,566977..567310,567371..567810,
                     567877..568117,568222..>568446)
                     /locus_tag="THITE_2050253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653830.1"
                     /db_xref="GeneID:11515978"
     CDS             join(566772..566875,566977..567310,567371..567810,
                     567877..568117,568222..568446)
                     /locus_tag="THITE_2050253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653878.1"
                     /db_xref="GeneID:11515978"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="JGIDB:Thite2_2050253"
                     /translation="MANPVRILVLGSGMVAPPCVEYLSRNPRNEITVGVRSGKGLQVQ
                     YPRTTALALDVSNAADLEAQVAAHDLVISLVPYAHHPAVIRAAIKGKTNVVTTSYVSP
                     AMRALEDDVKKAGIIVLNEVGVDPGVDHLYAIKTIDEVHEKGGKVREFYSFCGGLPAP
                     ECADNPLRFKFSWSPKGAIMSQRNSASFLQQGKQVDIPAAELMSAAKPYHVVDGYSFV
                     AYPNRNSVPFRDSYGIPEAETVVRGSLRYRGNPEFMMALAGLGWLDDEEEAWLLSGIT
                     WAEIQQRLISAASSDKDALVARIKEVYPFPSEEEAHRIIAGMAELGLFSHAPADIQGG
                     NVLDTLCHHLARLLRFKPGERDLVMLQHKFVVEWRDGSKQTMTSTLELLGNPDGFSAM
                     ARSVGATCGVAAQLVLDRHPAFTEPGVHAPYTREMCEPIREGVAREGVVLVEKVL"
     gene            complement(568376..571280)
                     /locus_tag="THITE_2116431"
                     /db_xref="GeneID:11515979"
     mRNA            complement(join(568376..568974,569063..570423,
                     570482..570632,570693..571280))
                     /locus_tag="THITE_2116431"
                     /product="glycoside hydrolase family 28 protein"
                     /transcript_id="XM_003653831.1"
                     /db_xref="GeneID:11515979"
     CDS             complement(join(568612..568974,569063..570423,
                     570482..570632,570693..571121))
                     /locus_tag="THITE_2116431"
                     /note="CAZy_ID 269949; carbohydrate esterase family 8;
                     CAZy_ID 269949. carbohydrate esterase family 8"
                     /codon_start=1
                     /product="glycoside hydrolase family 28 protein"
                     /protein_id="XP_003653879.1"
                     /db_xref="GeneID:11515979"
                     /db_xref="InterPro:IPR000070"
                     /db_xref="InterPro:IPR000743"
                     /db_xref="JGIDB:Thite2_2116431"
                     /translation="MLGFLCACIALGASFSGSLAASHKPGACSPPKTCSGPWARVAPA
                     PGAVVVDNSASPYPGSYRTVQEGVNALSTTTKTPQNLFIFPGTYVEQVYIPPLASNLT
                     VQGYTCNSKSYEGNQATITYNLALINTTSDDKTATLRQWNPNTKVYNLNIVNTFGHIP
                     QNGQNLALSAEATGQGYYGCQLIGYQDTVLAETGLQLYAKSLIVGAVDFIFGQTALAW
                     FEGVDIRTIATGCVTASGRDSATNPSWYVISRSSVAGINDTIPAGINYLGRPWRSFAR
                     VVFQETYLGNVIAADGWKEWSTSTPNTANVTFAEYNNYGPGSVQHEGPRASFSEQLTA
                     RIPIRSILGNNFQDEWWVDTKYLDPSDLRDDDAVSTSATASSTTSTAASTSTSSPTAS
                     TTSTTAVATTTVTSLTTSSSASPTTSSNPCVCTDYSQISAAVASCTDIVLSNIAAPGG
                     SAIDLSKLKAGATVTFDGLTTFGFTNSSSFNPITIGGQGITVTANPGAIIDGNGQAYW
                     DGLGSNGGVPKPDHFIVVSKVTGGSVIKNLYIRNWPVHLFSISGCADLVFQDLVLNNT
                     AGDAPNSRSNGLPAAHNSDGFDVSSSSNIVIRRSVVHNQDDCVAITSGNNMTVSDLDC
                     YGGHGLSIGSVGLKSNNNVTNILFTNSTVTASENGCRIKTNYNATGFVANITYANIAL
                     RGISAYGIDVQQDYLNGGPTGVPSSGVLIQHVLFRNVTGTADPSARDYYVLCGDGSCE
                     DFRFEDVSVTGGGVASSCNFPPGGCPS"
     gene            576155..576410
                     /locus_tag="THITE_2116432"
                     /db_xref="GeneID:11515980"
     mRNA            576155..576410
                     /locus_tag="THITE_2116432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653832.1"
                     /db_xref="GeneID:11515980"
     CDS             576160..576348
                     /locus_tag="THITE_2116432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653880.1"
                     /db_xref="GeneID:11515980"
                     /db_xref="JGIDB:Thite2_2116432"
                     /translation="MPRSHPNPRDPPRHPAQPSERASAPGTTLGPTTSPCIRHPAQPG
                     QPQGTTQVICVRHQGARQ"
     gene            <576801..>578462
                     /locus_tag="THITE_2089034"
                     /db_xref="GeneID:11515981"
     mRNA            <576801..>578462
                     /locus_tag="THITE_2089034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653833.1"
                     /db_xref="GeneID:11515981"
     CDS             576801..578462
                     /locus_tag="THITE_2089034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653881.1"
                     /db_xref="GeneID:11515981"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="JGIDB:Thite2_2089034"
                     /translation="MAQTRARAALEQSPAPSQSQALSTDPTSSYTLSAPPAPDATMGE
                     SSQHAQIDLNGSRAAPIDPLLSTQERDLAEEERRLSAEIALERRRQAILQLRAQHAQL
                     LRQNAQLAHVAEGATSSNSDPLAAQTANTTVPAASVAAPAPAPAPAPAPAPVAAPEAA
                     PVAAAPAPAPVAAPVAASVAIDAPPPAANPEFSAPIAPSPILPSAAGAPLWRAAGLNH
                     PTYSGKDASSLRAFLYDCRTNFQLMGYSLDGSDCVAYAASCLRGPPKNAWVKYVQEQE
                     ADPNFRLSAITWGEFVAFLQNELSDPDSRAFSAASELERLAQREDETVPEFVERFTSV
                     IADMPSKWDEPTRIVTLLPKFRPEISFILNCSPQLPATFQQLVSFARRIEHSQRIAGT
                     SRYRPRSSNNAPTAPQPPRPVNVPPAPFQRPVRCFTCGREGHRYANCPENRPPAQPAP
                     PSAPPVQPVPPAAAPTQLPPAQPAPQQPAPDAATAPAAAPKSRPVCYTCNEVGHISTF
                     CPKAICRRCGRTGHTAVRCPEPLNPNAQNNPNLAPLGRDRSANAA"
     gene            complement(582981..584454)
                     /locus_tag="THITE_2116438"
                     /db_xref="GeneID:11515982"
     mRNA            complement(join(582981..583582,583636..584454))
                     /locus_tag="THITE_2116438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653834.1"
                     /db_xref="GeneID:11515982"
     CDS             complement(join(583517..583582,583636..583887))
                     /locus_tag="THITE_2116438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653882.1"
                     /db_xref="GeneID:11515982"
                     /db_xref="JGIDB:Thite2_2116438"
                     /translation="MSKLFSSLGFRPINAAPEERPAGEAESPADDAPAAPAERASGAA
                     AAPANDDEKEEKKEEDEDEEMEESEPPTPRKGGFGRKRRASSDLDSTPKKRVPAGAAR
                     IIP"
     gene            587984..588681
                     /locus_tag="THITE_2116441"
                     /db_xref="GeneID:11515983"
     mRNA            join(587984..588339,588392..588681)
                     /locus_tag="THITE_2116441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653835.1"
                     /db_xref="GeneID:11515983"
     CDS             join(588238..588339,588392..588661)
                     /locus_tag="THITE_2116441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653883.1"
                     /db_xref="GeneID:11515983"
                     /db_xref="JGIDB:Thite2_2116441"
                     /translation="MESIGGIISGPDVVDAARELPKSTKHIQNLLRFSIERDVVLQPN
                     PKKKGGYRSINWKRPTNIEALLMHVTGVEPEVECNYCNKNQGPFMNCIVSRDNTGNGA
                     CAACHYNSGSNRCSFFLGEQS"
     gene            589674..590910
                     /locus_tag="THITE_2116443"
                     /db_xref="GeneID:11515984"
     mRNA            join(589674..589757,589825..590033,590092..590910)
                     /locus_tag="THITE_2116443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653836.1"
                     /db_xref="GeneID:11515984"
     CDS             join(589726..589757,589825..590033,590092..590693)
                     /locus_tag="THITE_2116443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653884.1"
                     /db_xref="GeneID:11515984"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Thite2_2116443"
                     /translation="MENQFRSSDEKLLRTGLFSDVTVKCGDRTWQLHKNILCSRCVWF
                     EKALTGSFQEAKSGMVEISNFAPEAIDWVVRYIYTGVCDIPSLKSSAPPTKTNFVTCY
                     EVYTVADYFALAPLAKIALDTLAAEFDARLGPIQLQYESAAEWLPELCEAIRLVYADT
                     PLPDANLTPIRRAFVSFVHTARFYFLQDAEFNRFLDEEAPGLALDLFRAMRATGDFVA
                     HLPDACCSFCKMKPTTRGDKAYYTHLAPDTLRLTACCSTCAAKKDLGSGMANWAGKRG
                     PAGA"
     gene            complement(<591424..>592145)
                     /locus_tag="THITE_53841"
                     /db_xref="GeneID:11515985"
     mRNA            complement(join(<591424..591801,591891..>592145))
                     /locus_tag="THITE_53841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653837.1"
                     /db_xref="GeneID:11515985"
     CDS             complement(join(591424..591801,591891..592145))
                     /locus_tag="THITE_53841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653885.1"
                     /db_xref="GeneID:11515985"
                     /db_xref="JGIDB:Thite2_53841"
                     /translation="MTEDKGGNKRSDGNEPHQHQAGSTTHREEDQWKYRPPYRIHEPG
                     DQFEVKWRGKCHCGAVQYELSREKPLASKYCHCTTCQRMHGWAAIFHKTDVNFTRGHH
                     DLGWYDPTARSTTHHLPCKVQCAYCRTPVMDEGRNMILLFPTLIEGINTPAGRAAFQP
                     QCHMFYPQRVVDIRDGLPKFKGLSDQSPLVDEETGEEIPGSGPKEEEEGK"
     gene            <593164..>594659
                     /locus_tag="THITE_53698"
                     /db_xref="GeneID:11515986"
     mRNA            join(<593164..593355,593417..593540,593636..593979,
                     594297..>594659)
                     /locus_tag="THITE_53698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653838.1"
                     /db_xref="GeneID:11515986"
     CDS             join(593164..593355,593417..593540,593636..593979,
                     594297..594659)
                     /locus_tag="THITE_53698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653886.1"
                     /db_xref="GeneID:11515986"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="JGIDB:Thite2_53698"
                     /translation="MAVPFDLVAAAEKLLAQAKMLAAVRDSSEVANEEALRRSIAETA
                     RKIALETAPPLDIVKSDWFVLADVAAWNIFIDWKAFDHIPLEGHISIADLARALDAQE
                     SLVARISAQLLSTGKLLPGPTPHTLRHSRISPLFRTAHPVSALAAVAVGNGMKPCAHW
                     PAYFAAHGRREPPGLAPTPFAFAWGRPDLPPWEVKALHPAYAALFTRCMRAREIVAGD
                     TACVLGWLRRLTFILLGALVYILRRILLDYPDQLAVGILRRLAEALPADNPKARVLVI
                     EARRLDVPTPENCNVDLFMLNLGGKLRDEAMLKDLAAAAGLSVMGYHASAREGDPTFV
                     MECARA"
     gene            596556..600255
                     /locus_tag="THITE_2116446"
                     /db_xref="GeneID:11515987"
     mRNA            join(596556..597245,597455..599390,599481..600255)
                     /locus_tag="THITE_2116446"
                     /product="glycosyltransferase family 20 protein"
                     /transcript_id="XM_003653839.1"
                     /db_xref="GeneID:11515987"
     CDS             join(596691..597245,597455..599390,599481..600151)
                     /locus_tag="THITE_2116446"
                     /note="CAZy_ID 269805"
                     /codon_start=1
                     /product="glycosyltransferase family 20 protein"
                     /protein_id="XP_003653887.1"
                     /db_xref="GeneID:11515987"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="JGIDB:Thite2_2116446"
                     /translation="MDPNADAPNSVHQVEAASTSASGTSEVRPGVVNRTESSLPPNLR
                     PSVIDVPVTPGITREAYEVELSNKSEGAAGTERFEEGYFSRHDVEHALAASPIPGSTN
                     REGQSFLNKIATGAQEGTDYLRRVSVAAMGESGPNPPSSGSSVPQASMSDIRAISPDL
                     ALTGNIISATFNIPHSLTYRKGADWELNPRRGQSALFDAFSYLSSDEAPWNHTVVAWT
                     GEIETPSELSPPNTPPFTTVHLSSLNALSKPIPLDPSKAPPTPPAADGLWIPKEDMQR
                     LERQLSHNKKIKTIPVWLADDADGREDGIKLKDQARWRRYAEHDLYTLFHYKLPEPSD
                     GRRERVHWADYYRMNQKFANKILEVYKPGDVVMVHDYALMLLPSMLRQRAPHMYIAFY
                     LHSPFPSSEYFRCLPRRKEVLEGVLGANLIGFQSYSYSRHFASCCTRILGFPSDGSGV
                     DAYGSRVEVGVFPIGIDATKVARLAWTDSVNEKFAALKTMYANKKIIAGRDRLDSVRG
                     VAQKLMAFERFLQLYPEWRDKVVLIQVTSPTSIEEEKEDPENKISSRVNELVMKINGA
                     YGSIGFSPVLHFPQYISQDEYFALLRAADIGLITSVRDGMNTTSLEYVICQRQSAGPL
                     ILSEFSGTAGSLKDAIHINPWDLTGVARQINNALTMPQEKREAMQQSLLAHVTSKNVQ
                     YWIAGFLRRLVAVLGSRKNVAATPLLDRSALLRKYRAAKKRLFMFDYDGTLTPIVREP
                     SAAIPSERVITSLKALAADRDNAVWIISGRDQDFLMQHLGHITELGFSAEHGSFMRHP
                     GATEWENLADKLDMGWQKEVLEVFQKYTDKVPGSFIEQKRCALTWHYRLADPEQGVHM
                     SHQCRKELETTVGRKWDVEVMTGKANLEVRPTFINKGEIAKRLVTTYNAELRALAASS
                     PGEGGDGTKDGNNDSSSPNKLGFVLCMGDDFTDEDMFRALNGLSQPAAGQGSGPAAAA
                     AAAAGAAEVEADDCFTVTVGASTKVTLARWHLLDPEDVIECVALLAGVGGSGTGTTSG
                     GVLSMGEVNLAALSAVEDHIPAH"
     gene            complement(600770..602687)
                     /locus_tag="THITE_2116448"
                     /db_xref="GeneID:11515988"
     mRNA            complement(join(600770..601321,601439..602087,
                     602166..602687))
                     /locus_tag="THITE_2116448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653840.1"
                     /db_xref="GeneID:11515988"
     CDS             complement(join(600890..601321,601439..602087,
                     602166..602536))
                     /locus_tag="THITE_2116448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653888.1"
                     /db_xref="GeneID:11515988"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2116448"
                     /translation="MRLPARILHELGLATMWRAPRDVKLLCAQRFVRLFAYGGSTLIL
                     ASYLSAVGIADDWIGLFMTLTLAGDVVISFLLTLFADAVGRRAVLALGAVLMAASGVV
                     FALSGNYWVLLAAAVVGVISPSGNEIGPFRAVEESTVAHLTPRELLPDVFAWYALLGS
                     AGTALGQLVCGWAMTSLQALHGWEFVASCRVVFFAYSAVGVVKLSLTLALSRDVEAAK
                     KDEARQPQPQQAQPPQNDETRPLLADAAAPQQREQPPAQKKQGLFASLDKDLWSLVIR
                     LFILFGVDSFASGLASPTWMTYYFRRKFSLPEGQLGSIFFVTSTIAAASVLVASSIAK
                     RIGNVKTMVFTHLPSSLTLTLLPLPSHLPLALTLLILRACTQNMDVAPRTAFLAAALP
                     AAQRTAVMGAVNVVKTTAQSLGPLLTGVLAGRGRFGLAFGLAGSLKVVYDLGMLVSFA
                     GTEKRRAVAGEGGRRRAVVGEGEEREGDEEGGR"
     gene            complement(<602864..>603991)
                     /locus_tag="THITE_2049954"
                     /db_xref="GeneID:11515989"
     mRNA            complement(<602864..>603991)
                     /locus_tag="THITE_2049954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653841.1"
                     /db_xref="GeneID:11515989"
     CDS             complement(602864..>603991)
                     /locus_tag="THITE_2049954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653889.1"
                     /db_xref="GeneID:11515989"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Thite2_2049954"
                     /translation="NISYSLVDRETTPRDRNWGITLSWALPLLEGLLPPELVPQLQAC
                     QPDVSLSVASAGEQGVLIRDGATGATKIRVRYPGGIRRMQIQKTKRVLAAGLRLKRGK
                     RLVSLSYGGDNDDSRATVTAHFADGTAETGTVVVGADGGASQVRRCLLGEAAAAQEVL
                     PYAFMNFPFRLPADRARWLDAVMNPSVDVAPHPKGMYMGLFLLDKPDLDRPETWLFYL
                     LVTWPIATREDEENTGNRLERLRAHMDGWADPYRSVVQWLADDVAIGTDQLRIWHPKP
                     WDNRGGRVTLAGDAAHSMTFHRGQGGNLAIKDADEFVKRMVEVQEGRRSLKAAMDEYD
                     RGVVERGQEVEISKQQAAAFHDYANFDSSPVFKMGIKPAGS"
     gene            complement(<604739..>606719)
                     /locus_tag="THITE_2050614"
                     /db_xref="GeneID:11515990"
     mRNA            complement(join(<604739..605747,605821..606599,
                     606654..>606719))
                     /locus_tag="THITE_2050614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653842.1"
                     /db_xref="GeneID:11515990"
     CDS             complement(join(604739..605747,605821..606599,
                     606654..606719))
                     /locus_tag="THITE_2050614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653890.1"
                     /db_xref="GeneID:11515990"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="JGIDB:Thite2_2050614"
                     /translation="MATIAAPEDLPLGISLPPGNPHGVSVHLPKWADTVGWASREPRV
                     LNAMKTGYPRFFIPRVVDRLAMQLLDMQQRSAGETGDREKGTTKLAIVLDSVGHAQAC
                     RKTLPAWSDPASKRFSAADIGVYVVSWEGRITPVEAVDGVPGDGDIESAVTVGNEDIV
                     LVTYPAELAAEAKAFWQHTGFGISSRRATHWLEHAPFLSTAPPDPGSMPAPAEIARQA
                     EQARSTLKSRIAAGQSSAEDNLEVSPSDVFLFPTGMTAIAEIAAAIKSLRRATPDNPY
                     RVAVFGFLYVDTYKVLHRVLGFEPTLFHATADAITALEAMLNPSAPSPTIPQCSTTAP
                     ATATMMKFDAIFTEFPGNPLLQAPDLARLRALATRHAIPLVVDDTVGTHAALRLLAAC
                     DVACTSLTKMFSGACDVMGGAAVLNPRGWGYATLKGALERLEHREGGGGGGSGNGGRR
                     TGERNWFWADVVRMEANSRDFAARVRAASGNAARVADMLRRSGCVREVFYPQGSPTQA
                     MYDRFRREGGGYGFLLSVRFAAPARAVAFYDALDVAKGPSLGTNFTLCCAYTLLAHYR
                     ELEWAAEYGVVEDLVRISVGLEEWAWLEERVGRALRAAEGVVVSEGPESAA"
     gene            <608125..>611096
                     /locus_tag="THITE_2129435"
                     /db_xref="GeneID:11515991"
     mRNA            join(<608125..609501,609641..609748,609786..>611096)
                     /locus_tag="THITE_2129435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653843.1"
                     /db_xref="GeneID:11515991"
     CDS             join(608125..609501,609641..609748,609786..611096)
                     /locus_tag="THITE_2129435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653891.1"
                     /db_xref="GeneID:11515991"
                     /db_xref="JGIDB:Thite2_2129435"
                     /translation="MASRYSLRAKTREIRYNEPQCLDDIDTDDELYESSDDPPSTPTP
                     LGKSGKQVCTMLGGSPRGRIKGTRAGNRHNKTKRPGSPNLKKPRPKVARLLRFSPVRK
                     NKRESHQQLPPCGSMSQPAMHHGLMAQSSLDGYGDNMGGSSHLMLPSMATCLVPASHF
                     SFGYQPGYTNNIGDSLLAKPPVAPAQAAPFAAAHGALKHPNGTDIGIAPFSCDVMSKI
                     DPRLLAPAAQVTQYHQGGLGSMPVDDSLYGRSTLPAASDGYGTSNGYVNGYTNGYSNG
                     CKPFKNYGQGHGDSNLPTALADVDISGLSSGLDFANGYGSTSLYHRQSNEYAAANAYQ
                     PCASNLPFASNAPAVNQLTWYPANFSSTNSAQQLAFCYPTPPAKRFIKAVASPGLFTG
                     RFVTSIAGLEDPFVDTPPPKRELYTVAGFAPVSSPTPVCHEHEQAPNLADMDQLTFDE
                     RLIDPRLLKTAGFPSALHRDSHRHPFPTLPVYDFGTTQNQYLTIPSALSNDVALDNMS
                     TIAQFNREDKEDDEDKEDDDDEATVIQSPDRERASSPAAASDPGDSGKENRPHPPVGS
                     DSDSDTAVTEEAYGNDTDNEQEEEEGGEEEDSASGADDDNAPAPAVPHQPLVPPSEIH
                     NPDVNPAAAFWRPAPNLHHQQPHPVAPVSIHSTPPIPLFDTDPAQPFAPWRASLLPPF
                     RPEPTDRVLLVPARFLAALGALYPGATFAVARHPASAGFAVRATGRELALGVALHFPA
                     LGRAAIQGEVVGQEDMHDLHEGEGEGEKGEVKYIVSLRRRDWPSGGVAWLPHTPAACA
                     WVREVREVFDVLPGGAEAFYFVPHRAPVRGRGGRRGSGGGQGGETAVVKGMWVCRAYE
                     GRRGPQDPRVILDWVRQGGRAVREDQLGRQVLCRMGEAWVWPEQYPKMTKAEREAKER
                     ETREAKRMRMDDTADGE"
     gene            <612171..>612809
                     /locus_tag="THITE_2089046"
                     /db_xref="GeneID:11515992"
     mRNA            join(<612171..612359,612421..612608,612686..>612809)
                     /locus_tag="THITE_2089046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653844.1"
                     /db_xref="GeneID:11515992"
     CDS             join(612171..612359,612421..612608,612686..612809)
                     /locus_tag="THITE_2089046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653892.1"
                     /db_xref="GeneID:11515992"
                     /db_xref="JGIDB:Thite2_2089046"
                     /translation="MKILATLAALLVAVATSKPVATAPRTEAQAELDKRDTEIVYLAN
                     CKHLVSGCPSPAETDSYIFYYPASAAANSGQPFSSDNQCAVMTSSYAWWGNSSLACTF
                     PTNGRFSAHIDADAQSGPDYSWAGWGSNGCKNWNCYKDNGRTIITTSGTEWSNSCSSV
                     YYCTPQ"
     gene            613907..615388
                     /locus_tag="THITE_2116450"
                     /db_xref="GeneID:11515993"
     mRNA            join(613907..614098,614183..614203,614266..614397,
                     614458..614605,614704..615388)
                     /locus_tag="THITE_2116450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653845.1"
                     /db_xref="GeneID:11515993"
     CDS             join(613996..614098,614183..614203,614266..614397,
                     614458..614605,614704..615205)
                     /locus_tag="THITE_2116450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653893.1"
                     /db_xref="GeneID:11515993"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2116450"
                     /translation="MSSAPAKDDRHPAVKGPSALRSILAGSTAGAVEIAITYPAEFAK
                     TRTQLNRRLADGQKLPWPPFGRQWYAGCTTLIIGNSAKAGIRFVAFDQYKKLLADADG
                     KMTGPRTVLAGFGAGVTESLLAVTPTESIKTTLIDDRKSANPRMRGFLHAVPIIARER
                     GLRGFFQGFVPTTARQAANSATRFGAYTALKQLAEGYTAPGEKLGAAATFALGGAAGL
                     ITVYVTQPLDTIKTRMQSIEARRVYGNSLRCAAIIFKQEGLLTFWSGALPRLARLIMS
                     GGIVFTIYEKSMELMDRLDPERKYI"
     gene            complement(<615448..>615977)
                     /locus_tag="THITE_2144886"
                     /db_xref="GeneID:11515994"
     mRNA            complement(join(<615448..615591,615660..615878,
                     615957..>615977))
                     /locus_tag="THITE_2144886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653846.1"
                     /db_xref="GeneID:11515994"
     CDS             complement(join(615448..615591,615660..615878,
                     615957..615977))
                     /locus_tag="THITE_2144886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653894.1"
                     /db_xref="GeneID:11515994"
                     /db_xref="JGIDB:Thite2_2144886"
                     /translation="MSGAATSVAANHFRGALSRWPKAVLRPELQLRDVLARRLEQGRP
                     LAPATARRGAAATQEQADLRQANALCSLLENRYQNKYRAPPSIFEPKSNPTYYKDLLK
                     ELEEAPHRSWLGRIAKRLGGMIRFS"
     gene            616206..618037
                     /locus_tag="THITE_2116454"
                     /db_xref="GeneID:11515995"
     mRNA            join(616206..616534,616604..617026,617092..618037)
                     /locus_tag="THITE_2116454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653847.1"
                     /db_xref="GeneID:11515995"
     CDS             join(616514..616534,616604..617026,617092..617676)
                     /locus_tag="THITE_2116454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653895.1"
                     /db_xref="GeneID:11515995"
                     /db_xref="JGIDB:Thite2_2116454"
                     /translation="MSGRYERVNSHDVDEPETPAAPLPRPTYPIPNSPPPSFHSRASS
                     RERQTAVNPDLADAFDADGDDSDDEADDRQRLVRGSAAPSVNGATQAGAATTQSAARP
                     AQPQRPVGGAPTTSRVYGSGIQSDGVFSNLSAKPDRGDGEKEELPPSYEQAAADQAPP
                     YWETTILAPGLGGPDDVYIDGLPVGSFFGFVWNAMISMAFQLVGFLLTYLLHSTHAAK
                     NGSRAGLGITLIQYGFYMKSTPSGPGGGGNPHSHMEGDGYTNPADPNAHNFDPNDVNK
                     SGGGSNDITGSDWAAYILMIVGWFILIRAVSDYLKVRRHEQLVLQSPDRGLGIPVVAA
                     GESPETAV"
     gene            618038..619391
                     /locus_tag="THITE_2116456"
                     /db_xref="GeneID:11515996"
     mRNA            join(618038..618500,618573..619391)
                     /locus_tag="THITE_2116456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653848.1"
                     /db_xref="GeneID:11515996"
     CDS             join(618399..618500,618573..619199)
                     /locus_tag="THITE_2116456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653896.1"
                     /db_xref="GeneID:11515996"
                     /db_xref="InterPro:IPR000682"
                     /db_xref="JGIDB:Thite2_2116456"
                     /translation="MAWRSSGGSNRDLVENLWRNQLITHQQVKEAFLKVDRAHYAPTF
                     PYEDSPQPIGHAATISAPHMHASAAEHLLPFVTPAPPARPAPRVLDIGSGSGYLTHVL
                     AELACAGSGADSGAVVVGLEHIAPLRDLGERNMRKTARGRELLDAGRVRFRVGDGRKG
                     WLEPGEEHKKWDAIHVGASAAEVHDALLEQLNAPGRMFIPVDDDESGWGQHVWCVDKD
                     EKGVVSRRKLFGVRYVPLTDPPKE"
     gene            complement(619392..621285)
                     /locus_tag="THITE_2116458"
                     /db_xref="GeneID:11515997"
     mRNA            complement(619392..621285)
                     /locus_tag="THITE_2116458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653849.1"
                     /db_xref="GeneID:11515997"
     CDS             complement(619584..621113)
                     /locus_tag="THITE_2116458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653897.1"
                     /db_xref="GeneID:11515997"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2116458"
                     /translation="MSNDPKLRVLVVGASIAGPAAAYWLAKAGARVTVIERFPQLRTN
                     GQNVDIRGVGVTVMRKMPGMEAAVRAKRPPIHGLSFVDARGRAFATIKPTGNPDQQSL
                     VSEYEILRGDLSQILFDLTKANDNITYVFGEQIASIEQPAPDTTSGPVTVTFANGRLP
                     PSPFDLIVACDGSTSRTRALAFGCSAREHMHPTNWWAAYFSLPTALLPADAVAGSDPN
                     LARAYNAPGGRLVCIGPDADPRTTRATIIGVRPRSRNLPAEILAFRAAAAQDHSSSTS
                     SSPDPSSPPDSAIKSFITHHLTHPTRTPTWPRGVITALLAALPASPDFHATELSQVRP
                     PRLWTSSSSHHAARVALVGDAGYASGASGAGASLALAGAYVLAGEICRALRLRRLHPR
                     QQRRAARDSSGLGLGKVADGESGVEEGVLGWDGTGALLDAALERYEAVMMPLVAEMRR
                     TPGFVGAVLAPQSAWGLWLRNWALWAVCRTGVSEAVQRFAAGAFAKREEAALPEYEWV
                     E"
     gene            complement(<621457..>623487)
                     /locus_tag="THITE_2049904"
                     /db_xref="GeneID:11515998"
     mRNA            complement(join(<621457..621889,621959..>623487))
                     /locus_tag="THITE_2049904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653850.1"
                     /db_xref="GeneID:11515998"
     CDS             complement(join(621457..621889,621959..623487))
                     /locus_tag="THITE_2049904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653898.1"
                     /db_xref="GeneID:11515998"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2049904"
                     /translation="MAFSCQTCARRKVKCDKAAPTCARCRKSNAGCVYEAPRPRKRRL
                     SSDDALDRLARYERVLRRHGLLEEAHADTVPTEEPVSLLWDEPETPGNGGKLLSAPGK
                     SRYLSSKLWQNLECEEVQGLSDTETEEDDPATPDPLTGAFLGGPQRSLLQYHPTHEQA
                     MVLWATYAERVEPLCKILHIPSTARLVETVSQQPAAASKTDECLLFAIYYFAVFSLTD
                     EECAAALGRPRSVLLPLYQSAARQALVNASFLKTTSLTVLQSLVLLLLASQHSYSAHT
                     FWILTGAAVRIALRMGLHRDGESSAGGTTSSAAAEAKLSPFDVEMRRRLFYQLLPLDA
                     RAGQAAGAGVAALPPDAWDTRPPRNVDDAQLWPGMAAPPAEQRRGATEMVFCLSRAWL
                     GSFFARRGARAAAAAAAAVRQPWMFADVREADRAIDEAEAGVEERFIRYCDVVDPLHF
                     LTVCVARAGIAACRLRVRLPRARSEAATEEERREAWQLALKILDADAAVCLHAGLRKY
                     RWRRDFLSAAEIDAAWDRIEHQYGNHDELAQSWRPLYLALGRLALKAWDANPPTRGKS
                     GAPEPGFIAALRSACTRKKQRKEGWGQNGEDTDTTPGLALDKSIGATDFDLSSSFDVA
                     GVDWVFWPELIQDGHYPAGHQSGDLSFSP"
     gene            623755..624209
                     /locus_tag="THITE_2116459"
                     /db_xref="GeneID:11516155"
     mRNA            623755..624209
                     /locus_tag="THITE_2116459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653851.1"
                     /db_xref="GeneID:11516155"
     CDS             623803..624066
                     /locus_tag="THITE_2116459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653899.1"
                     /db_xref="GeneID:11516155"
                     /db_xref="JGIDB:Thite2_2116459"
                     /translation="MFQAEVYHKGISRLENSKEAQWSIESPHAVVEWQRRGGKERPTY
                     LDRPIQRLPRRVSTAGEMKPPRHCSINPDTKGQDMQRSQSITK"
     gene            complement(624389..625277)
                     /locus_tag="THITE_2116460"
                     /db_xref="GeneID:11516156"
     mRNA            complement(join(624389..624618,624674..625277))
                     /locus_tag="THITE_2116460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653852.1"
                     /db_xref="GeneID:11516156"
     CDS             complement(join(624446..624618,624674..625136))
                     /locus_tag="THITE_2116460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653900.1"
                     /db_xref="GeneID:11516156"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Thite2_2116460"
                     /translation="MPHPITSIKTRGQRKRRLAGAILARHCVKPCATAPPDPVRVVCV
                     SDTHNKQPVLPPGDILIHAGDLTKNGSFDEVQAGVTWLSSQPHRFKILVAGNHDVLLD
                     ETFLERYPERRYGQSKTKKDLDWGDVIYLEDSTITLDVPVQPSPPAQAEPPTAPGRRN
                     TASRPSSTRRPRAPSTGAPASPTSSPSTPKPKKPEPTATNPNTTGQPRLWW"
     gene            <625596..>626375
                     /locus_tag="THITE_53192"
                     /db_xref="GeneID:11516157"
     mRNA            <625596..>626375
                     /locus_tag="THITE_53192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653853.1"
                     /db_xref="GeneID:11516157"
     CDS             625596..626375
                     /locus_tag="THITE_53192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653901.1"
                     /db_xref="GeneID:11516157"
                     /db_xref="JGIDB:Thite2_53192"
                     /translation="MGQLCCCCSDCQPEARRPRDGRSDVQIGAPQDVTIQIPRNRNDP
                     QGVPIQQVTRDIDQGVLRAALDHVSQFMERRNRHLSVIAVGGAVNTLYLRSRATTHDV
                     DVFGSDFGNESRILLDAAMHDAQQHIPELGTDWLNTETQLWMPGRMHDELTQMAREQN
                     VQVYHGRGLTILAAPWAYAFTAKLSRILLGGAHARSYDLADAVTYIHEYIRAHGNQPV
                     PIATVFDWARRWHHEITDDLLRNRVDPEYVRRYGRHAFTYD"
     gene            <626752..>627369
                     /locus_tag="THITE_26612"
                     /db_xref="GeneID:11516158"
     mRNA            <626752..>627369
                     /locus_tag="THITE_26612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653854.1"
                     /db_xref="GeneID:11516158"
     CDS             <626752..>627369
                     /locus_tag="THITE_26612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653902.1"
                     /db_xref="GeneID:11516158"
                     /db_xref="JGIDB:Thite2_26612"
                     /translation="PRCGPGAHVVALVPAVCPRCPRCAPGARVVPPVPTVCPRCPQYS
                     PGAHSMPPVPAVWPRCPRCAPGARSIAWCPQYGPGARVVPPVPALCPRCPQYGPGAYS
                     MPPVPALCPRCLRCAPGARSMAPVPALWPWCPRYAPGARSMAPVPALWPWCPRYAPGA
                     HSMAPVPALWPWCPRYAPGARSMAPVPALWPWCPRYAPGARVVALV"
     gene            <628054..>628743
                     /locus_tag="THITE_2144893"
                     /db_xref="GeneID:11516159"
     mRNA            <628054..>628743
                     /locus_tag="THITE_2144893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653855.1"
                     /db_xref="GeneID:11516159"
     CDS             628054..628743
                     /locus_tag="THITE_2144893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653903.1"
                     /db_xref="GeneID:11516159"
                     /db_xref="JGIDB:Thite2_2144893"
                     /translation="MSAKGISPWSKLRGIFGRAAREKPRTAQEDPDGPRPNPNDYPTF
                     PPLPPRDLLQNPAAQFDRIAARKYGAPQGEYEDKPLYGLYRFYEFVVLDSVTNYRNSL
                     EAFWRRRDWPVRDIPDPQDPDPERYAFLAGCTYLMVRAFNARVKLGLDRSMPSLITPD
                     EAEELRRRPDHLRKYERVPEWVEKVPPLEELLVVPTHDGEVLAGREDPRADPDFLAKG
                     ILLWTPHIYFT"
     gene            complement(628803..630028)
                     /locus_tag="THITE_2116461"
                     /db_xref="GeneID:11516160"
     mRNA            complement(join(628803..628867,628941..630028))
                     /locus_tag="THITE_2116461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653856.1"
                     /db_xref="GeneID:11516160"
     CDS             complement(join(628862..628867,628941..629672))
                     /locus_tag="THITE_2116461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653904.1"
                     /db_xref="GeneID:11516160"
                     /db_xref="JGIDB:Thite2_2116461"
                     /translation="MYMHTPALLTTLTGFVALAAANPLAAGANPVAPRVTPAVLLERH
                     HLLAARDSSTSSTATPTTNTETADPKSVECASIYSSFENAGPTLPATLGSWYKTAQTY
                     TLPPASEYDDAVVTGVCQETKTLTPPASLASAWASYTSASHSFNSARASAVHSAASSC
                     GGGYSALIDIEAISDGDSCTASIRALVSAVRSAVDAQTTGAPGNSTTAPAGVSSTTSS
                     GGGPRETGYVAAAAAVVVGVAGVMAAR"
     gene            complement(<633227..>636328)
                     /locus_tag="THITE_2129443"
                     /db_xref="GeneID:11516161"
     mRNA            complement(join(<633227..633295,633343..633529,
                     633594..636157,636278..>636328))
                     /locus_tag="THITE_2129443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653857.1"
                     /db_xref="GeneID:11516161"
     CDS             complement(join(633227..633295,633343..633529,
                     633594..636157,636278..636328))
                     /locus_tag="THITE_2129443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653905.1"
                     /db_xref="GeneID:11516161"
                     /db_xref="JGIDB:Thite2_2129443"
                     /translation="MATMVQPEDDSRETCVFAKPAQKAQSQPAPPVKRPRGRPRKPRN
                     NTVDTAIVLSDSESEGDDAAEPQTPSEARKRALAKVESPAPAPNPKRGTPSSAVLGTP
                     QRAASAAMWDEVAELKQQLFVERKQRMDAEAARTRMQQAMEEKEASWAADVAAQMVPL
                     QFQIQQLTQEKRSLETACKDLEARLKAAPDEEQPAPAPASTDDPKPAAPEMAELQAQI
                     RANKGLIASQAAYIEELSEIEEARTQDLAKANQKITFLTRTLDELGTRNEAATKAVKE
                     HESQIQQLRHDLAAANQARLAAEQTLTATQETLAKTEDQLATTKQQLAAADEATSTQA
                     QRIIANLQYERSSALDEMQQRIEEVKGLCVENTRLRQTVTALEKEKQQLTAASTERLD
                     LQKQLDGYKESVAILQREKQQLEAKLTLSADKLAVFKREAERRKAAAPEPQDTEHRPS
                     AETSQQTAAQVRALQSEVDALRQEARLHQETIANLQRENQHIKTAQRSAGGATPSEKQ
                     LRDGVAQLTRELAAKDTDVQTLRDCLAKEIVGKDKLEQAMAAQATQLQQLDTQLKHKT
                     QQAENSQKVADKLREYLKRSTRTVSQLRTDLESSKTLIREHDAILADKERVIAVKEIE
                     IQQRQTAAMALTGDKARLQQELVACKAQLHDLSTAISKLTAENETLQAASASKDKTVH
                     SLREQLTTLAREKDAATTHAASTQTNLAESASNPAQHQSLTELQAENALLTEMLSTLQ
                     TDLHALRTQAAATTAATPSPTTPSADDKPTAADDTGKINEPQPPQPDHGSDRPANNPT
                     EPVPARDTNNTIPIAPENAPSPAEGLTARLAALERNNSALKQAAATHAADAARLRDRL
                     AAVLALVERVEGQLGVSMSVGMGMSVGISIRIGMGRSSSISLSASSSITISLSISMGI
                     RMGISIISMAIRISKGRRTTRGEDGKEGREREQPLESGHGAR"
     gene            637646..640284
                     /locus_tag="THITE_2116463"
                     /db_xref="GeneID:11516162"
     mRNA            join(637646..638072,638148..638745,638828..639712,
                     639783..640284)
                     /locus_tag="THITE_2116463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653858.1"
                     /db_xref="GeneID:11516162"
     CDS             join(638176..638745,638828..639712,639783..640031)
                     /locus_tag="THITE_2116463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653906.1"
                     /db_xref="GeneID:11516162"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2116463"
                     /translation="MATTSTTTTNPPAAATPAPDPEKFMHTSGSTDPVWIHQQPYSAM
                     PTFPALGEDLSTDVCVIGAGIAGIHVAYELVRRGHRVALLEARDALAGESGRTSGHLT
                     NDLDDGYANIRAKHGDAGARVAAESHAWARDRVGEIAEELGIECEYRRVRAYDVSQFA
                     VGSDGYEGEMKELREEAGVQAGLGIEARFDENLTVRGWTGKPDQRGGLVAENQATFHP
                     TKYLAGVLAWLKTQPNFQCFTRTRVTGIHEKGVELLGLGHKSVTIETEVGHTVRAEHA
                     VEATCVPLQKLSVVAELEFFRTYCIAARVPKGSVEDCLLYDNAEAYKYVRLTACDDKD
                     DYLVVGGCDHKVGQEETTPRFDELETWTRERFTQAGAVDYRWSGQIYEPVDYMAFIGK
                     NQGNQKIYIVTGDSGDGLTHGVLAGRLIADEIEGKENKWASLYNPKRLGSIIKTLPSL
                     VKHDVQINLQYKRFLQTDITDIEDLAPGSGGVLNSATAKPLAVYKDEDGKVHKYSALC
                     PHMKGVVCWNAVEKSFDCPVHGSRFSKAGICVNGPAKINLTPADKAGAESQEYASGSG
                     M"
     gene            <641265..>641827
                     /locus_tag="THITE_2089061"
                     /db_xref="GeneID:11516163"
     mRNA            join(<641265..641589,641649..>641827)
                     /locus_tag="THITE_2089061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653859.1"
                     /db_xref="GeneID:11516163"
     CDS             join(641265..641589,641649..641827)
                     /locus_tag="THITE_2089061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653907.1"
                     /db_xref="GeneID:11516163"
                     /db_xref="JGIDB:Thite2_2089061"
                     /translation="MGTFVSGVIVDVTADSDRNKRGAALWKGNEFDKVGEGAAGDRQP
                     QVRQPVRRSEASRARLPKRKAHLHPTFASVEQQVRSPMLESWKLRLIQGTLLKRRNVE
                     LDVGVGLTVTETVAAAPSGIAGSSGHFVGVDLRGKWGSPESRPRLAPPSSEFRQAVWA
                     ASRASEE"
     gene            complement(<642847..>645123)
                     /locus_tag="THITE_53601"
                     /db_xref="GeneID:11516164"
     mRNA            complement(join(<642847..643027,643123..643633,
                     643697..643935,644187..644266,644351..644819,
                     644885..>645123))
                     /locus_tag="THITE_53601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653860.1"
                     /db_xref="GeneID:11516164"
     CDS             complement(join(642847..643027,643123..643633,
                     643697..643935,644187..644266,644351..644819,
                     644885..645123))
                     /locus_tag="THITE_53601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653908.1"
                     /db_xref="GeneID:11516164"
                     /db_xref="JGIDB:Thite2_53601"
                     /translation="MVAFGVVSALAWAAGLALASHSPAPLVGIRTRNYPGTSDEFTIR
                     EIRRRLAALARGQKNFTIGNSTTLEQAWDNVVLFTQSFENSANFTNGATVDTEIDIEV
                     KCSQCYFKAGITANLTIDGEIDIGADVKNLTTQFGEEIKNLTETAVASLKSVGEQVLD
                     AIEAAFDDSRHLTLDDVIDFDNVTIDTDIDIVPPPLPEVQLLFQIDFLDLYVAIDFTI
                     GAHAALSLPLFRSNTPLGSGFHLVLDDPTGFHIALFGQDVSDLFFVGMEVGVYANVAE
                     LLTNITGGADLAAAENGCELKIAQEYTLGVGAFAGATVGIGDHTWGGQPNTTVPIFYT
                     TLLDVCAATPSTNPATATTAALSARQAADDDLQTTTLTTTLTFTGVGCATAAVALCPQ
                     SLQTTSIRTTVSTLVTAVPKGATATFPASIATTVASTVPLGKQAKALSATSGAPTSFV
                     PPPPTTSSSSAAATSSKAPGSDVLGDINKVLDGETGGVSNKLIIGLSVGLGVPFVIAV
                     IAGIVFFIRRKRYAPVPKSDTAVEYTGGYQSPMAAEREREAMLKKEPAVAVGELNQPP
                     QAAYHD"
     gene            <647200..>647445
                     /locus_tag="THITE_2089064"
                     /db_xref="GeneID:11516165"
     mRNA            join(<647200..647349,647416..>647445)
                     /locus_tag="THITE_2089064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653861.1"
                     /db_xref="GeneID:11516165"
     CDS             join(647200..647349,647416..647445)
                     /locus_tag="THITE_2089064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653909.1"
                     /db_xref="GeneID:11516165"
                     /db_xref="JGIDB:Thite2_2089064"
                     /translation="MTTPGMRTNETVGVPHHVLLKHSENLTLFTSYHALSECLFDMVK
                     GSDTSFEVDRYCCSP"
     gene            <649790..>650331
                     /locus_tag="THITE_2129448"
                     /db_xref="GeneID:11516166"
     mRNA            join(<649790..649848,649992..>650331)
                     /locus_tag="THITE_2129448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653862.1"
                     /db_xref="GeneID:11516166"
     CDS             join(649790..649848,649992..650331)
                     /locus_tag="THITE_2129448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653910.1"
                     /db_xref="GeneID:11516166"
                     /db_xref="JGIDB:Thite2_2129448"
                     /translation="MQLFNTVVLLAAARLAAGAPIDCQGLLVWAYEGDADACYNAPTE
                     AASVTLYANTVMRWDLSNQRNCGSGLKRADDPANTNLTVTSFVTEPGKPVTLATGPGK
                     PGNLSATDMSGDCQNNGSGGIWAFRATIIG"
     gene            <651756..>653193
                     /locus_tag="THITE_2089066"
                     /db_xref="GeneID:11516167"
     mRNA            join(<651756..652172,652226..652383,652500..652743,
                     652924..653071,653153..>653193)
                     /locus_tag="THITE_2089066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653863.1"
                     /db_xref="GeneID:11516167"
     CDS             join(651756..652172,652226..652383,652500..652743,
                     652924..653071,653153..653193)
                     /locus_tag="THITE_2089066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653911.1"
                     /db_xref="GeneID:11516167"
                     /db_xref="JGIDB:Thite2_2089066"
                     /translation="MKLLSVGFGLIPLVQAGLRFPCSTLTFQRLDPVVQPGSNPSAHL
                     HHIVGGNAFNATMTGDVGERATCTTCQMAEDFSNYWTAVMFFKHPNGSYHRVPVVPVQ
                     PLLGGSNGAQGGITVYYTQYDLMRDNIQQQPIKAFPPGFRMTVGSPGSTSPPHVGLTY
                     QCLQGGNRGPEMSDFPTKPCSGGIFTTHHFPACWDGKSLDSPDHQSHMYNTITMNGFT
                     NAPPCPASHPVRVPQVTYETTWDTTKFNSMWPSGAPNPFVWSFEGTRGYGTHADYMFG
                     WKGDALQRAMDKSECFYDGCGAIKKQAMSIANQCKIKDMVGEQTDGWLPALPGMAEMK
                     N"
     gene            complement(<653688..>655100)
                     /locus_tag="THITE_125575"
                     /db_xref="GeneID:11516168"
     mRNA            complement(join(<653688..654222,654314..654477,
                     654710..654869,654922..>655100))
                     /locus_tag="THITE_125575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653864.1"
                     /db_xref="GeneID:11516168"
     CDS             complement(join(653688..654222,654314..654477,
                     654710..654869,654922..655100))
                     /locus_tag="THITE_125575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653912.1"
                     /db_xref="GeneID:11516168"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Thite2_125575"
                     /translation="MMRRLVLWTAALLGLCSAGAYPPDVVDKLAEASLPKLKDYLAKN
                     PQGSCTLETAVRRKEWSDLSVKERKEYTDAVLCLQSKPALTTSQAPGAKSRFDDYVVI
                     HILQTPRNHGSDPANSPLFDGSEGSMGGNGAKVAHQGIPIPGAPSPYNVIPPGDGGGC
                     VTTGPFKNMTINVGPIAPTIQVPRNPRSDGLGYNPRCLRRDINKHAAAVTTANYTYDL
                     ITSNSDVYWFQTVMEGQFAQGKWGVHAGGHYTISGDPAGDFFVSPGDPAFWLHHAMID
                     RVWWIWQLQDLDRRLAEVSMTRTMNNMPPSPNGTLDDPSGLGVLAPDVPVRELMSTMG
                     GLGGKFCYIYE"
     gene            complement(664197..665932)
                     /locus_tag="THITE_2116464"
                     /db_xref="GeneID:11516169"
     mRNA            complement(join(664197..664582,664646..664702,
                     664766..664892,664977..665550,665619..665737,
                     665809..665932))
                     /locus_tag="THITE_2116464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653865.1"
                     /db_xref="GeneID:11516169"
     CDS             complement(join(664495..664582,664646..664702,
                     664766..664892,664977..665550,665619..665737,
                     665809..665884))
                     /locus_tag="THITE_2116464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653913.1"
                     /db_xref="GeneID:11516169"
                     /db_xref="InterPro:IPR005581"
                     /db_xref="JGIDB:Thite2_2116464"
                     /translation="MVDPLRDLPSVDAALRRQVDPSVLAVLPDVEEVLRVEKGYKSAW
                     AQAWRLDVRHKDGKTESYFMKVSYGHHGREALKGEFESTAAIHSIVPNFCPDPIAWGT
                     LTNEPDAHFYLCKYYDFFEGVPNPTSFCKKLAELHSCHLSPEGKFGFHCTTYNGDLPQ
                     DNTWSDTWEDFFSKGLRHVLKIREERAGPSAELDELLPALFEKVIPRLLRPMESNGRS
                     IRPSLVHGDLWCGNTGIVDENTEDGIVYDPASFWAHNEYELGNWRPQRNHFDAKYFEA
                     YHSVMPRTDPVEDYDDRNALYALRFNFHAATLFPNDESYLQMAIEEIRRLTEKYPEGY
                     NEGQFSMVRSKI"
     gene            <666267..>666675
                     /locus_tag="THITE_118048"
                     /db_xref="GeneID:11516170"
     mRNA            join(<666267..666502,666549..>666675)
                     /locus_tag="THITE_118048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653866.1"
                     /db_xref="GeneID:11516170"
     CDS             join(666267..666502,666549..666675)
                     /locus_tag="THITE_118048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653914.1"
                     /db_xref="GeneID:11516170"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_118048"
                     /translation="MDLPSSFTLNNGMSVPAVGIGTFQGEAGNSKVKEAVKLALKLGY
                     RHIDGANAYGNEKEIGEAIKESGIPREEIFVTSKLGNKLTEDCSAQTWHDPNDVERAL
                     NTSLNDLQLAYGSVQAPS"
     gene            <667050..673940
                     /locus_tag="THITE_2150738"
                     /db_xref="GeneID:11516171"
     mRNA            join(<667050..667089,667148..667235,667290..667428,
                     667490..667531,667596..667808,667908..667998,
                     668241..668290,668464..671573,671656..672265,
                     672344..673940)
                     /locus_tag="THITE_2150738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653867.1"
                     /db_xref="GeneID:11516171"
     CDS             join(667050..667089,667148..667235,667290..667428,
                     667490..667531,667596..667808,667908..667998,
                     668241..668290,668464..671573,671656..672265,
                     672344..673804)
                     /locus_tag="THITE_2150738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653915.1"
                     /db_xref="GeneID:11516171"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="JGIDB:Thite2_2150738"
                     /translation="MERLLESGKARAIGLSNFNILKTKQILDVARIIPAVNQVEIHPY
                     FPQRELLEFSSRHGIILMAHQPLGGRPVPVVRAHSDEPFPTEDPTILRVAIECGMTPA
                     QVCLSWAVQRGIPVIPKSVQEEHMKQNLQLKRLPDDAFRAVDDITLKRRPIRFLDPSR
                     HLGFDIFDEDNDQPFKRTSKGVANFLRIETGNQLSLLHMHQAIFESSEHEFLAATASQ
                     MDQSQKRSFAGFLSRSGTEKSVQRGFVRTDTASSFLSVAASSLDLSDDEKGPLGLTTL
                     YEPPPPATPVADIVFIHGLGGGSRKTWSYSPDPPHYWPQSWLPQDEDFADVRIHTYGY
                     KADWGGRRQSVLDTHDFAQSLLGALRNHPAVRRSRTRIILVGHSMGGSVAKKAYILAR
                     QDPTAADLGARVHSMFFLATPHRGSDMATVLENMLAVAWGHKRFVSDLAPNSAALTAI
                     NDAFRHFAPELRLWSFYETLPTRGVNRIVVERHLATLGYHNEEVASMDADHRHVCKFD
                     TPADPNYKVLRNALVSALDMIRSTSRADPERSHGAGGERDHPGLHQAPSVSAAEATAI
                     VRSFLGVREPLEGDLATLQVLKQPGSCEWFTKKSCFTAWRDGTAPGILWLVGRPAAGK
                     SVLACHVIEQLTPPHALCSYFICKHAKAGESTLSECFRSLAFQMAIQDTAVMGALLQL
                     ARDDLSWDKSDESSVWRRLFTNCIFKLPSLGKHFWVIDGLDACSSFGALFTKRLLASL
                     PQHLRLFGTSRNLEEIERGLASLGASRASVQVLSDTDTIEDMRLFLSTRLSELGRPET
                     AEDRERMCEKILRKATGSFLWARLVLQEFEDAWTEEAMDAILREIPADLSALYARVVQ
                     SIQADRRKLPLAKSILTWVVLASRPLTVDELRCAVKLDTNQTLQNAAKAIPDLCSQLV
                     FIDQHDNVHMIHETAREFLLTETGELPPSMQKKRDHTRVASLLLKYLSSGVLKPLQGK
                     AHHGSGRPRGFAKPAVTAAPADTSLLEYACAFFSEHLYRATSSDDPLMDELSDFLGTN
                     NVLSWIEHIAAGGDLTPLSRTAMNLREYLGRRMKYVPPTDRSVQLVDGWATDLIRVAA
                     KFRAQLLDCPSSIHSLIPSLCPAESTISRTSSKDARQSSFASTLTVKGLPPGSWDDCL
                     IRMDFHKGQTTAVRHGVRYFAIGLSTGQISLYDPTSIQVLHELKHQERVRILEFSPDD
                     LLLASCGTKHITVWDPKAGTMVSSFELHSPPLAVTFVGVDELLGAFRSCELIKWNLQT
                     EEQECISWKQVGSQGGSGTYDAPEGIVPASPPSVAAFLTIDGEVLLAVGYRAHPILVW
                     NALDLQLLGFCEPDIANNGIDTMVFNPNPEVPALLVALQGGSLCIFNYVTMEMLCRRP
                     DVYANSVACSPDGRTVIIGSSQGLIEVFELEQDHNGAATTLNLIYRSNHPLDGRIVGV
                     AFSADGLRFVDVRGQQGRVWAPAALPTRGMLDGLADPVITTHLIPSADGKFIVAGKSN
                     GDVVLFSTADAAQAGILYRHARDASIVSISFVEARNLLISADIAGRVLAVQLHAPLSE
                     AAASSDTERVSVLLDQRFGGAIASLLTNAAGNRVLVSGPFFDQLWELPSGRIFLPKGA
                     AGAELAVTGTSVPPRPVSPAPNAAAAVTGDGTTASTAETRSAFQHPSNPDWFVRVTSD
                     IARVYSWADFTELTAQEGIRLARELVVGSEHNPPSPTPPNASSATANASYHLGPGFVV
                     ELFRPTASSSARLYLWPAAEFDPSRPESVARPASEPNLAAVGPAVLSILRIVGPSTLL
                     FLDIRLWVCSVELHSVTNTTSAGTLFRPVGFGRMPTSTSTPAAATAPRPDPRLVAPVA
                     REPAFHARRHFFALSEWRTASGELRCSVAFASPSPSRGGNTAGRDIVAFANGHRLVVI
                     HGGLEFAEDVVASVSMSGVGGGLGNGNTSQHVWSVVSGSMHRRSSNW"
     gene            complement(<674314..>676788)
                     /locus_tag="THITE_125571"
                     /db_xref="GeneID:11516172"
     mRNA            complement(join(<674314..675900,675955..676407,
                     676465..676668,676732..>676788))
                     /locus_tag="THITE_125571"
                     /product="glycoside hydrolase family 55 protein"
                     /transcript_id="XM_003653868.1"
                     /db_xref="GeneID:11516172"
     CDS             complement(join(674314..675900,675955..676407,
                     676465..676668,676732..676788))
                     /locus_tag="THITE_125571"
                     /note="CAZy_ID 269829"
                     /codon_start=1
                     /product="glycoside hydrolase family 55 protein"
                     /protein_id="XP_003653916.1"
                     /db_xref="GeneID:11516172"
                     /db_xref="JGIDB:Thite2_125571"
                     /translation="MMVRFAFVAAVLCGAYLGTRDKTSFWYANIDHTSAVVRGYAPDL
                     DGDQSYEIFRAVTPGDGPGIEAAINEASNGANRRAQWLASQPRVVYIPPGEYVVNKTI
                     YMNTDTIIMGDATNVRCPASKLHCDATADHQAQPPVIKASVGFSGSGKLFSGQDPTTG
                     EKGELSFAVGLKNIVLDTTNVPGGQPFVALWWGVAQAAQLQNVRIYMPHAEYGVGHSG
                     MRLGRGSTLTVADVRIEGGQNGIWNNGHQQVLYKSIYFYQNNVGILIDGGHTISIVNS
                     TFDTVGTGVLSTKGSPWIALIDAKSINSGITFKTTASASYLIENLDKDTKSDIAHGPG
                     DFVIGPQSHVAQFSYGNTIDHNPVYAPIKSTSLTRPSALAPSGRYPAIPAPNYASSPA
                     SDFLNVKDPAQNGGHRVLGDHSVDESAALNAILQLAAAQGKIAYFPFGKYRVDSTLTV
                     PAGSRLVGEAWATITGAGSFFADAAHPRPVVQVGRAGEVGTAHIQDMRFTVSEALPGA
                     IILQFNLAGATPGDVAIWNSLVTVGGTRGAGALTGACRDARAPCRAAFLGLHLARTSS
                     VYVENVWNWVADHVAEDFDGGSNFAAGRGVLVEATRGTWLHGVGSEHWWLYQLNLRKA
                     ENVMVSLLQSETNYDQGDNNPVVVPAPWTVDESGWGDPGFGWCGAKDRRCRMGLANYI
                     NGGRNIHTYASASWAFFSGPGYQECADVCQRVMHFVQETPSGLQAFGLCSKDTYATLR
                     LANGTEVVTKNGFTGSWGGDIGRYTP"
     gene            complement(<680696..>682857)
                     /locus_tag="THITE_2129455"
                     /db_xref="GeneID:11516173"
     mRNA            complement(join(<680696..680733,680801..681036,
                     681120..681222,681309..681531,681608..681659,
                     681725..681846,681902..681959,682017..682148,
                     682196..682302,682375..>682857))
                     /locus_tag="THITE_2129455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653869.1"
                     /db_xref="GeneID:11516173"
     CDS             complement(join(680696..680733,680801..681036,
                     681120..681222,681309..681531,681608..681659,
                     681725..681846,681902..681959,682017..682148,
                     682196..682302,682375..682857))
                     /locus_tag="THITE_2129455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653917.1"
                     /db_xref="GeneID:11516173"
                     /db_xref="JGIDB:Thite2_2129455"
                     /translation="MSAKPSASHHENALPAGATITSSALDDAEKGIYDSTPGLPVLSS
                     PASAHVDEKKELALISPTSDATAASPRPAQPAAKKPTKRKVSKWVLFRLWFNTYRKFF
                     TFVTLLNLTGIILAALGHFPYAENHLGALVLGNLLCAVLFRNELFMRFLYTIAIYGLR
                     SWAPLWLKLAVTSILQHVGGIHSGCALSGARQVNELLWLVYKVVDIIIYRSTQHPAII
                     ATGIITNVAVIISVLSAFPWVRNNYHNTFERHHRFIGWLGLASTWVFVILGNSYDFKS
                     GEWRPETYSLLNAQELWFAVFMTIFILIPWLTLREVPVEVEIPSPKVAILKFQRGMQQ
                     GLLGRISRTSLMEYHAFGIVSEGRHSGCHYLICGVQGDFTRELVANPPKTVWTRELKF
                     AGVGHASAMFKRGIRICTGTGIGAALSTCIQSPNWFLIWIGSDQEKTFGPTISALIYN
                     NIPPERMILWDSKKRGGRPDTVKLLKEVWYSFGAEVIFITSNRQGNDEMMQGCLEAGL
                     HSFGTLWDF"
     gene            <686462..>688116
                     /locus_tag="THITE_160781"
                     /db_xref="GeneID:11516174"
     mRNA            join(<686462..686539,686648..687116,687184..687479,
                     687540..687723,687859..687973,688068..>688116)
                     /locus_tag="THITE_160781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653870.1"
                     /db_xref="GeneID:11516174"
     CDS             join(686462..686539,686648..687116,687184..687479,
                     687540..687723,687859..687973,688068..688116)
                     /locus_tag="THITE_160781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653918.1"
                     /db_xref="GeneID:11516174"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_160781"
                     /translation="MGSHVSSLRRRPAFSSNPGAEPDLAGYSVKDFYPAAIGEILNGT
                     YQVVAKLGYGTASTTWLCRDLRNHRYATLKIYASRQPQTNREVAALRHINAVLAASAP
                     VKHGGATSIRTLIDQFEIPRSKTTSRANLCLVFEPLGMSLADARKRMFGGRMPVDIVK
                     GVIFCLLQALDFLHREANMVHGDIQEDNILFAIPRKAELKKVEEAEMAEPSPRKVFKT
                     HTIYSSRPLELQPTVPVLCDFGEARFGSESYGEHVMPDLYRAPEIVLRIEWDEKIDIW
                     ALGLMCGLKMWTLVEGTNLFTDNRGGRWVSALPHMARIVSLLGPPPIDLLKGWDASPV
                     TRRYFDKTELTALEGEAKADFLRFLRRLLQWDPVKRPSAHELLEDAWFPLGLLPPPPL
                     FVPG"
     gene            complement(<688166..>689722)
                     /locus_tag="THITE_2089074"
                     /db_xref="GeneID:11516175"
     mRNA            complement(join(<688166..688705,688773..688877,
                     689666..>689722))
                     /locus_tag="THITE_2089074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653871.1"
                     /db_xref="GeneID:11516175"
     CDS             complement(join(688166..688705,688773..688877,
                     689666..689722))
                     /locus_tag="THITE_2089074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653919.1"
                     /db_xref="GeneID:11516175"
                     /db_xref="JGIDB:Thite2_2089074"
                     /translation="MTVELTTALADPNADEEATDETEGEARWQGNEKYHGDAGDDVAL
                     LQALLACFDGPAVSGAGGRIPEATVHTVTIKGLQTQHLHAAGSITAAVPWPIPTFSDE
                     PVPTSTVSGGLSNNLSWYYRNPPLWAANIRSRAGSSTAARTASVLSNPTDSSAGKKTT
                     PMWTMFSQDHLSSAEGTMRPETQPGVASKSAPSSRLPGTLPGTLFDISKFLTLSTARW
                     PFTHRHRHVGRPTRP"
     gene            complement(689963..692623)
                     /locus_tag="THITE_2116470"
                     /db_xref="GeneID:11516176"
     mRNA            complement(join(689963..690682,690755..691146,
                     691225..691559,691622..692100,692178..692623))
                     /locus_tag="THITE_2116470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653872.1"
                     /db_xref="GeneID:11516176"
     CDS             complement(join(690494..690682,690755..691146,
                     691225..691559,691622..692100,692178..692393))
                     /locus_tag="THITE_2116470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653920.1"
                     /db_xref="GeneID:11516176"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2116470"
                     /translation="MSDDTEGKPQSGTAEVEAQVDHAYDLDEKARAADYKADAVQAEN
                     AEHNMTVLEAVRAYPMATFWAFVMSCTIIMESYDVFLIGSFVALPEFINEYGVYDAAK
                     DIMVLEPKWQSALQVSGQLGALIGVFLAGPLTSWIGYRWATILALMLLNVFIFAFYYA
                     SSMPVIFVAQLLEGLPWGIFIANAPAYCSEIVPIQLRAPATQMLQMFWAIGSIIVGAV
                     TYAYSGYNSPIAYRIPIALQWMFPTPLAILMFIAPESPWWLVRKGRLEEAARSVERLG
                     RRSKLNSSETVAMMRRVVELERSEKEPNLVELFKGTDLYRTLIVCGVYAAQNLTGNLI
                     ANQAVYFFEQAGMDVHTAFALGLITSALQMIFVMLSWILTTYLGRRTIYLWGSFFNVV
                     LLVALGIAGSVGQSTSASLAMASLGLIISVLFTLGPAPASWVIIGETSSIRLRPLTTG
                     IGRASYYIVEIPCIFLGSYMLNPTGANLGGRCGYVWGGTGLFCWIVAYFWLREMKNRS
                     YREIDILFKRKVPAREWTKTVINVEDDE"
     gene            complement(<694705..>695262)
                     /locus_tag="THITE_160778"
                     /db_xref="GeneID:11516177"
     mRNA            complement(join(<694705..694969,695024..>695262))
                     /locus_tag="THITE_160778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653873.1"
                     /db_xref="GeneID:11516177"
     CDS             complement(join(694705..694969,695024..695262))
                     /locus_tag="THITE_160778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653921.1"
                     /db_xref="GeneID:11516177"
                     /db_xref="JGIDB:Thite2_160778"
                     /translation="MNETNPHHIRMLSALQQHKTVLVPGCSAGSIGWSIARVFHERGC
                     HVFATASDTSNVAGFSELNGANVLKLDVTDAGGIARRCAPPGVAAPGRPPTRVFNRPC
                     GRMKLPDMSHYRNVVEVAYVQAGHDAPGKCIGVDMFVNQAVGGIIGGARVSIWRGTAA
                     GLVRFAS"
     gene            699859..701865
                     /locus_tag="THITE_2116473"
                     /db_xref="GeneID:11516178"
     mRNA            699859..701865
                     /locus_tag="THITE_2116473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653874.1"
                     /db_xref="GeneID:11516178"
     CDS             700579..701610
                     /locus_tag="THITE_2116473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653922.1"
                     /db_xref="GeneID:11516178"
                     /db_xref="InterPro:IPR013700"
                     /db_xref="JGIDB:Thite2_2116473"
                     /translation="MAIDCPEQRGATFLPHGGPSSADLFCDMTSVSDRETFISAQAPT
                     TSECNWDTLHNLPHNCFAVVLNMLSRLLITTPPTCALSGRLTVPISAPRTPETATTDA
                     LHATMSQNRQIIQSLTTLLDCPCSQDEYLLYLMTLVALKVMAQYTAVAAASAPTDNNN
                     PHSLPTPSSPSPTTMPPQPPATPISMWPGLDPESPSSSSSSSPSPPPPPPSSSSLAMV
                     PLGEETQQHLPAATGGCPHRAAAAPAAGARLVLPELQRVQRLVEALCKRLEGVRMRAG
                     GRAAPGSGSSGVGEEDAGLRCCGGLEGPRGVEAALLLSVPTVFQLEEDLRRAGRVLAS
                     ETLRALGRG"
     gene            complement(709355..711774)
                     /locus_tag="THITE_2116474"
                     /db_xref="GeneID:11516179"
     mRNA            complement(join(709355..710590,710659..711774))
                     /locus_tag="THITE_2116474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653875.1"
                     /db_xref="GeneID:11516179"
     CDS             complement(join(709716..710590,710659..711571))
                     /locus_tag="THITE_2116474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653923.1"
                     /db_xref="GeneID:11516179"
                     /db_xref="InterPro:IPR004294"
                     /db_xref="JGIDB:Thite2_2116474"
                     /translation="MAHIHELAAEISNYANNRLTDPSKVRFPRTPVFASMNKPSRFEG
                     DVFDLEISGTIPADIDGTFFRVQPDHRFPPLFEDDIHFNGDGSVTAVRISGGHADLKQ
                     RYVHTDRYVHETRARRSLFGRYRNPWTDNESVKGVIRTASNTNVVFWRGVLLALKEDG
                     PPFAMDPVTLETLGRYDFEGQILSPTFTAHPKFDPDTGEMVCFAYEAGGDGSDCSVDV
                     AVWTIDRDGKKTEECWYKAPFAGMIHDCGISKNWLVLALTPIKMDLERMKRGGNKFAW
                     DPNEDQWYAVVPRRGGKSEDITWFRADNGFHGHVAGCYELPSGEVVFDLTVADGNVFF
                     WFPPDENVTPPDGFAKRNRLTSPTVRWVFDPKAKKSAIRTPGAGDADVWVADERVKPA
                     LTWLTNGEFSRIDDRFVTKPYRHFWQAVVDPSRPYDFEKCGPPAGGLFNCLGHYTWSE
                     EHYHAGGSVQNGAAEQRDLKGKFGLEDVYFAGPTMTFQEPTFIPREGGAEGEGYLIAL
                     LNHLDELRNDVVIFDAQHLAKGPLAVIHLPLKLKLGLHGNWVDHRDIDAWKQRRAEGG
                     DVGPLKVATEPLPWQKKLAQQNGTNGTRA"
     gene            complement(712196..713109)
                     /locus_tag="THITE_2116475"
                     /db_xref="GeneID:11516180"
     mRNA            complement(712196..713109)
                     /locus_tag="THITE_2116475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653876.1"
                     /db_xref="GeneID:11516180"
     CDS             complement(712391..713098)
                     /locus_tag="THITE_2116475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653924.1"
                     /db_xref="GeneID:11516180"
                     /db_xref="JGIDB:Thite2_2116475"
                     /translation="MFSDHPDAYVEFLGARYRGKAGIKRLYKGRFQATFVNGRNGPVY
                     GWLLDHIMMQDIVDVDATGTHAWCRMRALMQAGTHQSIEEYYPGGHRQWWEGGLYENE
                     YIKENGVWKLFRYRYFPFWHANFESGWSHTKKNYVPWPTVTYPEDPLGPDEIFEQKML
                     WPDTRVVPFHYPHPVTGKPTAPDALRAPVYGADVSTSDPPLTLALPEGQSRPGASSRE
                     SKPGDKVLPELVQNKAE"
     gene            <714767..>715114
                     /locus_tag="THITE_2021402"
                     /db_xref="GeneID:11516181"
     mRNA            <714767..>715114
                     /locus_tag="THITE_2021402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653877.1"
                     /db_xref="GeneID:11516181"
     CDS             <714767..>715114
                     /locus_tag="THITE_2021402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653925.1"
                     /db_xref="GeneID:11516181"
                     /db_xref="JGIDB:Thite2_2021402"
                     /translation="PRSPAVSHAPVCSCCLAYQAVKSRERVRQALVLVQDHATTITER
                     SSRARFESIITGLAEVCILFDDAERLLVRTSSSSFPVEGKRSASELVDIILAAAAKKL
                     DWLNDAFQEARRDQ"
     gene            complement(<716176..>717819)
                     /locus_tag="THITE_118036"
                     /db_xref="GeneID:11516182"
     mRNA            complement(join(<716176..717188,717233..717566,
                     717613..717728,717792..>717819))
                     /locus_tag="THITE_118036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653878.1"
                     /db_xref="GeneID:11516182"
     CDS             complement(join(716176..717188,717233..717566,
                     717613..717728,717792..717819))
                     /locus_tag="THITE_118036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653926.1"
                     /db_xref="GeneID:11516182"
                     /db_xref="JGIDB:Thite2_118036"
                     /translation="MAAAVDALPCFDLFRNDDKFPSRRRRGRQQRAKRCAATRGAPAP
                     VLTRIDEPAWQESSSFGGPPGGGPASAASRRRLHGNPFGPSLRPNGNEGPKGKAGQGV
                     HLPSRGLKPRRCCGPERAGPGGLTLAAVTAKAKLALTPDIPRIYKTVQSLPRSPMANS
                     IKKALEAAAYQSTAQDIRLAIFCDASFKSPSAVGGYGVSFRRYAPGEPWHGEEMGLGW
                     PIEVAADNSLCEMVAIIESLVVARREVSSIAVSRRPHSLPLSVSVTVFSDSKVCLDGI
                     SRSRTRPRQHGGAFEQLFCRLEEEEAKLKLLRDMSGIFVSVEYAWVPGHCIEPHDRAD
                     LLAKTARKTNKPVWQRGDNAIRPDHPFTSPFPFTSVFPSLRPLFVAHRARVLAKRARR
                     QPHALSPRKHGQQQLEGEQREDQDGEQPMGRRGLRRMRLKEFAKRVEAQIQRRGAATG
                     CQAAIAGSQEEGQKNLSHGESGDTPVWARRKGRTPDKKVQRKGYGT"
     gene            <719711..>720308
                     /locus_tag="THITE_2129465"
                     /db_xref="GeneID:11516183"
     mRNA            join(<719711..720140,720208..>720308)
                     /locus_tag="THITE_2129465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653879.1"
                     /db_xref="GeneID:11516183"
     CDS             join(719711..720140,720208..720308)
                     /locus_tag="THITE_2129465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653927.1"
                     /db_xref="GeneID:11516183"
                     /db_xref="JGIDB:Thite2_2129465"
                     /translation="MPTDDEGCQVSFRRLKLGDDWLSHYRMVDRLPEPGQQQANWTHT
                     PGSPSAAPMAISQSKFGLLAASHGMTYSLRSANGSTSGPPLQDSCGSQSSKSTTMPSS
                     IRAWIWHYLDDNLFSFAASADLVRFASPVWDHVRALRHHLSVLRAGHGDLFTASHSRS
                     RRARRRPGAGQRKRPR"
     gene            complement(721032..721959)
                     /locus_tag="THITE_2116476"
                     /db_xref="GeneID:11516184"
     mRNA            complement(721032..721959)
                     /locus_tag="THITE_2116476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653880.1"
                     /db_xref="GeneID:11516184"
     CDS             complement(721257..721829)
                     /locus_tag="THITE_2116476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653928.1"
                     /db_xref="GeneID:11516184"
                     /db_xref="JGIDB:Thite2_2116476"
                     /translation="MSERLVVSHREAGNTDEDGCRYQEVAHFLYSSTTFSFASFAELG
                     AFLDWINPENIASIRSINLIAHMVPDSAEYCTQLMRGNYFRGDGWDHVALLKRMPGLT
                     TLEIDFFPSAMLSFTTRFNEIMKPLEELSAETDIRVRLPRIFYNKDKRGQGLPILQHV
                     EDRPAFYTLRRPEAVGGNQLGRCKAYCVLF"
     gene            <723625..>726870
                     /locus_tag="THITE_52833"
                     /db_xref="GeneID:11516185"
     mRNA            join(<723625..723782,723855..723965,724026..724259,
                     724328..726069,726140..>726870)
                     /locus_tag="THITE_52833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653881.1"
                     /db_xref="GeneID:11516185"
     CDS             join(723625..723782,723855..723965,724026..724259,
                     724328..726069,726140..726870)
                     /locus_tag="THITE_52833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653929.1"
                     /db_xref="GeneID:11516185"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="JGIDB:Thite2_52833"
                     /translation="MDCFAAPAIRTRDAIEDIWGPRTPYKDEWPTRVDYALDEEPEAW
                     VQSACVLCSNGCGLDIGVKDGRVVGVRGRATDRVNKGRLGPKGLTGWKAIHSKDRLTY
                     PMVRKNGRLERATWDEAMGLIVAKSKELQKHLTNHSIAFYTSGQLFLEEYYALALVGK
                     AGLHTLHMDGNTRLCTATAAASMRESFGSDGQPGSYADIDYTDCLFMVGHNTATTQTV
                     LWSRILDRLEGPLPPKLVVVDPRLSETARKATLHLAPRVGTNLALLNGIQHLMFKNGW
                     IDEDYVSKHVIGRSESEKVVGEYDPDTVEKVTGVPVKQLEEAARIIGTAKSLVSTALQ
                     GVYQSNQATASACQINNINLLRGMIGKPGCGILQMNGQPTAQNNREAGCDGEFPGFRN
                     HQNPTHMKELAELWNIDPIHVPHWNEPTHVQNLLNYIESGSVRMFWISGTNPLVSLPN
                     LTRIRNLLTQPGLFVVCQDIYMTETAAIADVVLPAAQWGEKTGCFTNADRTVHISHKA
                     VEPPGECKSDLDIFLDYAKRMGFKDKDGNDLIPWTTPEEVFEAWKKVSAGRPCDYTGL
                     SYERLTGGSGIQWPCNEKNPQGTERLYTDGVFPTDIDYCESFGHDPETGAPYTKQQYM
                     SMNPAGRAILKACHYSPPLEEPDEEFPLRLSTGRKVHQFHTRTKTGRTALQKACPEPE
                     VRVSEKDAASAGVSDGEMVIVRSRRGAVELKCSVGGIAEGQVFVPFHFGYWDSQDGRA
                     RAANELTFDRWDPISKQPYFKSGAVRLEKIPSPTSTNTSTGAPHIREQHSDAIRKAAA
                     KSAAATTASASASDLAAGRERQLEHWLGETYETAAQLEQIYTTLLPSLIDDLEVEAGL
                     RVLRRIGEDMRAALAPHARRHGYDVEDRLRSGSSRRRAAQALRDALFPPDRESETTAR
                     RSPLEVLRALQALAVYLAHIEVGLTALLPAAQALWDEAFVEAVIKAQGCLDRMQGWVR
                     HQVKVRSPQTLVVPVRKEE"
     gene            <727522..>728868
                     /locus_tag="THITE_2089085"
                     /db_xref="GeneID:11516186"
     mRNA            <727522..>728868
                     /locus_tag="THITE_2089085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653882.1"
                     /db_xref="GeneID:11516186"
     CDS             727522..728868
                     /locus_tag="THITE_2089085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653930.1"
                     /db_xref="GeneID:11516186"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="InterPro:IPR005110"
                     /db_xref="JGIDB:Thite2_2089085"
                     /translation="MTLSYAAGLAKVLEVARQQHNTRQKPEENVPLQDAIGGVPARAV
                     LSPRSIPEYDTSAMDGYAIRSHDTTTASPDTPVVFRVMGTVAAGDEPENGLDAGPEDG
                     VPPCVEIMTGAIFPEGYDACVKVEDTVAVRGPDGRCAGCIAVTRRILSGENKRFAGSD
                     IRQGHAVLKQGDTVQPAHILPLASLGVAEVPLVRRARVGVWSTGKEMTNGKAGTKDAN
                     GPYLTAAIKEMGLEAEFLGVLDDDLATLRSHIRKAADAERYDLLLTSGAVSKGRFDYI
                     RAALDEMGTEIMFHGLYIRPGHPVLFGLVPSKESKAAFFGLPGNPGAAAACFRLLTVP
                     YLRALQGQPQEQPIWASLRQRTDKRQDAHSCASKQNRDIFRHGVLSTSPSGGLFAEAS
                     NEQSPAKLGPFRAANCWIRFRPEPDSIPPGTDSLPLVECYPISPTGAIRLAPCLPN"
     gene            complement(<729076..>729633)
                     /locus_tag="THITE_2030938"
                     /db_xref="GeneID:11516187"
     mRNA            complement(<729076..>729633)
                     /locus_tag="THITE_2030938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653883.1"
                     /db_xref="GeneID:11516187"
     CDS             complement(<729076..>729633)
                     /locus_tag="THITE_2030938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653931.1"
                     /db_xref="GeneID:11516187"
                     /db_xref="JGIDB:Thite2_2030938"
                     /translation="PLLLAGGKSTRMGSPKHLLPMPDGRPLYQHQLDLLARACPDAPT
                     IYISLAQDSPLDRFLQSLTPSQDPPSPPTSPRPTTAPPAPASAPNPNPNKPSIALLRD
                     ARPNPAARSAGPAAGLLAAFRARPAATWLVLAVDYPLLTPGMLRALCAAYAPPVTCLR
                     NADGFCEPLVAVWGPAALGELRRRVE"
     gene            <730413..>730980
                     /locus_tag="THITE_2089087"
                     /db_xref="GeneID:11516188"
     mRNA            join(<730413..730623,730700..>730980)
                     /locus_tag="THITE_2089087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653884.1"
                     /db_xref="GeneID:11516188"
     CDS             join(730413..730623,730700..730980)
                     /locus_tag="THITE_2089087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653932.1"
                     /db_xref="GeneID:11516188"
                     /db_xref="JGIDB:Thite2_2089087"
                     /translation="MKPFFTTLLCFFASAASAAKHAKTPAAPGLTYLYSLNCTLGPSI
                     AVGSGPHGTRTVIPITGGTFSGPRLSGKVLDLGADWGLVDRNGTFSADTRYQLQTDDG
                     ANIFIRTSGPAQPDGHLHLRMEFETGSAKYYWLNNIVAVGILTTGNGYVLIDGWQLES
                     PKA"
     gene            731882..734194
                     /locus_tag="THITE_2116478"
                     /db_xref="GeneID:11516189"
     mRNA            join(731882..732674,732735..734194)
                     /locus_tag="THITE_2116478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653885.1"
                     /db_xref="GeneID:11516189"
     CDS             join(731956..732674,732735..733896)
                     /locus_tag="THITE_2116478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653933.1"
                     /db_xref="GeneID:11516189"
                     /db_xref="JGIDB:Thite2_2116478"
                     /translation="MKRRGPPNKHAEAARAAKQQRLEPNISPGPHNAAETLISIAGGQ
                     DAQQVLDAESIAPWPVLTLLIDDFFTYIHPLAPFPHEPTFRMSFTARQDRTNRGFLAL
                     LASMIGCLVASFPRTARLHLKTQQHGMKMYPKAITLIDRCRTVALEARGPTFYSRDDI
                     TVYDAATSYFLGLAAAYTMQWKVCRRFMAECMAFIRELGYHKPRDLGSSMFGVTYRGP
                     SFNHVEDQLGKRIFWCMFVGLRSMHQLGSHHSDVVLPPPTPTEPYPELPVEVDDQYIL
                     PHQILGQPEGVVSLLTGFNQGIKIYMTMNGLVSVEVSYGISTLPFNDQKAMLEESLQA
                     VKQVMDGLPRELTIELNGGAGNSQAHGPSGLHPAGPQAGGFDDSNGGLHYYPIGFAGM
                     QPPNLRHKPSPQLQRRRLLQYEIQKANIYASQLATRSYYVERYLNLRDAHREHARAQA
                     AQAAQAAQASSSSSTTTTAAVDTSTKSVAAAARQHAAAKQHPHHPNHPADPVDASMTA
                     ERELIVQHLLTVLTSISQRSMEPNGASLINKIRQVASTLVNDDPKRKGPVAVKNQESL
                     SRFVEILMRLERVPPGGGPGGGAGVAVGNGDDEEVELRSWADLRDYQVRFLQGGGFMN
                     LP"
     gene            complement(<734514..>736337)
                     /locus_tag="THITE_160765"
                     /db_xref="GeneID:11516190"
     mRNA            complement(<734514..>736337)
                     /locus_tag="THITE_160765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653886.1"
                     /db_xref="GeneID:11516190"
     CDS             complement(734514..736337)
                     /locus_tag="THITE_160765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653934.1"
                     /db_xref="GeneID:11516190"
                     /db_xref="JGIDB:Thite2_160765"
                     /translation="MSHKTSPLHLQATARCMAQSLPARLIAAVAGGFGTDFKYQYDEP
                     DNSYHEIMMLLPVVHGAGAVSKATTQAALRRVVLHDHGSVVRFFMTSVRYPACVSSVE
                     ELHCHVNLGCHSSKERLDYDVECVESLSTHLDYCRVSLGILKSIHQLMASELADESYR
                     AALDLRFRQSVFFSLLGHLRSIHTLRMTVYPGASQGLRWLSSELQHRYPEYIASVAPC
                     LSPCPSLRKVALCATAAYPATDPWPPLSLWPLINLPTVEELELETCPGSQIAVDTLPC
                     APSNATNNAAANENISPPILAHLQVVRIKGTLATVLPTLRRLLPSTPNIHTLEIYLTT
                     PVPFNPPSTATTPNQPTTFNLNTLLQPAMLLPRSLRYLSLTTTTTTSATPSNQPNQPT
                     PPAHSQPAKAISGPAPDTLARLASLRALHIPIWALFDASPLSHGGSGGSGASDGGVGG
                     VGVGRGGECLDGPGAGARSAAPRLQAAGGDGDGVSPGHRVRLPSGLERLEVVVDGWWG
                     SGEGGNMGEGGRVGAGEAMRALAEWCAREERRALRRVVVWCGKGADGGRWWSVAEEEE
                     LGKRFRLMGVEVEFRVYEPWPEGKVGGWRMLGAENDDQAKE"
     gene            740167..741986
                     /locus_tag="THITE_2116481"
                     /db_xref="GeneID:11519850"
     mRNA            740167..741986
                     /locus_tag="THITE_2116481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653887.1"
                     /db_xref="GeneID:11519850"
     CDS             740251..741627
                     /locus_tag="THITE_2116481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653935.1"
                     /db_xref="GeneID:11519850"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Thite2_2116481"
                     /translation="MAPGRVLARQAAGAAAAGRHSLTKHTPASYRSFASISQSPVSPA
                     RNHRVVVVGGGSAGLAISHQLLRSGRFAQDDIAIVDPAEWHHYQPGWTLVGGGLKDKE
                     QLRRPLASLVDPKLKLYSEPVSSFSPDDNSVLLGNGSTLTYDQLVVVPGIKVDLNSIK
                     GLPEAVSNPDSNVSCIYTYETVDKTFKTIQRLRGGQAIFTQPAGVIKCAGAPQKIMWL
                     ALDHWKRAGLYQPQQGGSSSSPIQIAFATGLPVMFGVPKYSAALEALRQARGVEGLFS
                     HDLVEVDGETAVFAGPDGPVRRRFDLLHVVPKMGAHAFVKQSPLANEAGFVDVDDATL
                     RHKRYANVWSAGDASSLPTSKTAAAITAQAPVLVRNLLRALEGGAEPHPGYDGYTSCP
                     LLTEYGKVMLAEFKYGGVPQETFARFGWDQATPRRAFYHLKKDFFPWVYYKSMVKGTW
                     GGPKGWIN"
     gene            743704..745186
                     /locus_tag="THITE_2116482"
                     /db_xref="GeneID:11519851"
     mRNA            743704..745186
                     /locus_tag="THITE_2116482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653888.1"
                     /db_xref="GeneID:11519851"
     CDS             744033..745076
                     /locus_tag="THITE_2116482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653936.1"
                     /db_xref="GeneID:11519851"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Thite2_2116482"
                     /translation="MASPAEQTLLVTGANGFVASHILKLALEKGYHVRGTVRSESSAA
                     SVRAKFPEHSDKLSLAVGPDLTKPELYAPAFAGTAKPITGVLHVAANFTLKVDDNRRD
                     LLDPAIGGARGILEATARYGRDVRRVVLTSSFAANIDLSKGARAGYTYTEADWNPVTY
                     EQAAAPGVDGATAYCASKALAEKAMWDWAAEHKPPFDLVSINPPWIFGPHVGGLRDLA
                     RLNESTAALHALIGAAEVPPPDYAGFADVRNVADAHLAAFEKPEAGGQRFIVGLHFDY
                     QSVVDSVRREVPELRDRLPVGKPGKVPEMYELDGSKAERVLGIRYIPLERSMRDSFVQ
                     FVEAEQALAAASA"
     gene            complement(<750123..>751132)
                     /locus_tag="THITE_118025"
                     /db_xref="GeneID:11519852"
     mRNA            complement(join(<750123..750168,750260..750270,
                     750339..750412,750443..750538,750653..750706,
                     750860..750869,751103..>751132))
                     /locus_tag="THITE_118025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653889.1"
                     /db_xref="GeneID:11519852"
     CDS             complement(join(750123..750168,750260..750270,
                     750339..750412,750443..750538,750653..750706,
                     750860..750869,751103..751132))
                     /locus_tag="THITE_118025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653937.1"
                     /db_xref="GeneID:11519852"
                     /db_xref="JGIDB:Thite2_118025"
                     /translation="MTATIVMTAILIYCSYNTLFQYLKYCKDAKNIKEASALEANDGI
                     DSPLGNYTHLYIAVYTKEDRASRSIIGYNLLNLLDHSIERYKGKYRRYYRALIDYNVK
                     KVDL"
     gene            <754551..>756017
                     /locus_tag="THITE_2050376"
                     /db_xref="GeneID:11519853"
     mRNA            <754551..>756017
                     /locus_tag="THITE_2050376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653890.1"
                     /db_xref="GeneID:11519853"
     CDS             754551..>756017
                     /locus_tag="THITE_2050376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653938.1"
                     /db_xref="GeneID:11519853"
                     /db_xref="JGIDB:Thite2_2050376"
                     /translation="MSSSAEEKSGRTATPAKFRQLHVKLPTETPPAQLPPHWPRPSDS
                     TTPSNAWLAAHPRGFLLLHNMHESQPMGKCMLLESLDTGELVVNKRLYRYSRRYPRAS
                     GEAAWQTEYATRAPGEVRFARLDDPLVEARLPDEPYFPELLAYGFPAWPRTFAANAHG
                     SQADLFSLYFRRCNGGSLSNLMEMYADAAVGAPVPEPFVWHVIEQLTRAVVFLHTGLT
                     RAELDAGARRAKDGWVPIVHRTIKADNVLLHFDSLDGGDGGGDPLDRCFPRVVLEGFD
                     QANFTNDAEEWWCPRALASYASQKPQRPECWEDVHLVGELFRRLVTVHDCARMQDARR
                     QVVSVQPDEEPFSLRFDVEGDGRLDRHLSRNLQLGGGKALAYSDELIKLLMKWEIPAL
                     QQNLESFFADEDIRKSIPDTKFLLDEVLPLAVKKVKEYRALGFDKLASDADNGGWSAD
                     VSWVMPDPAFERIPYSNNRGSVEHSLSALRVELARLFGP"
     gene            757811..758148
                     /locus_tag="THITE_2116483"
                     /db_xref="GeneID:11519854"
     mRNA            757811..758148
                     /locus_tag="THITE_2116483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653891.1"
                     /db_xref="GeneID:11519854"
     CDS             757828..757995
                     /locus_tag="THITE_2116483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653939.1"
                     /db_xref="GeneID:11519854"
                     /db_xref="JGIDB:Thite2_2116483"
                     /translation="MRMKRRVKRRRGGMRGGMTGRMRQENEEEGSEEEEKGDEHDEHE
                     ALEPEEEEDET"
     gene            complement(<758688..>760755)
                     /locus_tag="THITE_118023"
                     /db_xref="GeneID:11519855"
     mRNA            complement(join(<758688..759841,759878..760213,
                     760284..760516,760604..>760755))
                     /locus_tag="THITE_118023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653892.1"
                     /db_xref="GeneID:11519855"
     CDS             complement(join(758688..759841,759878..760213,
                     760284..760516,760604..760755))
                     /locus_tag="THITE_118023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653940.1"
                     /db_xref="GeneID:11519855"
                     /db_xref="JGIDB:Thite2_118023"
                     /translation="MPTANRKPRDPNLPAEAWEPFKEHIKQHLRAGGTVKQLMEFMER
                     TFGFKASLRQYRHRISQWGLDTKVKKHEMEAIVRVQHRRRLKEPGKNELAFWVRDRLV
                     PKHKIDRFQKANGIPNDVPYSPPSHGPTPPSVRYQTVSPPGTPQPTTSQPVVFQNSEP
                     PAQVSVPTDATIEEGAGTLRSPDWPEGATRRHQGLASSSHSQDPRPSQPFWDFMDVEM
                     ELRQDRPIHPEPQGTVPSRLTPGPDQNSTIASDLISADATTFGLSLPDISDLSMPMSD
                     LNFREDHVESTSLAPLAQDGAAGPLMDIPPTPGPVAEVGERYNHQARQHGSEGDGNSR
                     SDDLFDQIIRIDEASGDLGPCATASSALGDEHTPSPARAPTEAEEGPGRDPTPTPKEP
                     QQAGRRSPKGKGPDLPSRTTAAGETSDTLGRDSPSPSDSASDLALKRDLASDLARIKS
                     YLDSRNTKAAMSLFHKLLERLSEPVEHGFLPRTRTLIMAFDNRPRFVELRELITGFEA
                     AIRRESTQLGRHHPRTLHLRVAFVHLILKMLRDSKEKEERLGEDEVEEIMRISHSQLR
                     EIYGCCFTGDALERFVPSLDDDTTDDKEKLDHLVPDYSFLKTFVTACAKPPSLVVVRM
                     "
     gene            complement(<764554..>766038)
                     /locus_tag="THITE_2144921"
                     /db_xref="GeneID:11519856"
     mRNA            complement(join(<764554..764821,764936..765528,
                     765633..765689,766018..>766038))
                     /locus_tag="THITE_2144921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653893.1"
                     /db_xref="GeneID:11519856"
     CDS             complement(join(764554..764821,764936..765528,
                     765633..765689,766018..766038))
                     /locus_tag="THITE_2144921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653941.1"
                     /db_xref="GeneID:11519856"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Thite2_2144921"
                     /translation="MLHPASVGRIPFDAPNAGKPAETWYKIVGSLDSLTPPLIALHGG
                     PGAGHRYLTSLVDLYDKYKIPIIFYDQIGCGNSTHFREKPGDTTFWTFELFCAELDNL
                     VDHFGLREKGFYLLGQSWGGMLAGAYAARSGAVGLKKLVISSGPASMPLFAKGLRRLL
                     AQLPEDVRTVIEDCERRGDYESPEFEKAAAVFYARHVCRLDPYPDAVANAFENLKDDP
                     TVYHTMQGPSEFIVVGSFKDWEGWKDAHKIQVETLLLNGRYDEVTDLTVDPWFQTIPR
                     VRWVTLENSSHMSHWEDRERFMEVVGSFLAGPALEG"
     gene            complement(<767352..>768072)
                     /locus_tag="THITE_53202"
                     /db_xref="GeneID:11519857"
     mRNA            complement(join(<767352..767606,767641..767876,
                     767955..>768072))
                     /locus_tag="THITE_53202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653894.1"
                     /db_xref="GeneID:11519857"
     CDS             complement(join(767352..767606,767641..767876,
                     767955..>768072))
                     /locus_tag="THITE_53202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653942.1"
                     /db_xref="GeneID:11519857"
                     /db_xref="JGIDB:Thite2_53202"
                     /translation="ALPDRILEYEERPEWGEMQHPWNLGLSEEVDAAWEDLLYALNIR
                     ISEDEMSILHENRTHRVRVNGGDYVGVLGVYHHMHCLYNLRRVVHWDYYGPLLGDAKD
                     SEGFSKAHSGKASRTSTNLAHLTDHCIDSIRQALMCHTNTALYTAEWVKDSHDPFNKE
                     LRSSAVTTCIKWDSLSNWARKRALVPGTYTYLPGPYEGKEEA"
     gene            <778730..>780500
                     /locus_tag="THITE_2144922"
                     /db_xref="GeneID:11519858"
     mRNA            join(<778730..779060,779137..779954,780036..>780500)
                     /locus_tag="THITE_2144922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653895.1"
                     /db_xref="GeneID:11519858"
     CDS             join(778730..779060,779137..779954,780036..780500)
                     /locus_tag="THITE_2144922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653943.1"
                     /db_xref="GeneID:11519858"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Thite2_2144922"
                     /translation="MSSRETELHASPNGAVKIRSVVSKLDDDTLLQRLGKRPLLKRSF
                     NFMSMLGFSCSALLSWEGVLVTSVSGLLNGGPAGVIWGFLINWVGMMSVYATMAELAS
                     IAPTAGGQYHWVAMMAPKSSRNFLAYLTAWLTTLAWQAMAVSTAYIIATMLQGIIILS
                     QGPEPTYVPENYQTVLILWASVIFAVVMNSTTGRALARFEGLVLVLHLAGFFGVLVPM
                     VYFVPHGIAGSNDARTVFGTFLNTGGWSSQGLSFLVGFPQVGTSLIGADCAVHMSEEI
                     KSASVVVPRALLYTIFINGLLAFGMIVGLMFSITDLDSALEASNTMFYPFLEIFRTAV
                     NSTAGAVAMACVILVLAVASAVGVYASASRMMWSFSRDRGLPFSKLLVKLTKNALPFN
                     CILATLTITVLLSLVALGSSVALNALLSLIIAALFSTYLLVTTLLLWRRTTGAIQPYV
                     VGAESLDADSLAWGPWKLPEPFGVLNNVFACVYCVFLLFWSLWPQYTPTTPTTMNWSV
                     LIWGFVVLASVTWWVLRARHYFKGPIREV"
     gene            complement(<781606..>782799)
                     /locus_tag="THITE_2144923"
                     /db_xref="GeneID:11519859"
     mRNA            complement(<781606..>782799)
                     /locus_tag="THITE_2144923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653896.1"
                     /db_xref="GeneID:11519859"
     CDS             complement(781606..782799)
                     /locus_tag="THITE_2144923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653944.1"
                     /db_xref="GeneID:11519859"
                     /db_xref="InterPro:IPR005065"
                     /db_xref="JGIDB:Thite2_2144923"
                     /translation="MQPILAIGLLLLTKRVTGYLVPNPPGKYNVTLTTGSLIDYSRND
                     PYAATPTPRALMLSVFQPAKCASTVPVPIMPDEVADYQGPFLQETFNISANFTPLFLE
                     ARLPVCSSDHARGCSALDDSPILLFSPGYSIPRFYYNVLASAIASEGFTVITIDHPED
                     TNIIVYPDGHAVYNNASILDSPTWDLYPLAADTSFVIDQLSNATAIAALLPRRGPRPF
                     RTYRVAALGHSVGGAAAVVAASRDPRIRGAINWDGTILGMSPPAGEPSSSSSSPQPSL
                     PVRPMAQPVLFMSHQNFLDPTWTATWERLAGPKMIVYVENTTHYTFSDVPTLLQAAGQ
                     STEPWAELLGTIAPAEMVRVLTAYTTAWMRAVFAGNMEAGGPLLKETAPGRFPGVSIL
                     MKGNL"
     gene            <783624..>785300
                     /locus_tag="THITE_2050521"
                     /db_xref="GeneID:11519860"
     mRNA            <783624..>785300
                     /locus_tag="THITE_2050521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653897.1"
                     /db_xref="GeneID:11519860"
     CDS             783624..785300
                     /locus_tag="THITE_2050521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653945.1"
                     /db_xref="GeneID:11519860"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2050521"
                     /translation="MESTSATTTKRTRVVVAQSKRGCVTCKYGSSPFHPPAPSPILLT
                     GRCRTRRVKCDEQRPLCRRCIQAGRLCRGYVDRQESSLSALQPALKFGVAADRQMERL
                     SHLAAHVLSLDSDGRPLQGDGVWGRIFLQLSSQVECVKAAAAAFGAAYESSLNSGAVV
                     NSPSSSSWRYYGSALARLQSDLNGGAVGPESLALASMILACVEILSQHEQNAFTHFFG
                     AVQILTKAYQPHTSAPSAAILGRIRDELVKMNLSIGSYALAQTPAVMHLEHQAAAGVD
                     REAFSDPELAINTAMSCLHQSYQFIESAARLRYTYPSWKEHDPILCQGQSDAVNQCRS
                     VLDGLAALATRLQAQQASATSTARDSETMAEIYAMSAQLTAALIFLLCVHEPLQTAYD
                     GHEDLFRSIVRDAAASARLRRRAQPSALRRFSTRPGIVGPLFVVSAKCRDPPLRALAT
                     TMLGEQGREGPTDGRIMAAIGARLAALEMSACVPSVPGAPLTAGDVPESQRVHGYGVS
                     PPRVDGEGRRVVDVQFSRPKVPLEQGWGLVDYSCLDNWILWSEPIEISGA"
     gene            complement(<786183..>787301)
                     /locus_tag="THITE_2050802"
                     /db_xref="GeneID:11519861"
     mRNA            complement(join(<786183..786467,786525..>787301))
                     /locus_tag="THITE_2050802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653898.1"
                     /db_xref="GeneID:11519861"
     CDS             complement(join(786183..786467,786525..787301))
                     /locus_tag="THITE_2050802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653946.1"
                     /db_xref="GeneID:11519861"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="JGIDB:Thite2_2050802"
                     /translation="MATTNKTLIFKKVPTAMPVPGEHLVIEDRGFDASAPPPPGGLTL
                     SILYASFDPYLRGRMRPADVKSYRAAFELGGPVTNDTVARVLKSDCAAYAPGDLVVAH
                     LPIAEYAVLSREQVPTAVKSKVENPHGLRDLGLFLGPLGMPGLTAWSSLYEIGKPKAG
                     ETIFISSAAGAVGQVVGQVAKRLGLRVIGSVGSDDKLEFIIKELGFDGGFNYKKEATR
                     EALQRLAPDGLDIYYDNVGGEQLEAALDAMNDFGRIVACGMISQYNLPDKERYGIKNL
                     FQVVTKRLTMRGFIVSDPGFGDKYKKDHQEKMQQWLAEGSVKAKLSVTEGIDNAAEGL
                     VGIFEGKNFGKAVLKVKDE"
     gene            <789666..>790260
                     /locus_tag="THITE_160751"
                     /db_xref="GeneID:11519862"
     mRNA            join(<789666..789687,789774..789984,790104..>790260)
                     /locus_tag="THITE_160751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653899.1"
                     /db_xref="GeneID:11519862"
     CDS             join(789666..789687,789774..789984,790104..790260)
                     /locus_tag="THITE_160751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653947.1"
                     /db_xref="GeneID:11519862"
                     /db_xref="JGIDB:Thite2_160751"
                     /translation="MASQQQQVPIEMKQGVQQGAPPPFTPQGPYMQAAPPQPQYQHAT
                     PLANLLQVPAPVDCPVCRNRTLTRIEYVSGGFTALIAFAVLGLCCCCIPFFIDGTKNV
                     RHYCGSCNALLATWHRSGHGTDVHAYA"
     gene            complement(<790257..>795749)
                     /locus_tag="THITE_118016"
                     /db_xref="GeneID:11519863"
     mRNA            complement(join(<790257..790466,790679..790744,
                     791095..791114,791537..>795749))
                     /locus_tag="THITE_118016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653900.1"
                     /db_xref="GeneID:11519863"
     CDS             complement(join(790257..790466,790679..790744,
                     791095..791114,791537..795749))
                     /locus_tag="THITE_118016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653948.1"
                     /db_xref="GeneID:11519863"
                     /db_xref="JGIDB:Thite2_118016"
                     /translation="MQKQRWASQAGGDRALPIHILVVDADYEHSLPPPSAGLTPFPED
                     HDYGSDKGTTSAFHGMWLHPDNQTLGTGAFTIADYGGGDDAEAENAEEDSSLDVPSEE
                     PELGSYYDVPADDEEQSLPSGQLKPPLEGWAYRGDLHSVSGTPPDTGKLLRVSRDDLQ
                     SEGAIFDHYNDEVEGTSEPESQYDNDPLDAYHGEHASGKGYKPVSREAPSGPTSPKRG
                     HGPLTDRSASIDGLEAEPDGAVVLDAKSDPPRADESGSEVDFPLDNGVLTPDPQEFPF
                     SELPSPSLYIGLHNEPLSKALIQNPFPTEANRNQNTKSLEHERANHAQGVNDNSIHAH
                     NDDKHSTSHAHFTTMRNSSAPLDTSARRVESASGSLHDTSCGDSDGSQVGNEDLKEEE
                     GIDGKAVGQFDEAEVDKDSKPAMESHMLLGGERASTSKPLPKSEAESCLRGAKRLLSV
                     HDGLPLEGEPDVLFGGDRAILPEACARPHGGEHRLSPENGDEILLEGELELLFGYQEP
                     DSNSADSAPLEGGFDHQRTLTEPESPEAELVGAEDSAESVARGSKRGLDQGVQIDDVG
                     HKGHPDEGVLGKPLSTETSTEEAQSDGTPALGQSQTFDELTPMDRSTHLDQQNSGQPG
                     QGSGGLSPVAGPFTPRSTALGVTSAFDVYSESEPETEVVVHMEDARDEMSDATPGHQE
                     AARVDSGILDPSAGHVQPDDAESSRKLSVGDSLQGPSSDSGLSESGGESFKQQDDQVS
                     RPEGGQNFDESRFNLGSQNRSPGPAFTESNGKHAPSPRHHRNTTSLEPVAPVSPMPQP
                     TPPLDVKDDGPLVTPAPQHDSGENRVLTPPPDQEPRSMPSPAPFGEALHEINVYLDST
                     VDSGNSSLATLPEDNSGLQKRHNRVDNNGEVTSAEQRDEKPTAEDDLKADVAEPWHEE
                     EPGPKSTPPLEEHERPPDDDFDFHHPSARMQDDQGVIPKAAQSRVVASEEPLDRNETR
                     GAEMHMRVPQLEAGVVYPDVQQQHLHDGQVPRFPRLEARDGLPARPAPSFRQRPKGQY
                     HPDAYSVPARPERDIHRTLDIHRSPEQRYPTARTRNGAVPYHVYAPMRMMAVRGEPLE
                     VAVGEFSNSRGPEPSPKRQGLLARLFGWKPRRRRTEVEETGRNPYSEAHSTPPKRRGL
                     LGLLFNPHRLSKTEDRDTDNGTYRSHQLETAPNRRDITARTLQKKHRPQPSRDGYANP
                     DLRAPHETPTKPQGFLASVFSSFRPKRNTRPQPSNSFLSRLLAPFRRTTRQPSDIELG
                     ALDSHHHRYHHHNNKNNNPLGLGRVHISSPQFIYHRPGLPQYAPAVAAPAVTTTTTAP
                     GWTAGRDNNNSVWPTLPEQQRGGRPQAQAPGQGQRKAGGSDLRRDRESRSRVGMGMGI
                     GTGLGMGWYRQGSFGDAAAGSGAGGAVCHYGATIQVALWSTGKLGNWGTLLWNPKFEW
                     MISLYFRKRKRRRNAGRECRSLGRLHYGAILAPPAFRLEEWKWKEKRPDDNQSRTALE
                     YAVRHDCA"
     gene            797598..799650
                     /locus_tag="THITE_2116487"
                     /db_xref="GeneID:11519864"
     mRNA            join(797598..798591,798649..798900,798961..799237,
                     799294..799650)
                     /locus_tag="THITE_2116487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653901.1"
                     /db_xref="GeneID:11519864"
     CDS             join(797930..798591,798649..798900,798961..799237,
                     799294..799344)
                     /locus_tag="THITE_2116487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653949.1"
                     /db_xref="GeneID:11519864"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Thite2_2116487"
                     /translation="MPLSKIIVVGAGPSGLLLTLLLARANITVELLEQTHSLDTNPRA
                     SHYTAESCMEFDRAGILDEVRAQGFTPDGVSWRRLDERKTRLVSLRNAINDPDAEPGR
                     YRMVCLPLHKLGKILEARVRAQPTAEIKYGHKVVEIGEDAGKGKAWVRVEKEDGSSEV
                     READYVVGCDGANSIVRRKLFGDMVFPGFTWDQQIVATNMYYDYEPYDYDDSQFFVHP
                     EHWHMVAKIQTDGLYRVTYGEVGGLTYEQLKERQPAKFQAFLPGNPTPDKYKLVNFSP
                     YKVHQRCVDKMRVGRFLLAADAAHLCNPFGGMGLTGGIADIGSLYDALVGIHTGQADD
                     SILDKYDEVRRRIWHDIINPISSDNMTRLFKYSGPDEAMEKDPFFKLVTRMQNPGDGE
                     DEPPNPGLPSLRYDMTQHYRK"
     gene            complement(800744..801870)
                     /locus_tag="THITE_2116488"
                     /db_xref="GeneID:11519865"
     mRNA            complement(800744..801870)
                     /locus_tag="THITE_2116488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653902.1"
                     /db_xref="GeneID:11519865"
     CDS             complement(800987..801778)
                     /locus_tag="THITE_2116488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653950.1"
                     /db_xref="GeneID:11519865"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Thite2_2116488"
                     /translation="MGWHHSIIGMGASAFITCTDGKTVLKGQDVWENGRHCASFENPS
                     DENIVKEHAIYKLLGDHPNILQCFGLEEIHPGVRALRLELAPLGDLRRYLERHPNDGP
                     PLQTRLNMVLEIAAGLSHVHACGVWHSDLSTKNIFLFPGFHVKIGDFGGSVADALGYH
                     TGTLEDQDYELPCRGRDFRERPRNKRELFALGSAMYEIMSWARVFPGLSEDEMDERLK
                     REDFPAVDALVLGDVIESCWKERYSAVEEVVRDLTDRVNGADSSH"
     gene            complement(802938..804738)
                     /locus_tag="THITE_2116489"
                     /db_xref="GeneID:11519866"
     mRNA            complement(join(802938..803449,803507..803599,
                     803669..803830,803901..804125,804240..804738))
                     /locus_tag="THITE_2116489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653903.1"
                     /db_xref="GeneID:11519866"
     CDS             complement(join(803330..803449,803507..803599,
                     803669..803830,803901..804125,804240..804407))
                     /locus_tag="THITE_2116489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653951.1"
                     /db_xref="GeneID:11519866"
                     /db_xref="InterPro:IPR007736"
                     /db_xref="JGIDB:Thite2_2116489"
                     /translation="MDFDTAASHCPPTAARKQAANVDAFLSKPGIARANIAASTAAPD
                     GSPESVVKYKDYTVLQQHVLFWDRDADGLISPWDTYIGFRDLGFNVLFSLLAMLIVNV
                     NFSYPTRLAVSWWPDPLFRVYVGGIHKAKHGSDSGTYDKEGRFVPQMFEDMFSKWDVH
                     NSGSLSAGELWRMIKGHRLAADPFGWGAAIFEFGTTWLLLQKNGRVSKEDLRQTYDGT
                     IFWKIKEARESGKGWNKGFGLRDLIAIGQRKSKSHVM"
     gene            complement(805018..805109)
                     /locus_tag="THITE_t106"
                     /db_xref="GeneID:11519867"
     tRNA            complement(805018..805109)
                     /locus_tag="THITE_t106"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:complement(805075..805077),aa:Glu,seq:ctc)
                     /db_xref="GeneID:11519867"
     gene            <805813..>808548
                     /locus_tag="THITE_2049779"
                     /db_xref="GeneID:11519032"
     mRNA            <805813..>808548
                     /locus_tag="THITE_2049779"
                     /product="glycoside hydrolase family 2 protein"
                     /transcript_id="XM_003653904.1"
                     /db_xref="GeneID:11519032"
     CDS             805813..808548
                     /locus_tag="THITE_2049779"
                     /note="CAZy_ID 269658"
                     /codon_start=1
                     /product="glycoside hydrolase family 2 protein"
                     /protein_id="XP_003653952.1"
                     /db_xref="GeneID:11519032"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="JGIDB:Thite2_2049779"
                     /translation="MRTRRLYTVFPFASRLATATGAALVSSPGETAAIPSWDLQSTAS
                     VGTDLGTLSRTGLDTASWHHVSSSKCTLMGCLIQAGVYNETELFYSDNLLKVDDKQFS
                     VPWIYRHEFSLQPAAGQHFFLQTHGISSRADIFLNGQQVASSSEQAGAYAGQTYEITK
                     LVGSENALAIQVHPTDYYRDFAVGFVDWNPWPADNGTGVWRDVEVKQTGPVMLEPLRV
                     VTQLGTPLGISPANVTLKARAHNLENSSITVTVTGLVAPVSGGGAVIWTKALTLPPLS
                     VTDIVLDTVVHKPAIWWPRQWGEQPLYNAKITVTTADGGLSDAACSEFGFRSVTRTLN
                     SFNDTAYYVNGHPFQVIGGGYSSDIFLRWDTARWETQLRYVLDLGFNTVRLEGKNEHP
                     ELYSTADRLGVMIMPGWECCDKWEAWSYNDNLAVPSPIWSAADYAIANQSMLHEAAML
                     QPHPSVLTYLIGSDFWPDERATALYLAALRSLDWPTPVVCSAANHTCSAQTGPSGMRM
                     DGPYDWVPPSYWQSTPPASAALAAPFAGFNTELSPGCGTPPLASLSKFLSPADLDALW
                     RDPSARLFHMSRAGSSFETRGIFDAALAARWGAPAGLADYLLKAQLMDYEAVRAQVEG
                     FTARWAPEEAHAPPGGGRGRSATGMVYWMCNAAWPGLHWQLWDWYMRPAGAYFGAKVG
                     GRLESVVWDAVGKAVWLVNRSLHGRGHRQIAVDVLRADGRVVYRRVIPVQAMPNRSRK
                     VLALDWALWGVRDVVFLRLVLTDGKGTVLSRNVYWVADTLNELDWDNTNWYVTPVTRY
                     ADYTALNRLAPARVWAVAVRDREDGVAVILENKSRVPAFFVSLNLVDRRGQDVLPLTW
                     DDNYVTLWPRERMTLRAKAVAGTKWEPAAVEVEGKNVGKQTVPLSYGPSFAQKSN"
     gene            809888..811656
                     /locus_tag="THITE_2116495"
                     /db_xref="GeneID:11519868"
     mRNA            join(809888..810371,810461..810850,810925..811656)
                     /locus_tag="THITE_2116495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653905.1"
                     /db_xref="GeneID:11519868"
     CDS             join(810207..810371,810461..810850,810925..811410)
                     /locus_tag="THITE_2116495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653953.1"
                     /db_xref="GeneID:11519868"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2116495"
                     /translation="MSLPSTQKQWLIQGTDKGFDGLLYQDAPVPAVGDNEVLVRLRGA
                     SLNYRDLIIPQGKYPLPLNLPVVAGSDGAGEIVAVGANVTKWKPGDRVVTLFNQGHQR
                     GAIDPVAARTGLGGCLDGTLRQYGVFSQDGVVRLPRHLDFVEGATLTCAGLTSWNALY
                     GLKSVRKDDTVLVQGTGGVSLFALQFAKAAGATVIATTSSEKKAEILKKLGADHVINY
                     REDPHWGETARKLTPNGEGVDHVIEVGGEGTMTQSLRAIKMEGVISVIGLLTGAGSKD
                     SIMETLMRLCTVRGVYVGSREQMEDMVRAIEEHNIRPVVDEHVFTLDKIREAYDFMVS
                     TLVCRSSYEWVC"
     gene            813186..>814755
                     /locus_tag="THITE_165536"
                     /db_xref="GeneID:11519869"
     mRNA            join(813186..813725,813785..814421,814481..>814755)
                     /locus_tag="THITE_165536"
                     /product="squalene epoxidase"
                     /transcript_id="XM_003653906.1"
                     /db_xref="GeneID:11519869"
     CDS             join(813225..813725,813785..814421,814481..814755)
                     /locus_tag="THITE_165536"
                     /codon_start=1
                     /product="squalene epoxidase"
                     /protein_id="XP_003653954.1"
                     /db_xref="GeneID:11519869"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="JGIDB:Thite2_165536"
                     /translation="MPPAFDVLVVGAGVAGCAIATAFARQGRHVLVVERNLAEPDRIV
                     GELLQPGGVAAIAALGLSHCLDGIEATPVKGYHLFWKDEQAAFWFCPFSGSNNRVLDT
                     PGSKPIPPTGRSFHHGKFIERLRASIAAEPNVTLLEATALELLRDETTGAVVGAACAR
                     TGDSPAKHYASLTVLADGSCSNFRSLFTPHRPKAQSRFWGLELVDARLPRHGYAFAVL
                     GQGPPILMYQIGARETRILIDIPHDKQRQLRTTASVRRYIQQHVVPIVPESVRPSLEK
                     AAAQGRLRSMPNAWMPASRSAVPGLVMLGDAANMRHPITGAGMTVALKDAVLLSQLLS
                     PEKVPFLGNSGAVRKAVRGFHWRRKAHSATLNILALALYLLFVSEDPSLIIMQRGFIR
                     YVQEGEKNFAEPAWLMGGLVDSPFLLFYHFFMVALYSIRLHLGQAGWLGVPKAVLQST
                     LVFASAVGIIWRPIVDELRQ"
     gene            complement(815451..816671)
                     /locus_tag="THITE_2116496"
                     /db_xref="GeneID:11519870"
     mRNA            complement(join(815451..815965,816038..816108,
                     816172..816671))
                     /locus_tag="THITE_2116496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653907.1"
                     /db_xref="GeneID:11519870"
     CDS             complement(join(815712..815965,816038..816108,
                     816172..816644))
                     /locus_tag="THITE_2116496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653955.1"
                     /db_xref="GeneID:11519870"
                     /db_xref="JGIDB:Thite2_2116496"
                     /translation="MALITVAVDSGLGRHISTLATPQAHRALLFTTIGFVPGILSYTM
                     PKFAVVILIKDLLRPSRLHVMALWALAAVNAVLTVLCITFTYVQCEPPSALWTTGIVP
                     RCWDPLALIATSIASGATSALFDFWFALYPAAVLWRMQINLKKKVALITALGLGVCAG
                     IVAVYKCTTFETSRPQYNDLTFTSVNIVIWTTIEANAVIISACIPMLMPFVELVFGEN
                     FLRGGVNGQLPTIRSSSEPAASSESSDVGMKASERQREDWMRQVRGT"
     gene            <818276..>819624
                     /locus_tag="THITE_125550"
                     /db_xref="GeneID:11519871"
     mRNA            join(<818276..818628,818688..819315,819419..819432,
                     819465..>819624)
                     /locus_tag="THITE_125550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653908.1"
                     /db_xref="GeneID:11519871"
     CDS             join(818276..818628,818688..819315,819419..819432,
                     819465..819624)
                     /locus_tag="THITE_125550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653956.1"
                     /db_xref="GeneID:11519871"
                     /db_xref="JGIDB:Thite2_125550"
                     /translation="MSNIRSIVSFSALLALSQAGSSAAATVTKQCVQLEVPVPVVATN
                     RRYSMPRVESTIDAIDWTVTVTTWSTPSAMDRVTGLYPVNSTFRINAQLCVPPRNGAK
                     SDILQIATPGLGFDKRYWDVELKPEEYSYVDAAVSKGYSILTYDRLGTGKSQKPDAYD
                     VVQIPTEVEILAGLTNLARSGKLISSSKVLGSTHPVPKLQPSKVVQVGHAYGAYLITV
                     ALGKYGRLADGAVLTGFLLTNLTRMLDVLNYDHAFARQHDPVRFGEYTSGYFVLETES
                     CLQKLFLRKGAFEPALLAYTERIKQPEAVGEYASEGTSPLTPAAEFEGPVLLFNGENV
                     YDEDATRNVFQHAVNVTSYLQPNTGHALTVATNASAGYEVILQYLDSHGL"
     gene            <820336..>820767
                     /locus_tag="THITE_2089113"
                     /db_xref="GeneID:11519872"
     mRNA            <820336..>820767
                     /locus_tag="THITE_2089113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653909.1"
                     /db_xref="GeneID:11519872"
     CDS             820336..820767
                     /locus_tag="THITE_2089113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653957.1"
                     /db_xref="GeneID:11519872"
                     /db_xref="InterPro:IPR005502"
                     /db_xref="JGIDB:Thite2_2089113"
                     /translation="MASLPSLPPSATTSILRAALHDRVVGVLVGSALGDAIGLYTEFL
                     TAADAAAAYPTRTFTLTATPHPTPFKLDMHRAPKELGHWTDDTDHALLILLAFLHTAR
                     TSPSSPNPSTHPPANATPQANPSPPPPPLPTQHDLALRLHA"
     gene            <820946..821978
                     /locus_tag="THITE_2116497"
                     /db_xref="GeneID:11519873"
     mRNA            <820946..821978
                     /locus_tag="THITE_2116497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653910.1"
                     /db_xref="GeneID:11519873"
     CDS             <820946..821751
                     /locus_tag="THITE_2116497"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003653958.1"
                     /db_xref="GeneID:11519873"
                     /db_xref="InterPro:IPR005502"
                     /db_xref="JGIDB:Thite2_2116497"
                     /translation="MICLWRAEGEAFALAAALSRVTHADPRCVLACVIGTGLVRALVR
                     GAVSGEGEVDALVERAVEWCRGEDAEGMAMVNVEELWRHVKPDGGLEALQLDERAAIG
                     YVYKTLGSGVVLLRMAMRRMAASQGGLLDRTRLFEELITDLVMRGGDADTNACFAGAL
                     LGGYLGYCALPDHWKHGLKHEAWLLGKAEALCQVLGLKDGEYNGKDDKDTEVHGGKPE
                     LSKEEMEVRWMLLQQAMVKKMEDAAKAAASSAKDTSSRWPFAWLSNGPK"
     gene            <844237..>845805
                     /locus_tag="THITE_160737"
                     /db_xref="GeneID:11519874"
     mRNA            join(<844237..844302,844342..844532,844590..844619,
                     844676..845326,845385..>845805)
                     /locus_tag="THITE_160737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653911.1"
                     /db_xref="GeneID:11519874"
     CDS             join(844237..844302,844342..844532,844590..844619,
                     844676..845326,845385..845805)
                     /locus_tag="THITE_160737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653959.1"
                     /db_xref="GeneID:11519874"
                     /db_xref="JGIDB:Thite2_160737"
                     /translation="MSATNAGPITTIFTPPASCLSTSMFIGHWGAYDPATSCYPTSTK
                     LFLFVQEYYYSPGICPSGYWFACPWTGTSFPASVTASLCCPSDFECVDGWSHVCARGG
                     SFDGLEHVFVISRNSQTLASTAALTTATLEPDSFIWADGVPVAWETTDTAILKLLGQL
                     TTTSSTSGTSLSEESSSSIGRTSSEVAPKTSGTATATATDTGGSSLLVSPSTSTSDSQ
                     TTPSSTTGPTPTTAAITSEPLLTGNCASPSWTLLDMSTAYLYAPVLGCAYDNLNCCPF
                     QVDAAPRTGAPGPFPAASVARCPDGYVTVTSSACCLSGFQPLSTAFVSQSACVSRLSS
                     PLSQPPLPTTAQDASVTVGVVLAMQIPIETAAPSSGSGLSKGAVAGIAVGGAVALLVI
                     ATLVFLLVRKSRPPQPVSGLMVPEDKHPPVHVYPSELHGQGVSELPYQRDFCAELPGA
                     AR"
     gene            <846733..847972
                     /locus_tag="THITE_2095935"
                     /db_xref="GeneID:11519875"
     mRNA            join(<846733..846795,846891..846983,847104..847972)
                     /locus_tag="THITE_2095935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653912.1"
                     /db_xref="GeneID:11519875"
     CDS             join(846733..846795,846891..846983,847104..847862)
                     /locus_tag="THITE_2095935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653960.1"
                     /db_xref="GeneID:11519875"
                     /db_xref="JGIDB:Thite2_2095935"
                     /translation="MAQSAQDLSRLPVNGCDLFLLEKWDADSALSPDEQMRQIFARFL
                     ELPLPERQVYTQRVAARGVFSAGSLSPAEQDILALARPYNERNRGEVCLLRTYYGAGS
                     DAVFDAVVQTCRAFGGVGPECVFSDAARYNYGEDWRRVFGLMPQLLECHDDYEAECAA
                     EFARAQESDEEDEELGGWSRDDFTLAELFNHYHLASKVGVIYILDEETLGDDREDDDD
                     EKDGSAGSYSQRELLVVWYDAQGKTVRWRRRDAVSISQEMAVINTAAIDDHPVRTEAE
                     IGEDYDWDGPLGLSSMEEDEESASDADP"
     gene            complement(849860..849944)
                     /locus_tag="THITE_t105"
                     /db_xref="GeneID:11519876"
     tRNA            complement(849860..849944)
                     /locus_tag="THITE_t105"
                     /product="tRNA-Thr"
                     /note="Anticodon: CGT"
                     /anticodon=(pos:complement(849910..849912),aa:Thr,seq:cgt)
                     /db_xref="GeneID:11519876"
     gene            complement(<850123..>852233)
                     /locus_tag="THITE_2144934"
                     /db_xref="GeneID:11519031"
     mRNA            complement(join(<850123..850179,850452..850617,
                     850754..851085,851125..851388,851436..>852233))
                     /locus_tag="THITE_2144934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653913.1"
                     /db_xref="GeneID:11519031"
     CDS             complement(join(850123..850179,850452..850617,
                     850754..851085,851125..851388,851436..852233))
                     /locus_tag="THITE_2144934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653961.1"
                     /db_xref="GeneID:11519031"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2144934"
                     /translation="MAFLMFGGATLSVGAAALVVYLAAIAVYRLYLSPIAKFPGPKLA
                     ALSNWYEFYYDVVRQGEFTWQIQKLHKRYGPILRITPTELHIDDPDYYDVLYTRGSGR
                     RNKYAYFSGRFGYASDTFSTVDHDLHRLRRKAISPFFSVAKIADFQPVIRAKVDKLCK
                     KLDGYAAAKGSVVRLSRAWMALTTDIITEYAFAKSYDQLDSPDFADTLHEALVAIYVT
                     GHFALHFPIVFPILDLLPEWLVKWAQPDIIPVVGLRKTRSAPRSTSTCDLAERVRQIR
                     DGINKGHEAAAHPTIFHEVLNNDELPPDEKSNARLGDEAQLIVAAGLITTSRVLSVAS
                     YYLSTQPALAASLRAELAAALQQQQQQQPYDDWRQLEKLPLLRGVVHEAVRLAHGIVT
                     RDPRRAPDAELRYGDWVIPRNTPVSMTTYDILMNERIFPEPEAFRPQRWIGRPELERY
                     FVPFGKGSRQCLGINLAFAELYITIATVFSRYEFDMFERDETDVRMAHAYLVPYAKWE
                     SKGIRATVRKVQQPNSWGSLADDEAFGGST"
     gene            complement(<859056..>859322)
                     /locus_tag="THITE_2033989"
                     /db_xref="GeneID:11519877"
     mRNA            complement(<859056..>859322)
                     /locus_tag="THITE_2033989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653914.1"
                     /db_xref="GeneID:11519877"
     CDS             complement(<859056..>859322)
                     /locus_tag="THITE_2033989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653962.1"
                     /db_xref="GeneID:11519877"
                     /db_xref="JGIDB:Thite2_2033989"
                     /translation="KSLYQRFVDAKTHRNVQISEEDLKKYTGMSKAQLTDWAKDRPGV
                     AGNRAAGGVAIGQASGIGGYEAAHGLGGWGPDAAGKLKFPPKPRQ"
     gene            869551..869622
                     /locus_tag="THITE_t84"
                     /db_xref="GeneID:11519878"
     tRNA            869551..869622
                     /locus_tag="THITE_t84"
                     /product="tRNA-Cys"
                     /note="Anticodon: GCA"
                     /anticodon=(pos:869583..869585,aa:Cys,seq:gca)
                     /db_xref="GeneID:11519878"
     gene            complement(<869695..>871314)
                     /locus_tag="THITE_2129497"
                     /db_xref="GeneID:11519010"
     mRNA            complement(<869695..>871314)
                     /locus_tag="THITE_2129497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653915.1"
                     /db_xref="GeneID:11519010"
     CDS             complement(869695..871314)
                     /locus_tag="THITE_2129497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653963.1"
                     /db_xref="GeneID:11519010"
                     /db_xref="JGIDB:Thite2_2129497"
                     /translation="MHAGAPGHRGKQEHQRHPRRGHDLGHGHSNNDQMTGTVGRSRDA
                     NSQYRARRQENHEQNRHKTRQGNQHHDRHSQGERENRGALGEDKKQHSPRPVHNDQPG
                     RGQNSRRSSSQQQQHNRRHHHQQHHQQQQQQRQQKHQQHKQHKQHDHQQHHQQQQQHQ
                     QQHQEELLPAHNLHLRSYYDNDDIDLVIDTDTAADTATEHPPQQEQQQRCVERQAAPP
                     GQIAETSAPQPPPSRVSFDTTPRDQQQHFPRHDNLRPRKPILKPHPAPGFASPGMTVI
                     AAPPSPEATPPSPGPLSKDIFATYAQPNLEPAPCARCSTIPKCCATSHHPQPDPNPTP
                     ASPSPAYPAQTGAAAAAAIPSSTLLTLSHQITELHAALARSHALVAAHEAEQARAERR
                     FPREVAVKAFFGGLRERVARGSRAVAVLAREAQAREERAALGGFWIGSASGGGGGGGG
                     GGGGAAVVDDAEVLPDAEMAGPLAAEWAFCAAWEGVVAGMGEVRKVEEMLEYHAGKRW
                     GTAGLWERYVGLLEALERRVREAGWGSLWRE"
     gene            complement(872039..>873728)
                     /locus_tag="THITE_2078396"
                     /db_xref="GeneID:11519879"
     mRNA            complement(join(872039..872976,873049..873338,
                     873511..>873728))
                     /locus_tag="THITE_2078396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653916.1"
                     /db_xref="GeneID:11519879"
     CDS             complement(join(872117..872976,873049..873338,
                     873511..873728))
                     /locus_tag="THITE_2078396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653964.1"
                     /db_xref="GeneID:11519879"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="JGIDB:Thite2_2078396"
                     /translation="MPNPSPTRDAALAALRAAEARFVANNPLSQAQHNLAVASLPGGN
                     TRTLLHTAPFPITMQRGEGAHLWDVDGHKYVDLAGDLSAGLLGHSHPTVQRALHAALA
                     ETGLSLGATTPHERRHAALLSARFGLARVRFTTSGTEANLHALAAARRFTGKRGGVVF
                     AGGYHGGVLRDGAALGGGAVVDGLPDNTVDKRDFVVVRRYNDLAMARRVIEAVAARGE
                     LAAVLVEAMQGAGGVIPGRSEFLLGVRAAARENGALFILDEVMTSRLAPGGLGAALGL
                     SPDLVTLGKYLGGGLPFGAFGGREDVMAVYDPRLAGAMAHSGTFNNNTLAMCAGYAAL
                     KEAYTPEVCVSFNERGDRFREKLRDVARGTRLSITGRGSLIGLHFTEDGLEDIECAED
                     IKGKERPDLRDLFWFEMLEAGFWTTRRGFLALILETENEELDAFVEAVRDFLERHRQL
                     MLVDK"
     gene            complement(874015..875450)
                     /locus_tag="THITE_2116501"
                     /db_xref="GeneID:11519880"
     mRNA            complement(join(874015..874619,874693..874787,
                     874854..874982,875061..875450))
                     /locus_tag="THITE_2116501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653917.1"
                     /db_xref="GeneID:11519880"
     CDS             complement(join(874235..874619,874693..874787,
                     874854..874982,875061..875255))
                     /locus_tag="THITE_2116501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653965.1"
                     /db_xref="GeneID:11519880"
                     /db_xref="JGIDB:Thite2_2116501"
                     /translation="MMLDRNSLPPFIHPRLVAGSGAAVDEMEPLHNCISLLHMMNSQV
                     PGSRKLFWRNVRAECERFLGEYHGWKKQGLLAALQALSVYLIPRLGEGETQHNNFDSL
                     LIAAVVAISTQFSRVEVASDPDPLASWDDWILEESKRGLCVIFQVVGLLFYFEPAGMC
                     NVRRETNLVIAPLPSRKQLWEARDELAWRAEVERDEAEARTAFALAANGDLVKLEDQD
                     HLHCVSDAVQIRTHRPVEGPLWTTTNWDEWCSGMDALGGLIMLAASLTA"
     gene            complement(877533..878200)
                     /locus_tag="THITE_2116503"
                     /db_xref="GeneID:11519881"
     mRNA            complement(877533..878200)
                     /locus_tag="THITE_2116503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653918.1"
                     /db_xref="GeneID:11519881"
     CDS             complement(877860..878180)
                     /locus_tag="THITE_2116503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653966.1"
                     /db_xref="GeneID:11519881"
                     /db_xref="JGIDB:Thite2_2116503"
                     /translation="MPPQKRHIATIPPDIRRTPGTVPLDPPGIGNEDFNAGRKQSRFG
                     YPVLELWELVRPVTLAEMKDKWGMNSAPMGWRYVGRGLWEDRWGGEDADGKEDRGGRV
                     RRVF"
     gene            complement(878202..878862)
                     /locus_tag="THITE_2116504"
                     /db_xref="GeneID:11519882"
     mRNA            complement(878202..878862)
                     /locus_tag="THITE_2116504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653919.1"
                     /db_xref="GeneID:11519882"
     CDS             complement(878214..878684)
                     /locus_tag="THITE_2116504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653967.1"
                     /db_xref="GeneID:11519882"
                     /db_xref="JGIDB:Thite2_2116504"
                     /translation="MSPVRPSPGPSPAKKPRSFTQTTLTSAFLRRESPGTSKSGSTSA
                     LHRTIDGRIAKKPTPTTPKPKADSEAGSDNDRVLSDVLLSIKPVHLANIASRQKNHEY
                     RKYRLRDGVTRLWFYETSEGGSGRASITYVPIYPAACSTLSHLQQFAPSPRTTY"
     gene            complement(879014..881009)
                     /locus_tag="THITE_2116505"
                     /db_xref="GeneID:11519883"
     mRNA            complement(879014..881009)
                     /locus_tag="THITE_2116505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653920.1"
                     /db_xref="GeneID:11519883"
     CDS             complement(879309..880835)
                     /locus_tag="THITE_2116505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653968.1"
                     /db_xref="GeneID:11519883"
                     /db_xref="JGIDB:Thite2_2116505"
                     /translation="MPPPPAAAVAARKLIGLLEPLLDGPDNAKGSGAATQPPGPGVRD
                     ILSAIQDLVPALSPGSPLFATFHNGQVHDPLGGGSYAFRDDVVGPLISALVHDETLAG
                     ELSGDTIATAGSGQARHARIPTRPIVIHAGLQPNNSPHVGTLIVFCYAFAVAGAIRDR
                     MHTAAASTGVGSAPVTAPPVSVEITFVDTAPVEGQGEVIDGVHYQRSHRDVPKALQTY
                     MADYDEVLHLLSTWSGIPYTVRFQSDFFAGPTIPSILRYIIEHHELLGQQLSPKHGTL
                     ALRAACPVPGCRLADKHGRRNVYTKPSSGGQQSDAGTITFHCPHHGPHVVRLSRPDEV
                     ARLEANAPARNLIRSMSHLLDTRTHHVRVTGADYAGMYQEAFLYRPLAAWAAWAAAST
                     STSTSTSTSTATATAAAVAGRTPHILYAPLVVDWSGAKLSKALYVRGGGYAAMELLGS
                     GGLCSFALLRGRFGGDGAAGLRRIWEEVGRWLADPRKLFRAYSVEYLQRVVLEGGKWE
                     "
     gene            complement(<881662..>882018)
                     /locus_tag="THITE_2089127"
                     /db_xref="GeneID:11519884"
     mRNA            complement(<881662..>882018)
                     /locus_tag="THITE_2089127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653921.1"
                     /db_xref="GeneID:11519884"
     CDS             complement(881662..882018)
                     /locus_tag="THITE_2089127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653969.1"
                     /db_xref="GeneID:11519884"
                     /db_xref="JGIDB:Thite2_2089127"
                     /translation="MVRRALSLRRGANPLTLPLDQPPNHSRNHNPTSRPELAPEPAPS
                     SSSSPSSCPSPTTTASTTTASTTAAAAARATTTTYTTITLHVPRPGPARREHPPLPYS
                     RHHLLRRAGGGGGKQG"
     gene            complement(883541..885231)
                     /locus_tag="THITE_2116508"
                     /db_xref="GeneID:11519885"
     mRNA            complement(883541..885231)
                     /locus_tag="THITE_2116508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653922.1"
                     /db_xref="GeneID:11519885"
     CDS             complement(883646..885070)
                     /locus_tag="THITE_2116508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653970.1"
                     /db_xref="GeneID:11519885"
                     /db_xref="JGIDB:Thite2_2116508"
                     /translation="MSTTLLPFLYQTQTLQRLSRTGVPTRTFRALLHSTAARSNPPRS
                     RPHGPRHEDIPFELPEGYERPDGRSEDQDAEAGGMRSTITRQEHEIFSRIFEEIATRN
                     ATRPRPAVPPAPPPSAGPESPRPAPDESAGDSLPSRLGFLKFDDLQVRTEEPNPEKVR
                     NTVNIIVQDAAEVQSNFRRQMMRPFDPLHPLEQTSAASDWEKALLRFPPSLRKAARMA
                     LGTIEEDKAAEVHGSATPAAEQSLSIEEKPARQLDLKLDPLAKSVQNEALRREQRNRV
                     EAKMHAAQTDFELWDILEEEVFPLVEKLGIDEASSKAKRSRKRDKSKLPLHVYGPLYP
                     SYLLSALRLFDTKFARSSPLALHILPRVKELGPASYVLGVSTPFYNELARILWNRYGD
                     PTAVFNLLEEMRVAGLYCDETTRGVVQAIENFLASVGQGKWGPFLRELASLPEFEFAL
                     LPRIRHWLKTINMHIYERKHQLQA"
     gene            885384..887495
                     /locus_tag="THITE_2116509"
                     /db_xref="GeneID:11519886"
     mRNA            join(885384..886101,886155..887495)
                     /locus_tag="THITE_2116509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653923.1"
                     /db_xref="GeneID:11519886"
     CDS             join(885558..886101,886155..887185)
                     /locus_tag="THITE_2116509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653971.1"
                     /db_xref="GeneID:11519886"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2116509"
                     /translation="MAPAAKEEPAAMSAFERKRLENIANNNAILSEISTTAAKIIPKP
                     APPKPKRPSAPRVKREPVQREPLRPTRQSSRLAGLGADADVLKRKAEVEAEVEAEKAK
                     AKKMRISGDLNLGDIQVEGRKWEAGLDGLAGLKGLPVRGAQPGVRTFTDEDVKSTTDK
                     GLKDLRLRMSGLKLYEKWPVQDIKIVPQRIYSMGFHPTEAKPIVFAGDKEGAMGVFDA
                     SQEPSKVEDDEDEEAELPDPVISAFKTHSRTISSFHFSPVDANAVFSASYDSSIRKLD
                     LDKGISTQVFAPADPDEDLPISAIDMATSEPNIIIFSTLQGSLGRHDLRTKPSTAELW
                     SLTDQKIGGFSLHPLHPHLVATASLDRTLKIWDLRKIQGKGSARAPALLGSHESRLSV
                     SHASWSSAGHVATSSYDDRIKIYSFPDAGTWSAGAELSESQMAPTREIPHNNQTGRWV
                     TILKPQWQRSPRDGLQKFVIGNMNRFVDVFAADGEQLAQLDGEGITAVPAVAHFHPTM
                     DWVAGGNASGKLCLWM"
     gene            888349..892803
                     /locus_tag="THITE_2116511"
                     /db_xref="GeneID:11519887"
     mRNA            join(888349..889416,889472..889909,889964..892803)
                     /locus_tag="THITE_2116511"
                     /product="glycosyltransferase family 1 protein"
                     /transcript_id="XM_003653924.1"
                     /db_xref="GeneID:11519887"
     CDS             join(888631..889416,889472..889909,889964..892798)
                     /locus_tag="THITE_2116511"
                     /note="CAZy_ID 269950"
                     /codon_start=1
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="XP_003653972.1"
                     /db_xref="GeneID:11519887"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="JGIDB:Thite2_2116511"
                     /translation="MELPERLRDHGDQVDGEEEVLRPQGYGGGLFMNMNQSIFGLIAA
                     AGSQADYADRFEGHSSEDEDEGERRMAETIAGPTALQPESSSARGLAQTTVLPRHDAH
                     DAADVKAHGRHLRKLSESRLLRSVPGLARFAGKIRPSKSFKPKSDDGAQGAEATQSAP
                     QPTPDLMPSIQITRTDSMMTAPARTPQAYDLDGSNESPQDAETSKTGPSELAKKLKEI
                     FGFDKEEEVVEEYPCWLLQHVLLEGHMYITARHIAFYAYLPKKANEVSKKGYLSKCGK
                     RNPKYSRYWFSLKGDVLSYYLDTKNVYFPYGQIDLRHGISAVITDGDKEGTHFTVSTD
                     HRTYYFRADTAQSAKEWVKSLQRAIFRSHNDGDSVKISLPIENVLDVEETHMLNFADT
                     CKIRVIDNDETYAIDEYFFSFFSYAREAINILKILVEDSSSHAHGLSDQVEPSSERTS
                     TSGRREQASNLPHLRTGKISEGVRATLSPLSPVRGSSPSPRQSSDRPRSSFDRFRAFT
                     RGSMDTNANIHPGSPRRRSFSHGRRSLSRKRHEGHERQESSDSYVQSLDPSQASLSAM
                     VASASSEDASASQILRGSEVFHGPTLQHAGPSTRAGHHASDSKPPTRPATAPRQSTDA
                     GETDGRATTPTLQSIATMGGYPLRKANALMGYLDRQSRRMSNLLATESMGYVEKVSGM
                     WKGGAKHYDEPPELRTDEEDGALGPEEKAHSEARFRAHFTLPESEKLQAAFYAHMMRV
                     IPLYGKIYISDWHFCFRSLWPGTRTKLILPLRDIENVDKEKGFRFGYAGLVVVIRGHE
                     ELFFEFGKAEVRDDCTITILQGLEATRYLRGSSLMDGGESEDAQAAVAEHNALEKARS
                     QGFADHEVQLPRETSSVSEAPTIIFDDPKASFLNFKPSQPMKITCLTIGSRGDVQPYI
                     ALCKKLLEEGHHPRIATHGEFKPWIESHGIEFAYVGGDPGQLMQLCIQNGTFTWAFLK
                     EANAKMRGFLDDLLATSWQACQGSDLIIESPSAMAGIHIAEALGIPYFRAFTMPWTRT
                     RAYPHAFIMPGQKMGGGYNYFTYVMFDNLFWKATAGQINRWRNRMLGLPATTWEKLQV
                     NKVPFLYNFSPYVVPPPLDYSDWIRVTGYWFLDEGGEKWTPPPALMRFIEQARADGKP
                     LVYVGFGSIIVADPARMTQEVIDAVLKADVRCILSKGWSDRATNEKGDTVKAGAADDS
                     SSKSSSKKAEPELPPEIFLIHSAPHDWLFRQIDAAAHHGGSGTTGASLRAGIPTIIRP
                     FFGDQFFFGSRVEDLGVGICLKKWGANSFARALWEATHSERMIVKARVLGEQIRKVSR
                     YLLSLVEHLFFPPFFLHNHPYPRHLSRTSQTR"
     gene            895381..898858
                     /locus_tag="THITE_2116513"
                     /db_xref="GeneID:11519888"
     mRNA            join(895381..895507,895608..898858)
                     /locus_tag="THITE_2116513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653925.1"
                     /db_xref="GeneID:11519888"
     CDS             895689..898418
                     /locus_tag="THITE_2116513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653973.1"
                     /db_xref="GeneID:11519888"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Thite2_2116513"
                     /translation="MSKVIRLGSRIRYPITIVRLLKSPGDKIKKQEPLLEYSFKWMRE
                     VTDKFGDNPRQEEQTTTVTWESPTDGELTQWHITEGQRIVADRACLTVKEECSHGIQY
                     GGLCGMCGKDMTVVNWAAETRDTERAPIHMVHDQTCLTVSPSHAQRTERELQRRLLQS
                     RKLSLVVDLDQTIIQACIDPTVGEWQRDPTNPNHESVKEVKSFQLDDGPSDLARRCSY
                     YIKMRPGLEEFLKRISELYEMHVYTMGTRAYAQNVARVVDPQRKLFGNRVISRDENGN
                     MFAKSLGRLFPVSTNMVVIIDDRSDVWPRNRPNLIKVSPYEFFKGIGDINSSFLPKRH
                     DLLTSDAATNGVQNKGRKMEPPPKVDKNKDEALEAIVNMTGGDDSALTKRQVEEQERA
                     FEKQIKDRPLQLLQEKLDREGEEAEKATVQSEDGSESRSSSPAAHRHRVLQDDDTELK
                     YLEQHLIKLHKTYYEEYDSNRASHNAGGNVDFSSVPDVGRILEELKSQVLRGLKIVLS
                     GVLPRGIDIYQSEIGVQIMSFGADLRPRIHNDVTHLVVNASQPGREKLLEARRRPHIK
                     IVSQEWLAACFSRWEAVDETPYLFTARLVDEDEPNNRNKPPAAAAATTGENAAAEDDE
                     ENNEGENKAPNGGHNRRGPRLRLVSASGESRDLQPADDDGDEDSSEEEMDEDLLPDAL
                     PDGQSSPIDGLKTFNWGSADAELEEFLASGSSDEEEDDDDDDEEEDGDYVQADEDEEE
                     EDSDDNTRRRSRTASPTSGLSASRKRKSRAEDGEDGDGTEAFGDDGGHETPAKKLRRT
                     QSQRTTSLRAQFAAGEQPADQLEGGSGLPTPGGTDDLDGAQQQQRQSGSTRIGEQPDE
                     DDDEMDFDEAALEAEFEAEFAAEFDKAEAEMQAEQAALALREANKPGTEAEKG"
     gene            898989..900685
                     /locus_tag="THITE_2078408"
                     /db_xref="GeneID:11516478"
     mRNA            join(898989..899455,899991..900100,900169..900321,
                     900399..900685)
                     /locus_tag="THITE_2078408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653926.1"
                     /db_xref="GeneID:11516478"
     CDS             join(899405..899455,899991..900100,900169..900321,
                     900399..900450)
                     /locus_tag="THITE_2078408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653974.1"
                     /db_xref="GeneID:11516478"
                     /db_xref="InterPro:IPR009346"
                     /db_xref="JGIDB:Thite2_2078408"
                     /translation="MPQDMPPAGGYEAVQFRRNLPSRGLFRPGPLIAGGAALMLFGWY
                     KLIVGIREQNELAREKMWARIHLIPLLQAEEDRDQVRRYLADQAREKELLGENTRVYH
                     SDRFVRPTFGVTPAVVSKE"
     gene            complement(<901169..>901984)
                     /locus_tag="THITE_2089133"
                     /db_xref="GeneID:11516479"
     mRNA            complement(<901169..>901984)
                     /locus_tag="THITE_2089133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653927.1"
                     /db_xref="GeneID:11516479"
     CDS             complement(901169..901984)
                     /locus_tag="THITE_2089133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653975.1"
                     /db_xref="GeneID:11516479"
                     /db_xref="JGIDB:Thite2_2089133"
                     /translation="MAVKQILLVTLGGWAAASPVSPLAPRDPSPEAQADTTTPAIPTV
                     TVTRTFTIPAWTKTDTVTRTLNCTRTIYVPAGSPSSTAATPTGAAPAPALLGRQTTTI
                     SPPPPTPTPGRTVTRTVVVAETATRTGDLTISEYLCSATVEYAYTVDATTTATFTRTR
                     YPADHTVTATTTIECARPPPPPPPRTTSAPPPPAAVSSGSGSGKPPAEVALEEARQAV
                     DSSSEPLTPLTTLHITQTVYAGTTVTATGYTTRFVWRCSASSTASPPAASESP"
     gene            complement(903575..908158)
                     /locus_tag="THITE_2116519"
                     /db_xref="GeneID:11516480"
     mRNA            complement(join(903575..903800,904060..906591,
                     906648..906913,906966..907477,907646..908158))
                     /locus_tag="THITE_2116519"
                     /product="condensin-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003653928.1"
                     /db_xref="GeneID:11516480"
     CDS             complement(join(903630..903800,904060..906591,
                     906648..906913,906966..907477,907646..907881))
                     /locus_tag="THITE_2116519"
                     /codon_start=1
                     /product="condensin-like protein"
                     /protein_id="XP_003653976.1"
                     /db_xref="GeneID:11516480"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Thite2_2116519"
                     /translation="MDSVNFDINDALKHYMSDPAGIPTPEADSALVDCENDPEALADN
                     ALVNGVLNPIVDAVAENPDAITRSSIFDSLQFLLKYTSFLSAHALSKIFDLITSGLAA
                     EADVIHHDLESDEQELMAHHKQLLEMYGFLLQWTIAAVETKAAEKSSATVPARGRGKP
                     KGRKDAAGKDATWDSSTQLETALGTMCKVLRLKLSKIFLTTSERDTFISLLTRPVYMI
                     LESEQRVKNTSIRMHAFKVLCIAVKHHGHGYAAQISIVQNLTYFEHLSEPMAEFLHIL
                     AEQYDYPQLADEILRELSNKEFNSNDTKGPKSVSTFMIRLSELAPRLVIKQVTLLAKQ
                     LDSESYTLRCALIEVFGNMLAHLSKSDERGENHKMQMNAFFDVLEERFLDINPYCRCR
                     TIQVYIKLCELDQKFPKRRQKAAELACRSLEDKSSHVRRNAIKLLGTLIRTHPFTALH
                     GAQLARKDWQERLDKVEAELNALKPPVDAPGLDGDKGNTSVDQELLDDATQVESPKKQ
                     PAEMTDEEKVAAIRKAQEEAATSEAIEKLTLTKRYYTEALKFIDVLHEATGTVCQLLG
                     SRNKSEVIEAMDYFEIGDAYNIEQNKVGIRRMLRLIWTKGNSDEGKGVQTHLIECYKR
                     LFFEAPDNFSPNDAANYIARNMISLTFGATPAELTSLEQLLSTMMKQGMIPDLVIAKL
                     WQVYGVQKREISKKQRRGAIIVLGMLATASPEIVVGEMETMLRTGLGAHGRADLQLAK
                     YTCVALRRINPTGRQAKESTAKFSRLPNDHAVLVRLAAITEVPTDSKDWYGVAEQAIN
                     AIYALSRHPDVLCSEIIRRKTKAVFGRSGSRASSRPNSRPASRDETQPAPSSAAAAEG
                     ADGGEPPVPSSQPPSSQPQPASPTKKQSRDDVTGLSQLLFIVGHVAIKQIVHLELCEQ
                     DFKRRKQEKEKTAGAAKDRNSLSASTSSRRSVSASHSKDKSKVDEEGDELDLIGGTTE
                     DDFTEAMAHIRERELLYGPSSILALFGPLASEICANNTTYRDRNLQQAATLCLAKLMC
                     VSSEYCEANLPLLITIMERSTDATVRSNAVIALGDMAVCFNHLIDENTDFLYRRLADP
                     DPSVKRTCLMTLTFLILAGQVKVKGQLGEMAKCLEDEDKRIADLARMFFTELSTKDNA
                     VYNHFVDMFSLLSADRRIDEESFRRIVRFLLGFVEKDKHAKQLAEKLAARLARCETER
                     QWNDVAFALGLLQHKNEDISKLVAEGFKVVQAAA"
     gene            908553..910435
                     /locus_tag="THITE_2116522"
                     /db_xref="GeneID:11516481"
     mRNA            join(908553..908951,909035..910435)
                     /locus_tag="THITE_2116522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653929.1"
                     /db_xref="GeneID:11516481"
     CDS             join(908636..908951,909035..910203)
                     /locus_tag="THITE_2116522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653977.1"
                     /db_xref="GeneID:11516481"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2116522"
                     /translation="MATVTATRRRRADSFQAATSFQIHEDAPSTEDTEMNESALQHPD
                     DDATNQDGGGPGDEDGQDSEYVESSEEDGPDDSHIQQDMEKLQNCFSGFRQKYRLIKR
                     IGEGTFSTVYKAEDLLYDSYDNSWDLDRDTEKWSPPPLRSFASQSSATLDYQSQPQPQ
                     PQRRRKPKYVAIKKIYVTSSPSRILNELELLHDLRGCESVCPLITAFRWTDQVVAVLP
                     YFRHADFRDYFRNMTIPDIAIYLRSLFTALASVHRHRILHRDIKPTNFLYDPASRRGV
                     LVDFGLAEREGYDCKPCVCHDDPAVRKARLRPLLSSTLKPGYPREDTRPSRRANRAGT
                     RGFRAPEVLFKCTEQSTKIDIWSVGVILLTILSRRFPFFNSADDIEAMIEIATIFGQR
                     RMQTAALLHGCMLETSIPTIGKSGFSLQGIILWSTGRSEKHEVPADEKLAIEFLSRCM
                     ELDPSKRISAEEALEHEFLRLGMDQSVEGTSEAGDDDEMDILRV"
     gene            910437..911415
                     /locus_tag="THITE_2116524"
                     /db_xref="GeneID:11516482"
     mRNA            join(910437..910787,910888..911415)
                     /locus_tag="THITE_2116524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653930.1"
                     /db_xref="GeneID:11516482"
     CDS             join(910620..910787,910888..911391)
                     /locus_tag="THITE_2116524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653978.1"
                     /db_xref="GeneID:11516482"
                     /db_xref="JGIDB:Thite2_2116524"
                     /translation="MSDDDDDDNKTNNAPPIDFHHPYQPYDVQLQFMRTVYDVLEKGN
                     GQVGILESPTGTGKSLSLICASLTWLRAHKRARYEASVDATAAAMAGEPQWMVEAALR
                     RRREELARRWEDRERALERARARERAMEVRGRERAAKRARVDQLNEGGGRTRKEKDGE
                     VDEEREFLVGDWDGDGVGGDDDGLGGLSKETRALLEKVGLGGGSRREGDNGGEEVEDE
                     VKVGC"
     gene            911860..913799
                     /locus_tag="THITE_2116525"
                     /db_xref="GeneID:11516483"
     mRNA            911860..913799
                     /locus_tag="THITE_2116525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653931.1"
                     /db_xref="GeneID:11516483"
     CDS             912172..913644
                     /locus_tag="THITE_2116525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653979.1"
                     /db_xref="GeneID:11516483"
                     /db_xref="JGIDB:Thite2_2116525"
                     /translation="MGQTSANSPQGGQGIVDSNTVLKARGADLINLYQLVRYIQESKL
                     AYKVESYASYAEEQESTTANGSKPPTSTPVLHTLVSFLTSLTNLSTEGRIFYEKISST
                     PSDIKLSYLLLSPTHAFSSIASAARAVILAGGTMSPFDDYRAHLFPTLPPDKITTLSC
                     GHVIPSSNLFVWTLASTKPIPPGSSTASDSFEFSFQKRSDRAMIRQLGLALLNICSVV
                     PDGVVVFFPSYGYLDEVVASWQTPDNPASQGAPGTAGPATAAPTIWDRLAAKKALFRE
                     TKGGSSEDILQQYSAAILSPEPTSGPAQQQPPTSQKPKTGAVLLSVVGGKLSEGINFA
                     DRLGRCVIVVGLPYPNIHAPDWKARLEYVEATALSRLRDHTHTNTRAERPVQDQDQDQ
                     GQNPLPTPTREDREQAKQAAREFYENACMRAVNQSIGRVIRHRGDYAAVVLVDRRFGA
                     ERVRAKLPGWIRAGLPSAGEEARGLVGLMGGLGRFFRGRE"
     gene            914099..914793
                     /locus_tag="THITE_2116526"
                     /db_xref="GeneID:11516484"
     mRNA            join(914099..914316,914377..914793)
                     /locus_tag="THITE_2116526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653932.1"
                     /db_xref="GeneID:11516484"
     CDS             914500..914655
                     /locus_tag="THITE_2116526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653980.1"
                     /db_xref="GeneID:11516484"
                     /db_xref="JGIDB:Thite2_2116526"
                     /translation="MAANHLFDTVKEHLTSMRHRYAAVDPSGRKLLEVKSRFQREAPS
                     TLCFNKH"
     gene            <916255..>917674
                     /locus_tag="THITE_2051261"
                     /db_xref="GeneID:11516485"
     mRNA            join(<916255..916689,916765..917265,917378..>917674)
                     /locus_tag="THITE_2051261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653933.1"
                     /db_xref="GeneID:11516485"
     CDS             join(916255..916689,916765..917265,917378..917674)
                     /locus_tag="THITE_2051261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653981.1"
                     /db_xref="GeneID:11516485"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2051261"
                     /translation="MHAIIVGAGPAGLAAALALHQQSTPSSPIRVTVLELRPNIQTLG
                     GAVNLTPIAMRYLDALGVGARLRPLGVRVPYIEMLSHRTGRTLGRVWPDVDALRVLRQ
                     DLVEALVATARAVPEDQLRLRYGVTITHIEEKGDAASPEGSIATLDGDILLGCDGIHS
                     VVRSTYVDPARRKTYSGRASAYGFITVREPGRAGIETADGSPAVNVSSIISGRLGSLL
                     VTFFEPSRTKLYLTTVIARPEPADGGRDGRRAAGEDMEAVRQDFLRRFRGGKLAGVEE
                     TVQRCEEWVSFPVYMLPAGGVWSKGRALLLGDAAHASPPQGESSGLAIEDGVLLAHVF
                     SRRDTRSVPQLFADYEALRRDVIKKAHDDAVFRWEQVHDRSWFGMIFLEWLTIVYVWF
                     KNSKEDFGRDVRELPLPA"
     gene            complement(<918064..>918570)
                     /locus_tag="THITE_25363"
                     /db_xref="GeneID:11516486"
     mRNA            complement(<918064..>918570)
                     /locus_tag="THITE_25363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653934.1"
                     /db_xref="GeneID:11516486"
     CDS             complement(<918064..>918570)
                     /locus_tag="THITE_25363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653982.1"
                     /db_xref="GeneID:11516486"
                     /db_xref="JGIDB:Thite2_25363"
                     /translation="GPRRRIVGHAAASWATPPHRGPRRRIVGHAAASWATPLHRGPRR
                     RIVELGRPYAGAWAPGTAAGRWAPGAYCGHRGHNAGTRGIPQAPGLYRGHRGYTAGTR
                     ATTQAPGPYCGHRGHNAGTWATTRAPGAYRGHRGHNAGTRAITRAPGAQRRHQGHNPG
                     TGGTTRAPG"
     gene            <921038..922375
                     /locus_tag="THITE_136625"
                     /db_xref="GeneID:11516487"
     mRNA            join(<921038..921796,921839..922375)
                     /locus_tag="THITE_136625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653935.1"
                     /db_xref="GeneID:11516487"
     CDS             join(921038..921796,921839..921991)
                     /locus_tag="THITE_136625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653983.1"
                     /db_xref="GeneID:11516487"
                     /db_xref="JGIDB:Thite2_136625"
                     /translation="MSGLYDDPFAYDGPDFTTYLGQNQFAAGSSPDDFHVTSATETHF
                     PAAVHALKPAPQLQQHHQSPYQLSPTEPLLPDFDHALQGHLARSAPTSFPQAPPTPQH
                     APPPHLNINTMGLTWNTTTTAAAAPTSAPAPSNPDPRGTGPQQPPANAEDLHSMLAAL
                     QAELRQTALERDEARLQLSTARNELYAARQIERRLRVERDEARSQADFLGAERAKARQ
                     TEARLRRERNEARLALLLKSKGGAVGVAGAGAGVGRIGVGGAGAGAGAGAGGAGGIAV
                     MGGGGMESQGEESGESPPMVLAGHDQG"
     gene            complement(923220..>925350)
                     /locus_tag="THITE_2078416"
                     /db_xref="GeneID:11516488"
     mRNA            complement(join(923220..924112,924255..924281,
                     924354..924425,924475..924592,924657..924797,
                     924856..925087,925162..>925350))
                     /locus_tag="THITE_2078416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653936.1"
                     /db_xref="GeneID:11516488"
     CDS             complement(join(923515..924112,924255..924281,
                     924354..924425,924475..924592,924657..924797,
                     924856..925087,925162..925350))
                     /locus_tag="THITE_2078416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653984.1"
                     /db_xref="GeneID:11516488"
                     /db_xref="JGIDB:Thite2_2078416"
                     /translation="MLPTPRAPVIDPQRAAENNSTAYLIVISIFWGLAFVTACVRFYT
                     RAVVVRSFGRDDVFMVLAVLCAVAGLASWIVECRSGFGRHQDTIPRAEFVSLMEAQFY
                     QSIIEASFAFGFLKISIALSLLRLSRGSWYNRILWTLIAFTCFYTLFAFVTILTVCRP
                     IAGQWDASLRPKCYSRLIYRDFGLFNAACNIFTDVAFATLPVPLIWSLQLQRRIRLYL
                     IAILSGGYFSAVALGIVKAIFIIAYVRETDGTFFPGAPFFGSLQLDIGIIAACAPTLR
                     PLLGRALHLSTSLDPYRGANYYRAGKALDRLPRPPVPAAARRYLHGRRGGGRDAGDVD
                     VEGDAEADADGVFHMDVGKGGCVRLVGGGGGKQWRPGGGGGGGSFETVRLGFAGAVVH
                     AEYAGLAKGEANGVGGGGKGEGSRKGSARTLSGSGGEGAVVRGPPHVAGGMGLKGIVK
                     TVEVRVEK"
     gene            complement(926387..927380)
                     /locus_tag="THITE_2116527"
                     /db_xref="GeneID:11516489"
     mRNA            complement(926387..927380)
                     /locus_tag="THITE_2116527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653937.1"
                     /db_xref="GeneID:11516489"
     CDS             complement(926516..927127)
                     /locus_tag="THITE_2116527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653985.1"
                     /db_xref="GeneID:11516489"
                     /db_xref="JGIDB:Thite2_2116527"
                     /translation="MSVHAVALSATHEFSKTPAAAITLLAGLGVQGDCHSGVHVQHRS
                     RQHLRPRPPNLRQVHLLARETLAEVGVAPGQLGENVTTAGVDLLALGRGTRLHFLPAA
                     GADADAGEGEGGEAQAQAEGHAAGLDDPHAVVVVQGLRNPCPQIDKFREGLKERFIVR
                     DAERRIVGRKAGVMGTVEVGGEVSVGMRIVVEKPATFEPLECV"
     gene            <927957..>929056
                     /locus_tag="THITE_160711"
                     /db_xref="GeneID:11516490"
     mRNA            join(<927957..927972,928041..>929056)
                     /locus_tag="THITE_160711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653938.1"
                     /db_xref="GeneID:11516490"
     CDS             join(927957..927972,928041..929056)
                     /locus_tag="THITE_160711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653986.1"
                     /db_xref="GeneID:11516490"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Thite2_160711"
                     /translation="MSSNHPYRYLNIPKDAPIELKPSAGKGWGVFAKQKIQRGALILQ
                     EKPLFVIRKARADITEEDVGRAFQQLSPQQKQQFALLRDNATRIFPCLLMAFAENCFN
                     LASGSDAWVSLPPAEGLFLLHSRFNHSCLPNAKVPTGHVGDEIASFATRDILAGEEIT
                     ICYSPVFECLTRHERHQALGFTCDCRACLPGTPFQRLSDARRRLSRGLQYLTHGVDVD
                     VPSDGGLGTSSLSPAIVDPQLRRAAQNFDIPLTSRFIYEPLSAFLWAEEGLMDGFMFQ
                     RVTPGIRAVVGMFRTRENAAIARFALVQDTWLERLNVAFRLYWRGDAADQSVAEGFRV
                     MQLAASLSS"
     gene            <930605..>932813
                     /locus_tag="THITE_160710"
                     /db_xref="GeneID:11516491"
     mRNA            join(<930605..930964,931041..931429,931519..931634,
                     931712..931902,931973..932038,932111..932667,
                     932741..>932813)
                     /locus_tag="THITE_160710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653939.1"
                     /db_xref="GeneID:11516491"
     CDS             join(930605..930964,931041..931429,931519..931634,
                     931712..931902,931973..932038,932111..932667,
                     932741..932813)
                     /locus_tag="THITE_160710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653987.1"
                     /db_xref="GeneID:11516491"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Thite2_160710"
                     /translation="MAGPETETAVQVAENAPIRPQHRKLHDPDVSFEEYLHYAQKTRE
                     EERTLEKPRTAWRQLLAGEKKSAGNGAAGESVGVVHQDLGDLNLSTRNNRLHVSDEEW
                     TNASRALRTASAGAAFYLITTDILGPFAVPFAIGTLGYGPGVALFTAFGLLAGYSGYL
                     IWHVFMHVDSYEFPARNYGDLAFRTWGTVARHITNFLQAIALLLLLGQVTILFGQNIS
                     QMSKFRLCYIVCPLVFVIAGFFLTQIRTLKAYGWVATLAIWLNLIVIFISMGVMAHSP
                     PNYAIAVLGSAGSAVDPDSITPVDGVYPPIVHYSGLPANNLVGNINGLLSGVLAYAGA
                     QLFVEFLAEMRRPRDFLKAMWGAQLFIYTVYVVYGCYVYYFQGQYTYNPSFQGVSAYS
                     WQTVGNAITLLAGLIAAGLYGNIGIKVFYNNVLVDLLNAPLLVTKPGKLFYAALVPVW
                     WSVAFVIAAAIPDYFGFISVMSASTLLNLTYTLPPLFALGMDIRKNAMRPGEGFNPET
                     GEVTRNGTAMQRYIRGFFSGGPLQLAKNVWHVLYFLASLAMCGLGMYAAVQGMVDAFK
                     HPQLNSFSCVSPLNLNA"
     gene            complement(<933180..>933734)
                     /locus_tag="THITE_2089143"
                     /db_xref="GeneID:11516492"
     mRNA            complement(<933180..>933734)
                     /locus_tag="THITE_2089143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653940.1"
                     /db_xref="GeneID:11516492"
     CDS             complement(933180..933734)
                     /locus_tag="THITE_2089143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653988.1"
                     /db_xref="GeneID:11516492"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Thite2_2089143"
                     /translation="MDLTSHVSHNPVFLALPAELVERVACFLLEQDLLNFRRTCRRFH
                     HNSQTAFANTFFSTVTTDLCLASFQRLQRIAQDDLPRHYVRTVIFTSKAPCPNRPRHA
                     PGQGYHWSRTPGPQFQAQYLNPDVTSNPSISDFCTTLAAPSNLRLFPRCKIDINERLL
                     NSPGDARLLFSQTPIAISVMMVKG"
     gene            complement(<935201..>936140)
                     /locus_tag="THITE_2129515"
                     /db_xref="GeneID:11516493"
     mRNA            complement(join(<935201..935853,935951..>936140))
                     /locus_tag="THITE_2129515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653941.1"
                     /db_xref="GeneID:11516493"
     CDS             complement(join(935201..935853,935951..936140))
                     /locus_tag="THITE_2129515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653989.1"
                     /db_xref="GeneID:11516493"
                     /db_xref="JGIDB:Thite2_2129515"
                     /translation="MRLPLWAATLWISALFALTEAVFVRSSSGCAPNEYWCQDRCGSA
                     DYGDTCCQTPDGQHNLCGAVCNAVGGCDSVPGLQVSAPDKTYGSPPGTQKTASTSEPY
                     TESGSLSTVTSQVFVTQVRTRTIIVTLTSSRSCTSEGNHSSSGNPSTEPASGEPTTFS
                     SRLLSTEPSSCPQGFSTEFPQCAFPGTSEATSAGSTTGDFTGIPTGWPTSSPPSNPTT
                     SASTWTDSLGETIVSSGSEIVIGGTETIPVPTGHSTLTTDGHTFTFGSGSGNQPRGVA
                     PATT"
     gene            <936776..>938351
                     /locus_tag="THITE_2129516"
                     /db_xref="GeneID:11516494"
     mRNA            join(<936776..936781,937191..>938351)
                     /locus_tag="THITE_2129516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653942.1"
                     /db_xref="GeneID:11516494"
     CDS             join(936776..936781,937191..938351)
                     /locus_tag="THITE_2129516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653990.1"
                     /db_xref="GeneID:11516494"
                     /db_xref="JGIDB:Thite2_2129516"
                     /translation="MAHSTGARQQQQQQQHRNTTIAIATTSEMPVLDQIFKTLHRLET
                     QVNSQSNRLNAIELSIKSRSDDITASSTDDSSSETSNSGFSNHRQSRSSASSMNTPSP
                     HCPQSPAASYRASLAELRNRFAFSHSSLDIGSPPASRLHEHIRGDGTRSPTVNNRDEG
                     SDDEWEDEVVYTESTYSQYPSRLDLSNLADAPPLLNDIQLQRYVHSAKSSLNPQDFTG
                     REDASSPPGPIGMRQPSGFDGPHRPQSRSPPASVCAPSIAKCASCGHQAGSEQETNLQ
                     SAAQDTTPAEKQKPLQWRVLAAQRHDRAEMALFAWECCKASSQSWWFESEEWRAIQSE
                     TRRITEVLAPTSAAAASSSLRKAREAVGKLKTMLATRLNNAGFFWARRETAVVP"
     gene            950554..951168
                     /locus_tag="THITE_2116532"
                     /db_xref="GeneID:11516495"
     mRNA            950554..951168
                     /locus_tag="THITE_2116532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653943.1"
                     /db_xref="GeneID:11516495"
     CDS             950696..951070
                     /locus_tag="THITE_2116532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653991.1"
                     /db_xref="GeneID:11516495"
                     /db_xref="JGIDB:Thite2_2116532"
                     /translation="MGSVEDRTRDQSPSVLKDFFMERGDLTPNMPPANVFYTFYYPGQ
                     SSGVADPGGPRGKALVTVDDGGKTADQRQILVLRLYLANDDPRLELRFTVDDGMPLSE
                     GGVTVPESDKTTDGNKVYPPKE"
     gene            <956430..>957669
                     /locus_tag="THITE_117983"
                     /db_xref="GeneID:11516496"
     mRNA            join(<956430..956432,956551..956814,956868..956929,
                     956996..957030,957112..957135,957300..957355,
                     957430..>957669)
                     /locus_tag="THITE_117983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653944.1"
                     /db_xref="GeneID:11516496"
     CDS             join(956430..956432,956551..956814,956868..956929,
                     956996..957030,957112..957135,957300..957355,
                     957430..957669)
                     /locus_tag="THITE_117983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653992.1"
                     /db_xref="GeneID:11516496"
                     /db_xref="JGIDB:Thite2_117983"
                     /translation="MVEAIISKLFSSLGFRLINATPEERSTSEVESPADDAPTAPTER
                     TSSAAATPTNDDKKEEKKEEDEDEEIEESEPPTPYKGSFGHKRRASSDLDSTPKKRVP
                     TGVAHIILYRHCIAKFFDSGSGSRYIEFYSFIEAFDKRDHPTTDKKGVVDTLTVAREA
                     ISGTPVAPTAYSENFLEQWGEVQKAEGVLKRRLRRFVDAPTPLLPPPPPPSTTLEEVV
                     ERLAKLEEQ"
     gene            971600..973670
                     /locus_tag="THITE_165525"
                     /db_xref="GeneID:11516497"
     mRNA            971600..973670
                     /locus_tag="THITE_165525"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003653945.1"
                     /db_xref="GeneID:11516497"
     CDS             971861..973399
                     /locus_tag="THITE_165525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653993.1"
                     /db_xref="GeneID:11516497"
                     /db_xref="JGIDB:Thite2_165525"
                     /translation="MATARPSMARLAVFAALLGQLQPALATFYTVTSYYALSTRTTKY
                     VEDCTECDVYTYTSTLTLKPTVTPTARPISSDTDIDTYEDVEIVSVFVPVDAVPSSDI
                     LTALPTPTYGIFTDYAVPVTWTAPASCPTAFTVVTYAYYYPPYEVTAHLSPISTATSL
                     YTDTEEGSVHTHVTYFLASTAVPSTVANTATNVIYTRYVERCINPTAGFDAVSGGGDD
                     SGSGGGGSSGSDDDDDWDVCSAMTGCVRVATYAIVLASVLPAIFLLGFVESYFWFRRL
                     MLGKSALRLGTICWCCISLWVICMTQHQPARSPEDQVLLRQYWDTLSAGTRLKYWFRH
                     GFRWRYPVELLGNPNGNNPAVVPMPPPPPPGGADGGDGAEKMPPAAQAQPVYVMAPYP
                     GQQQPVPGQNGYAPAAPAGFVPAQGYGVPVQYMATAQPGVGAAAAAAAAGQPQTHPGS
                     VPSPSPVSPSAEQSSHTTPPPQEQTQQPRPPGGQPQELPLTPPGGDQPHELPNSPPAG
                     QPPR"
     gene            <974931..>977494
                     /locus_tag="THITE_2050349"
                     /db_xref="GeneID:11516498"
     mRNA            join(<974931..976026,976098..>977494)
                     /locus_tag="THITE_2050349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653946.1"
                     /db_xref="GeneID:11516498"
     CDS             join(974931..976026,976098..977494)
                     /locus_tag="THITE_2050349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653994.1"
                     /db_xref="GeneID:11516498"
                     /db_xref="JGIDB:Thite2_2050349"
                     /translation="MSSQAAKAFYDSADDEAKEWLAKALFYRELETIKRDAPLLDPTE
                     FRIKKVEVYDDNAARPGQVGLRGGAAPDRPSSPLLKRGRSFASQLPWYLTRLLAKAGQ
                     VIDLLDSDDDAPAAKRQPPGPLTDMRIDIPKLTKAMGYAGTLERQFPLEVEAARADFL
                     STGYEYMDQETMLNGPDWLHYLRTYDKQGNLVLLYKGFPMVEDVVFIKHPNHWPWYLT
                     GVKTVESGQCYWLAVALLIYGNASFWVRVKAEHLSFLEKVLSNPEHPRHQFYTRLNQS
                     DSRTTATGPRSSSLQPETMFDGDANLWERLQIPGCWTNEDTCILTADVYGVFIVLYKY
                     HSGEVPWWNKVYDMKTYGSYNSRHLFLCYTVWNHFQPMVPNDYYAYEFKLPRPTLQST
                     KKYALVTSAKHRRRVGDGPDHYWRVGGRDIIPSPCSRPSFEPEHLGRAVGYGPYVNQS
                     AAPQPQPAQQQDPAQQQAPAQQQDPPQQQAPAQQQAPEQQQAQAQASPDSGLPSSVAR
                     GIASMLSAPQAGARSPPQPSIITQADVHTVQNAVNILQQFVSGVTQAGSSTSLKRSAA
                     SPPDDGRPAKKRRRNTDPGARPGNLLGGDGNQLSSVQPSSVLRSSAAQQPNLAPPQPP
                     PQQPPPQQRSPAQQQPQPPPAAAQQQPPPVIVISSSSSSSSPSSGTESDRWFDDTCWR
                     PATKWLLMREPVKRLRSWCSDLKLARDDEELVWLKEMCADALVRAGVEVRVHPVPNNL
                     GLSRTTIVNAYEEVHYYLDEGVIRLPGGREVEDSDEEDGKEDNEEDEEEADEDGDDKE
                     GDGEGDEEGDGEGDEEGDGNGDGDGDGDGDGN"
     gene            complement(<977820..>978889)
                     /locus_tag="THITE_160705"
                     /db_xref="GeneID:11516499"
     mRNA            complement(join(<977820..978131,978203..>978889))
                     /locus_tag="THITE_160705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653947.1"
                     /db_xref="GeneID:11516499"
     CDS             complement(join(977820..978131,978203..978889))
                     /locus_tag="THITE_160705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653995.1"
                     /db_xref="GeneID:11516499"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="JGIDB:Thite2_160705"
                     /translation="MNGPPPPQEPLVSDIITAALTSLPSPAPSLPNPLFPVAVGSKPS
                     NPPPTLDRTGINRIALYRGCFNPPHAGHLQLLETVLHRGGGMPTINVRAAVVLPLRDA
                     AVAPKDRSLVFPLAVRARAWRDAIADSGVLAGRVCVLPSGSGSDYGSGSNSGVGEDAE
                     GDLGFEWVAEFTRRVEELARREGCEVRFMIVCGPDHIHLGVRPVAAWGCREIAVADGT
                     RDAHFRGEDEGGGSRVLWRIEGCGEWRELEGPHKVWECSVLDASEEEWDGTEDGRLKY
                     WFMPRVKQEEQFSSTGIREIVNANRTRTVRLAARLTGYALSPGRLVEYLRQLARRK"
     gene            complement(<979835..>981280)
                     /locus_tag="THITE_2020879"
                     /db_xref="GeneID:11516500"
     mRNA            complement(join(<979835..980624,980667..>981280))
                     /locus_tag="THITE_2020879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653948.1"
                     /db_xref="GeneID:11516500"
     CDS             complement(join(<979835..980624,980667..>981280))
                     /locus_tag="THITE_2020879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653996.1"
                     /db_xref="GeneID:11516500"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2020879"
                     /translation="PDDAPLPDKSPSSNAATGASAASVRALTSQAIAFYFRAPVKAFF
                     RTRVDYLAYARALQEQQQQQQRQAHAAAARLANDPLPHSTPSPATATTTHPPRHWLLS
                     RLRSTAPGLLASAIRHHGWRVVPDQVLPPLLANAAVGAVLYTSYLQALARLHPESGRA
                     SRRVYPPPAPAQTFAAGFVAGAVQSVVAAPLDAVQARWEMVAAASAMGNGVGGGTGVG
                     EKRPASMWAFSRGKLKEIGVRGIFAGWGLSFLKDSLGSAVFFSAFEYLKAQSYYSFVT
                     WYYGSLNEDAVVRLSRKRPAPEDGRQRLSRDWEGEEQPPPTVIRPHYAIEPAFLLLAG
                     MGASVAQQVVLHPLSHVQAEHWERLEALDAKARKLKLKRQARSAEPPGANSTWRWRML
                     RAYRDAYRITWAECVAEAQAAGLSMRQWLYRGFWWNTIRQVPSTSAGLIIFELVRRKY
                     GFGGDQVRINRDGYDIML"
     gene            1005478..1006941
                     /locus_tag="THITE_2170564"
                     /db_xref="GeneID:11516501"
     mRNA            join(1005478..1005659,1005750..1006941)
                     /locus_tag="THITE_2170564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653949.1"
                     /db_xref="GeneID:11516501"
     CDS             1005936..1006745
                     /locus_tag="THITE_2170564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653997.1"
                     /db_xref="GeneID:11516501"
                     /db_xref="InterPro:IPR008701"
                     /db_xref="JGIDB:Thite2_2170564"
                     /translation="MTRVDAALLLLAVAAAPAVLAAPPLLVGRAPNPPTALPQRATAN
                     DLRWQPSLDFDTDGCYNVPAIDAQGNIVQGLPHDFTGLSSDCHDLSDLDNNNVYSRQR
                     CNNGWCIYLYGYYFEKDVAIPDFIDPGHTHDWEHIAVWVSDATGKAEYVAASQHGNYE
                     VRAAADVRWDGEHPKMVYHKDGLSTHCFRFANADDDKIENAKGVWFRGALVSYNGFPS
                     TALRDELFAHDFGEATIDFKDATFPGAIGRAKPSQITVFDPNLDVGSPGTP"
     gene            1008353..1009844
                     /locus_tag="THITE_2116536"
                     /db_xref="GeneID:11516502"
     mRNA            join(1008353..1008585,1008649..1009008,1009167..1009460,
                     1009625..1009844)
                     /locus_tag="THITE_2116536"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003653950.1"
                     /db_xref="GeneID:11516502"
     CDS             join(1008531..1008585,1008649..1009008,1009167..1009453)
                     /locus_tag="THITE_2116536"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003653998.1"
                     /db_xref="GeneID:11516502"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Thite2_2116536"
                     /translation="MKLTTSVALLAAAGAQAHYTFPQTDINGQLSGEWVTIRETTNHY
                     SHGPVTDVTSDQIRCYELNPGTPAPQIATVQAGGTVTFTVDPSIQHPGPLQFYMAKAP
                     SGQTAATFQGTGNVWFKIYEDGPSGLGTSNITWPSSGKTEVSVKIPSCIAPGDYLLRV
                     EHIALHSASTVGGAQFYLACAQLTVTGGTGTLNTGELVAFPGAYSATDPGILFQLYWP
                     IPTSYTNPGPAPVSC"
     gene            complement(<1021018..>1021188)
                     /locus_tag="THITE_53764"
                     /db_xref="GeneID:11516503"
     mRNA            complement(<1021018..>1021188)
                     /locus_tag="THITE_53764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653951.1"
                     /db_xref="GeneID:11516503"
     CDS             complement(1021018..>1021188)
                     /locus_tag="THITE_53764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003653999.1"
                     /db_xref="GeneID:11516503"
                     /db_xref="JGIDB:Thite2_53764"
                     /translation="YIKKVYKVLRRLKDIGLNLDLKKYIFVIKEVKYLGYIIEVKVYI
                     SPNPEKIKAIYK"
     gene            complement(<1035531..>1036987)
                     /locus_tag="THITE_52978"
                     /db_xref="GeneID:11516504"
     mRNA            complement(join(<1035531..1036365,1036381..1036428,
                     1036451..1036509,1036601..>1036987))
                     /locus_tag="THITE_52978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653952.1"
                     /db_xref="GeneID:11516504"
     CDS             complement(join(1035531..1036365,1036381..1036428,
                     1036451..1036509,1036601..1036987))
                     /locus_tag="THITE_52978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654000.1"
                     /db_xref="GeneID:11516504"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_52978"
                     /translation="MYNIPYSPQSLGSLRDTGADSDPGLIRATEAIAWSSIFPYAYYM
                     IRSFEVPEHEVAFYASALVGVFTFGEFLTGVVWARVSDRIGRKPTLMLGTFCALVSAL
                     SFGCSGSVAAAIASRAFGGLFNPNVGLLMEEQRRHFLLSASSGLLGIFHCVPAWAAAY
                     YCLIINLIGPVLGGLLADPVTLYPAVFPGNSIWDAHRYLLPNLAVGILQVLTLLLTFF
                     CLRETHPRLAQRYDPGLSAIRAAKSYLRGGSAEEVTYAPLPLDSVPSGTLESPPEAHQ
                     LEALEEDSLERKAASSRVFTLQVVLEILVVSLLAFHKMSSDALMGTFLSLAPASGGDD
                     QGSRASRRSAFFPHANGGFGFDTRTIGIIFLTEAVFRALIQPTFIPWLISKLGALSAF
                     RTVLGLYPAMYLLTPFLPSLPSPLGLVALLPDLWIKVALSSVGYVCSAVL"
     gene            complement(1037396..1038899)
                     /locus_tag="THITE_2116537"
                     /db_xref="GeneID:11516505"
     mRNA            complement(join(1037396..1037789,1037871..1037958,
                     1038033..1038899))
                     /locus_tag="THITE_2116537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653953.1"
                     /db_xref="GeneID:11516505"
     CDS             complement(join(1037489..1037789,1037871..1037958,
                     1038033..1038720))
                     /locus_tag="THITE_2116537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654001.1"
                     /db_xref="GeneID:11516505"
                     /db_xref="InterPro:IPR005581"
                     /db_xref="JGIDB:Thite2_2116537"
                     /translation="MFMYLQTEKLGDTGRVMMQGEYESLKAMHAVSPSLVPEPYGWGQ
                     YDDDPETYFLLAEFRDVGEQPPHPVNFTRRLAEMHIKSVSPTGKFGFHITTCHSKLPQ
                     ITDCWEDSWAVLYRKQLAHMIKLDEEKHGPWPEFKIVCQLVLDKVIPRLLEPLQSGGR
                     SIKPCLVHGNLWDENCAADMVTGEPFIFDAGSFYAHNEYEIGNWRAVRHRLSATRYVK
                     NYLRNFPPSAPKHEWDDRNLLYSLRFDLGTAILIPSEQRQIVKENMTILCKKFFPNEY
                     AALQNGLIGLPLRANPSLRRAATYSEDQQVDEEEEDETQFEENDEEDIEEETASKLLD
                     MDAKDDWDDQTTVVDEDQQPRSRL"
     gene            1039688..1040279
                     /locus_tag="THITE_2116538"
                     /db_xref="GeneID:11516506"
     mRNA            1039688..1040279
                     /locus_tag="THITE_2116538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653954.1"
                     /db_xref="GeneID:11516506"
     CDS             1039884..1040273
                     /locus_tag="THITE_2116538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654002.1"
                     /db_xref="GeneID:11516506"
                     /db_xref="JGIDB:Thite2_2116538"
                     /translation="MATGSDSRFFTSAPPKNPQGLTLVHEPHDATADVIFVHGLGGSS
                     WTTWCWRHDSSMFWPAWLQHEQGLSEFRIFTFGYNANWRGPDTPLSILDFAKGLLIRM
                     RGFGDEDPSGAQPLGKVCAVMITTTGW"
     gene            <1040443..>1045327
                     /locus_tag="THITE_2144959"
                     /db_xref="GeneID:11516507"
     mRNA            join(<1040443..1040694,1040744..1040906,1041017..1044647,
                     1045210..>1045327)
                     /locus_tag="THITE_2144959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653955.1"
                     /db_xref="GeneID:11516507"
     CDS             join(1040443..1040694,1040744..1040906,1041017..1044647,
                     1045210..1045327)
                     /locus_tag="THITE_2144959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654003.1"
                     /db_xref="GeneID:11516507"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2144959"
                     /translation="MISRVHGIVFLSTPHRGSSHASSLNTLLSVMVGTSNKVYVSELE
                     SNSTSIEDLNEQFRTVCGPLRLVSIYETLPTRVPPGIKKLIVGKDTGVLNYPKEISGP
                     ADADHHTICKYRSRVDDNYILFITFLKQISRDLMAPFLGIVENPVEDVQKFASQGLQG
                     SGEWLRERKSFQHWLSDPTGENRLFCLSGMPGTGKSTLAAMTVRHLQQAFLAQSCQFH
                     FFLESQPTKKSVAYCLRSIAFQVASTHDVFAEQLLRLHQDVGDVLSSQKHQTIWAKIF
                     EGILFKLDVGYTLHWVIDAVDESENPQAFLKFLSQMQSYSCIKIMLLSRPSKDITSAL
                     AQKGKAAIFDTISVRDTAADIRGYVRSVVAEALPAESLIREEIIERILARTEGSFLWA
                     RLALDRLHHDWHTLGDIQKAMDVIPKDMQSLYRNMLLSIKNQEPRLQDIAQRILTWAT
                     CSFRPMRVVELQAALEPEFGGFISLKDTIVQVCGHFVRVDGDSVTLIHATARRFLVTP
                     DGEEPELISSRGGHETLAKACLRYLSDDRWRRILSQVPQADTEHKDRLSAVYESHPLL
                     SYALNYWAYHVRHAPVSSPELLQHLKLFFAKHVLCWIQAVALSRSLRTLPLASQYIKL
                     YLKRRKRARPSSLDAAEPRGETSAPGDNEVQFLERWAVDLIRLLGKFGSNLAETPSSI
                     FKHIPPLCPRDSIIAQFGARQDSALIRVAGISSRNWDDNLARLSVGQDQTASKVRCSG
                     VYFLTLVSASGTIIVWSAETCEELRRLEHGEWVVLFETNGTGSMVVSSGRFTFKIWDI
                     STGNLLHSFNKLPEADPMHLAFGNTDTDLVVAYDDCSIVRYDAQTGTALARFRTDKSD
                     KLRGCPRLMVLSPDRTQVVIAFRGRPVFVWEANVDAPNPPRRCIRAADESRSDENDVY
                     SAPEVAVWHPDGDSLFILYQDTVLVHWNLIEDEREEYDNTEAREMVINSDGTLLLTSN
                     NRGVLSVWALPKLNLVYRLHGNEFVRDIAFSPDSQRIYDVRDSICSVWEPDALVRPDD
                     IDRHGDNLSSTADGSGVSEAVSEPVYSQDKSGSAITALAYERGGEFYCCGREDGTVAI
                     HDMLKGKISRKVCTHGPHADVISLAWSPSGRYLVSGDDMGKIIAKKLRLKEDGKWAVY
                     PVFEAWIADDVADEVADQFLFSPDETLLLISTRSRDQIWDLASRTLALERTRSGDRSG
                     QWINDPFDDSRLLFVEQNRVHIHNWRDFEKETTLDIITTDPTDQAEEATPRPSDITST
                     DKVQALSTTHSRRFIVHQTSPEPWNMRSKTNRGRNQINLLLAADLQGPAPTPKEQVRR
                     RSLPELSARTQLFLGTYREKIIFIDHQNWPPISVSMTVRVSNGRRHLHGWTRSLREQK
                     APCVGLEAG"
     gene            complement(1046266..1047266)
                     /locus_tag="THITE_2116540"
                     /db_xref="GeneID:11516508"
     mRNA            complement(join(1046266..1046801,1046868..1046979,
                     1047051..1047068,1047141..1047266))
                     /locus_tag="THITE_2116540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653956.1"
                     /db_xref="GeneID:11516508"
     CDS             complement(join(1046695..1046801,1046868..1046979,
                     1047051..1047068,1047141..1047188))
                     /locus_tag="THITE_2116540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654004.1"
                     /db_xref="GeneID:11516508"
                     /db_xref="JGIDB:Thite2_2116540"
                     /translation="MAPWARLFWTLYLSVEDRIVHFILRSPSFHRGVRRIHRTVENLR
                     YGRDPNEPLRQGEATAEPSRSQSFLKHFIEELRNQARGKPTDLPPNPPKD"
     gene            <1048088..>1054168
                     /locus_tag="THITE_2154984"
                     /db_xref="GeneID:11516509"
     mRNA            join(<1048088..1048170,1048231..1048765,1048906..1049229,
                     1049286..1049447,1049506..1049533,1049592..1051525,
                     1052231..>1054168)
                     /locus_tag="THITE_2154984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653957.1"
                     /db_xref="GeneID:11516509"
     CDS             join(1048088..1048170,1048231..1048765,1048906..1049229,
                     1049286..1049447,1049506..1049533,1049592..1051525,
                     1052231..1054168)
                     /locus_tag="THITE_2154984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654005.1"
                     /db_xref="GeneID:11516509"
                     /db_xref="JGIDB:Thite2_2154984"
                     /translation="MKVNEDAIKPVGLTLLYEPDWPIDPAVDVVLVHGIGGHPVRSWK
                     CQSQEQALAATQTTVSHPGIKRRLTKRQPTALLRRSNSEPLLPRDQRAGSSARTPLGN
                     LSAKSASRLNLDISAEPTRQGSLSRSRSLLRKISVKSASRLKLAVLAEPAGQRHLQDG
                     AYWPLDFFPASCPNARLFTWGYHTLVTGTKPLPLQADIFSHAKELLLLRLSEAEHDGP
                     LKEILLSTSAVIFLGSPHRGTEHCKLGDAIRSMASVTLPGDPDDPALQELCGANSVAV
                     ELGRQAFVRLWNEYNFKVKTFQESVIPSYQHPEIRAETTIRRLASFIGDPREDAETIY
                     ALHADICRFGSAEDAGYRALMKTLTAIICKEEDARHVLNTKETECLSVLVQPQPALPE
                     THPATSYPGTCLWLYDLHDFKAWHHRDGPNKHKILWIRGESGCGKTILLRSLRRRLER
                     QWGPAGAAFIWCAAQACNGTDVPLAGHYHVSPAGVYRDLLAQLFLLDPRLRKALLALY
                     NQPRSDPRTFDDAQVVSFFADYYVNQKIETPVRRTFIIVEIADEACPAYVNELLNRLS
                     RLARNSDFSICVASGYRQEIIEEENLISIPMHLRNTDDILRYVNLNLLAEWEERDSAV
                     MTIGRKARGVFLWAEIMVNILNAAIIEGATQEMIEYTLDEVPDDLHGLYEWMLSTLND
                     RERAESLLLFQWVMLAAEPMRLNDLFLAVRLTDADPFALYRKHGPLMALDIGMPLSMR
                     ELRQLRNSEINSDTPDQFHRFLRARSIGLLELKSDSHQSAANEPLGLQRVQPIHSSVR
                     TFFLSGRGFACLAAGNPSIPANLPVTDFIDITHYAMLRACLTYLNMRDFESLGHGASR
                     RRKPTSSQALFPLSPLKPTATTPPSLSPLQQQQPRWHPHHPQLISYSSSRTTTTISSN
                     PTASTHHQRHLILTSYPFLPYAVTHLLFHLLSPTRFRYFFPQRALLAALAADGFRLWK
                     RWTSLLGAADPDAIVAMHAAPGARAAPLLSPVFGARFRLERVLRKLARLANTRVSAVV
                     LHFPGSPACNRCSPAAPMYAARSHVRTTLLHAPCARRCLVAQQARRTLAAAATSAASA
                     ATDVGTAHNAIAQQLRDTGVWAYLRGRRRGKNTDKYRVNVVSEELCDDILNYIKPTMA
                     RHEGCDILDIFPGVGVWSRKLNDLLKPRSHLLLEPDEEYYRPFLQPLLERPGTQLLPE
                     SGIVWEQLNKILNPTYLPHQVERRYSADETPERNDTLLVTMNLSMHPKRKFRSFDSLA
                     QLVLFQVIASIRPASLFHKYGLVRMLLWIPDQEKGAIMPRTVQRRKKMAIEAEISTDY
                     VCEVAGAEVVDSGSGRGQWYRRDSGMDLYSTAQTLERMRRGGFVMPPGREPEHLLEFL
                     KQNGAVPSDDELAYGQERAAYTAELHELETAQAEGRLQQGSAAYARLKALQYWVKWSV
                     KRTGKIGNILRERHEIVQAFVNAGSDQALLERAAKMGEDWCKKVDSLDRSMRADVLLQ
                     RDNMHILYQDPPVMNWDRRYVEPLRVRAHEFYPAVPSALLDIQPKAAARVLRDIGPRS
                     TRGGDTFDLVLRSLSQRGSEPITKALNTIFPGAGDGVFPYCPSLADPAAGGSPIRDVG
                     EVTTRSMNERQFVEIAERWMQWPFRPTYAELVSRTVEDFSDDIEESPSGNSMSPNVD"
     gene            1054926..1057594
                     /locus_tag="THITE_2116543"
                     /db_xref="GeneID:11516510"
     mRNA            join(1054926..1056043,1056103..1057594)
                     /locus_tag="THITE_2116543"
                     /product="glycosyltransferase family 90 protein"
                     /transcript_id="XM_003653958.1"
                     /db_xref="GeneID:11516510"
     CDS             join(1055308..1056043,1056103..1057244)
                     /locus_tag="THITE_2116543"
                     /note="CAZy_ID 269951"
                     /codon_start=1
                     /product="glycosyltransferase family 90 protein"
                     /protein_id="XP_003654006.1"
                     /db_xref="GeneID:11516510"
                     /db_xref="JGIDB:Thite2_2116543"
                     /translation="MPFPRRPSAFLRYLLPALILTLTFYILTQTKGLSSQIGPLLPAV
                     SWKHKNGSNRHPIDKLVKKADEEFSSLISRATSTLEDAAAAYRKRRGRHPPPSFDKWY
                     EFARQKNAIIVEEFWDQIYHDLEPFWALKPAQIRKDAREFEMRIEIRDHKASTRSDWF
                     WTQIWLEMLQTIEHLLPDMDLALNPMDEPRLVVPWEDIQGYMRQAAKTKTMEDPRGVV
                     SEFGKLPLPGKETLEEEAAPERIWEHEKHYWLIARRGCAPDSPARKADVVTDFNRTPS
                     IASSFDLKHMQDGYVVNYTLSTDFCHQADLQALEGIFVEPLSVSATRSLLPVFGGSKL
                     AVNNDILLPAPMYWNEEERFTGAEGASIPWESKHSSAIWRGVATGGLNRETNWRSFQR
                     HRFVAMNNASQLALAASGASPPLNFALPAKEYHLAATRSSSSSSSSSSSSSSTNSDLT
                     LPGWLSATTDIAFTDLMCAHDGFWPGCNYTDAYFAPVPPMPMAEQFRHKLLPDVDGNS
                     FSGRYLGFLRSTSLPVKAALWREWHDSRLVAWKHFVPMDARFGDWYGILEYFLGCEAA
                     GVPGRDGVAERIAMAGREWAGKVLRREDMQVYVLRLLLEYARVVDERREKMGWVGDLL
                     R"
     gene            1058652..1059996
                     /locus_tag="THITE_2116544"
                     /db_xref="GeneID:11516511"
     mRNA            join(1058652..1059530,1059603..1059996)
                     /locus_tag="THITE_2116544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653959.1"
                     /db_xref="GeneID:11516511"
     CDS             join(1058767..1059530,1059603..1059915)
                     /locus_tag="THITE_2116544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654007.1"
                     /db_xref="GeneID:11516511"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="JGIDB:Thite2_2116544"
                     /translation="MSPFGRNGDIAGAGTLTPPPTTGRNSPRFFGKLNTSMIESKFLA
                     HPEDLGIVAVGFSGGQGKPGVDAAPTALIEAGLLTQLRDELGYNLHGHDTVHLYNDLV
                     PAQDPPHRGMKNPRAVSAVTRRIAGQVYEHAREGRLVLTLGGDHSIAIGTIAGTAKAM
                     RERLGREIAVIWVDAHADINTPETSGSGNVHGMPVSFLTGLAREDKDEFFGWLKDEHR
                     ISVKKLVYIGLRDVDPGEKRILRENGIKAFSMFDIDKYGIGRVVEMALAHIGNDTPIH
                     LSFDVDALDPLWAPSTGTPVRGGLTLREGDFICESVHQTGSLVAVDLVEVNPRLAPEN
                     DIGAHETVRAGCSLVRCALGESLL"
     gene            <1062307..>1062986
                     /locus_tag="THITE_2129528"
                     /db_xref="GeneID:11516512"
     mRNA            join(<1062307..1062497,1062605..>1062986)
                     /locus_tag="THITE_2129528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653960.1"
                     /db_xref="GeneID:11516512"
     CDS             join(1062307..1062497,1062605..1062986)
                     /locus_tag="THITE_2129528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654008.1"
                     /db_xref="GeneID:11516512"
                     /db_xref="JGIDB:Thite2_2129528"
                     /translation="MASTVTSDSAVYERRVVERIHKYHWPAVQLNLWMLIMLIASCLI
                     IGVFATFIQIQQTLLLPIPWYFPYYITVASLSVAFILLLLWLIFQRRLLPSIVLIGGF
                     ILFVLWLVGLVVISIQLWGPSGSVSSNCNVYVFGASPQPTGQSLQTLAWLQQRSICQS
                     WQAVFAFGLVGEIFLLWIMVMSYQVFADDS"
     gene            complement(<1063786..>1065818)
                     /locus_tag="THITE_2129529"
                     /db_xref="GeneID:11516513"
     mRNA            complement(join(<1063786..1063792,1063858..1063907,
                     1064111..1064278,1064365..1064523,1064614..1065579,
                     1065735..>1065818))
                     /locus_tag="THITE_2129529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653961.1"
                     /db_xref="GeneID:11516513"
     CDS             complement(join(1063786..1063792,1063858..1063907,
                     1064111..1064278,1064365..1064523,1064614..1065579,
                     1065735..1065818))
                     /locus_tag="THITE_2129529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654009.1"
                     /db_xref="GeneID:11516513"
                     /db_xref="JGIDB:Thite2_2129529"
                     /translation="MPTTARDYPAAAASPAGSHSASSGPQVANQACRPYQSAHDEALD
                     ELLHPGRNGTGTGEAIGVDIGALGFYTDDSGLGDSALWENVGNIGAAAGDADPGPIEL
                     QGLSLTEDAGNSSGAKEAKDWAGNGGTALARDTGPAEEAGSAWGDFAGGYEEEWHFAP
                     PQEASGDTGNPDTPPIANVGNADSPSNSGSLVDLPTAARDGGEASDERVFGDAEGTGT
                     PPIVDTSNDGSPLASGNAGAESKPASSLSDEGMILVLPTRPAETSTTTPSLQPQPPDS
                     SQPAEEAVPAAAGPDASSRASPPAEHKPFTVCICRDPPEKGYRPPPCRSLKCTGRVSN
                     PEHPIQAFRRRCDECIAARCHRPMRSYLCICRSCSARRAPKRLGCKLKNPAECEGRTV
                     DHLRRWCNRCKEAGCDEITTNPRRGRPYKCKCTWEEAPPCAFPERCLKEGTMVKTGEA
                     RVAWYCANCGYDVDNQESVLDDGDGFT"
     gene            1070025..1075515
                     /locus_tag="THITE_2116547"
                     /db_xref="GeneID:11516514"
     mRNA            join(1070025..1073645,1073700..1075515)
                     /locus_tag="THITE_2116547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653962.1"
                     /db_xref="GeneID:11516514"
     CDS             join(1070313..1073645,1073700..1075184)
                     /locus_tag="THITE_2116547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654010.1"
                     /db_xref="GeneID:11516514"
                     /db_xref="InterPro:IPR012943"
                     /db_xref="JGIDB:Thite2_2116547"
                     /translation="MDNLQEGHEPVSRPSTACKIDPDDDAASPTKQHADEKRPATDVA
                     AVKAENIPPLHPPAAALAAPESSYLESPSMNLRHSDSQAEIIVRQHLQDIESSFSAAP
                     SPLPASNNGLDDTFLFDSPSKKPAPPRFAPNADDSSAVDQSQVLPTLSRSTTSTPHNA
                     RESSPQLPGQDNSTDDVGNGTASLETFSSSPTAAATVRSISQALSQAASVRSEPSRER
                     ADSPVEQHAPDQPVDDSLLHPDSSASLSTASRDESRERAAADAGHTPGQALKAAKRPR
                     FLRSRIGSQRSSVSSLHTDPDSDVTVGMGADYALQSGGAVPSSGMPRSFNNPLSRSIS
                     MGSMASGIEDLHDSSGPVFRQLETLDEVDGSISPQSDSRRGPDRAILQTPKPTKAAAL
                     AAPTDTVIARHVRDVQVPESLAKEYKNRGGLVTPARPGTSDAGGFGTSTASRHGRSLT
                     LKEQSSTIERLSKENFDLKLKVMFLSDRLDKLSEEGIKEMISENVELKTGLAVLQRDN
                     KVLRRRVKELEKQLKDEEERPGTARSGQSDDEQSAAYDQEAQEREEELIYLREQVEEY
                     VTEIERLRKENLNKEAEKRRMAEVVRTLGEKTGERLGEDFERQEEADVWKDLLEQETA
                     RREQSDEDNRRLRDEIFRLKQELAAHSAVGPMHHTTNIYNITKKPRDRPSSPGRSGTS
                     VLGDADGHATLSVSSTLVEELRRESEQLRHENAELRREVGAQTSMLTSRNREKERLYQ
                     EIEDLKMAQRRGAPAPSTIDSLLERSASRAGVHERSQSRASGGTRGTNTAVDDADLEE
                     LENKLAELRDKNNDLKLQNQDLQRELNACMADFEAAIEAKRQAEELVAALQDDLETAM
                     SDLMALQAERDEALQEHANLENEFEALRKEAQEEIDALEGEADQRTAEIERLQLDLND
                     RTENFDALQGEMRKMSEALVRLEDEQEAKLRRIKQLEQELSDANKELEDLEAKLLEAN
                     DKANRLSVQQESSQGEIAFLREEQESDKIRIGDLEAALANAEQSLREEKERAKELEQR
                     LAAERRQREIVANREKEEVQQFVNELNREASAAKDEARRLRKSLTSREVEATEWKERL
                     LELENNLREALGDLNGTRSSLLKSIAKLQRDLENTVRDLDATKSSLAEKDRMIKQRDA
                     LLESHALESRKLAEMLDKERQAHRNVKHQFETFQKTHQHITRTVSSQDQRIMELEQMK
                     SQDKKRLSQLENTFKEQLTERNNLLLVLWTRLSALCGTDWAHDNSLINGRALPSLESV
                     ATMLPGFSKNLLAAVKTIETMVGSFQGKIKSVEKDLWREYQTLENHLEQRTKKLDRLE
                     AIVRNGIATGQLSTHSHTLTETQARLARLEDAYRQLKIENHTLRAAAEARRAAYAASA
                     DHNGPESPGGSPSPLVPTGPKAKDRSSKIPKSGSKSSGLGKMATPTRSSSSHYHYHPH
                     PSRQSLAAADEVAMLSRSRGGSPATPRGGGDPAATEDDDTITGSLPQPSQPQASKGGH
                     DRERTSASAATSTAITTSTAASGTNTNNASASSNASGSTGAGGSSSGGGGSMDNKWML
                     RLRDLEHKLKAEREGRLLDRGEALKRLTASESENAALRENLERERERRRAAGR"
     gene            complement(<1077098..>1082243)
                     /locus_tag="THITE_2144965"
                     /db_xref="GeneID:11516191"
     mRNA            complement(join(<1077098..1077141,1077500..1079614,
                     1079675..>1082243))
                     /locus_tag="THITE_2144965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653963.1"
                     /db_xref="GeneID:11516191"
     CDS             complement(join(1077098..1077141,1077500..1079614,
                     1079675..1082243))
                     /locus_tag="THITE_2144965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654011.1"
                     /db_xref="GeneID:11516191"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="JGIDB:Thite2_2144965"
                     /translation="MPAPDTVRRHGRRKPDLNIDTSPPPPPPPPRARERDLQRDRQRD
                     GGRAAEAVPQTPTGLLPPTPSEDSVSDSPPARPRAPQGRDPADIETFLEGLTPVDIPI
                     DMTDKDIDRPEPHRPGLRDSHDLSLPPRQVTRDSLVANMLLSLDQLSMGQIGTTYGPS
                     RSSYDESAIYRTPFSEDARAMTFTSRSGRANGHGYSYSSDFEGADDASRISSRGRRSN
                     SSSGYQPGLGRINSMRETSQRSPARPLHSRGGKGSKSSSTASVDAGYAQVLSSQRWAR
                     GFGGRSSSFDGEPRPSPAPWQVEFASSFFNDAYDAAPTPTVPAGPRKLTTAPSMPVMP
                     PPEPKPVPKSPTRGAAPERRRSTRSSRSATVGRKAEPKFNAARDAPPLPVFDLDSAPA
                     PHVGYEKTKEPVPVPPANAAPQPKEKQGFFRRMFGSSKSAVTSSSSSPQVSAFSQQQK
                     SSTPPSRESHQSATHTLQKKTSSFFRRRKYSITDSEPPPVPALPLAPAVKLPLDRLDV
                     LAGKAEPSPITSLRRAMDPFLQDSSSASAAPENPADTPLPSVESPHDPHQEKTTERAA
                     AENDEDRAPRGFSPDYEPSPKAVIRKVDPETVTPGSRPVATPSRQPDEYPAGSPPKSF
                     LRDNSDSEDSPVRQRKAPRSEPREKNLRPGPQPDGRTRSPSPVVSKSKSVPNLNKARE
                     EARLSSRPDSKRSPSARNDRGDSSALSPEAGAEPRYKHSVPSLRVDSAEPSPNGMGTG
                     ESINQSAKSIDEPEIIVGDPTEDDRQKAQKIFDGNEDFIQKDRAAAWMGEEGIVRQRT
                     LRAYMELYDFEGQSILASMRQVCQRLLLRAETQQLDRILVAFSKRWCECNANHGFKST
                     DVIHTICYSIILLNTDLHMADIEHKMTRSQFIKNTMTTIRQALQESAPDAFNRPSILP
                     GKATLGADGEGRTSEDSKHNSFRASFKPPPRPGSALGTFSDQTPGDSCGPLVKAPFDG
                     PLRAWEAQVELVLKDIYASIRDERLPLFGAEPAAPQTPGGLSVMGVLKRTPSVLSKAP
                     SEGVASTRGRVPEAAKASSSRWNSKSRSRPRGFNNGFSSSRTSLEDGNSVWTPTDSSA
                     TWSKLSLGRTHTSMSMDSFGSSYPRGDFQQSIGFANALSQAIIREDSALETLKDEIKN
                     EQLLDDESLELEGPPWVKEGIVTHKHHLDGIDRKAKGRNWVEVFAVVQKGQLSLFSFS
                     PNKSLRNKARRGLGSTALLPKGAVVGGGNWQDNATNLGTFSLRQTLATALPPPGYSRT
                     RPYVWALSLPTGAVHLFQVGTPEICREFVSTANYWSARLSTHPLVGGISNIEYGWSEA
                     LINSASTNAAHHPANDSAASIVGGRPPSSTKGHSRPGSAANAASVAAAGVGRSSMQSG
                     RSMRSASFDFAVRPGSGSSGVLGGGGGSTLPRHHAHPHHSSAHPHHGRLPGDRVHIAD
                     WTPPTPSMRPSPLAEADQLESLLGYVRALEAELQAHNALRSPMLGAFSPRSPNAARAM
                     ANWERKSEYLLREIVKFRTYVDALRHAEARRREIYRERETARRAARGEEVRDVGESED
                     EDEREHEREAPVSSGGGKSLSDG"
     gene            complement(1083301..1084168)
                     /locus_tag="THITE_2116548"
                     /db_xref="GeneID:11516192"
     mRNA            complement(1083301..1084168)
                     /locus_tag="THITE_2116548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653964.1"
                     /db_xref="GeneID:11516192"
     CDS             complement(1083344..1084006)
                     /locus_tag="THITE_2116548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654012.1"
                     /db_xref="GeneID:11516192"
                     /db_xref="JGIDB:Thite2_2116548"
                     /translation="MAGSTVRSSSANLLPHAYSRPLPLFSPRVWLTRNYATVLVNNAG
                     FPGGRDLTEDAPAAKIRAVFGELLNVHITSVAVMTYAFLPLLRRAPAPRVINVTSGLG
                     SMTRVLTPGLRMGRFPPYGASKVGMNGLTAHMQVVETERAAAEAAEEGKESRGARVRF
                     FISNPGVLKTAFTHFHPMGRAPQLGAKSIVELIGDDEGKYDDHMQWEWDLEGDQMRKV
                     PW"
     gene            complement(<1099961..>1100398)
                     /locus_tag="THITE_2049812"
                     /db_xref="GeneID:11516193"
     mRNA            complement(join(<1099961..1100271,1100293..>1100398))
                     /locus_tag="THITE_2049812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653965.1"
                     /db_xref="GeneID:11516193"
     CDS             complement(join(1099961..1100271,1100293..>1100398))
                     /locus_tag="THITE_2049812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654013.1"
                     /db_xref="GeneID:11516193"
                     /db_xref="JGIDB:Thite2_2049812"
                     /translation="FLVEAYNNLIGYIKAKILLNKSSKSVKSFILQYILFVVVNRGSK
                     FKGEVKEILCKLDIKRVIISLYNLYTNSVNKASYIPIAILFTKITNSIGKRWRELLLY
                     ILYIDYTTIKGSYKISPFFLIYNYKPISLVEFNVPI"
     gene            complement(<1178128..>1178367)
                     /locus_tag="THITE_2051926"
                     /db_xref="GeneID:11516194"
     mRNA            complement(join(<1178128..1178252,1178316..>1178367))
                     /locus_tag="THITE_2051926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653966.1"
                     /db_xref="GeneID:11516194"
     CDS             complement(join(1178128..1178252,1178316..>1178367))
                     /locus_tag="THITE_2051926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654014.1"
                     /db_xref="GeneID:11516194"
                     /db_xref="JGIDB:Thite2_2051926"
                     /translation="ILGDYITIYLDNVLIYLSLNLDLKKYIFIVKEVKYLGYIVEVEV
                     YIYPNLKKIKAIYK"
     gene            complement(<1188533..>1190392)
                     /locus_tag="THITE_2129533"
                     /db_xref="GeneID:11516195"
     mRNA            complement(<1188533..>1190392)
                     /locus_tag="THITE_2129533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653967.1"
                     /db_xref="GeneID:11516195"
     CDS             complement(1188533..1190392)
                     /locus_tag="THITE_2129533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654015.1"
                     /db_xref="GeneID:11516195"
                     /db_xref="JGIDB:Thite2_2129533"
                     /translation="MHPFPVWPGVPFLWEQYRCDCYKYFQFYLCGCPDLTIAKSGRPP
                     EHQPSIRRCAMWYKPEWEQRQAASYRFEHKPDWDLPFKEPQVLPFPCYHHWNQSRIFL
                     DPSALGDLGRRLDNPATNPPRAARWNRNIRALQHFQEQGRTWELKKRVREVLDDPSQR
                     PCKLRKRAADDSETEALRPRFHALALDDRLRDSLQEGIGSADQTLAAYPSPPTSGPSS
                     SGDESGYHSASPSHPAPPPGGNSCNGSGPDSGRRKFAAHVEDASSTESSPRLESDTYS
                     ASPLQPVSPSHRANPPDGSYRNGSGPGSGSRNIYAAYVEDASSTESSPGQEGDIYSAS
                     PLPTCPPDASFLHWAWLRFSNRMFAAGDLWGEGGQIPPSGVSETGIPSPSSSRSRSSD
                     QSSGASPAASDLAAPPNPQQLPTPEESSRDASASEPSASEESASESSSPTPPASPLPP
                     PPGTPCPSQPEDNHTPPSPPPASPPCPSPPTPPPPSPPSPAAPANQPYTNPLFAYFSI
                     PPAKNQSHFSSLTWLLEEQHVDLWALDGYRWLQPQPQQQWPCAPRFDGNTHRGYAGGA
                     YRFDLETLGLIRWANWHKWDKKGRWARAVGDWFSMGGWAVEEGGLLGAPLSME"
     gene            complement(1190804..1192127)
                     /locus_tag="THITE_2116549"
                     /db_xref="GeneID:11516196"
     mRNA            complement(join(1190804..1191229,1191290..1191511,
                     1191624..1192127))
                     /locus_tag="THITE_2116549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653968.1"
                     /db_xref="GeneID:11516196"
     CDS             complement(join(1191009..1191229,1191290..1191511,
                     1191624..1192020))
                     /locus_tag="THITE_2116549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654016.1"
                     /db_xref="GeneID:11516196"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2116549"
                     /translation="MSTQKSAIVTGGASGIGLAITRHLAAQGHRVAILDLNAAAGPGV
                     AASVAAEFPQSTVSFHQCNVASWDEQAAAFAKVFQEHGGRLDIVVANAGVSEQGATSL
                     VRLGEEDAAAKGPTRPKTTTVEVNLLGTIYSVNLAVHYMNRKPKTEGASRGSIICTAS
                     NAGLYPLPIAPLYAASKFGVVGLVRSTARVIEKANLQINALAPAVLETNIAPDKDLFR
                     HMIVTPMETLIRGVDQFLADASVSGAVAEIHGDKVTIRPPHEYVDEESRQNIETFWNL
                     GYA"
     gene            complement(1193084..1196600)
                     /locus_tag="THITE_2116552"
                     /db_xref="GeneID:11516197"
     mRNA            complement(join(1193084..1194437,1194488..1195812,
                     1195915..1196043,1196217..1196334,1196418..1196600))
                     /locus_tag="THITE_2116552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653969.1"
                     /db_xref="GeneID:11516197"
     CDS             complement(join(1193275..1194437,1194488..1195812,
                     1195915..1196043,1196217..1196299))
                     /locus_tag="THITE_2116552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654017.1"
                     /db_xref="GeneID:11516197"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="JGIDB:Thite2_2116552"
                     /translation="MPQLGATFVPGGHDDYYMPEVVAPAPQRVMPEVPQSMQEDIQRM
                     ELEAREVEAPRDGNATAPNNQDAPSKSFKPFHTNAPDSAAMDAPSFSPFPKVKGENIP
                     PSDEEKEQILWQARNLVLHSNNVSMQVTWARDALIWVEIAMDARTREWKRENKEKERP
                     PTPKTEHELRVDAMNILEYLAQQDHPEATFMKGKWLEFGKFGFRENKREAYALYKKAA
                     ENGFGRAEYRMGMLYENSNDIPNAIKHYSLGVQMGDSASSYRLGMMHLMGQHGYPKDL
                     LLGLEMIQHAADTADEDAPQGAYVYGMLIARELPDINIPEHVLPCDLAVARQYIEKAA
                     YLSFAKAQLKMGQAYELSQLGCDFNPAYSLHYYGLAARQGQPEASLGVSRWFLFGYED
                     LFPKNEQLAFKYAQDAALSGLATGEFAMGYYHEIGIHVPKDIREARRWYELAADHGNK
                     DAKDRLDSLSQSRMLTKADHETTTLTRIKSQHGSQRGKRPERLARLKDAMPTVSEAEQ
                     NAAAGGVDFPDPTPRPPAFAVNVDNSLAMRPKSAAPYPHDDQPPPLNVRPKSTAPYPE
                     DDVRSPHVNPGAHLAVSAGPQADRPNSAFGIRPLSPSAGLPPGGGRGRPMSSQPPVAG
                     WEPQVPPGYRKPSPGPGGQWQQRPPPQQDPRYGAAGGIVPAGTMPVGDPTRARLQKPN
                     PKLQPSPQGPPPGQYPPGGGYPGPASQPGRDYGPSAGNRPVSDSYGPGGYDRHSTAPP
                     AVAGRVPGAPAASSNASLRPHSRGGGGSGRASAPPAQDARPSPGTGAGPGGQAQAQQR
                     PQPGGRPPAQAAPGGNLVHPDGKTMGGGPATFEDMGIPLGKSENDCVSFGFLFFLASH
                     LRVCFSVTIFSPFCAFAAASACSSARHSTAFISLPCHTYVTVC"
     gene            1200023..1202378
                     /locus_tag="THITE_2116556"
                     /db_xref="GeneID:11516198"
     mRNA            join(1200023..1200628,1200694..1201397,1201459..1202378)
                     /locus_tag="THITE_2116556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653970.1"
                     /db_xref="GeneID:11516198"
     CDS             join(1200081..1200628,1200694..1201397,1201459..1202132)
                     /locus_tag="THITE_2116556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654018.1"
                     /db_xref="GeneID:11516198"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Thite2_2116556"
                     /translation="MRVIRSLLLLLGCSSAATAVLQDKLQPRSTLDTIEQELEAELLG
                     VVDCAGCHAALGLLKLLAVFGDSAFSDVLADLCTLSKAEDADVCKGILEREGPIIAQR
                     VRALDLDSDSSQLFCTTFLGVCSYPDIRPFPVKLSQKPANVVRPAVSGQTPIKVVHYS
                     DIHVDPFYEAGSNYNCTKPICCRPYADSDAPGKTSFPAGPNGEHTCDAPISLEESMYA
                     AIRSVAPDAAFALFTGDIVDHAIWNTTQAQNVLDINDAYSRMAASGLPLVFGTAGNHE
                     SNPTNAYETAAQGSQAQWVYDALNANWAKWFGSGTDNAVEKMGAYNAAYTSPAGGKLR
                     VINLNTNLYYIDNFYLYEEPMELDPSGQWAWLVAQLDAAEKAGDRVYIIGHMPMGVSD
                     AFREASNFFDQIVNRYQDTIAAMFFGHTHADHFQLSYSDYSAQSFTNAVAMSYIVPSL
                     TPTSGMPAFRIYTVDPVTFAVLDAETYIADTSDPSFQTASPVWKKYYSAKAAYGPLVQ
                     PPVAADDAAAELSPAFWHNVTAALAADQAAFDAYYARKSRGWAVSACTGDCVTNEICA
                     LRAARSQDNCAVLQPGLHFAKRAAEAEAVGANGMKRHRDECGVPVAREALAALATKDG
                     LGLLRRRVQEGVRAGRL"
     gene            1202467..1204111
                     /locus_tag="THITE_2116558"
                     /db_xref="GeneID:11516199"
     mRNA            join(1202467..1203648,1203758..1204111)
                     /locus_tag="THITE_2116558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653971.1"
                     /db_xref="GeneID:11516199"
     CDS             join(1203079..1203648,1203758..1204030)
                     /locus_tag="THITE_2116558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654019.1"
                     /db_xref="GeneID:11516199"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="JGIDB:Thite2_2116558"
                     /translation="MADRELTALLAHLKSSAGRLSYSETNALLSRAKLLLLQLNALTP
                     APGTPAAHLALARDTFEQGALASIRARNPDAFTRYVAQLRPFYELLPRGGGAAAAGEE
                     GEGGGQQGERNKVTGLYLLLLLTQGLYGEFHSELEALAAAGGGDAEADRYLGYPIRLE
                     RWLMEGSYDRVWKAMKKGEVPCEEFGVFSEILTSQIRSEIASSSERAYPSLPLSSTKS
                     LLFLESEGAVVEFARSRGWTVRDGQIYFPSAQETGEEEQEKEMSQMIMENTLGYARQL
                     ETIV"
     gene            complement(1204249..1208884)
                     /locus_tag="THITE_2116559"
                     /db_xref="GeneID:11516200"
     mRNA            complement(join(1204249..1204686,1204755..1205869,
                     1205929..1207262,1207319..1207536,1207617..1207855,
                     1207930..1208230,1208284..1208410,1208476..1208525,
                     1208593..1208884))
                     /locus_tag="THITE_2116559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653972.1"
                     /db_xref="GeneID:11516200"
     CDS             complement(join(1204444..1204686,1204755..1205869,
                     1205929..1207262,1207319..1207536,1207617..1207855,
                     1207930..1208230,1208284..1208410,1208476..1208525,
                     1208593..1208622))
                     /locus_tag="THITE_2116559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654020.1"
                     /db_xref="GeneID:11516200"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="JGIDB:Thite2_2116559"
                     /translation="MQSSSGILTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDY
                     RMGTLIDRFEEHDGPVRGVDFHKTQPLFVSGGDDYKIKVWSLQTRRCLFTLNGHLDYV
                     RTVFFHHELPWIVSASDDQTVRIWNWQNRSLLCTMTGHNHYAMCAQFHPTQDLVVSAS
                     LDQSVRVWDISGLRKKHSAPTSMSFEDQVSRANANQTDMFGNTDAVVKFVLEGHDRGV
                     NWVAFHPTMPLIVSAGDDRLIKLWRMSETKAFEVDTCRGHFQNASGCLFHPHQDLILS
                     VGEDKTIRVWDLNKRTAVHTVKRENDRFWVIAAHPEINLFAAGHDNGVMVFKLERERP
                     ASAVYQNTLFYITKDKCVKSYDFQKNVESPTLLSLKKLGSPWVPPRTLSYNPAERSVL
                     VTSPTDGGTYELVNLPRDGSGAIEPAGSKRGQGNSAIFVARNRFVVLNTSTQTVDIKD
                     LMNNTTRSFKPPVGTSDIYFGGTGNLLILTPTAVHLYDIQQKKTTAELAVTGVKYVVW
                     SNDGLYAALLSKHNVTIVTKTLEQVSTLHETIRIKSATWDDAGVLLYSTLNHVKYSLL
                     NGDNGIVRTLDQTVYLVRVKGRNVYCLDRAAKPRILQIDPTEYRFKLALVKRNYEEML
                     HIIQNSSLVGQSIIAYLQKKGYPEIALQFVQDPATRFELAIECGNLEVAVEVAKQLDR
                     PKLWTRLSTEALAHGNHSIVEMCYQKLKHFDKLSFLYLTTGDNTKLSRMAKIAEHRGD
                     FTSRFQNALYLNDVEDRIQMFKEIDLYPLAYMTAKAHGLEEECQSILEATGLTEEQLN
                     LPTFGEPLTPPKPVVPTYKANWPTKTTSQSFFEKALLGQMEGLSLEEEPAAANGPGEA
                     EEEGAVKKDALGEAEEDEDAAGWDMGEDIVPEVEEGFVNVDSTEAGGAGSSEADLWAR
                     NSPLAVDHVAGGSFETAMQLLNRQVGAVNFAPLKPRFLEVYQASKTYLPASAGLPSLV
                     NYVRRTVEESDPREVLPIIPRDLEYLAANDLQRGYDAMKANKLEDGLRIFKGILHAVL
                     VNAVGSESEVAEAKKLISSASEYAVAMSIELGRRALGSPDEVSKNPQLLKRSLELSAY
                     FTIPKIEVPHRQLALLNAMNLSFRSKNHSSALSFANRILAHGGASKLLETARRIKSQC
                     ERNPHDAVEIEFDQFAEFEICAASHTPIYSGTAYEECAFDGSKYHTKYKGTVCTVCEV
                     CEVGKHGSGLKLFA"
     gene            1209481..1214371
                     /locus_tag="THITE_2116565"
                     /db_xref="GeneID:11516201"
     mRNA            join(1209481..1209731,1209791..1214371)
                     /locus_tag="THITE_2116565"
                     /product="glycosyltransferase family 24 protein"
                     /transcript_id="XM_003653973.1"
                     /db_xref="GeneID:11516201"
     CDS             join(1209583..1209731,1209791..1214213)
                     /locus_tag="THITE_2116565"
                     /note="CAZy_ID 269736"
                     /codon_start=1
                     /product="glycosyltransferase family 24 protein"
                     /protein_id="XP_003654021.1"
                     /db_xref="GeneID:11516201"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="JGIDB:Thite2_2116565"
                     /translation="MLQLSRLPWGLAAAVLAATWLPSARVAASPSVNVALKAAFPSPP
                     YLVELLETAAADNATVYFALLDRIAKGHFSDAATDKALYEKFVEVLRDDGHMDAESLS
                     TFKLGLSMRTAAPRVEAHYQYYATAVEPSLSGDQDGCVHWFLVDGKQYCKPTLDAAHG
                     DVKGHSQARTLPFDRKLGSGSRDVILYADITSKDFGAYHETAVNLARQGEGSYRLRYR
                     RSPAHPVEALSVSGYGVELTLKRTDYIVIDDRDTGAAGAPADEAQKPITSSDIVLDEE
                     EEITDIKPLEKSELSLLGVKAASFIMQSESPFDTLLKLTQDFPKYSNSLGAHNVSAKF
                     AAEYEENQKMLGPDGRNILWMNGVQLVDRQIQPFGLVDVLKRERKLIKGVLDLGLTGQ
                     QAVSLLGHTEVAQAKSGDEEPRRFDWRDRLEDGRVIIWLNNLEKDKRYADFSPHLWAL
                     IQHFGHGLPQVRKDIFNLVVPVDFSDPEDLKLITTQLLTFMKRLVPIRFGLVPLTPTE
                     KAIDQAKVVYYLLENHGLAATVSYLEKSLENDKAARPDERIFNEAIKDRPLRPNATPL
                     PFQDIFTSEAHEKQIHLAKRWVERLRADGDVPSIFFDGFPIPKDEHWLRGMNQKLMVD
                     LQAVQQAAYFGAINETTWIPGYLLENAVSRRNTLIFPEDARDLTVLNVNKLYTEHRDV
                     FDQVPVVEAEKQSTKEDWAALTVIADLDSAEGQKLLLYAIQFRKAHPGIRMEIVHNPG
                     DVSRDASELTQRLKARVDKLLGADRLSDLEAILESGESKADPTYDAALAGFLAAANLK
                     AGQNALMLNGRLVGPIPSAEHFKKEDFEQFLEAERSSRIIPVYKALEDLNLGDRVSGP
                     VAAAKLTSATALSGMSDLPQGIFDSASPIRMTVFKELNSTYTSFEVGDASTATIFFAA
                     VINPASEIGQKWAAMFKVLSELEGVHLQIFLNPAAELAELPVKRFYRYVLQSSPSFDE
                     DGKVKALSANFASVPEDTLLVAGMDVPPAWLVTSKVSVDDLDNLRIKDIKARRGTAHV
                     EAVYELENILIEGHSREVPSGQPPRGVQLVLSTEKDSHFADTIIMANIGYFQFKANPG
                     VYSIRLKEGRSSDIFTLESVGPQGWHPVPGDETSEIALMDFQGATLYPRLKRKPGMEQ
                     EEVLGESKANATTAGAAMDFVSKGLRFAEGILGRGKAAAETKSASDTEHAEINIFSVA
                     SGHLYERMLNIMMVSVMRHTNHTVKFWFIEQFLSPSFKDFIPTLAAEYNFKYEMVTYK
                     WPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYDLVTLDLQGA
                     PYGFTPMCDSRTEMEGFRFWKTGYWASYLKGRPYHISALYVVDLRRFRALAAGDRLRQ
                     QYHTLSADPQSLANLDQDLPNHMQFHIPIHSLPQEWLWCETWCSDETLAAARTIDLCN
                     NPQTKEPKLDRARRQVPEWTEYDEEIAALARRRREELYQQQQQQREEQVVEKQEGRKK
                     EEETVERNPKSRRFEDEEAAAGGRVRDEL"
     gene            complement(1214372..1216968)
                     /locus_tag="THITE_2116567"
                     /db_xref="GeneID:11516202"
     mRNA            complement(1214372..1216968)
                     /locus_tag="THITE_2116567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653974.1"
                     /db_xref="GeneID:11516202"
     CDS             complement(1214529..1216952)
                     /locus_tag="THITE_2116567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654022.1"
                     /db_xref="GeneID:11516202"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="JGIDB:Thite2_2116567"
                     /translation="MASLSMPGTTAANKENVAPRGRFPTPQSLERLHKPFKCPGFATR
                     TVATDRPARKRRKIDYAGADGDADADKPYTNADRLALATREANKFPVFQAKDKDKVFR
                     KAFTVPFLNKDHAAYNPNRPPPTLGLRQGAIFIPKPLHDPCGEFAIVLYDPTIDDKPK
                     EAPKSEEKEAAAAAEPPSKLDAPLMHKSLAEILGIKKKVVGEHPRVPVVIDPKLAKVL
                     RPHQIEGVKFMYRCVTGMIDEKANGCIMADEMGLGKTLQCITLLWTLLKQSPDAGKTT
                     IQKAIVACPSSLVRNWANELTKWLGADAITPFAIDGKASKEELTRQLRQWAIASGRAI
                     TRPVIIVSYETLRLNVEELKNTPIGLMLCDEGHRLKNGDSQTFNALNSLNVSRRVILS
                     GTPIQNDLSEYFSLISFANPDLLGSRLEFRKRFELPILRGRDADASEAERKRGDECLA
                     ELLAIVNKFIIRRTNDILSKYLPVKYEHVVFCNLAPFQQALYNYFITSPDIQALLRGK
                     GSQPLKAIGILKKLCNHPDLLDLAADLPGCEQYWPDDYVPKEARGRDRDIKPWYSGKM
                     QVLDRMLARIRADTNDKIVLISNYTQTLDLFERLCRSRGYGCLRLDGTMNVNKRQKLV
                     DKFNDPDGDEFVFLLSSKAGGCGLNLIGANRLVLFDPDWNPAADQQALARVWRDGQKK
                     DCFVYRFIATGTIEEKIFQRQSHKQSLSSCVVDSAEDVERHFSLDSLRELFQYRPDTR
                     SDTHDTFKCKRCRPDGRQHIKAQAMLYGDTSTWNHFVNDGLKTIQDHLLKQESGEQEV
                     SAVFQYISH"
     gene            1219438..1220981
                     /locus_tag="THITE_2116570"
                     /db_xref="GeneID:11516203"
     mRNA            1219438..1220981
                     /locus_tag="THITE_2116570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653975.1"
                     /db_xref="GeneID:11516203"
     CDS             1219605..1220708
                     /locus_tag="THITE_2116570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654023.1"
                     /db_xref="GeneID:11516203"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2116570"
                     /translation="MSADFWAGYISGAVGIIIGNPLDVLKVRLQAGPAAVPAPTAPVP
                     APPLNSAPSLHTNYIRPFLLGTAAPVLGYGALNALLFVSYNRTEAFLNSLSAVPGAST
                     SIGDSQGRGTNLLTTWLAGAVGGLATWVVSTPTELVKCRAQVQHQAPTTTPNSRPSAG
                     ATSWAITKHILTHQGGIRGLYAGGAVTALRDSIGYGFYFWGYELCSRWMLQLQLQQQQ
                     QQQPPPTQQHNDPGGASLLGTDAARVLLCGGLAGIITWASIFPLDVVKTRVQTQDLAA
                     AAAAPAAGGERTPLVAGAAAAGRRKLGAWEVAKETYREGGIRAFFRGLGVCSARAFIV
                     NAVQWAVYEWIMAELGQGRSRQDVLALEAGRSG"
     gene            complement(1222629..1225184)
                     /locus_tag="THITE_2116571"
                     /db_xref="GeneID:11516204"
     mRNA            complement(1222629..1225184)
                     /locus_tag="THITE_2116571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653976.1"
                     /db_xref="GeneID:11516204"
     CDS             complement(1222835..1225006)
                     /locus_tag="THITE_2116571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654024.1"
                     /db_xref="GeneID:11516204"
                     /db_xref="JGIDB:Thite2_2116571"
                     /translation="MASYFGRLEHDGRRLGADLDLIAKWARAFNLRHPIHSYYLTQLS
                     DDDRAKLFSGPAQEFRLLQGPNDTLKLETVKDEVDRIDPDVQAMMRSNGYLRSEAKRF
                     EILDAIEDAQDEAQAAAALALSKALLSGMDGPPAEKLSKQVADKILDSAAYRVKAQWR
                     AARHERLRNMTSEPANCSGLDGVACQDTPTKETAGSPVGPDFIARWNATLRERFPGLA
                     VNGSLSFEPATDSLEDTRACKSNSDKGTAKIFTSDFTDVVDNQATPHQKPAAEAVSPS
                     GSVPEYGSETSAGSVHWSSPGYSAGDSLSSPDIDSVFGPLDDADGGVALLPSSLADEL
                     GLTDESEVATPTPALHHLGAGLEQAYLTVRSGFNAMSADSVSSTFNSVNAPTTSDPFA
                     TQGARDNNTAAQDSTLEASPGPFSLTSSKPHKYPLAKEQPWMGFTCYEVASNLGNGQL
                     VPKYWTTKRGKERYLRYKIGDLKLDDAKLRSDRVSGAVARNPVHVFVDLSNIIIGFYD
                     SMKESRGIPVNKRIIAPPFSFKNFDTILTRDRNVAKRIVAGSLSNSHTKRWPGYMLQA
                     QELKYEMNILERVPKPASALRNRKSKAGARDRESATSGADTSGDDFVLGPMKHGEQGV
                     DELLHLKILQSAMDTPNPATVVLATGDAASAQYSDGFKKNIERVLSHGWNLELYAWRR
                     NISSAWREPEFAKKWGHQFKIIELDGFCEELFDMTIESLEH"
     gene            complement(1225875..1225945)
                     /locus_tag="THITE_t104"
                     /db_xref="GeneID:11516205"
     tRNA            complement(1225875..1225945)
                     /locus_tag="THITE_t104"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:complement(1225911..1225913),aa:Gly,
                     seq:gcc)
                     /db_xref="GeneID:11516205"
     gene            1227059..1227538
                     /locus_tag="THITE_2116572"
                     /db_xref="GeneID:11519030"
     mRNA            1227059..1227538
                     /locus_tag="THITE_2116572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653977.1"
                     /db_xref="GeneID:11519030"
     gene            complement(1227238..1231189)
                     /locus_tag="THITE_77005"
                     /db_xref="GeneID:11516206"
     mRNA            complement(join(1227238..1228724,1229050..1229609,
                     1229672..1230512,1230576..1230678,1230747..1231189))
                     /locus_tag="THITE_77005"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003653978.1"
                     /db_xref="GeneID:11516206"
     CDS             1227328..1227516
                     /locus_tag="THITE_2116572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654025.1"
                     /db_xref="GeneID:11519030"
                     /db_xref="JGIDB:Thite2_2116572"
                     /translation="MDNTGGLQQIQPSPSPGNAPRRGGIPDPDTLNFPSRVQHQLQSS
                     PSPNPVQSHPEQWDGIQW"
     CDS             complement(join(1227561..1228724,1229050..1229609,
                     1229672..1230512,1230576..1230678,1230747..1231183))
                     /locus_tag="THITE_77005"
                     /note="expressed hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654026.1"
                     /db_xref="GeneID:11516206"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Thite2_77005"
                     /translation="MPTLRERPSRGEISPAKKASQNSPTATRSTPRKRRPSMPGDAIE
                     VRESIEAKGDVDDDVEMEDADSPARKDDGDGDADANGDADADADADGDADADADADAD
                     ADADGEPDDTAEQVRQEEDWRNLLQLIRDTSEYLCRYTVKIDGEDHEIASGFQRLVNK
                     RSLPDYFEVIKEPMAFSTIRAKLGKKVYTKFNEFVWDVTRICHNAQVYNRPSAPIFSD
                     AGRLMDVFKEKLAEMVADGTISAEDAEIPDLGPLPEFEDSPPPEDDEEEADEEDDEED
                     EDEEDEDSDEEGGRRRSGRRRRQSGARKGAEEGDDAHKKRGRPPKVFTPLEARIQAIL
                     KGLRRFKNERGHLRISHFEKLPDKAELPDYYTAIRNPIALETIKRKHKRKKYQTVDQA
                     LQDLELMFDNAKQYNEEGSEVYQDAVELAKQARILAEQEKAKSDDEFRDEDGKLPLAS
                     IEHRGETWRVGDWVHIRNPNDLSKPIVAQIYRTWSDASGQKWVNACWYYRPEQTVHRF
                     DKHFYENEVVKTGQYRDHHIEDVEDRCFVMFITRYPRGRPRGLPPDKSVYVCEARYNE
                     EKFKFNKIKTWTSCLPDEVREKDYEMDLFDVPRTLRKVPSPIKHLLQADAKETDDLPK
                     PTWRSPNAPPLIGAVHRRPREPNESPPPEPNPLPAVVAPVPLAIAPTQVPIKANVGVV
                     GAPAYHHPAAVAPAPAPAPTHFQMQHFQPRPVPPPAPHQAPVHLQPQPQPQPMPMHVP
                     HPVMPQMQPSPHYPPQAYPPQYGVQPQMAPPQPIQYQTAAHIAPVFDQHHRPVHPAPQ
                     AMPPSRPPMAPAPAPSMAALPHGTPQGAHVYNVPRAPEVYTLADNVDATIPPEVREQF
                     QRDEDGRVLFFTAPPLVRPQNRVAEQHAGLGHSVRHLATIKQLREERARKRKERDEAL
                     AREQEDSKRQAAAREEDARRRAEAEAERSRQAELLEKVLLGWAADMDRGTEMLGDQLG
                     GLDSWKEMMRRSREETEGKTDEEVRVANLRWLFDEQLRRGEITLEQKKQYEDCFIHRT
                     HLEK"
     gene            <1232230..>1233378
                     /locus_tag="THITE_125507"
                     /db_xref="GeneID:11516207"
     mRNA            join(<1232230..1232587,1232760..1232983,1233046..>1233378)
                     /locus_tag="THITE_125507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653979.1"
                     /db_xref="GeneID:11516207"
     CDS             join(1232230..1232587,1232760..1232983,1233046..1233378)
                     /locus_tag="THITE_125507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654027.1"
                     /db_xref="GeneID:11516207"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Thite2_125507"
                     /translation="MTVQIGLRTPTGQSRVQVDEHSTLRDLIELIKSKTGLSNFSMKY
                     GFPPKALDISPALLDASVDDLHLRGETILVTPVDSAPPPTSLPPPSTEPKPKPFTPKG
                     IEPDQTSLEWPERGGYLAFGGAIGLENPSAALRNQVADYILSHPNEYNKAILGDEPHV
                     YTTRMRRMDTWGGAIELSILSDIYNLEISSIDVKSLRVDRFGEGKENRVIILYSGIHY
                     DRIAFCMDLSYPVEVDVTQWSTDDDEVLEKARQLAQQLQRLHYYTDTTDFVIKCEICD
                     WIGQGVRQAGQHEKETGHSQFGEMQITD"
     gene            complement(<1233604..>1235726)
                     /locus_tag="THITE_2129545"
                     /db_xref="GeneID:11516208"
     mRNA            complement(join(<1233604..1233971,1234211..1234481,
                     1234556..1234584,1234659..1234762,1234839..1235027,
                     1235103..1235134,1235201..1235399,1235454..1235511,
                     1235570..1235588,1235652..>1235726))
                     /locus_tag="THITE_2129545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653980.1"
                     /db_xref="GeneID:11516208"
     CDS             complement(join(1233604..1233971,1234211..1234481,
                     1234556..1234584,1234659..1234762,1234839..1235027,
                     1235103..1235134,1235201..1235399,1235454..1235511,
                     1235570..1235588,1235652..1235726))
                     /locus_tag="THITE_2129545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654028.1"
                     /db_xref="GeneID:11516208"
                     /db_xref="InterPro:IPR004304"
                     /db_xref="JGIDB:Thite2_2129545"
                     /translation="MGKSTIRTVCKVDFDRPASEQPYLHNRWHPDIPFAGTIKDGETV
                     KIECLDWTGGQIKNDDSADDVKNVDLTKVHYLSGPFEIEGAAPGDLLLVEIMDVQPFE
                     DRPWGFTGVFDRRNGGGFLDEIYPSAAKAIWDFEGIYCTSRHIPHVKFAGLIHPGILG
                     CAPSAELLETWNKREAELIAANKLDRDVALPPQPLSCHAGSADRELAEKIGREGARTI
                     PGRPEHGGNCDIKNLSRGSKVFLPVHVPGAKFSVGDLHFSQGDGEISFCGAIEMAGII
                     TINFQVIKNGMAGLGLRSPVYIPGPVEPQFGPGRYIYFEGFSVDEAGRQHYMDVTVAY
                     RQATLRCIEYLRRFGYSDYQAYLLLSCAPVQGHVAGVVDIPNACTTLGLPMDIFDFDI
                     SPLAALDATAEGETGKGGRDMGRCAFESGRTEGEVRSDAGKKGRVSFGGGLAYRE"
     gene            complement(1236140..1237970)
                     /locus_tag="THITE_2116582"
                     /db_xref="GeneID:11516209"
     mRNA            complement(join(1236140..1236711,1236767..1237492,
                     1237563..1237669,1237747..1237970))
                     /locus_tag="THITE_2116582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653981.1"
                     /db_xref="GeneID:11516209"
     CDS             complement(join(1236514..1236711,1236767..1237492,
                     1237563..1237669,1237747..1237864))
                     /locus_tag="THITE_2116582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654029.1"
                     /db_xref="GeneID:11516209"
                     /db_xref="JGIDB:Thite2_2116582"
                     /translation="MSSVDRSTLLDKDKLRKKFDVSHFDLNAIIRGVQLTLVGAHRAL
                     QNPEIFTSQHYKQAAVAVAAGLAIRLLIAFPILGIKILLWALSLVLPLDRVSWDDALV
                     DGLTFIEEHLLQAPLFLMSLMRYVTPALDDLFMDSLRWVDQTYAAKHRHDPDPSRLRA
                     MYYPQLRLYRPTDGRTHSSGADESATIFLYRFARKGAISIAVFAASYLPLVGRLVLPA
                     ASFWTFKGAVGLGPASVIFGTGLLLPRRYLVIFLQTYFASRSLVRELLEPYFARIKFT
                     KDEKKKWFRSREGLLFGFGIGFYTLLRVPLLGVLIYGIAEASTAYLITKVSDPPPPPS
                     QSQGFAASQTEWRNKQKFLSLSLWNLDALHDKPPPYSEVDPHPVASRQ"
     gene            1238484..1241345
                     /locus_tag="THITE_2116585"
                     /db_xref="GeneID:11516210"
     mRNA            join(1238484..1239114,1239180..1241345)
                     /locus_tag="THITE_2116585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653982.1"
                     /db_xref="GeneID:11516210"
     CDS             join(1238844..1239114,1239180..1241050)
                     /locus_tag="THITE_2116585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654030.1"
                     /db_xref="GeneID:11516210"
                     /db_xref="JGIDB:Thite2_2116585"
                     /translation="MESPRPNSPGFAAPRRVFTAPVPPSAPQSAADSQAAGGLVDTLY
                     HHPNVKIVSFTAAARSLSVGPRSAAAPDIEPGSLPWSTQLERTIAVGPFRIYRAPGSV
                     AFLSCGSALQPIMPKSQAWCVDEESSKFVLQIRRPQYWRIEVPVAEEEDLHRAQQLRN
                     VFDAILLFEKTACPFKRSFTVELPERPQTPVRKRPWTPVRRSSTSLPLTPVTPVEIAR
                     LHEGTPRGSICLGDLRTVGEARRALSEHARRLEPPAEEPTSKGNSQLRTGLHDDETPS
                     ASPVKSPCARGPMAPPHVPVIAAPNPKSREAGVNVPAEAPRFKPPTESAESLQNPETW
                     VSASLPPSPPLSAPGSPRSASPAPRPQAQLTTTASSDKPVTSEVSQTCSAATSGSLRE
                     AEYSVATASSPIHDLELSSPRGPLPTQNQFISASTPAEEEPVTLSKSPSSNPPPSSSS
                     APPASPSPRARRPPIRRATTSSSISPSRRTLSPLPPAADLLTPRRASATAGRASADSG
                     TSTNTTATARTTGTLAAVRRLPMTVIHKTCEILMSPPSHLISLMLNVAARIAAGEWRG
                     LVFGMGEAGERVSVTWDWSDDEFAGQQGRYVGRRGAALGAGRGWATGFDDGDVDWWAR
                     GRGRRRRIKMVGAFPESGDEEEDEQEEIGPLDVPRSARSKSPSSPPPAGEEKQAAVES
                     SAPTPADDDAETHNGQDPTPQRDADTDWGVD"
     gene            complement(1242031..1243969)
                     /locus_tag="THITE_2116588"
                     /db_xref="GeneID:11516211"
     mRNA            complement(join(1242031..1242851,1242925..1243391,
                     1243464..1243969))
                     /locus_tag="THITE_2116588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653983.1"
                     /db_xref="GeneID:11516211"
     CDS             complement(join(1242134..1242851,1242925..1243391,
                     1243464..1243835))
                     /locus_tag="THITE_2116588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654031.1"
                     /db_xref="GeneID:11516211"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="JGIDB:Thite2_2116588"
                     /translation="MDAPDSAAARSAPGNAANTSGAAASSTMERQNSQSSAHKVSHIA
                     AHRQSFAENQRYPPPSPRNQRHPSFTQQALQELMNHPPSNRHPTPRYAGRDWRDIALG
                     ELVVPEDVRWADLDLSVQDATMLLLRHNPTNVVLVRESPSSKTAVSTFDYSDLNAYLL
                     VVVGLAKPEDEDISLYAEIAKKAQSQEDIPLREIQSLARKEELVTLPADATLDKAVEA
                     FGGGIHRVLIANSAGDVVGVLSQLRLVEFFWNEAVNFPVIERLYGCLLRDLQIGTHQI
                     IAINLDRPLTDALLLMHNEGLTSVAVVDQGLNVVGNISTADVKHLTSAASLPLLNNSC
                     MNFISVILSERGVEHGRDSFPVFHVNPYSTLGHTVAKLVATKSHRMWVVESASPSPSA
                     PATPLLQPSHPAAPSPAPAPGGAAVGSPPPSATVIIPPPGNAPPPQSPQPNQTFATTV
                     IPSGLPGARLSGRLTGVVSLTDILNLFAKSSGLRPSDPAEQRARRRRSSSSSVRPSLD
                     SARASIDLRR"
     gene            1245375..1249072
                     /locus_tag="THITE_2116592"
                     /db_xref="GeneID:11516212"
     mRNA            join(1245375..1245697,1245764..1245983,1246053..1246228,
                     1246284..1248787,1248850..1249072)
                     /locus_tag="THITE_2116592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653984.1"
                     /db_xref="GeneID:11516212"
     CDS             join(1245485..1245697,1245764..1245983,1246053..1246228,
                     1246284..1248787,1248850..1249057)
                     /locus_tag="THITE_2116592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654032.1"
                     /db_xref="GeneID:11516212"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Thite2_2116592"
                     /translation="MSAAKSPSGATSLLPAEVNGQLAQLLQQLQSADNNIRSQAEDVL
                     QNQWTSQRPEWLLMGLAEQIANSTDPNMRSFAALIFRRIASKTRKIGNSDNVDMFISL
                     DKEHGTVIRGKLLETLVTESDKTVRNRISDAVAELARQYYDNNDSWPELLQALFSLSQ
                     APDALKRETAFRVFTTTPGIIEKQHEDAVAQAFAQAFKDDSVAVRLAAMEAFAAFFRS
                     LSKKNQTKYHVLLPEVLNILPPIKDSQDSEDLSKALVALIDLAEGAPRMFKQVFNVLV
                     QFCISVIQDKELSDLCRQNALELMATFADYAPSMCKKDPNYTNDMVTQCLSLMTDLGE
                     DDDDAAEWLAADDLDDPESDQNHVAGEHCMDRLANKLGGMVILQPTFNWLPRMLSSPA
                     WRDRHAALMAISAISEGCRDQMIGELKQVLELVVPALKDPHPRVRWAGCNALGQMSTD
                     FAPTMQKEYYDTILSAIVPVLDSPEARVKSHAAAALVNFCEEADKSVLEPYLDGLLSA
                     LYQLLQSDKRYVQEQALSTIATIADAAEQAFARYYDTLMPLLVSVLGRENDKEYRLLR
                     AKAMECATLIALAVGAPRLGGDATMLVQLLANIQDNVQDPDDPQAQYLMHCWGRMCRV
                     MGKAFLPYLPKVMPPLLELASAKADIQLLDDDEQIEKFQQEDGWELVPLRGKTIGIKT
                     SSMDDKHMAIELLVVYAQVLEEDFAPHADEIMEKIALPGLAFFFHDPVRFVSAKLVPQ
                     LLSCVKKAYGPQSEQLASLWNKTVDKLLEVLTAEPAVDTLAEMYQCFYESVEVIARPC
                     LTDAHLGRFIEAVNSTLEDYKDRVAQREEERRGVAAEDAEDEQEEILMAIEDDQTLLS
                     DMNKAFHCVFKYHGANFLRHWEHLLPTYQGFLKSEDPTQRQWGLCIMDDVLEYCGPQS
                     SQYANYITQPLIQGCQDPSPAIRQAAAYGIGVAARHGGDAWSAFLWGAVPFLFEVMRV
                     PDARNEDNVYATENACAAIAKILHFNSSAVAQPDQVIAEWINTLPVTNDEEAAPYAYL
                     YLAELISKQHPAVMSRAPQIFVYVAQALEAEALSGQNAARVVAATKLLVEGTGTDVSP
                     LLQQFSPESQNVIRSHFL"
     gene            <1251139..>1254336
                     /locus_tag="THITE_2049533"
                     /db_xref="GeneID:11516213"
     mRNA            join(<1251139..1253898,1253995..>1254336)
                     /locus_tag="THITE_2049533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653985.1"
                     /db_xref="GeneID:11516213"
     CDS             join(1251139..1253898,1253995..1254336)
                     /locus_tag="THITE_2049533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654033.1"
                     /db_xref="GeneID:11516213"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Thite2_2049533"
                     /translation="MQQNGQQGQGQAIGVANAAELGGLGHASSLTAMEGVSLGGVEPR
                     NTPDFQRRRSVPHLFPGALAPQGGDRRMSLVDFGNPSNAVPDYQLGNMPGLGGLEGTA
                     SPYAQQGLITMPDPQVYGTLAPESTGIAAFPNLDMASMSANTGHPNLYNSPDLRSQYP
                     PPTLNPAGPDLVMDMGLGNVVMNVPNDTRMADFGFGGSGDMMGVGHVFDGLPVPQEPP
                     NLIPNPDLSQFQTDMPPPELRETSVPASFHSPAASTTGSQAMSHSSGGRSSIPAGTPS
                     STAATTGGLTARQESQKDVYSKSGFDMLRALYYVATRKNPTVEIGAVDMSCSFIVCDL
                     TLNDCPIIYASDNFQNLTGYNRHEIVGKNCRFLQSPDGVVEAGSRREFVANDAVFKLK
                     NALAEGREIQQSLINYRKGGKPFLNLLTLIPIPWDNDKMKYCIGFQIDLVECPDAISG
                     QESGAMQVDYRHDDIGQYFFSPPSSTHWEPKSGQSLSVDEVSTLLEQLNPRAPASEWH
                     KQSWDKMLLENADDVVHVLSLKGLFIYLSPACKKILEYDTTDLVGASLASVCHPSDIV
                     PVTRELKDAQPGATVDFAFRIRRKHSGYTWFESRGTLFSEPAKARKYMILVGRKRPVF
                     SLRRRCLDAFGGGVGVGDGEFWSKMSTSGMFLCVSSAVLPLLGLQPADLEGTSMQELL
                     RRESRAEFGRTVEKARKGAVVGFRHELTHRRGQLVPAYTVFYPGDAPTPGQKPSFLIA
                     QTKVAKGAARVIAGGSKLAGGTAPAAAAAAVAPAPAPSPFEDLPSGVVLGHQKQLVSP
                     AVAAAGREEEDDDDIFVELKTTRCTSWQFELRQMEKVNRLLAEEVTQLMAGKKKRKRR
                     RGPGLAGGGGGGGAGSGSTSNGVSPSTLLHGCAMCHTKDTPEWRRGPSGNRDLCNSCG
                     LRFAKQQAGKVSPRTGASRASSGDDPGHPSPYHHHPASSLRAGTSSAGSNSPVEVSPL
                     RREVSADELSAGSAGAGTGSVERASLGELSSAGGSVSGSAGGLEMGSIPEEQPPRAGG
                     MSE"
     gene            complement(1259975..1261387)
                     /locus_tag="THITE_2116595"
                     /db_xref="GeneID:11516214"
     mRNA            complement(1259975..1261387)
                     /locus_tag="THITE_2116595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653986.1"
                     /db_xref="GeneID:11516214"
     CDS             complement(1259997..1261151)
                     /locus_tag="THITE_2116595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654034.1"
                     /db_xref="GeneID:11516214"
                     /db_xref="JGIDB:Thite2_2116595"
                     /translation="MNQAQSQTPPRKNERWGPEIYLHFEFRFSWGKKDQPPKNHQITY
                     RSRGPRERAPAFPRQVPAPNTNYLAAVRAFDYRQSRMRELRQHYANNDPNRHHQMQEY
                     YQVDQPRTYLPVPVIREPERPTRADAQPSHERGRSAPPPIGENPWDVSVPPLPRPSAG
                     EIRRKPLPAPPSQFRLGEGGQPWSTWSMPVGYDPDTHPKDDEEGEEGARARSVSGPTA
                     DRNSTTYATNPTMVSTFSPEPVARARDVETGRARELGALSAAMMTVDNGFENQWWYQG
                     RRETVASASADDRPRTPGNNNDNKNDNNNNDGADDESPLEHQPRWSTGPMTPVTLSPE
                     DPSATPMRPTAGVVSPLTEAALTPAQVPASLLQRTMSTRSEELWFHEKGQ"
     gene            complement(1264431..>1265985)
                     /locus_tag="THITE_165509"
                     /db_xref="GeneID:11516215"
     mRNA            complement(join(1264431..1265458,1265607..1265753,
                     1265808..1265907,1265967..>1265985))
                     /locus_tag="THITE_165509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653987.1"
                     /db_xref="GeneID:11516215"
     CDS             complement(join(1264663..1265458,1265607..1265753,
                     1265808..1265907,1265967..1265985))
                     /locus_tag="THITE_165509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654035.1"
                     /db_xref="GeneID:11516215"
                     /db_xref="JGIDB:Thite2_165509"
                     /translation="MESGEYVPGSVYFYAPNKGAPVFFAVAFAVSGLFHVYQCIHYKS
                     WQLTGLYVFCSVLFTAGFIVREMGAFDYENLIKYIISTCLIYAAPPLLELANYHILGR
                     ILYYAPYHSPIHPGRVLITFGFISFVVEALNGNGVAYSVNQSLPADKQAMGRALLKAA
                     LLIQLAVLALFVLLAVTFHRRCARAQAKNAGAGAGKPRAGYARLTAALRTLYASSALI
                     GVRTVYRVAEYWSIVQGDGYWRAGADPASLSVVIRYEWFFWVWEASLMLVNHVLVNAR
                     HPRRYLPQSSKTYLALDGVTEVQGPGYKDGRPFWLTLVDPFDLWGLVNGRDKAARFWE
                     QAGEATAAKEASRGVEAQV"
     gene            1266915..1267743
                     /locus_tag="THITE_2170572"
                     /db_xref="GeneID:11516216"
     mRNA            1266915..1267743
                     /locus_tag="THITE_2170572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653988.1"
                     /db_xref="GeneID:11516216"
     CDS             1266980..1267219
                     /locus_tag="THITE_2170572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654036.1"
                     /db_xref="GeneID:11516216"
                     /db_xref="JGIDB:Thite2_2170572"
                     /translation="MAPPPTKSDQQVASEFTAYYLQRATKEFAEDLDKVRAADDFKND
                     ALQTLISALQQGTAMFSAEEKRMIVTAAAQPARKS"
     gene            1267669..1267766
                     /locus_tag="THITE_t85"
                     /db_xref="GeneID:11516217"
     tRNA            1267669..1267766
                     /locus_tag="THITE_t85"
                     /product="tRNA-Ser"
                     /note="Anticodon: TGA"
                     /anticodon=(pos:1267702..1267704,aa:Ser,seq:tga)
                     /db_xref="GeneID:11516217"
     gene            complement(1269197..1270043)
                     /locus_tag="THITE_2170573"
                     /db_xref="GeneID:11519011"
     mRNA            complement(1269197..1270043)
                     /locus_tag="THITE_2170573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653989.1"
                     /db_xref="GeneID:11519011"
     CDS             complement(1269812..1269970)
                     /locus_tag="THITE_2170573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654037.1"
                     /db_xref="GeneID:11519011"
                     /db_xref="JGIDB:Thite2_2170573"
                     /translation="MYEDEPQPQQPQQSQQSQSQQSQSQLGGFQGRSIPTGPSNPANP
                     GYYGYQHQ"
     gene            complement(<1270202..1271788)
                     /locus_tag="THITE_128245"
                     /db_xref="GeneID:11516218"
     mRNA            complement(join(<1270202..1271487,1271562..1271788))
                     /locus_tag="THITE_128245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653990.1"
                     /db_xref="GeneID:11516218"
     CDS             complement(join(<1270202..1271487,1271562..1271769))
                     /locus_tag="THITE_128245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654038.1"
                     /db_xref="GeneID:11516218"
                     /db_xref="JGIDB:Thite2_128245"
                     /translation="MVLGAWFARTSSLVRRVMGSTAYAAYNNGSAGAGNAHTVTAMGR
                     WSVLDKQLPAVDKIKAIHVYDFDNTLFKTPLPNPKLWNGPTIGMLANPDAFVNGGWWH
                     DSRILAATGEGIAKEEPRGWNGWWNEQIVELIHLSNKQKDALCVLLTGRSESGFGELI
                     KRMVASKGLEFDLISLKPAVGPNNERFANTMMFKQTFLEALMETYRHAEEIRIYEDRV
                     AHVKGFRHFLDEYNAKKINGVETPMTRGPINGEVIQVVDMVTYLDPIVEVAEVQQIIH
                     DHNTALSKGQRGTRGERLAIKKTVFYTGYMINNADTQRLLTLVQLPQNLPEGDLKRHA
                     NNIMICPRPCPPAILEKIGGLGSKMTWEVTGSACFENTIWAACVKPVPATAKFHTGDP
                     VPLVVLALRKGARHVDAGKIQHWQPVPPDRAFRFETTVGEKILLRIEPEDHHPHREPA
                     SHARAFNKRKHTAAADDFRARSSVGPQPPQQPQQQQQQQQQQHRQFHQ"
     gene            complement(1272033..1272773)
                     /locus_tag="THITE_109806"
                     /db_xref="GeneID:11516219"
     mRNA            complement(join(1272033..1272386,1272440..1272619,
                     1272676..1272773))
                     /locus_tag="THITE_109806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653991.1"
                     /db_xref="GeneID:11516219"
     CDS             complement(join(1272272..1272386,1272440..1272619,
                     1272676..1272725))
                     /locus_tag="THITE_109806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654039.1"
                     /db_xref="GeneID:11516219"
                     /db_xref="JGIDB:Thite2_109806"
                     /translation="MGIFAKRTKTKTRRRTRDLDQIQADLLSPRHLEQYKETKAAEDL
                     PGLGRHYCIECAKWFDTETTLVLHRKGKPHKRRLKQLREGPYTHEEAAAAVGFRIDNG
                     PEKSKSQDIEMS"
     gene            1274310..1277997
                     /locus_tag="THITE_2155001"
                     /db_xref="GeneID:11516220"
     mRNA            join(1274310..1274597,1274669..1274858,1274983..1275082,
                     1275207..1275376,1275434..1275509,1275566..1275777,
                     1275846..1275861,1275930..1276327,1276388..1276912,
                     1276969..1277031,1277098..1277997)
                     /locus_tag="THITE_2155001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653992.1"
                     /db_xref="GeneID:11516220"
     CDS             join(1274487..1274597,1274669..1274858,1274983..1275082,
                     1275207..1275376,1275434..1275509,1275566..1275777,
                     1275846..1275861,1275930..1276327,1276388..1276912,
                     1276969..1277031,1277098..1277597)
                     /locus_tag="THITE_2155001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654040.1"
                     /db_xref="GeneID:11516220"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="JGIDB:Thite2_2155001"
                     /translation="MLASRQLLGVARSRALGCASLGLRRMATLTDSPLDKKVRQNNLE
                     ENSFINYKKMSENLAIVRSRLNRPLTFAEKILYSHLDDPHGQDIERGVSYLKLRPDRV
                     AMQDATAQMAILQFISSGIPSVRAPSSVHCDHLIEAQVGGAQDLDRAVSVNKEVYDFL
                     SSACAKYNIGFWKPGSGIIHQTVLEWLAFPGGLLIGTDSHTPNAGGLSMAAIGVGGAD
                     AVDVMAGLPWELKAPKVIGVNLTGKLNGWTAPKDIILKVAGILTVKGGTGSIVEYFGS
                     GLDSISCTGMATVCNMGAEIGATTSLFPFGDRQYDFLAATNRKHVGDFAREYAKELRA
                     DEGAEYDQLIEINLSELEPHINGPFTPDLATPISKFSEAVKANGWPEELKVALIGSCT
                     NSSYEDMSRGASIARDALAHGLKAKSTFLVTPGSEQIRATIARDGQLQTFEEFGGVVL
                     ANACGPCIGQWDRRDVKKGEKNSIVSSYNRNFTGRNDANPATHAFVASPDLVVAMSIA
                     GTLHFNPLTDKLKDKDGNEFLLAPPSGDSLPAKGYDPGQNTYQAPPPNRDAVSVQVSP
                     SSDRLQLLSPFNAWDGKDALDCPILIKAQGKTTTDHISAAGAWLKYRGHLDNISNNCL
                     IGAINSANGEANKVKNQTTGQWDAVPAVARDYKAKGIKWVVIGDWNYGEGSSREHAAL
                     EPRHLGGLAIITRSFARIHETNLKKQGMLPLTFSDPADYDRIQPDDRVDILCTELAPG
                     KPVTMRVHPKDGSPYEVKLSHTFNEGQIEWFKNGSALNTMAKMAQN"
     gene            1278235..1282454
                     /locus_tag="THITE_2155002"
                     /db_xref="GeneID:11516221"
     mRNA            join(1278235..1278785,1278917..1279054,1279122..1279203,
                     1279287..1279474,1279568..1279734,1280283..1280551,
                     1280614..1281673,1281753..1282454)
                     /locus_tag="THITE_2155002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653993.1"
                     /db_xref="GeneID:11516221"
     CDS             join(1278596..1278785,1278917..1279054,1279122..1279203,
                     1279287..1279474,1279568..1279734,1280283..1280551,
                     1280614..1281673,1281753..1282307)
                     /locus_tag="THITE_2155002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654041.1"
                     /db_xref="GeneID:11516221"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR007246"
                     /db_xref="JGIDB:Thite2_2155002"
                     /translation="MPTVNTPGLSLQRIYSYVNRLPLFTRLVVAAIVLFEAAAILLGN
                     WWDVRAWGALAPDELGFGSLYRTNTYPLIHTDMFHLIVNLVSVTPMLDMFEREHGTLT
                     TLALFIGPLSTLPALLYVGAEKYVLGLHSPVMGASIWAFLLAAIEAVRMHRVHPYFVI
                     AGQSFPVWATPLAALVVTMVLWPKTSALGHLCGLAVGYICGLGLLKYLAPPEKVLRWI
                     EGRLNLLGRLPHYVSVDQKTHGRFGVLPMSNLGATPVLINAATASALQLRRDPRILKL
                     PPYLSLLCIVVGVAWLLLLPLDQYSRRTYISENALLPGQVHTYFSGSDQNVFRAYKHE
                     VNALVGKSNAEINDKLEPIVKGLGLKTARQNFTYHAAGHTYAGENLYAILQAPRGDAT
                     EAIVLVAAWENVKHEINRNGVPLALTLLRYFKRWSLWSKDIILVLTPDSIAGPQAWVD
                     AYHDAHDPSRVASLPLKAGLLQGAIAIDYAQESRFDSVHIVYDGVNGQLPNLDLINSV
                     VHIAGGQMGIGVALQEMWRHDNGYSDRLRTMLRGMLKQGLGLPSGPHSSFIPYHVDAV
                     TLQPFGEGWQDEMAMGRVIEGTFRSLNNLLEHLHQSFFFYLIMHRERFVSIGTYLPSA
                     MLVAANFTIMAIALWVKSGQAPEAAASKSKADTTTTPPPTPTVERDLFLPLGVVALIQ
                     SLSIVPLYLFNHAPESILTPLFIAFTLINTALPSVLSHLLTQTYAPTAQQYQLVKSFS
                     LLLLGMFLSSLATLNFSLALLTGLLAAPLSFAGPCRSRRTTTCRAAAAVLLHALGPPA
                     VLLAAAAYSRAGVAAVLREAAVGWHVCGTYSPLVVWCVWWPAWLATSVVVLGKGEDGD
                     GDGEGKGNGKGNGKGNGKGNGKVKTT"
     gene            complement(1282481..1284126)
                     /locus_tag="THITE_2116616"
                     /db_xref="GeneID:11516222"
     mRNA            complement(1282481..1284126)
                     /locus_tag="THITE_2116616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653994.1"
                     /db_xref="GeneID:11516222"
     CDS             complement(1282654..1283883)
                     /locus_tag="THITE_2116616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654042.1"
                     /db_xref="GeneID:11516222"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Thite2_2116616"
                     /translation="MNVDTIPDFLAEQRDSAPEELQPLVLEFETLWERKLWHQLTNQL
                     IEFFNHPGSAPQRLQFYKVFVLKFADKINQLKLVDLALKAATQCRGTRGRHPTLPVLC
                     CVVLCCAVLTVGWADNQERLSFMEAVAKKVDNEDSQDALVFATIAVARVKLDLNDLDG
                     ARKDLDRAEQILDSFDSVETIVHAAFYGANADYYQAKADFGSYYRNALLYLACIDIKS
                     LSPAERRNRAYDLAIAALVSSSIYNFGELLLHPILDALSERDDDKWLRELLFAFNRGD
                     LAAYEVLADKIQSNALLLRHGRQLHEKIYLAALTEAVFRRPPHDRAMSFATIAAETKV
                     RMDEIEHLIMKALSLGLLRGTIDQVDQVAHIDWVQPKVLDMKQIDNMRQRLKEWDSSV
                     DQLGNWIERVGQDVWAA"
     gene            1284257..1286263
                     /locus_tag="THITE_2116621"
                     /db_xref="GeneID:11516223"
     mRNA            join(1284257..1284512,1284572..1284648,1284705..1284799,
                     1284856..1284947,1285002..1285143,1285198..1285356,
                     1285414..1285749,1285803..1285977,1286172..1286263)
                     /locus_tag="THITE_2116621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653995.1"
                     /db_xref="GeneID:11516223"
     CDS             join(1284382..1284512,1284572..1284648,1284705..1284799,
                     1284856..1284947,1285002..1285143,1285198..1285356,
                     1285414..1285749,1285803..1285901)
                     /locus_tag="THITE_2116621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654043.1"
                     /db_xref="GeneID:11516223"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Thite2_2116621"
                     /translation="MASLPTAVRSTAPKIARSALQRRAISDVHITRTGKPLVRTQGGR
                     SSLGEHTATVFGATGQLGRYIVNRLARQGCTVIVPYREEMAKRHLKLTGDLGRVVFTE
                     FDLRNTQSIEESVRHSDVVYNLIGRNYPTKNFSLEDVHIEGAERIAEAVAKYDVDRFI
                     HVSSYNANPDSTSEFFATKGYAERVVREIFPETTIVRPAPMFGFEDKLLLKLASVTNL
                     FTANNMQERYWPVHVIDVGEALEKMLFDDNTASQTFELYGPRNYSTAEIAELVDREIY
                     KKRRHINVPKAILKPTAGLLNRVLWWDIMSADEVEREFIDQVIDPSAKTFKDLGMEPS
                     DISKWTYHYLKGFRSSTFYDLPPATEKEMREEKKYIHVLDDQ"
     gene            <1286235..>1287568
                     /locus_tag="THITE_2052159"
                     /db_xref="GeneID:11516224"
     mRNA            join(<1286235..1286266,1286341..1286515,1286629..1286745,
                     1286851..1286968,1287050..1287109,1287207..1287237,
                     1287331..>1287568)
                     /locus_tag="THITE_2052159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653996.1"
                     /db_xref="GeneID:11516224"
     CDS             join(1286235..1286266,1286341..1286515,1286629..1286745,
                     1286851..1286968,1287050..1287109,1287207..1287237,
                     1287331..1287568)
                     /locus_tag="THITE_2052159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654044.1"
                     /db_xref="GeneID:11516224"
                     /db_xref="JGIDB:Thite2_2052159"
                     /translation="MTNHESDDEELTLSASTLDALKAFYAERDARAEQFAKLQAEAEE
                     RHAAGQTKPLSMDVFTEDWNKSQFWYAEETASLLARQLLDGATAETTIAAVSAPSVFV
                     AMKNILNAAPSDEPKPKLVLLEHDNRFAIFSEFVFYDYAQPLKLPSTCDRIICDPPFL
                     NEDCQTKAALTVRWLAKPDDAAPHQQQHQQQQQPQPTTKLIVCTGERMEPLVTRLYRA
                     LGLRTTDYEPRHAGGLSNEFYCYANFAAADGCWGWRVR"
     gene            complement(1287630..1290110)
                     /locus_tag="THITE_2116631"
                     /db_xref="GeneID:11516225"
     mRNA            complement(join(1287630..1287662,1288021..1288145,
                     1288238..1288471,1288539..1289329,1289401..1289514,
                     1289591..1289827,1289887..1290110))
                     /locus_tag="THITE_2116631"
                     /product="ubiquitin carboxyl-terminal hydrolase-like
                     protein"
                     /note="Has EST support"
                     /transcript_id="XM_003653997.1"
                     /db_xref="GeneID:11516225"
     CDS             complement(join(1288044..1288145,1288238..1288471,
                     1288539..1289329,1289401..1289514,1289591..1289827,
                     1289887..1289971))
                     /locus_tag="THITE_2116631"
                     /note="102] Contains conserved domain COG5077[COG5077],
                     Ubiquitin carboxyl-terminal hydrolase"
                     /codon_start=1
                     /product="ubiquitin carboxyl-terminal hydrolase-like
                     protein"
                     /protein_id="XP_003654045.1"
                     /db_xref="GeneID:11516225"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Thite2_2116631"
                     /translation="MSARPATPASPKNYKVKSPQPGQPMYGCEHLQRLFNQDQATTNT
                     SIQHYKTILRTIFDTTPLISQTAKATDGQIVTSLTPTYLCLQCPSTLTEDDRIKHGNK
                     KSHRFYVESRSGALYCQMCDDIVWDPTFEDLRIRKMGTGTFSTTRKRKHEELFEAADP
                     VRDNPTYISANTTAASCKANGLRGIYNAGATCYQNVVLQSFIHNPILRNFYLSDGHQS
                     SNCDTPHCLSCAMDDMFQDFYALENTNGYTAANILSGFWISEKKAFENLVTTKEQDAH
                     EFFQFLAEELHERNGDGKKPETGSEHSCNCIIHQTYYGKLQSTTTCQNCGGVTNQVQS
                     FLDLSLPLENLSQKKSKKAPSRPNGGVLTLQECLDEEYVKSDKCEYRCNNCNSMQQAR
                     RQTSIKRLPNVLAIQLKRFEFKQGRNERAAKIDTPVQFPLQLNMLPYTNRARSAPESK
                     ENYELARSCTYDLLSVVVHVGEIDTGHYLSYCRVGDQWFAFNDHKVELAQKSDVLNSQ
                     AYLLFYIVRSLS"
     gene            1290991..1292425
                     /locus_tag="THITE_2116634"
                     /db_xref="GeneID:11516442"
     mRNA            1290991..1292425
                     /locus_tag="THITE_2116634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653998.1"
                     /db_xref="GeneID:11516442"
     CDS             1291144..1292184
                     /locus_tag="THITE_2116634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654046.1"
                     /db_xref="GeneID:11516442"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="JGIDB:Thite2_2116634"
                     /translation="MRLAAGLLPQPLLRPTTSGLNMATQLPPLPEVERLAVGCIRILG
                     GNPGKFTLQGTNTYLLGTGPRRLLIDTGEGKPSWIAALKRVLAEERASIDSAILTHWH
                     RDHTGGVPDLLQAWPGVPVFKRHPEPGQRDIADGQTFAVEGACVRAVHTPGHTADHVV
                     LLWERQADDGDDGPDGAESDVLFTGDSVLGHGTAVFEDLAEYLASLERMRRLFRRGGG
                     RAFPGHGAVVADGPGKIAEYIQHRAQREEQVLQTLRGARPGESEAENGGPGGAVKDGS
                     GNANGAWTVMELVRSIYRDVPESLHPAAAGGVVQILQKLRKEGKVLAVADGDGERWRL
                     AGSGSGLGRPAL"
     gene            1294987..1297546
                     /locus_tag="THITE_2116636"
                     /db_xref="GeneID:11516443"
     mRNA            join(1294987..1295411,1295485..1296167,1296235..1296348,
                     1296401..1296592,1296652..1297047,1297153..1297546)
                     /locus_tag="THITE_2116636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003653999.1"
                     /db_xref="GeneID:11516443"
     CDS             join(1295144..1295411,1295485..1296167,1296235..1296348,
                     1296401..1296592,1296652..1297047,1297153..1297308)
                     /locus_tag="THITE_2116636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654047.1"
                     /db_xref="GeneID:11516443"
                     /db_xref="JGIDB:Thite2_2116636"
                     /translation="MKALAGSVLPVIAGVAVLGLVPAALAHGEDEHGHGHEDGGMGGM
                     QMTDADKPLPEDQYPPTYFAHPEHRVAIYGHIALMVLAWVFALPAAVMLSLARSRYTL
                     LVQFGFLAINAGGVLLGVIYNTSTPDLYPNNAHYKLGWIVTFVVSAQVVVGLLARVAG
                     VFKREKLAAGSHAAERQGFIPVSTEAMAEHESRFPGAPYRRYSHDSGQGTEPRTESLR
                     SHSLSGPDCPASPTSPVHDAHKEYHHSDDDADPDEDLEAHLPLFSKSTKAHSVVAKVA
                     GRISDRFWKVLIFAYNFVDRTILILGFIALCTGIITFGRFFEGAGIFSGLAHWIKGGV
                     FFWLGIFTLGRWAGCFGELGWAWNVRPRRAGQKWRPSAEFVESFAIFFYGATNIFLEH
                     LGNWGGEWSSQDLEHISITVLFLGGGLCGMLIESTRIRNLLNYTVTDAAQQHILDRDA
                     ERDLHDALREPESYRFSMNPIPALVILLTGIMMSSHTQESMISSMVHKQWGDLLAGAS
                     FARGLTYLLAWLRPPRSVYPSRPPTELLTAFGLIAGGIIFMASASDTVSGMIHYQLDA
                     MFMYTVTMGLVGLLMAWVILMIALKGWAARREAGRA"
     gene            complement(1298185..1300479)
                     /locus_tag="THITE_2116640"
                     /db_xref="GeneID:11516444"
     mRNA            complement(join(1298185..1299340,1299392..1299551,
                     1299699..1300479))
                     /locus_tag="THITE_2116640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654000.1"
                     /db_xref="GeneID:11516444"
     CDS             complement(join(1298213..1299340,1299392..1299551,
                     1299699..1300114))
                     /locus_tag="THITE_2116640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654048.1"
                     /db_xref="GeneID:11516444"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011722"
                     /db_xref="JGIDB:Thite2_2116640"
                     /translation="MPSSLEDVPDEIIRHILLYLSPEDTLLSFQRLSRRFHHLANEPL
                     LWKQHCQLSFSHWGPEHNLQEKLKARASSVDWRNLWATRKKKNKRIAQLLDGVISTKV
                     GQLKRLQEICTLGIDAKDYLLEQCHVDDSAEDFLARRYYASALLDSIHKGLAVDMWCR
                     YQGQALSSQHLDMALAGFDMFVLHDREQDIDYVVRTLDSLAEEFRAEHPAFEDLSTRA
                     KALTLLRWLRAKNLTGMDRPEINYRNLRNCFLGHALSEEDHPSLPLISSAIFTCIAER
                     LGMTAFCLAFPSHVHAAVYAPPGKDLDGNDTEDEDGERKRMCLDPYGSDHEVTLSDLR
                     LKLVDFGWTQGIEDFLRPTPVPIIIQRMAQNIKATHDTILNLADNPIRAAEMKRLRSG
                     YPGLNLDAAVYASMWAELVMKQTSSRHWDSNLVPFLQKFALSWSEDVWIVKKYLAPLY
                     NKFVASQNLPRQRTGWHNVNDIIRMLENIDNRLPEVNRRYTEEITARVHYKIGQVFRH
                     RRYGYIGIINGWAAMGCTTLPMPHYLDAAEAEEEGDVIDPTLSVRETNMGPLRTYYTG
                     L"
     gene            1300563..1304269
                     /locus_tag="THITE_2116645"
                     /db_xref="GeneID:11516445"
     mRNA            join(1300563..1301176,1301244..1301315,1301378..1301505,
                     1301582..1301700,1301763..1301782,1301874..1301931,
                     1302015..1302406,1302458..1302483,1302544..1302670,
                     1302728..1302993,1303054..1303065,1303120..1303540,
                     1303608..1303667,1303734..1304269)
                     /locus_tag="THITE_2116645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654001.1"
                     /db_xref="GeneID:11516445"
     CDS             join(1300747..1301176,1301244..1301315,1301378..1301505,
                     1301582..1301700,1301763..1301782,1301874..1301931,
                     1302015..1302406,1302458..1302483,1302544..1302670,
                     1302728..1302993,1303054..1303065,1303120..1303540,
                     1303608..1303667,1303734..1303936)
                     /locus_tag="THITE_2116645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654049.1"
                     /db_xref="GeneID:11516445"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="JGIDB:Thite2_2116645"
                     /translation="MEKVTEALQKTAIGGGDKKPKKEKKAPAEADASAGPLELQPPPA
                     FIQERIDLFDRLYKEQQEELARKPHDDILITMPDGTVKPGKAYETTPAEIAKGISNSL
                     YKRTVVARIDGEHLWDLERPLEKSCKLELLDFNDEQGKFVFWHSSAHILGEACERRFG
                     CSLCIGPPVDNGFYYEMALPGGAAVQSTDWAPLENIVSKIVKEKQPFQRLEMTKEDLL
                     KMFAYNPYKVHIIKDKIPDGTKTTVYRNGPLIDLCRGPHVPDTGRVEAFAIMKNSSSY
                     FLGDPNNDSLQRIYGVSFPDKKQMAAHKKFLEEAAKRDHRVIGRQQELFYFEECSPGS
                     AMWLPHGMRINNAIMEYIREEYWKRGYDEVMTPNMFNVSLWEQSGHLAHYKEDMFILN
                     VDKEEFGLKPMNCPAHAMMFRHRERSHKELPLRLADFGVLHRNEASGALSGLTRVRRF
                     QQDDAHIFCREDQIKEEVADLFDFMKSFYGMLGLSFKLKLSTRPDKFMGEIETWDRAE
                     ARLKEALDDFAASNDGVSWELNPGDGAFYGPKVDIAVLDCLNRHWQCATIQLDFQQPI
                     NFSLEYQTAEGVQKDKADGPAHAAAPEPAPEPEPAAADKKDGKEKKKPLVIKKPLSPG
                     CARPVMIHRAMAGSIERFTAILTEHFAGKWPFWLSPRQVIVIPVGMGFLGYAKEVAAI
                     LKKERIYVDVDSSGNTLQKKIRNGQMAQYNFCFVVGDEEMRSRKVNIRYRDDTSTQAR
                     DVPVDLDEAVEKLRKLKADRGMYNPFPHKKEDGADKA"
     gene            complement(1304455..1305897)
                     /locus_tag="THITE_2116651"
                     /db_xref="GeneID:11516446"
     mRNA            complement(join(1304455..1304936,1304999..1305192,
                     1305298..1305393,1305495..1305728,1305779..1305897))
                     /locus_tag="THITE_2116651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654002.1"
                     /db_xref="GeneID:11516446"
     CDS             complement(join(1304568..1304936,1304999..1305192,
                     1305298..1305393,1305495..1305573))
                     /locus_tag="THITE_2116651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654050.1"
                     /db_xref="GeneID:11516446"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Thite2_2116651"
                     /translation="MSKRSSVAGAAANGAASKEGSPVNPPSIDKQKLLLSADSGHFSL
                     IRALHLADFITELNGLCGILSLFSSMRYCLGDPTHHGNLWAALAFLPFGLFFDFLDGK
                     VARWRKKSSLMGQELDSLADLISFGVSPAAVAFAIGIRTPVDHLCLAFFVLCGLTRLA
                     RFNVTATSIPKDASGKARYFEGTPIPTTLALDALMGWWVARGWIHAALPGGLWFAGSP
                     LEVHPVVALFLLHGCLMTSRTIHIPKL"
     gene            complement(1306324..1308350)
                     /locus_tag="THITE_2116654"
                     /db_xref="GeneID:11516447"
     mRNA            complement(join(1306324..1307034,1307094..1307290,
                     1307343..1307524,1307578..1307680,1307751..1307845,
                     1307900..1308350))
                     /locus_tag="THITE_2116654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654003.1"
                     /db_xref="GeneID:11516447"
     CDS             complement(join(1306454..1307034,1307094..1307290,
                     1307343..1307524,1307578..1307680,1307751..1307845,
                     1307900..1308208))
                     /locus_tag="THITE_2116654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654051.1"
                     /db_xref="GeneID:11516447"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="JGIDB:Thite2_2116654"
                     /translation="MTQEAIPPAGESYLEGGDGGSSLPVRRSGRVRKRMLPFNDDADH
                     PKERPAASSNSTSARRNSQRKAAPEVFDIPDNLLEASLAPWKENEKAEWASWVELESD
                     PAFFTAILGLLGVKGARIVELLSADEDSLAALPAPVYGMIFLFEYVGESMDEGKNNEP
                     SEDVWFANQTTNNACATIALLNILMNTEGLQLGEKLLRFKQESKGLSAPLRGHMITNS
                     TWIRTAHNAFSRRLDLLNAVLAVQNDVDQKKIRTKAKRKKAKAKVSDNDTAYHFIAFV
                     PIGQKVWQLDGLSNKPVFLGEYAPGQHWTSAVSPVIQQKMAHHEMELSFSLLALCADN
                     ASQLRQKLAANVRRLESLETRFKSNSEWKPKANSSIIHSSSDDRLPLYQLDAEDIRTS
                     VSDEKTPEPTSGTVEAGLQAWEQLCDEQQRLRSQYEDELGGLETTGVLGRTKDHTPAI
                     HEWVKLLAGHGVLMQLHEEASRHNAPWPGVVGQRPSGM"
     gene            1309208..1313932
                     /locus_tag="THITE_2116658"
                     /db_xref="GeneID:11516448"
     mRNA            join(1309208..1310009,1310068..1310216,1310270..1312362,
                     1312419..1313932)
                     /locus_tag="THITE_2116658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654004.1"
                     /db_xref="GeneID:11516448"
     CDS             join(1309515..1310009,1310068..1310216,1310270..1312362,
                     1312419..1313545)
                     /locus_tag="THITE_2116658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654052.1"
                     /db_xref="GeneID:11516448"
                     /db_xref="JGIDB:Thite2_2116658"
                     /translation="MSGAPPIGAFPQTPVAASKRGPVKAPAAASPSAPSPSYPAAAAN
                     ARSTTTTRSSPLPVAPQAGASTTAGSAPLIPLHILDAPTQRLYALGFYVALLAWKFYN
                     WAQLVEEDTESFWLFLKWIAIDCAFLFGLPELRIPWLELSQPFVVAAFFVHAVFDWLL
                     MFNIGFPWQAWILGLVKIFYDRELAISEHNVKLSSIIHNSSLIMGRQIINILPEGSAV
                     LNPDLHPFCLGGDRKTAPIPIFFNATIPVEVELIRTDLETNQQESIKLTRVQIRDIER
                     KAKRESQEGVQTVVQFDYPAKKPGAYRLGRVLDEYKLEVQRKNPQTFVVPCPKAWVGP
                     PASPGRCLGDLSDLTLQAEGIPPLKIKYSRTINGKDHSFHFQSLQPEGFVSPLGTLRS
                     TSLIGLDDEDISWARSQRVPVGLNESMHASGDWQYSVDEVQDGFGNLVKYDSPADDPE
                     GRPKPKHLVQNFVVKERPQVRLEGCDLRNPLKVAKGNEKELPVRFGIAGQTPDVTAHS
                     LTWQFSPIDTLTESGDHGDVVSIGSYNAKNARDRPRISAPGLYTLKSVSASSCEGEVQ
                     EPSSCLLLNPLEPKLTIRSEEIPDTCAGNSIGLRVDMDLIGTPPFIVRYDVISNGQRR
                     SERVSIPGLRYQMDLVPRIAGHHKYIFTHVGDDIYSGQKLTGSEYVLEQDVKPAAAAL
                     IQHSTGKMSSCLGDEVTVDILLLGEPPFTLEWEIIHDGKRKLHKATDIQSNSYQIKTA
                     PLTQGGEYTLGLTSVQDTRGCRNFVQDELKISVRRQSPRAAFGQIEGKRKVLAVEGST
                     VKLPVRLTGEGPWKVFYANLNDGPPDNPKILERTVRNDNGYLDVKGRGTYTITDVWDS
                     QCHGVVDPKASRFDVDWFPRPEMSVVLSHGVSQADDGYVLEDVCEGDVSGFEVALKGT
                     PPYTVEYEVRHHPLQGSSSLSKKKFDASLGKESIQADTAKAGLYTYKFTALEDNLYSS
                     DRHFKPLVVKQKVNRKPSASFAKPGQTFKYCKSEQDNEDGIPVTLTGVPPFSLEVEIK
                     HQSAAVPEIYRTPTINSHSYEIRIPRHQLRLGTQQIRIRDVKDGSGCHSMAELGGPSV
                     QVQLFEAPTIYPLETRTDYCVGERISYTLSGTPPFEVWYTFDGTERKAKSPTTSFRRV
                     AESPGEFTITSLADRASECRAPVHITKTIHPMPAVRISKGKNVRVDIHEGGEVEILFE
                     FWGTPPFEFTYTRSTNARKGQRSQVLETRHDVSHEHSKIIRANQEGTYEVVAIKDKYC
                     AFSTQGAEAGKKDAGGKAQKVIKYH"
     gene            1314793..1315829
                     /locus_tag="THITE_2116660"
                     /db_xref="GeneID:11516449"
     mRNA            join(1314793..1315533,1315593..1315829)
                     /locus_tag="THITE_2116660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654005.1"
                     /db_xref="GeneID:11516449"
     CDS             1315147..1315368
                     /locus_tag="THITE_2116660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654053.1"
                     /db_xref="GeneID:11516449"
                     /db_xref="JGIDB:Thite2_2116660"
                     /translation="MPTFLPSFLPTFLPTFLAQPEAYLSSPAGSPPFWPSRKPTDLAQ
                     PYGTSLTCRPLYHGNCQPVGPGRDGPTRC"
     gene            <1316471..>1316677
                     /locus_tag="THITE_53718"
                     /db_xref="GeneID:11516450"
     mRNA            <1316471..>1316677
                     /locus_tag="THITE_53718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654006.1"
                     /db_xref="GeneID:11516450"
     CDS             <1316471..1316677
                     /locus_tag="THITE_53718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654054.1"
                     /db_xref="GeneID:11516450"
                     /db_xref="JGIDB:Thite2_53718"
                     /translation="DNAPAHCSRSTKAYIVKHFPSTYIVTWPPHSPDLNPIEHIWIWM
                     KRWIERNYPTRPTGEALKEAVLRT"
     gene            1318012..1320597
                     /locus_tag="THITE_2116663"
                     /db_xref="GeneID:11516451"
     mRNA            join(1318012..1318440,1318533..1318548,1318618..1318690,
                     1318764..1318904,1318969..1319865,1319925..1320597)
                     /locus_tag="THITE_2116663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654007.1"
                     /db_xref="GeneID:11516451"
     CDS             join(1318380..1318440,1318533..1318548,1318618..1318690,
                     1318764..1318904,1318969..1319865,1319925..1320176)
                     /locus_tag="THITE_2116663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654055.1"
                     /db_xref="GeneID:11516451"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="JGIDB:Thite2_2116663"
                     /translation="MPPADSDAGATQAGSNSSDFVRKLYKMLEDPSYNSVVRWSPDGD
                     SFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYDFHKVRHNEENGESPYGRDAWEFR
                     HPEFRADRKDNLDNIRRKAPAPRKPPPAEDAFPASQQIIVLSESLTATQHQIQALQEQ
                     YYELEKTNRLLVSEVLSLQKMVRAQSQASNELITYLNNMEDQRRHSRHSAQSSHSGQT
                     GGQSGGQNFHAGGMGFLPDGADEPAPELRRAREILNGVSPDVQADRELERLSMAYNQN
                     GSPADSAGSSVMFQQPGPGGMQLVHDPLNDPRHLVYPVGQTTGIDPFHADHIHNIPYS
                     RPLSNPTIQTEAPSQITPPLKEQFGSLWRGKKPHILLVEDDKTCARIGSKFLTMMDCS
                     VDTARDGLEAVEKVNRDAERFDLIFMDIIMPNLDGVSATAMIRMVAPQVPVVAMTSNI
                     RQEDIQTYFQFGKHSFLPPAGYLVVPNPI"
     gene            1325432..1328272
                     /locus_tag="THITE_2116667"
                     /db_xref="GeneID:11516452"
     mRNA            join(1325432..1325777,1325855..1328272)
                     /locus_tag="THITE_2116667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654008.1"
                     /db_xref="GeneID:11516452"
     CDS             join(1325616..1325777,1325855..1327951)
                     /locus_tag="THITE_2116667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654056.1"
                     /db_xref="GeneID:11516452"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="JGIDB:Thite2_2116667"
                     /translation="MSSKQGGKGGAAAGKAKKPAKAGTDEKREDVLQAVILADSFQDR
                     FKPFTLETPRCLLPLVNVPVIEYTLEFLASNGVQEVFIYCGAHSESIEQYIRESLRWS
                     PGSILSPFSSLEFIRVSDAHSIGDFLRDLDKRAIIAGDFILVHGDLVANIQLDAALAK
                     HRARREANRDACMTMVLRSVGEQPHRAARARGITPVFVVDPTTGRCLQYEETHPLQSE
                     HHLVLDPAVFSHGEFEIRSDLIDCGIDICTPDILALWSESFDYELPRKNFLHGVLKDW
                     ELNGKMLFTEILDDGYAARASNLQMYDCISKDVLERWTLPFVPDSNLVHGQTYRRIKG
                     GSYAEDHVVIERGAKVTQSALGRGTTVQTGSVVSRSVIGKRCKIGKNVRIENSYIWDD
                     AVVGDGTSIFHSIVAGSVVVGANCRIPEGSLISFNVHLDNGIQLPSKPPARISLLSDE
                     QQRAETDVSLVGKGGKGALYQVVTEEEESDDEDGVKRDPAILQSSLIYSLEGLNLSTS
                     SISTLASEDGYGSDDEISTAASLQGSDFGQTRDRLSSFASDDASKPDSFHADAVSGLV
                     DALRADDDDFDSAKLEFMGLRLANNASDSAMRRAIAVAFVRRAAELLTPPHGALEPTR
                     AAERALAAKAGAVKFIREVGVGGDSVAQQADFALAVQKALLAVKDLEPARAGTLLAAL
                     LQQLYSLDVLEEDGILAWWADERAAEGEGMNKLREKCRVLVEWLENADEEESSEEEEE
                     EDDDDEDEEDDD"
     gene            complement(1328950..1331657)
                     /locus_tag="THITE_2116669"
                     /db_xref="GeneID:11516453"
     mRNA            complement(join(1328950..1330877,1330962..1331657))
                     /locus_tag="THITE_2116669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654009.1"
                     /db_xref="GeneID:11516453"
     CDS             complement(join(1329042..1330877,1330962..1331357))
                     /locus_tag="THITE_2116669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654057.1"
                     /db_xref="GeneID:11516453"
                     /db_xref="JGIDB:Thite2_2116669"
                     /translation="MAPSFLNFKELRRRSRASFRTERSTDESSEASHNTTPTSGSLTP
                     PSIGAQSDPALHLQLKEQTQPQTQSQFLSPPGTAIRRPQTHPYPNGGTNRHSVSGMVG
                     LGSPLPSGKGPSLPVSPYSPRVTNVADSSWVYQKVLLVHGTIGDPSHHSLDGTLTVSR
                     LDDNFPPLAWPVCDSRFKALVYLMPGANRLRLDFSSPKLANSGSSNPIHASYLTVHMI
                     PPVGAPPLQLAILLAKDSPGTFDAIPPRIEREGNGLDIAVRKFRMAAYLWQAFTAEQM
                     WRNKLGRRVFRFEEEWTTGAASHRDRDHGTLRSEARVHIIRTDKTVAELRDLNLAQQN
                     PKASDAGGLYGITADAVRDYFKPLPGQKLYVSVLLLDAHWDTNSKTIVGHAALGGRVG
                     DLHLGIFGSHCLQSYPSSFEEIVPAFTDCTPTDTAHVGNDCNEAGSSWEAASLGIGAH
                     LHETGHLFGLPHRESGVMARDFVVLNRTFLTREAYSTRTRSRGGPVAQEDECTWHRLD
                     CLRFRSHPCFRLPNDPVLHLDDSVQGWPMDGTLTLTAATGIAYVEIFAGDGGDVCRAW
                     IEYPPENGGSVQRMVSLSEQDLRSRLPGANENNNSSSSSSSKRKEKLRISAKSYGGGT
                     LDVDDFAKLCSKEEACVKLPGLSKTAFRGKKLGMSAMDGSEPHEFVFSSALRQDRVLS
                     KIVFYHGSAVDGIEFVYDDDSRQLLGKKGGKKGGDVFDMGRPFILFSYFNCLPFPIDL
                     AHV"
     gene            1333965..1335369
                     /locus_tag="THITE_2116672"
                     /db_xref="GeneID:11516454"
     mRNA            join(1333965..1334154,1334218..1335369)
                     /locus_tag="THITE_2116672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654010.1"
                     /db_xref="GeneID:11516454"
     CDS             join(1334083..1334154,1334218..1335192)
                     /locus_tag="THITE_2116672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654058.1"
                     /db_xref="GeneID:11516454"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="JGIDB:Thite2_2116672"
                     /translation="MSSPFKPQPEAVADRVLRRAEIRKMARRLQNRLALAQFKTKHNL
                     VNETLDTIEPKFEHEMRRRRLQDRDILSDSSSSASDLPYSARALMSSPLKAPLFSDAI
                     GSSNGSTGHRKRTYMASFDDTFSSPSKRFRQSPTAHRSFSGHHYQQQHQFTQSSPIKP
                     RRQQHFTTSTGPDLSFYSGSRQISDVLTPTNYAANSDDEDDLPTHSFHTSHIRVSPPR
                     TPPMRSRSLAKKPKERPPVQETKSGEEGADLLLYLAASPSPANPPKIRMDPPSTPPPK
                     NNKLALPSSMMTTPGGGNPYPATPGLGFDFAEFLHMTPSPAQKPWKTPATHTGGKTPR
                     SAARRRLTFDDTPS"
     gene            complement(<1336986..>1338258)
                     /locus_tag="THITE_125477"
                     /db_xref="GeneID:11516455"
     mRNA            complement(join(<1336986..1337002,1337046..1337215,
                     1337382..1337820,1337883..>1338258))
                     /locus_tag="THITE_125477"
                     /product="caspase-like protein"
                     /transcript_id="XM_003654011.1"
                     /db_xref="GeneID:11516455"
     CDS             complement(join(1336986..1337002,1337046..1337215,
                     1337382..1337820,1337883..1338258))
                     /locus_tag="THITE_125477"
                     /note="Shares amino acid sequence identity with the
                     putative metacaspase 1B of Neurospora crassa."
                     /codon_start=1
                     /product="caspase-like protein"
                     /protein_id="XP_003654059.1"
                     /db_xref="GeneID:11516455"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="JGIDB:Thite2_125477"
                     /translation="MPTVNSNSYVHGNHNAPPPPPQSTQHYGAHGHSFQYSQCTGRRK
                     ALLIGINYFNQRGQLRGCINDVRNMSAYLVENYGYKREDMVILTDDQQNPMSQPTKQN
                     ILRAMHWLVKDARPNDSLFFHYSGHGGQTKDLDGDEEDGYDEVIYPVDFRQNGHITDD
                     EMHRIMVRPLQAGVRLTAIFDSCHSGTALDLPYIYSTQGILKEPNLAKEAGQGLLSAV
                     SAYSRGDLGGVANNIMGFFKKASGSEDAYARTMAIKTSPADVIMFSGSKDDQTSADAT
                     IASQATGAMSWAFITALKKNPQQSYVQLLNSIRDELQTRYTQKPQLSCSHPLEPYGL"
     gene            complement(1340621..1341062)
                     /locus_tag="THITE_2116676"
                     /db_xref="GeneID:11516456"
     mRNA            complement(1340621..1341062)
                     /locus_tag="THITE_2116676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654012.1"
                     /db_xref="GeneID:11516456"
     CDS             complement(1340716..1340898)
                     /locus_tag="THITE_2116676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654060.1"
                     /db_xref="GeneID:11516456"
                     /db_xref="JGIDB:Thite2_2116676"
                     /translation="MISAHSALILARAASTALLIPAAAVSIEWLRYDSAGRRLRIQQP
                     RFRKSPACPANLVSPG"
     gene            complement(1341063..1343606)
                     /locus_tag="THITE_2116677"
                     /db_xref="GeneID:11516457"
     mRNA            complement(join(1341063..1343022,1343449..1343606))
                     /locus_tag="THITE_2116677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654013.1"
                     /db_xref="GeneID:11516457"
     CDS             complement(join(1341227..1343022,1343449..1343473))
                     /locus_tag="THITE_2116677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654061.1"
                     /db_xref="GeneID:11516457"
                     /db_xref="JGIDB:Thite2_2116677"
                     /translation="MFGGIAFMIPGPGSLTNGPPKDVPPPTPINLPRCCPQVSDRDGP
                     GVQGPASGKPPAALTSVLQGIVRPTDVAISHLEALRTHVIPDAAPSQIIPDPAFIPDF
                     DAWHALSADDAHATNESTRRRLNTGNLSPGCQTYLERRRELSIPNEAAYRTIRRIPPP
                     KGQPQARLGNAYEFYRHLELFTSFWEDTSKPPAKPEAKTGPSAGEGNGENGAASEGGK
                     NPEESSGAPGFYRTGAGHQMPPDYRQNMVTAFLKLVTYDFTCNVSAPRTEPRLHITSR
                     SSTGTPRSSYFTSGCTFIFRTPGTREAARAGIVEGPLAAVSARHTTSFPDPNSAERGS
                     TPPGADRESTLDLARELVAALITAQHRAREGRVEKRIGENAWWCTKPRWGGGPGGPIG
                     REVEMLSGADETIGDKDAPPSEAALPPQPSSSSLPRSPSSSSSMSLPQRPFSRPSALP
                     IPGGDSGGSSKGAKRLKKSGNHPMYDNYRMVRPPAPTWDKKTRYEAIGRARGADYDDI
                     FVVSTVLHHVSIVRVRVPDRLLAVLDGEPDNGRSWGRLEVWRSPWFDFFKVEERVQAM
                     QLVWCMMAYMMREQPGKQQGAEGPKEEPARSQGDVKMTGA"
     gene            1344986..1347803
                     /locus_tag="THITE_2116680"
                     /db_xref="GeneID:11516458"
     mRNA            1344986..1347803
                     /locus_tag="THITE_2116680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654014.1"
                     /db_xref="GeneID:11516458"
     CDS             1345122..1347317
                     /locus_tag="THITE_2116680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654062.1"
                     /db_xref="GeneID:11516458"
                     /db_xref="JGIDB:Thite2_2116680"
                     /translation="MVSSSLPSGAFLTTINGRRCTAIPRAAAAASSALTTTSASSVVV
                     EATTTDSATLATSASSTRTTAGLTTGLVAAPAADADGSTEVPGQSSTSTTSSSSSTII
                     ITATTNVPPGSVQIAQAQDSETTETSETSSSAGSPTPVPPAPVTTSGTTSQSFTVLGD
                     VTSSQPSAAQSSQADGSVTAQAADTVATSSGVATAETSPPLLPESPAATPLLTTIESP
                     QRATGSAAADATDTTSPDPALNTVPALSSNAVQSTVAVAGGVIGGAVAISILAFFIWW
                     WRRRLMRKRRSTLLTPLDAVPSNEKGSYVISRRSIGPTPVVEKVRVALGQNFKKIRGH
                     IRNRTAPSVNLDRGPSQFLDPPATRSRANSAVTGTEPAAKDRLRGWWSALGARVGFNQ
                     RNKTGRGATSDVTQEKKTGSSDSQPDFLTLLNMDDGELDREAQRRRANLARTNGSVSS
                     TDNFLGLSLDFGRDDDPFSDANALAHNSAKPAPLAVGGSSSSNPFSDANAIRDPAPSL
                     PKAAATYVPGMRRSRTNSTAAGGRQLSTAYYSPANRDSVGSLRSLATATTTTNQRNKF
                     RSDPFDLERPELLGTTTTATTTTITSAAAGVPDLPLPLRTDTTTVTNNNNGADVRRPT
                     GTRTRAESTVSRYSKYSKYSSGVSAVSSLSSGGDDDGWSDPGPDVGPAAARSAGARWP
                     GQQVQGQLGQQGQQGQGQTQGQGQQGQGQGARRLSGGSLGSLRSVGKAM"
     gene            1352758..1354479
                     /locus_tag="THITE_2116685"
                     /db_xref="GeneID:11516459"
     mRNA            1352758..1354479
                     /locus_tag="THITE_2116685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654015.1"
                     /db_xref="GeneID:11516459"
     CDS             1353099..1354244
                     /locus_tag="THITE_2116685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654063.1"
                     /db_xref="GeneID:11516459"
                     /db_xref="JGIDB:Thite2_2116685"
                     /translation="MAHLPPNTAIFSPSVARAAASAAKDWSYIDRWLQRKFPGRGPPP
                     FERNADTLRALLALAAANQAADEERALIARLEAETLDQLRAYEKSRHQNQTGGSADAG
                     SDTNDHVLHDAREAILTALESSLTREGQTALNAMATLALQTGVPQPTPTALGAELINL
                     SAQSATLEQTISRIDTLTAYLSREAAATAELSAELGSPSPHHHHHDVDNDPTEDGDDN
                     GPAAPQTGYHPPANLAIQNLETQRRIKALSARLPELRDKAASLAKSVGSGSGSGGGVP
                     SSSSSSSSPPLPPPSSSPSSSWSLPFPSIEQVRQEEEAYLALLAQKKALDAQVRAFAG
                     LPPDTERARQELEGLRAELRRMTLRRDEVFEGLVERETPRKGPPARR"
     gene            complement(1355032..1358358)
                     /locus_tag="THITE_2116687"
                     /db_xref="GeneID:11516460"
     mRNA            complement(join(1355032..1355346,1355408..1355487,
                     1355547..1355665,1355733..1356637,1356690..1357350,
                     1357414..1357581,1357715..1357877,1357981..1358358))
                     /locus_tag="THITE_2116687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654016.1"
                     /db_xref="GeneID:11516460"
     CDS             complement(join(1355126..1355346,1355408..1355487,
                     1355547..1355665,1355733..1356637,1356690..1357350,
                     1357414..1357581,1357715..1357877,1357981..1358048))
                     /locus_tag="THITE_2116687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654064.1"
                     /db_xref="GeneID:11516460"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Thite2_2116687"
                     /translation="MDPAIQRALNDKLYDKRKVGALELERVIRELVTLKDYAKVEAVL
                     DQLCNEFAYAVHQPHARNGGLIGLAAAAIALGPELARYLEVIVPPVLACFTDQDARVR
                     YYACEAMYNIAKVAKGEILIYFNHIFDALCKLGADSELSVKNGAELLDRLIKDIVSES
                     AATYVSVLEHPPPYQGDDKDAPDDSVELPTAFSLKRFIPLLRDRIYALNPFTRTFLVG
                     WIILLDSIPDLELVTYLPEFLGGLLRFLGDSNRDVHVATQGCLDKFLNEIKRIARIKK
                     GIAESKKSREGRRKRIDSVGSVGSVRPQLEEGEEVESETAAEEDDLESEDDWIPGQDV
                     QINYKAILEILTATLDSQFDEDGLLESLRWIVEFLDICPEEVLPFTPKILAHLLPAMA
                     SGVESIRQAAGRVNTSLMDYVVSLSDEAELAMPPPSRIPAPAPSAGDRQDGTTGARAS
                     LSGSTRDLEVRSPTPAQGRKTIPGTPTPAVSAPQPQPDLDYAAAVNSLTLLFLNDHEA
                     TRVAALTWLIMLHRKAPRKVLAFNDGTFPALLKTLSDPSEAVVTKDLQLLSQISRNSE
                     DDYFTNFMVNLLQLFSTDRKLLETRGNLIIRQLCISLSAERIYRTLADCIEKEEDVEF
                     ASIMVQNLNNNLITAPELSELRKRLRNLETKDGQTFFVTLFRSWCYNAVATFSLCLLA
                     QAYEQAYNLLQIFAELEMTVNMLIQIDKLVQLLESPVFTYLRLQLLEPERYPHLYKCL
                     YGLLMLLPQSSAFAALKNRLNSVSSIGYLHIAPRPYVLSPIPAHCPPNTPWKHH"
     gene            complement(<1360101..>1360532)
                     /locus_tag="THITE_160631"
                     /db_xref="GeneID:11516461"
     mRNA            complement(join(<1360101..1360298,1360470..>1360532))
                     /locus_tag="THITE_160631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654017.1"
                     /db_xref="GeneID:11516461"
     CDS             complement(join(1360101..1360298,1360470..1360532))
                     /locus_tag="THITE_160631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654065.1"
                     /db_xref="GeneID:11516461"
                     /db_xref="JGIDB:Thite2_160631"
                     /translation="MGKSKMDEAAAERIRRARGDKDGFTKRAADAARRNEQRESSSGY
                     SSSKHSSGGGGIRSGSKSGSKSGSGSGGSKSDHHGSGDKKKQ"
     gene            complement(1362040..1364002)
                     /locus_tag="THITE_2116695"
                     /db_xref="GeneID:11516462"
     mRNA            complement(1362040..1364002)
                     /locus_tag="THITE_2116695"
                     /product="fatty acid delta-6 desaturase"
                     /transcript_id="XM_003654018.1"
                     /db_xref="GeneID:11516462"
     CDS             complement(1362420..1363952)
                     /locus_tag="THITE_2116695"
                     /codon_start=1
                     /product="fatty acid delta-6 desaturase"
                     /protein_id="XP_003654066.1"
                     /db_xref="GeneID:11516462"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="JGIDB:Thite2_2116695"
                     /translation="MMDKYRIGRIEGRWKNFLPPIQGGRFRPRVGEGEAEVEQEYEAS
                     ATPAPMAMEDATASSSDPTSRSPSPVFDGDATGSDSGSRSRKSGIARSGSATSLSSAE
                     EDEASTAATPVDGMAHLDALTRKGIKLDLSKYPAPDPATQEAIVEKYRLLNERIKAEG
                     LYDCNYYAYAVEVTRYALLFGLMLLFLRWRWYVVSAFFLGCFWHQLVFTGHDAGHMGI
                     THNFQVDSVIAIIVADYLGGLSMGWWKRNHNVHHIVTNSPEHDPDIEYIPFLAVSHRF
                     LASLRSTYYERVMHYDAVAKLLIPLQHYMYYVYLLFGRFNLYRLSWEYLILGQGPRKG
                     AAAWFRWLELAGQVFFWAWFGYGILYRSIDSNWDRFVFVMVSHMVTTPVHVQITLSHF
                     AMSTADLGVDESFPQKMLRTTMDVDCPPWLDFFHGGLQFQVIHHLFPRIPRHNLRRTQ
                     RLVQEFCDEVGIPYALYGFVDGNKQVIGRLADVARQAAILAKCQRVMAGLEKGHGHHH
                     HH"
     gene            complement(1364010..1364356)
                     /locus_tag="THITE_2116696"
                     /db_xref="GeneID:11516463"
     mRNA            complement(1364010..1364356)
                     /locus_tag="THITE_2116696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654019.1"
                     /db_xref="GeneID:11516463"
     CDS             complement(1364051..1364242)
                     /locus_tag="THITE_2116696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654067.1"
                     /db_xref="GeneID:11516463"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Thite2_2116696"
                     /translation="MAASRSYPVLSRREIEALIAEGRTIIIVDQHVIKADAWLKYHPG
                     GDKAIMHMVGRDATDEVNG"
     gene            complement(1365091..1367508)
                     /locus_tag="THITE_2116698"
                     /db_xref="GeneID:11516464"
     mRNA            complement(join(1365091..1366104,1366176..1366880,
                     1366952..1367031,1367088..1367143,1367206..1367508))
                     /locus_tag="THITE_2116698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654020.1"
                     /db_xref="GeneID:11516464"
     CDS             complement(join(1365487..1366104,1366176..1366880,
                     1366952..1367031,1367088..1367143,1367206..1367264))
                     /locus_tag="THITE_2116698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654068.1"
                     /db_xref="GeneID:11516464"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Thite2_2116698"
                     /translation="MLSQRLIGRTAVKSAFRPSGLPSIVSAPRWRRTYATQAEERDLV
                     IIGGGVAGYVAAIKAGQEGMKVTCIEKRGTLGGTCLNVGCIPSKSLLNNSHLYHQVLH
                     DTEHRGIEVGDVKLNLKQLMKAKDQAVTGLTKGVEFLLRKNGVEYLKGTGSFQDEHTV
                     KVQLNDGGETSVVGKNILIATGSEVTPFPGLEIDEKTVISSTGALSLEEVPKKLLVIG
                     GGIIGLEMASVWSRLGSDVTVVEFLDQIGGPGMDTEISKNIQKILKKQGINFKTGTKV
                     VNGEKTGEGVKINVDSAKGGKPETLDADVVLVAIGRRPYTGGLGLENIGLELDERGRV
                     IIDSEYRTKIPHIRCIGDVTFGPMLAHKAEEEAVAVVEYIKKGYGHVNYGCIPAVMYT
                     FPEVAWVGQSEQDLKKAGIKYRVGTFPFSANSRAKTNLDTEGMVKMLADPETDRLLGI
                     HIIGPNAGEMIAEGTLALEYGASSEDIARTCHAHPTLAEAFKEAAMATYSKPIHF"
     gene            complement(1367955..1370809)
                     /locus_tag="THITE_76931"
                     /db_xref="GeneID:11516465"
     mRNA            complement(join(1367955..1370692,1370732..1370809))
                     /locus_tag="THITE_76931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654021.1"
                     /db_xref="GeneID:11516465"
     CDS             complement(join(1368042..1370692,1370732..1370798))
                     /locus_tag="THITE_76931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654069.1"
                     /db_xref="GeneID:11516465"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="JGIDB:Thite2_76931"
                     /translation="MPPPGVKKPTLPFHLLKELGVSASAYTITDSRQGQRRGAAKGQI
                     ASRKERRKAERKQGKANRAAATRDHAERTVPIRKSNAPPATADSSRPTHGQARNGPKS
                     ILKKGRPVPTEDEQESKGFDDTLEEDDDQDLLSDGVLDEGSDDEGEESAASEDADFGD
                     DAVDAPPKRSMSKTAKAMLARDDAEIAELERKLGLKNRKKLPKSFRDDGLGDLLDGLG
                     GGFDEEKQEKRKRKAEADEWLAQKRRKAEAASTSGQQSRLVDESADDSGDSDDLGEVM
                     DGFDEDDDLEDADSDDHELDEEDVNGGDQGESQDSFEGFDSEDEETAEQPPQRRIREN
                     PYVAPTTGQTAKYVPPSLRKESGSDAELEARIRRQTQGLVNRITESNMLTILAEIEKL
                     YREYPRQHVTSSLVDLLLIQVCDPTSLPDTLLILTAGFATAAYMVLGNDFGGQLIEEV
                     VGRFERYYGEAKAAAVDRPDVPKQTSNLITFISELYTFQLIGPNLVFDYIRMLLESLS
                     ELNAELLLRVVRMCGPTLRQDDPMALKDIVSLIPPAVAKAGEKNLTVRTKFMIDTITD
                     LKNNKMKAGAGASAVISEHITRMKKMLGQLKSRKLKSTEPMRMGLKDIQDADKRGKWW
                     LVGASWAGRPAGEQDAGKPTNAQDDESDDESILLDDVEQGPDLAELAREQGMNTEVRR
                     SIFVSIMSAMDYQDAYARILKLRLNKERQREIPNVIIRCVGAEQYYNPYYTLVARRLC
                     SELREVRWAFQSCLWKLFGRMGEPDFGEDEAEDEEEDESMDTRRIVNTAKMFGALIAG
                     GSLGVTVLKRLNLLYLQKKTRDFVEVMLVTVLLECQGSERAEESTAKVFAGAEAAPDL
                     ARGLQYFLKKVVRKSDLAGGKKNAKLLKDGCKMAEAVVQTALARAEDLA"
     gene            1371000..1371770
                     /locus_tag="THITE_2116699"
                     /db_xref="GeneID:11516466"
     mRNA            join(1371000..1371148,1371213..1371291,1371375..1371770)
                     /locus_tag="THITE_2116699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654022.1"
                     /db_xref="GeneID:11516466"
     CDS             join(1371125..1371148,1371213..1371291,1371375..1371700)
                     /locus_tag="THITE_2116699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654070.1"
                     /db_xref="GeneID:11516466"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="JGIDB:Thite2_2116699"
                     /translation="MGHLTHDEFFAKLTDLFNTRKTRAHGSVYLTQKRLTFNQATTAT
                     TTTGTASSAADDPLADLHPAQPLPVLIRATDGKSKERRASKVKLSTVVDPADLEAFYA
                     RYAEVCKAGMSALKPRDRTKRKAKAKKRRGGGAGAVVPAS"
     gene            complement(1372878..>1376029)
                     /locus_tag="THITE_2078523"
                     /db_xref="GeneID:11516467"
     mRNA            complement(join(1372878..1374165,1374237..1374652,
                     1374717..1374768,1374834..1374977,1375038..1375131,
                     1375189..1375196,1375303..1375355,1375422..1375737,
                     1375967..>1376029))
                     /locus_tag="THITE_2078523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654023.1"
                     /db_xref="GeneID:11516467"
     CDS             complement(join(1373881..1374165,1374237..1374652,
                     1374717..1374768,1374834..1374977,1375038..1375131,
                     1375189..1375196,1375303..1375355,1375422..1375737,
                     1375967..1376029))
                     /locus_tag="THITE_2078523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654071.1"
                     /db_xref="GeneID:11516467"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2078523"
                     /translation="MLCRCGPCSRFEGGIVRWGRLRERSRSPRRGRSRSPNTRRSFSP
                     RDRSASQRRRRSRSPMTGQGAAAGGTGSGYSGAPHRSYEERAAHREQVMNNIRETSQQ
                     DRRVYVGNLSYDVKWHHLKDFMRQAGEVLYADVLLLPNGMSKGCGIVEYATREQAQQA
                     VATLSNQNLMGRLIYVREDREAEPRFGPPGGIPRGGFAGGMGGPYGAGGFNAGMAGGG
                     VRQLYVSNLPFNVGWQDLKDLFRQAARVGAVIRADVHLGPDGRPKGSGIVVFESPEDA
                     RNAIQQFNGYDWQGRLLEVREDRFAGPAMGAGGYGRGGFAGGRGAFGGGYGRGGFGGG
                     RGGFGYGGVRGGYGGGVFDANSASVPPNPFTDHATAGVEKCDTIYVRNLPWSTSNEDL
                     VELFSTIGKVEQAEIQYEPSGRSRGTGVVRFDNADTAETAIAKFQAYQYGGRPLGLSY
                     VKYLTPGGGDNMDTDPHGGLTQDQIM"
     gene            <1380423..>1381329
                     /locus_tag="THITE_16677"
                     /db_xref="GeneID:11516468"
     mRNA            join(<1380423..1380854,1380997..>1381329)
                     /locus_tag="THITE_16677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654024.2"
                     /db_xref="GeneID:11516468"
     CDS             join(<1380423..1380854,1380997..1381329)
                     /locus_tag="THITE_16677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654072.1"
                     /db_xref="GeneID:11516468"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="JGIDB:Thite2_16677"
                     /translation="LTQPAARRRAYHSHDHPPPPGPFTPAEQALLSAAYARVPQHGFT
                     AEALALGARDAGLLDISPAVLPDGGVFGLIRWHLYTQRTALAGKVEEIFGSSGGGGRD
                     GGDGGEALGKGQAPLTTVADKVEALAWARLQANEAIVGHWQEALAIMAQPSYVPASLK
                     ELALLADEILYLAGDVSVDPSWYTKRASLSAIYAAAELFQTTDQSPGFRETRAFLRRR
                     LDEAAQAGATVRSVGEWLIFNAGAAVNVLRSKGVRI"
     gene            complement(1381378..>1385418)
                     /locus_tag="THITE_2066875"
                     /db_xref="GeneID:11516469"
     mRNA            complement(join(1381378..1381717,1381779..1381879,
                     1381950..1383551,1383633..1383812,1384047..1384133,
                     1384182..1385207,1385281..>1385418))
                     /locus_tag="THITE_2066875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654025.1"
                     /db_xref="GeneID:11516469"
     CDS             complement(join(1381678..1381717,1381779..1381879,
                     1381950..1383551,1383633..1383812,1384047..1384133,
                     1384182..1385207,1385281..1385418))
                     /locus_tag="THITE_2066875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654073.1"
                     /db_xref="GeneID:11516469"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="JGIDB:Thite2_2066875"
                     /translation="MPARIINGVAAEASRKRARRAAAEDGDDDEEVVEVHHARSNLRL
                     EQRKRVRLSDVDDDKSERRARRESTSSGDEASESAEEAASPPRTPPKSQYELMRDNNF
                     EHLRHEAADDQRATQRLRFRPSLLGENTIAENGIIESVTCVNFMCHERLHCELGPLLN
                     FIVGENGSGKSAVLTAITLCLGGKASSTNRGGSLKSFVKEGCDRAVLAVKIKNRGQDA
                     FKPEIYGESVIVERHFSKTGSSGFKVKTALGQVYSVKKQEVDELVEYYALQVDNPLNI
                     LSQDNARQFLNSSTKAQKYKFFIEGVQLQQLDNDYRLISENLELMVAKVPDQEERVKH
                     AKAEFDKAKRLREELEGNQQIRLKLRTLRNQMAWAQVAQEEEELRRRDDDLAQAALEL
                     ANEKVERAAETLQHVQDERYEIVRRIQENKDSEPGLIQKADDAKKALETIGDELLRKR
                     GEINSVEARINSLQEHRGSVFDAYEAKLLKPEWSSILEKTFGINLNAFIVTSKSDETL
                     LRGMMNRLNIRTCPVFICSPHPLDLSSKEPDPEYDTILRVLKIDNQMVRDQLVINHMI
                     EQVILIPERARAEQVMFDGAPPRNVKACLCFHDRKRGEGLRLAVNNNGNISTSPIQPN
                     PHLRTRMKTDSDTQIALLKESLQQIMDEARSVDAEKRRLHQESQRCQAALTQLKTKRN
                     ELELAFRAARGKADNIQAELDESVGDDGRLQGLKVQLAEYQAQLNHHGIQYGMLSAAK
                     QDKNKEVEEAQRRLKEQRLNANDYEERLKKAEAELKRANDLRTISLIEKNEIISRAAE
                     YAELKSKAEARRARQQANVEAFVTQAKAVSEERFYIPEGETYDSIQKQYNTLRERLKK
                     AEDRRGMTDQQVHDYFAETKKVYNKVVADLQSITVVNARLRETLTVRLEKWRKFQRYI
                     SSQSRANFIYLLSERGFRGKLLLDHERKALDLQVEPDRTERRATGRSTKTLSGGEKSF
                     ASICLLLAIWEAMGSPLRCLDEFDVFMDNVNRAISTNMLITAARRSVNRQYIFITPNA
                     IEGRNTLDKDVKIIRLTDPRQRRLADH"
     gene            <1386088..>1388155
                     /locus_tag="THITE_2050569"
                     /db_xref="GeneID:11516470"
     mRNA            join(<1386088..1386319,1386384..1387124,1387200..>1388155)
                     /locus_tag="THITE_2050569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654026.1"
                     /db_xref="GeneID:11516470"
     CDS             join(1386088..1386319,1386384..1387124,1387200..1388155)
                     /locus_tag="THITE_2050569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654074.1"
                     /db_xref="GeneID:11516470"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="JGIDB:Thite2_2050569"
                     /translation="MDTAAEPRPGEEGFDGFRMRLPEDCLEYMLFVVGDKSASDLPSL
                     ETVRKAADQKLDQLARDYIWQRDPFRLETRSQKGLGLPYLYGTTHYGDSVEDEWLIVY
                     LLRELSKSFPHLWIRVSDSDGEFLLIEAAKVTPKWLTPENDANRVWIHDGRLLIIPLS
                     NPDPSHPAADSAPLSLAEAIQTIRTAPSSLIHSPLIEAEAFYRLEKYPGQITAWLHHA
                     LVTIPRKLAYILHARPKSVAPATEAFYLRDPRSLKPILSASAAPAPGSASASSPSSSA
                     TAADLIFPPIDLVTVSVRFTRVLYAQLKSQHFPPPPAWRGALRSVVEGGSSENLQRRL
                     ARLELGMKLTTGFEMLARTAHDSASRVVREVGLLLEDLAEDGGDRALPSDEEIQGWEG
                     VEREDDDSWMDIDYRDFERELDGAAAGRRGQPGDGAGFGDAAAQADLRKIVSRFEAFL
                     NDETAGIEGAEIDEMDRDNDSTEEESEEGSDEDEDKEVSFDEEQFARMMREMMGLPAD
                     EASGQGKAKQKAVDESAAESDEEEEEEIRKLAEQMESELRGHGALDLDPKPKTAAKSI
                     KKKGETTSKAEQVEPQEEEEDGEGSDEEVDIDYNLAKNLLESFKSQAGMAGPAGNLLG
                     LMGVRLPRDEEDSDDDQK"
     gene            complement(<1388321..>1389874)
                     /locus_tag="THITE_2052174"
                     /db_xref="GeneID:11516471"
     mRNA            complement(<1388321..>1389874)
                     /locus_tag="THITE_2052174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654027.1"
                     /db_xref="GeneID:11516471"
     CDS             complement(1388321..1389874)
                     /locus_tag="THITE_2052174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654075.1"
                     /db_xref="GeneID:11516471"
                     /db_xref="JGIDB:Thite2_2052174"
                     /translation="MCQTPTVETVKGMLGPAVPADVTIKKIQSVPSLQPKSIYQAALS
                     DGRSIQLVLPPPPQWRPLRSEQGLIESEAAAVAWIKETITRQSTTERQDERPPSSNSD
                     RITRPPEVLALLPTLLHHGQPTDGSKTPFAAYLAVQGTPLSLLGRPPTPSSQRAIDRQ
                     LGALFRSLAHLTSPTGRFGPLAAVLGTATTTGRPPEETTAGAAPAKTSPKLMLQGGLS
                     ATGGAGTWSVAFHSMLESALRDGEDMAVVMAYSTIRRQFRRVGYLLEEVTVGRLVVVE
                     GGERANILVSEERAGGDAAEEQEPQGDSERQEGRAGKGGAKDEREDGKSGKDPHIKDG
                     RESEEPQKEADTQPRLRLCGLRDWSSCVFGDPLLATVFSGAQQQHEPGRPSAAFLEGF
                     NNGGKTTTTAAAAAADDNDHAPPPLPTRDRPPFFFPLDKSVVEDNNGTAWVRLLLYQA
                     YHAVVRIVSEFYRPRQDSSARELEARRTLNEVLARLAEVPDDAARRKHPRPSGGEMSP
                     AKRVKAADG"
     gene            complement(<1391458..1393026)
                     /locus_tag="THITE_2116714"
                     /db_xref="GeneID:11516472"
     mRNA            complement(join(<1391458..1391843,1391915..1392124,
                     1392233..1392376,1392446..1393026))
                     /locus_tag="THITE_2116714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654028.1"
                     /db_xref="GeneID:11516472"
     CDS             complement(join(<1392006..1392124,1392233..1392376,
                     1392446..1393000))
                     /locus_tag="THITE_2116714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654076.1"
                     /db_xref="GeneID:11516472"
                     /db_xref="JGIDB:Thite2_2116714"
                     /translation="MYGIKSGRDAPAGESGERGGEEVDEKEEEENEDIEAAIRKEVAA
                     LTSKPSDAAAGNVMRPVKMNVDCLLFVKTPPAVDPVAFVRRICEDARACNELPGLMRC
                     RYVNRLTPVTAMGRATEQGLVEVARKVLASTFDLSGKRGKSSAATGDDGKGAAGGAAN
                     AETGGERTSNDELAVPDAEGKIPFTFAIRPTIRNHSNLKRDVVINTIAGLINDDRHRV
                     NLSSPDKVILVDIYQTVCGMSVVDGDWEALKRFNLTELYSQARNAQSGEGSKSD"
     gene            complement(1394097..1396096)
                     /locus_tag="THITE_2116720"
                     /db_xref="GeneID:11516473"
     mRNA            complement(join(1394097..1394417,1394486..1395716,
                     1395781..1396096))
                     /locus_tag="THITE_2116720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654029.1"
                     /db_xref="GeneID:11516473"
     CDS             complement(join(1394114..1394417,1394486..1395716,
                     1395781..1395970))
                     /locus_tag="THITE_2116720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654077.1"
                     /db_xref="GeneID:11516473"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="JGIDB:Thite2_2116720"
                     /translation="MGLDIRERGLKKPVAVAEYLFRRLHEIGIRSVHGLPGDFNLVAL
                     DYIPKAGLRWVGSVNELNAAYAADGYARIKGISALVTTFGVGELSAINGVAGAFSEHV
                     PVVHIVGCPSTISQRNGMLLHHTLGNGDFNVFANMGSQIACDTARLNKPAEIADQIDH
                     ALRECWIRSRPVYIMLPTDMVEKKIEGARLDTPIDLTEPENEAEREDYVVDVVLKYLH
                     AAKCPIILVDACAVRHRVLKEVHDLVEKTQLPVFVTPMGKGAINESHPSYGGVYAGTG
                     SHPDVAERVESADLVLSIGALKSDFNTTGFSYRTSQLNTIDFHSTYCQVRYSEYPGVA
                     MRGVLRKVVERVDLSKLSQPSSPQVVNKVAENWDDSETITQAFFWPRIGEYLKENDIV
                     VTETGTANFGIWETKFPPGVTGVTQILWGSIGWSVGAAQGAALAARDMGVDRRTILFV
                     GDGSFQLTAQEVSTMIRHNLKVTIFLIYNEGFTIERFIHGMEAEYNNIARWQYTEVPA
                     VFGASDKQCRKFVVKTKDQLEKLLTDKEFNEARGLQFVELWLPKEDAPRALRITTEVA
                     ARTNARVE"
     gene            complement(<1396857..>1397475)
                     /locus_tag="THITE_2145027"
                     /db_xref="GeneID:11516474"
     mRNA            complement(join(<1396857..1397283,1397342..>1397475))
                     /locus_tag="THITE_2145027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654030.1"
                     /db_xref="GeneID:11516474"
     CDS             complement(join(1396857..1397283,1397342..1397475))
                     /locus_tag="THITE_2145027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654078.1"
                     /db_xref="GeneID:11516474"
                     /db_xref="InterPro:IPR006863"
                     /db_xref="JGIDB:Thite2_2145027"
                     /translation="MAEDSRESQSANAPATDGAAPSAGTSAEPPKKFPKGVVLGKDGK
                     PCRSCTSFAAWASQTKSSLKAASATATPPRDCPPDVEVLGRSTWTLLHSIAATYPTAP
                     TAKEQSDLKNFMRLFSKLYPCWVCAEDFQAYMEKQEVKAGSRDEFGNWLCEAHNEVNR
                     KLGKPTFDCRKWEERWRTGWKDGSCD"
     gene            1397495..1398749
                     /locus_tag="THITE_2116724"
                     /db_xref="GeneID:11516475"
     mRNA            join(1397495..1398055,1398117..1398749)
                     /locus_tag="THITE_2116724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654031.1"
                     /db_xref="GeneID:11516475"
     CDS             join(1397779..1398055,1398117..1398727)
                     /locus_tag="THITE_2116724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654079.1"
                     /db_xref="GeneID:11516475"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="JGIDB:Thite2_2116724"
                     /translation="MASKIPVFLLKTRSVPGDAYEELFSTPADGFDFEPSFVPVLEHR
                     FDEEGLAKVRSALQNRSISSAVDSTYGGLIFTSQRAVEAFAKLVEERRGEEDGWPHLQ
                     DVPVYSVGPATTRALKAVPQVPPLQVFGEHTGSGDKLAPFILEHYGEWYKGREPMPPL
                     LFLVGDKRRDVIPRVLTEAGWRLDEVVVYGTGELESFKEDFTQRLRETADRPLRWVVV
                     FSPSGCGSMLSALGLLDESTGRAKPKQPDRDTLIATIGPTTRDHLMQKFGYEPDACAK
                     QPTPEGVWQAISRFSKGSE"
     gene            1401276..1402735
                     /locus_tag="THITE_2116730"
                     /db_xref="GeneID:11516476"
     mRNA            join(1401276..1402004,1402078..1402735)
                     /locus_tag="THITE_2116730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654032.1"
                     /db_xref="GeneID:11516476"
     CDS             join(1401375..1402004,1402078..1402602)
                     /locus_tag="THITE_2116730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654080.1"
                     /db_xref="GeneID:11516476"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="JGIDB:Thite2_2116730"
                     /translation="MTVYTAHNNQPLRSRRSRELDVSPASSSPGSVTPPGGGATSSSS
                     SSAFLSSSVSSLWGGIMRRFSGEPSPATSNLTLPASLPHARTYQPDGGDRRHTHDHLG
                     NGVDGVYTPPHVLQAQRTSSPMRPPPLEPLQLVGFAEDTRPEARLLTVPVAEEIRIMV
                     PARLGIVDEWRLVYSLEQDGASLATLYEKCACYQGKRVGFVLCVRDCEGGLFGAYLSD
                     HPHPAPKYFGTGECFLWRASVLAPPPPPPAPSASNNNNDDDNDPQPGVAAPTTTIART
                     PTPTTTKTTTKPPGPPRSRSTTPQPQPQPQPQSIRFKAFPYSGVNEYYMLCESHFLSL
                     GAGDGRYGLWLDDSLERGVSSTSQTFGNEPLSDEGEKFGVLGVEVWVIGG"
     gene            complement(<1403559..>1404825)
                     /locus_tag="THITE_2049821"
                     /db_xref="GeneID:11516477"
     mRNA            complement(join(<1403559..1403935,1404013..1404394,
                     1404460..1404655,1404719..>1404825))
                     /locus_tag="THITE_2049821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654033.1"
                     /db_xref="GeneID:11516477"
     CDS             complement(join(1403559..1403935,1404013..1404394,
                     1404460..1404655,1404719..1404825))
                     /locus_tag="THITE_2049821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654081.1"
                     /db_xref="GeneID:11516477"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2049821"
                     /translation="MSNAQNRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSG
                     QKVAIKKITPFDHSMFCLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQE
                     LMETDMHRVIRTQELSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLK
                     VCDFGLARSAASQDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEML
                     SGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFP
                     NTSELALDLLEKLLAFNPVKRITVEEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKH
                     KDSLSKEQLKQLIYQEIMR"
     gene            complement(1407994..1411201)
                     /locus_tag="THITE_2116739"
                     /db_xref="GeneID:11518081"
     mRNA            complement(join(1407994..1410449,1410506..1411201))
                     /locus_tag="THITE_2116739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654034.1"
                     /db_xref="GeneID:11518081"
     CDS             complement(join(1408224..1410449,1410506..1411102))
                     /locus_tag="THITE_2116739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654082.1"
                     /db_xref="GeneID:11518081"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="JGIDB:Thite2_2116739"
                     /translation="MSAPHGGYGQYPPPQPGEQFTHPDQGYADPTAAPPPATGAQHAA
                     EHGKKKKRTYAAGAFEVGMGGNAVLGGQAPAGGQFGAPAPVYGGYPQPDVQPAGYAAQ
                     PQQPYGMAQPAPAPAVGGYQAPEPYYPTAGAPPAAGGVAGLTSGMSAMHLGPGAQQQL
                     PPQARAAPLNQLYPTDLLNQPFNVSELDLPPPPIILPPNSSVTPSPDANCQPKYVRST
                     LNAVPTTHSLLKKSKLPFALIIQPYAALHDLDDPVPIVQDQVISRCRRCRSYINPFVT
                     FLDHGHRWRCNMCNLTNDVPQAFDWDAAAQKTVDRWQRHELNHAVVEFVAPQEYMVRP
                     PQPLVYLFLFDVSYAAVSTGLLATSARTILDSLNRIPNADRRTRLGFIAVDSSLHYFS
                     VPKDTDENGETSMLVVSDLDEPFLPVPQELLVPLTECRNSIESFLTKLPEMFANNQNN
                     GSCMGSALRAGHKLISPLGGKLVVLSASLPNVGYGKLDMREDKKLLGTSKESGLLQTA
                     SGFYKSFAVECSKNQVSIDMFLFSSQYQDVASLSNLPRYTGGQTWFYPGWNAGRPEDA
                     IKFASEFSDYLSSEIGLEAVLRVRATTGLRMSTFYGNFFNRSSDLCAFPAFPRDQCYV
                     VEVAIDENLTKNVVCLQTAVLLTTCNGERRIRVLTLALPTTTNLADVYASADQCAVTT
                     YYSHKAVERALSHGLESARDMLQSKITELLQTFRKELAGGSMGGGLQFPANLRGLPAL
                     FLGLIKHVGLRKSAQIPSDLRSAALCLLSTLPLPLLMQYIYPRLYSLHDMPDNAGVPD
                     PETSQIVLPPPLNLSSERFVPYGLYLIDDGQTQFLWVGRDAVPQLLIDVFGVTDRAQL
                     RVGKGSVPELDNDFNERVRAVIQKSRDHKSRGVGSIVVPHLYIVREDGEPSLKLWAQT
                     LLVEDRADQGMSYQQWMGSLREKVSL"
     gene            1412055..1412977
                     /locus_tag="THITE_2116742"
                     /db_xref="GeneID:11518082"
     mRNA            join(1412055..1412306,1412365..1412631,1412688..1412977)
                     /locus_tag="THITE_2116742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654035.1"
                     /db_xref="GeneID:11518082"
     CDS             join(1412260..1412306,1412365..1412631,1412688..1412736)
                     /locus_tag="THITE_2116742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654083.1"
                     /db_xref="GeneID:11518082"
                     /db_xref="JGIDB:Thite2_2116742"
                     /translation="MAWGTQHTQTPPSPVKQLLPLIITLVILSVVAWVGYQIYLSMVK
                     IQAQARRQMGDNVVFTKAGVRVQVQDLGTESYVDKTQSWVVKAWNLGSASNAQDEATK
                     RKRHVITKSKPEGSHHHH"
     gene            complement(1413295..1414260)
                     /locus_tag="THITE_2116744"
                     /db_xref="GeneID:11518083"
     mRNA            complement(1413295..1414260)
                     /locus_tag="THITE_2116744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654036.1"
                     /db_xref="GeneID:11518083"
     CDS             complement(1413464..1414168)
                     /locus_tag="THITE_2116744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654084.1"
                     /db_xref="GeneID:11518083"
                     /db_xref="JGIDB:Thite2_2116744"
                     /translation="MGADWWIRDAVVDPIAAKCQHLGLLACELRAEANRLMTSATRTP
                     ENARLVQGVMRRAQKLDEQVAAWIRDVPAAWRFRTLCWQSHSLAVPDGGKDYSKAEVF
                     PGRVDVYNDFWLAAVWNLARTTRLITMSIAVRCAAWVCSPMDYRTTPEYATAARVCGE
                     TISDILASVPYHLGWHIKRKHLFADDGSAGFACGDESGMKGLAAYFLTWPLACVITQD
                     FATDARVFCPVIPSPP"
     gene            complement(1414262..1415337)
                     /locus_tag="THITE_2116746"
                     /db_xref="GeneID:11518084"
     mRNA            complement(1414262..1415337)
                     /locus_tag="THITE_2116746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654037.1"
                     /db_xref="GeneID:11518084"
     CDS             complement(1414328..1415290)
                     /locus_tag="THITE_2116746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654085.1"
                     /db_xref="GeneID:11518084"
                     /db_xref="InterPro:IPR001747"
                     /db_xref="JGIDB:Thite2_2116746"
                     /translation="MSKPLPSSASTSSTGTVSPSSSSSSSSSSSSSSPTVALPPAADS
                     HPKQQQQPPPPPYPQQQRHGDPLHSHCHQQQQQQQQQQRQQQQLQLLQPPLGPTPLHI
                     PPETLAPCHFVANFVLLPRQDGTRGFLDYLLPLLQQSGGVGDGNGGDGDAHLRHAFNA
                     CALASLANRISSSSFSSSSSSSASSSSFGPSGAGSAGGLSGAGGGAAAAAAAAAAAAA
                     GRGGGAGSTCLAKAYAEYSRALKATQAALVDPERWRSDGVLAAVLLLGMFEVSTPPLA
                     TFLFPKGLADALDRTSPPNRSAVWLGGRMSRARSSLSRPAGGAS"
     gene            complement(1416445..>1421184)
                     /locus_tag="THITE_2155027"
                     /db_xref="GeneID:11518085"
     mRNA            complement(join(1416445..1418208,1418262..1418404,
                     1418461..1418719,1418783..1418886,1418946..1419170,
                     1419224..1419295,1419348..1419469,1419533..1419998,
                     1420072..1420260,1420318..>1421184))
                     /locus_tag="THITE_2155027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654038.1"
                     /db_xref="GeneID:11518085"
     CDS             complement(join(1416771..1418208,1418262..1418404,
                     1418461..1418719,1418783..1418886,1418946..1419170,
                     1419224..1419295,1419348..1419469,1419533..1419998,
                     1420072..1420260,1420318..1421184))
                     /locus_tag="THITE_2155027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654086.1"
                     /db_xref="GeneID:11518085"
                     /db_xref="JGIDB:Thite2_2155027"
                     /translation="MPVNGVAGAAAAGDSGETILAKIHEALKVVHSPYSPNQARRDAE
                     DFLEGIKSLGEAPSHGFSLAFNKPQEPIVRHYGLSLLEHAVKHMWGDYSPEHRDYLRV
                     WVLQLAETVSADDPPYLRNKIAQLWVELAKRSWVASWMDMDCLLVRLWRVPNSPVHKL
                     FVLQILETLSDEIFYGDDVVVALREGALSKACVEIFTPAAVLTEAFPNRQAGPHVRFE
                     SEGWLSRVTQLVSECLGSGLEQNEDARTCAVKALNVLNSAVLWAIPKALNAVGCRAVM
                     CSCLAAPSVPVQKAALESLHSLYSRSNFTDQEFVDLVVPMYSPGMVELFRRLFEWSTV
                     DPQDLDEDKYQFCKKFSEMLCALGNYLDRKFAAIPPQTNIQGYLELLMLVVQSQSLVV
                     SIPILLTWTRLLSHRALGPAIADMPFIVNLLELCSNRLIRYESFPEDTEDPIYVLLVE
                     DTDTIPERHAFLGNYRRYCCAVIESLVQLRMSDAFSHLLGRAERALNTLYDGQPALNP
                     ADYSRNSVPVLTVDAHATVIEAALRGYDMWRTSCSRTPEEKQQAAAVEEYFEKWCGQL
                     LEMKFEDPLILKRILQLLVTFSTKALDSNPAFMLRVLEHILMTWPALQPEHRLFNDAI
                     RDLQTESMVELQRLALKMPDPLLDVYDQLEAKVQEMIASGTLDEKRQVAYQTFLFIII
                     HRATHIDPATRLSRLAAFIEPVKNLWKEESLKQALGSYSGFCELLGLDKVQKYVADRR
                     IHEIADWGATDLDAEGLALQNELEQRQAMLPLRVTKSFLTYSVEGIEKNSAPYQASCT
                     VWQDGLQLILPELLKFLSYAHASHNPANWSLLPVEMQPIVGRLFTDRFWQAGISEGSK
                     DDFYARLLGKRNTLEGLGSTIRGTVRFVRETCYTIIYCMSRLDMQFYGFLELPKPLAN
                     ALFADSFYLSSHQVINLLTLVRFLVDNCPVELHDHFVPPILATCFEQMDTKISSEWEE
                     LGQRETVQAAADELAEEMKAESILRQLTYSAVLMVADVLDPDRTGACTRHYLSVSFET
                     HADGLTASPTGQTDTAASNAKYPPLRKFCLMNPAVAVPLLVFCSHAIQMHDGRSCGAV
                     LRVFRSIVPEFAPSDLTKTLKNSGHTAPLEDFPIPEDTAREIREFISAEVLKAAISSL
                     HDPYFVDLQRDLGALIASILAYYSPLTPTPRNILVSLHSIKPEDVDRTIQQVSRSGLH
                     SRQQRALVLELLEDLKGVSISEMGKLPKSIGTAPGSSYGSKKSGRSKMVQEFMTPNAG
                     SRSGGAAVAGGSAARDKTPDLEGLAGMFSEAG"
     gene            complement(1421644..1423319)
                     /locus_tag="THITE_2116755"
                     /db_xref="GeneID:11518086"
     mRNA            complement(join(1421644..1422787,1422844..1423319))
                     /locus_tag="THITE_2116755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654039.1"
                     /db_xref="GeneID:11518086"
     CDS             complement(join(1421800..1422787,1422844..1423106))
                     /locus_tag="THITE_2116755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654087.1"
                     /db_xref="GeneID:11518086"
                     /db_xref="JGIDB:Thite2_2116755"
                     /translation="MDEEGKLVRSLRSEVLELPPSCVEFCPAFPSYFLVGTYDLQRQT
                     GEQEIADADADASSEDEAGRPAQLKQPQSRNGSIIAFRLCDGDITRIQTVPQPSALLD
                     LRFNPHSGNGDICAAVSSTATLALFRLSPEEEQPLKHLNTMDIAGMSQGEIKPSAGQE
                     ILFLSFSWHPLRANVLALTTSTGNVHLVHLRLFDGNWALNPEPILTHTLETWCVAISP
                     VLVASEPLNERQEACRSPFRVYSGGDDSMLRFKTCSWNEGAMVESVSGLASRGHDAGV
                     TAILPLALQEDGNELVVTGSYDEHIRLFEVPSSGKPKSLAEHRLGGGVWRLKLIDLNT
                     TANQSYIWRARMLASCMHAGVRVVELLKTMSGGYRFRVLGRFEEHQSMNYGSDFQPGW
                     MEKLSVVSTSFYDKLLCLWEFEMV"
     gene            1423325..1424947
                     /locus_tag="THITE_2116756"
                     /db_xref="GeneID:11518087"
     mRNA            join(1423325..1423857,1423915..1424655,1424714..1424772,
                     1424837..1424947)
                     /locus_tag="THITE_2116756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654040.1"
                     /db_xref="GeneID:11518087"
     CDS             join(1423833..1423857,1423915..1424655,1424714..1424772,
                     1424837..1424893)
                     /locus_tag="THITE_2116756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654088.1"
                     /db_xref="GeneID:11518087"
                     /db_xref="InterPro:IPR015034"
                     /db_xref="JGIDB:Thite2_2116756"
                     /translation="MDSESDFYGDEETVSVLEDRVANFDVVSWWDRHRPMASYIQQTA
                     RNLSAGPAPGCLYNKYEGEPGARQLSESVDDFLARLPPATTDWRPGLDWIFIANPYEP
                     PGPGAALDRFMAGGEERLQLLEAFENMVTASSAGGMAGRSLAKLQKDVAKERRAAVED
                     LRQLAVVCNVVLGKWMLFPEPGSVNSVWAKVARATANNELGVSAKVETRVDSQKARLI
                     CVYTRDFRDKDDVARVLNRLRQLELVSPGGKQIYYKSDAWTHLGIYGGNRWGIQASMY
                     SSNELFAYIRTLASRRP"
     gene            complement(1425147..1426265)
                     /locus_tag="THITE_2116758"
                     /db_xref="GeneID:11518088"
     mRNA            complement(join(1425147..1425287,1425411..1425851,
                     1425920..1426265))
                     /locus_tag="THITE_2116758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654041.1"
                     /db_xref="GeneID:11518088"
     CDS             complement(join(1425450..1425851,1425920..1426126))
                     /locus_tag="THITE_2116758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654089.1"
                     /db_xref="GeneID:11518088"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2116758"
                     /translation="MTACNPSAGDAESARAEYPGELKYIQYQHSLEAQYLPAIRALIS
                     KDLSEPYSIYVYRYFLCQWGHLCFMALHPTDSSLIGVVVCKLEMHSSHSPPTLRGYIA
                     MLAVSAPYRGYGVATALVKMAIDAMAQRGADEIVLETEETNIPAMRLYERLGFLRSKK
                     LHRYYLNGNSAYRLVLLLKSTDVDAATDLALDEDDVSPPLSR"
     gene            1426664..1429291
                     /locus_tag="THITE_2116760"
                     /db_xref="GeneID:11518089"
     mRNA            join(1426664..1427285,1427356..1429291)
                     /locus_tag="THITE_2116760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654042.1"
                     /db_xref="GeneID:11518089"
     CDS             join(1426968..1427285,1427356..1428924)
                     /locus_tag="THITE_2116760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654090.1"
                     /db_xref="GeneID:11518089"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="JGIDB:Thite2_2116760"
                     /translation="MASTLRRRVPAENKPSESYPPTDNGTDKAGGKADDTTKPLHHHR
                     PKTRKRKTTAIFLLGSLFGIIAAGFFAKSNDLIDFPEIGELSMDSLFDVLPAGLVKDM
                     RELVVGERAFLESYDAFSVGLQVRSEGLSAYHPIVMVPGVISTGLESWGTSNASRPYF
                     RKRLWGSWSMMRALVLDKETWKTHIMLDKKTGLDPPGIKLRAAQGFDATDFFITGYWI
                     WNKILENLASLGYDPINSYTAAYDWRLAYHNLETRDHYFTRLKSHIEMAVLLQNRKVV
                     LTSHSMGSQVVFYFFHWVTSKRGGGGGADWVERHIESWINVSGCMLGALKDVSALLSG
                     EMRDTAQLNAFAVYGLEKFLSKAERAEIFRAMPGMSSMLPIGGSAIWGDLDGAPDDQP
                     GQEHSYGSFLNFRVWQNWTTPDRNFTVDDAMRYLLDTAEDWYRDQVTRSYSWGVAQTT
                     AEVEANEDDPRKWINPLETRLPLAPSLKIYCFYGVGKPTERGYYYRSPEPGSPTHLNL
                     TIDTGFTQGMVDHGVVMGEGDGTVNLMSTGYMCNRGWKIKRYNPANVKITVVEMPHEP
                     ERFNPRGGPNTADHVDILGRQNLNEFILRIAAGRGDTIQDSIVSNIREYAARAKVYEE
                     GNDG"
     gene            1429584..1432062
                     /locus_tag="THITE_2116764"
                     /db_xref="GeneID:11518090"
     mRNA            join(1429584..1429932,1430008..1430540,1430602..1432062)
                     /locus_tag="THITE_2116764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654043.1"
                     /db_xref="GeneID:11518090"
     CDS             join(1429878..1429932,1430008..1430540,1430602..1431519)
                     /locus_tag="THITE_2116764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654091.1"
                     /db_xref="GeneID:11518090"
                     /db_xref="JGIDB:Thite2_2116764"
                     /translation="MTDSSGSWPAESERHFWDALSEILSATCTTPEQLDETLRSWLDL
                     VSGARDERLESEDDIARCSQMLIESQIFRNNSSYVRTQLIYGLLQEDELAKLHVYANF
                     LLLDGRTDEDTFRAMISEGCFVRLLELIKGCADQDARLHRLLLQLMYEMSRIEHLRAE
                     DLLQVDDNFVMYLFQLIEAVSDDASDPYHYPVIRVLLVLNEQYMVASTSAAVDPDSPT
                     APMTNRVVKILSVHGPSFRTFGENIILLLNRETETSLQLLILKLLYLLFTTSATYEYF
                     YTNDLRVLLDVIMRNLLDLPSEANVLRHTYLRVLAPLLAHTQLSQPPHYKKEQILSLL
                     EILRGSGSAHFKPPEPTTLRLLERVAKTPWLVDDEASSSDVSPVGSLSHSQTGSSVSV
                     VANVSEKPGVKTPSRKSEMGPESMGGQAASGGSPPRPKPPPPRNQRAQMCLPEVPKHR
                     HGAPIVPPAASTVHVNGNGQKKQPPKIPPPRRKAKLPAAAGVTAESTNPVS"
     gene            1432064..1433169
                     /locus_tag="THITE_2116766"
                     /db_xref="GeneID:11518091"
     mRNA            join(1432064..1432454,1432561..1433169)
                     /locus_tag="THITE_2116766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654044.1"
                     /db_xref="GeneID:11518091"
     CDS             join(1432311..1432454,1432561..1432956)
                     /locus_tag="THITE_2116766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654092.1"
                     /db_xref="GeneID:11518091"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="JGIDB:Thite2_2116766"
                     /translation="MAQPAVQAAKTAFRRFRELHGVVISAGLMDKTVKVRVGGQKWNN
                     WVKKFFDDPKTHLVHDPNNSLRLGDIVAITPGWRVSKSKRHVVKHIIAPGSGVPIEER
                     PPVPTEEERWAEREAERALKAKRRAAKKMAERVEAQLGRTELLLRKARKEFALRARLM
                     GLNLDPKQLEAGGAAQSQQ"
     gene            complement(1433170..1435869)
                     /locus_tag="THITE_2116768"
                     /db_xref="GeneID:11518092"
     mRNA            complement(1433170..1435869)
                     /locus_tag="THITE_2116768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654045.1"
                     /db_xref="GeneID:11518092"
     CDS             complement(1433383..1435851)
                     /locus_tag="THITE_2116768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654093.1"
                     /db_xref="GeneID:11518092"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Thite2_2116768"
                     /translation="MRCWKQALEQIDDHHANRVLPNFTPRSETEKALVDSLRRLELQC
                     KERIDLLEALRLSRQESAQNGAPPSESTTEKPIAESRDVELPGQKGRGWIGNGTIPAV
                     TYTELARPELPRRRSTNSRTPSSQKVVLGDSGSGVADGTMSSPSRKPFSLVPPQPSPE
                     TKTSSRASSPERHAMRTTLRASRLGEKLKKTTPRRSAPAATDGPGANQAAMLAWSSLQ
                     RRDSLDPGTLDGQELPRMSSSPPTPSEQSRRSLEALYTAWDSNSRRLTTPRTRSPVKE
                     SDKRVGADLAELRRTDGSRYAHPSPFSISAASSALSALTARDSIERLAPAGTHIAHQK
                     TASPQTPLMRKPRDPLDASAGFSQAGKSRRGGRHVSSDSAIASRSSASNTPSASRSKA
                     IPTRSRTSTSMTQARGSGKRETRPGVASSPADSDLSSSSLETPARSSRRRTGREGQSL
                     VADSLSDSSTADERTKAAKLWKKRKAAILEKLPAGVDPHAAKQILNEIIVQGDEVHWG
                     DIAGLEVAKNALRETVVYPFLRPDLFMGLREPARGMLLFGPPGTGKTMLARAVATESK
                     STFFSISASSLTSKYLGESEKLVRALFALAKVFAPSIIFVDEIDSLLSQRSGSGEHEA
                     TRRIKTEFLIQWSDLQRAAAGREIGEKDKERGDPNRVLVLAATNLPWAIDEAARRRFV
                     RRQYIPLPEAETRAVQLRTLLKQQKHTLSDADIETLVGMTEGEPLSLLSRSIDENLTL
                     FQGFRARILRHWPKMQPWDRFARSGRLCCTCLWMTYVLSNYRILLRAYPLLGRASAKL
                     ASSSMRSGQKSLENAADRVYLVGL"
     gene            complement(1436311..1438857)
                     /locus_tag="THITE_2116771"
                     /db_xref="GeneID:11518093"
     mRNA            complement(join(1436311..1438365,1438434..1438857))
                     /locus_tag="THITE_2116771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654046.1"
                     /db_xref="GeneID:11518093"
     CDS             complement(join(1436563..1438365,1438434..1438706))
                     /locus_tag="THITE_2116771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654094.1"
                     /db_xref="GeneID:11518093"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="JGIDB:Thite2_2116771"
                     /translation="MASSPGPPSPQDLTAATPSLAVKAGNPLSSKVTTVLSSSYADTE
                     FREALALLDERGTLNTAETRRQLRLDLQKEVLDRNGEIIDEFAKVAEQLRRIGSTLGR
                     LNDSFNEMKTQIGAAHEATASALTEASKLMTQRRQVEQKQALLNAFNATFVLSEDETA
                     ALTLTSEPVDEFFFATLAKEKRISKDCEILLGFENQTLGLEIMERTTRNLNLGFQKLY
                     KWVQKEFKTLNLENPQINSSVRRALRVLAERPSLFQNCLDFFAEAREQVLSNSFYTAL
                     TGSSPSGVERPSVKPIELVAHDSLRYVGDMLAWAHSAAVGEREALEGLFIGDGGEMAK
                     GIQAGRENEVWRLAAEEGEESNEFDAVKTLNELVDRDMSGAARMLRQRVEQVIQTNEE
                     TILAYKLANLLNFYKSTFAKLLSPASALVESLGLLEAEALRQFRSLARDHVAAIQGDL
                     QQMPADLRPPEFLIDALEQLTAIMRTYEASFTASAGSEEDFEPVLAEAFDPFISGAAN
                     MAGTLRSPSNSIFLINCLAAARSSLSQFGFTQRRAAILQAQIEDERSRLVEAQYRSLR
                     TESGLDGLIVSLEPLRENEEDVAKVRSLEAVQAPALARASQTLDDFLPSALMDAMEKL
                     RNLQDSRLAQEITEEAAERLCVDFEHVEEMLMLADEMAEQQHGESDDFQSLRALFPRT
                     SGEIRVLLS"
     gene            1439115..1442499
                     /locus_tag="THITE_2116774"
                     /db_xref="GeneID:11518094"
     mRNA            join(1439115..1439172,1439442..1440173,1440241..1440961,
                     1441027..1442499)
                     /locus_tag="THITE_2116774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654047.1"
                     /db_xref="GeneID:11518094"
     CDS             join(1439518..1440173,1440241..1440961,1441027..1442340)
                     /locus_tag="THITE_2116774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654095.1"
                     /db_xref="GeneID:11518094"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="JGIDB:Thite2_2116774"
                     /translation="MTSNVFSRLVPTSQGRSFYEELRRRDDDPEDRAGLLDEENLNHD
                     FHDYDLQHAEGLGVEDSRTTLGALPSPGRGPTEGRPHLGTRSTWVPQDDGDNEVPASL
                     LVETEEAAPRTTRGQSAGNKRQNQAAAIPGSSRARAQWEATQAQQKLHDDRAFEPSRR
                     GNGLPSSLFAGMVSGSAKKKAEWRWANVSNLDTFIKDVYDYYLGHGIWCILTERILHL
                     VNVAFLALLLTFLTQCVDYGKLRGSKRLSQILVPQCTRNMSGLWNLGLWMFAFYFIWK
                     SIQYLLDLRRLLNIRDFYLYLLNIPDEDMQTITWQEVVARIMALRDHNPKTAASLTPA
                     QRRWLGSQSKERLDASDIANRLMRRENYLIALFNKDLLNLTIPLPALRNRQLFSQTME
                     WMLMFTILDFVFDERGQVNQEFLRSERRGELSRKLRARFVFAGTLILILSPFVVGYLV
                     LVYFLMYYHEIQRNPAILASRTYTPLAEWKFREFNELPHLFRKRLDMSHPFASHYIDQ
                     FPKAKTEMFFRTVAFISGALSTILAIASVVDSELFLGFEITPDRTALFYTAVFGGVWA
                     FARANISAENSVFDPEYAMRNVIQYTHYEPDHWKDRLHSFDIKKEFSELYKLKMVIFL
                     EEMLSILTIPFVMFSSLPKCSDQIIDFFREFTIHVDGLGYVCSFAEFDFKKGFGNGRQ
                     RDGGDVRDDYYATKHGKMEASYYGFMDNYGNFALNPRTGPASRLPPGARNQFHPPPVW
                     PSINSALPTADLQASRMGREWLKGATSNSKTLRYGPALSQPSPMASILLDPHHQPPSQ
                     NPAGRATHAPRHRGLYQGKSNTIEETQEDDGEVSDAGRRQADEEAYESGAALDESAWQ
                     TSPAATLSRDNSATEGRGPPDAGVVHMIYQFNQAQLHRRP"
     gene            1443892..1446448
                     /locus_tag="THITE_2155033"
                     /db_xref="GeneID:11518095"
     mRNA            join(1443892..1444168,1444253..1444335,1444420..1444442,
                     1444532..1444664,1444729..1444878,1444941..1445412,
                     1445476..1445546,1445606..1446448)
                     /locus_tag="THITE_2155033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654048.1"
                     /db_xref="GeneID:11518095"
     CDS             join(1444131..1444168,1444253..1444335,1444420..1444442,
                     1444532..1444664,1444729..1444878,1444941..1445412,
                     1445476..1445509)
                     /locus_tag="THITE_2155033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654096.1"
                     /db_xref="GeneID:11518095"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2155033"
                     /translation="MAQPNAEPVEDYDYESLPPNFSLLQNMAAGALAGIAEHCAMYPI
                     DAIKTRMQIVNPSSTTVGSGVLQATYRMASTEGILSLWRGMSSVIVGAGPAHAVYFAT
                     YEAVKHVMGGNRAGAHHPLAAATSGACATIASDALMNPFDVIKQRMQIQNSAKMYRSM
                     FDCAKYVYRKEGIAAFYVSYPTTLSMTVPFTALQFLAYESISTAMNPTKKYDPLTHCL
                     AGAVAGGFAAGLTTPMDVIKTMLQTRGNAADAELRTVNGFMAGCRLLYQREGARGFFK
                     GVRPRVLTTMPSTAICWSAYEASKAYFIHQNNLS"
     gene            complement(1446555..1448653)
                     /locus_tag="THITE_2116781"
                     /db_xref="GeneID:11518096"
     mRNA            complement(join(1446555..1447265,1447323..1448653))
                     /locus_tag="THITE_2116781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654049.1"
                     /db_xref="GeneID:11518096"
     CDS             complement(join(1446690..1447265,1447323..1448303))
                     /locus_tag="THITE_2116781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654097.1"
                     /db_xref="GeneID:11518096"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Thite2_2116781"
                     /translation="MLVRLSTLAFAAGILSTPSLVTALSPSDIPPDTPVSKLLASAQS
                     HLSKGETGDALVYYDVAIARDPTNYLTFFKRATTYLSLGRTSQATDDFEKVLSLKPGF
                     EGAHVQLGKLKARAGDWDGAKEHYQKAKKTEELASLEEAKGAARLAEAAAQAENWEEC
                     IKQADDAILTANRALSLRELRARCLFERGAVERGIGDLQHILQMKPGDTSPHVKISAI
                     QFYVLGQLQEGLASIRKCLHSDPESKECKRFLKVGKLVEKGVQKAAKALEKNQHMTAV
                     RSLVPTADGEGLIKEVKDEVKVLRADGTIPKSAGNALVARLVGMACHAYYESNSKKAK
                     EYCEEALQEDENSFYGLLYRAKHLMDADEFEASINTLRKAAEAHPGKDDIINPLMQKA
                     QVALKRSKTKDYYKVLGVSHDADERQIKAAYRKLSKLHHPDKAVKQGLTKEEAEKKMA
                     AINEAYEVLSNPELRARFDRGDDPNSNEQPQFHGNPFGHGHPFMFQQGGGGGPQFQFK
                     FGGSGFPFGM"
     gene            1448908..1449928
                     /locus_tag="THITE_2116786"
                     /db_xref="GeneID:11518097"
     mRNA            join(1448908..1449082,1449160..1449311,1449395..1449928)
                     /locus_tag="THITE_2116786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654050.1"
                     /db_xref="GeneID:11518097"
     CDS             join(1449025..1449082,1449160..1449311,1449395..1449790)
                     /locus_tag="THITE_2116786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654098.1"
                     /db_xref="GeneID:11518097"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="JGIDB:Thite2_2116786"
                     /translation="MSSRGAPRGRGGGGFGGRGGRGGFQQRDMGPPATVLEMGKFIHA
                     CEGEMVVESTNPKIPHFNAPIYLENKTAIGKVDEVLGPINQVYFTIKPSEGIQATSFK
                     YGDKFYIAGEKLLPLEKFLPKPKPPPGTVTKVKKPSRGGGSRGGRGGAGGGFSRGGRG
                     GGRGGSGASRGGGGRGGGRGGAPRGGRGGFSRGGRGGGRGR"
     gene            complement(1451557..1453595)
                     /locus_tag="THITE_2116791"
                     /db_xref="GeneID:11518176"
     mRNA            complement(join(1451557..1452108,1452169..1452656,
                     1452722..1453291,1453354..1453595))
                     /locus_tag="THITE_2116791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654051.1"
                     /db_xref="GeneID:11518176"
     CDS             complement(join(1451719..1452108,1452169..1452656,
                     1452722..1453247))
                     /locus_tag="THITE_2116791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654099.1"
                     /db_xref="GeneID:11518176"
                     /db_xref="JGIDB:Thite2_2116791"
                     /translation="MSTANVAVDAAPQANGHDQATYLSHEQHPNIHDADALSRPTAHS
                     QSDYGNHLIAPTATRPARFTEEWDASQRGSSIAEGPGPSTMQRPTSYSGRASGLTGDG
                     AASMSRGNTLRKKPSLRRSASLKRTGSRRSMMAGSVRSLVLQSATDQDEMHSAFYCPV
                     PTTSNPTEILANRFQAWRKILKDLITYFREVQTHHEHRAKSFLKLANVLNNTTAPPGF
                     LASGGLDDALQVLRSYNRQAIAEANKSREIEEDVILALTGLRSDLHQKIKEIKNLSGD
                     FKNSVEKEMESTRRAVNQLQEVLGQSELDPALATGKQDPYLMRLAVDRQLERQIDEEN
                     YLHQAYLNLENSGRELESIVVGEIQKAYNAYAGILKRESDAAYNAIEELRIGPLSMPK
                     DREWTAFIQRDDRFVDPDLPMRSAESIHYPGRDHYACQEIRAGLLERKSKYLKSYTPG
                     WQVLPHSAIMLRGAQVF"
     gene            complement(<1454186..>1455770)
                     /locus_tag="THITE_2129606"
                     /db_xref="GeneID:11518177"
     mRNA            complement(join(<1454186..1454214,1454399..1454933,
                     1455004..1455464,1455521..>1455770))
                     /locus_tag="THITE_2129606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654052.1"
                     /db_xref="GeneID:11518177"
     CDS             complement(join(1454186..1454214,1454399..1454933,
                     1455004..1455464,1455521..1455770))
                     /locus_tag="THITE_2129606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654100.1"
                     /db_xref="GeneID:11518177"
                     /db_xref="JGIDB:Thite2_2129606"
                     /translation="MALQWFLFLLAAALAQAQGDNKTPTLDPAVIQSGSFVDGSTSIG
                     ANEANQSPSLTSQNNFINFCKGKTLTNGLQITTGSCNGIVMGDLPAQNRMVSVVITKP
                     LNGDTIESGKDFNITLQVQNLVAGAFTNADATYYSAPQQLKGGSIVGHVHVTVQNTGP
                     TLNPTQPLDPTQFAFFKGINDAGDGRGGLSAAVVGGLPAGNYRLCTLTAAANHQPVIM
                     PVAQRGSQDDCVRFTVTGNLSNSAQAPPTRPATQRTITPPTPVLLVLLVLLALPVQPV
                     QPVPPVQPVQLVLLVLPVLLVLPVPPVLPVQLVQLVQLVLLVQRVQLVQLVPPVQPVQ
                     PVPPVLPVQLVLLVLPVLLVLPVLLVLPVPPVLPVLALPPVLALLRVPTVPGMAKAKR
                     RLLRQQEKGEEVLSGLLDSLEGAISPAAKPTY"
     gene            1458006..1460155
                     /locus_tag="THITE_2116796"
                     /db_xref="GeneID:11518178"
     mRNA            join(1458006..1459059,1459136..1459648,1459979..1460155)
                     /locus_tag="THITE_2116796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654053.1"
                     /db_xref="GeneID:11518178"
     CDS             join(1458784..1459059,1459136..1459612)
                     /locus_tag="THITE_2116796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654101.1"
                     /db_xref="GeneID:11518178"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="JGIDB:Thite2_2116796"
                     /translation="MAGTQSLPPPALPQLVAEQHTPIPPTDKDTKRLIVVLSNASLET
                     YKASHSSAGRMGVQREEKYSLLNSDEHIGVMRKMNRDISDARPDITHQCLLTLLDSPI
                     NKAGKLQIYIQTAKGVLIEVSPTVRIPRTFKRFAGLMVQLLHRLSIKGTNSQEKLLKV
                     IQNPITDHLPPNCRKITLSFDAPLVRVRDYIDTLGPNESICVFVGAMAKGPDNFADAY
                     VDEKIAISNYSLSASVACSKFCHAAEDAWDII"
     gene            1461585..1463953
                     /locus_tag="THITE_2116797"
                     /db_xref="GeneID:11518179"
     mRNA            1461585..1463953
                     /locus_tag="THITE_2116797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654054.1"
                     /db_xref="GeneID:11518179"
     CDS             1461937..1463646
                     /locus_tag="THITE_2116797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654102.1"
                     /db_xref="GeneID:11518179"
                     /db_xref="JGIDB:Thite2_2116797"
                     /translation="MLPFLEVEHLPSSSSFYSAIIQPLGLRYLSTEDRHFPSITYGDP
                     SRSAPVFQIRQVVSSRDRPLRTSRIVLSAPSPAAADDAYEFALRANPDVSRDAHPRHF
                     SDGFAAASGASARRTATSGGETRVLITDFDGNLMEIVYQPPADYPSNYRGSTVRYTRS
                     TTDEASRILDWNYDVAFSSRPSPAGPGSASGASPRTVSRRPYSRYSEDGDEPKPGLRR
                     SVTAGSSVYEPATSARENSNGLSAGAVVGTLLGVAAGAALGGAFTYNVFKSEKSRAPR
                     EEADMSSFARRSTFPSKYDGYSGRKTRYVDVEREVEKVWYQSDYPAPSDYRRPPPEYI
                     ARYSIVDAPRSRDADDRYDDARGRQPFSRSRASSARPRSESASYREPYGGGEAEHRSY
                     ASSRSSRHPPIVQRSYTYDSPDRDTYVSARSRRSSSTVRAPPPPPAADPFAPLPHVSS
                     HSRSASRVITTTTTTTTIKGGGSPRVYSREGSYISARNVPLPESRAPTYISARDVPLP
                     PSRPSTYVSARHVPLPDSRVGSSHARWDDAVGDDVDDDADSIAPSDSISCVGSRRSGR
                     SRY"
     gene            1464863..1467376
                     /locus_tag="THITE_2116799"
                     /db_xref="GeneID:11518180"
     mRNA            join(1464863..1464922,1465008..1465070,1465216..1465287,
                     1465379..1465473,1465535..1467376)
                     /locus_tag="THITE_2116799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654055.1"
                     /db_xref="GeneID:11518180"
     CDS             join(1465240..1465287,1465379..1465473,1465535..1467218)
                     /locus_tag="THITE_2116799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654103.1"
                     /db_xref="GeneID:11518180"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="JGIDB:Thite2_2116799"
                     /translation="MPNFNLGESIPPHTAHAVSFSLPTWRSNIGYEEGEDWVIGRMET
                     GYPRFFIHRSIQAFAADIVAKFGTQGSKAFLFPTRQIAARCLSFVKARAPPAAAASLQ
                     TVHLVLDTTKATPDALLSLAPTICAVLGSQEAFPFLKQYWQHTGDGVSSRRAEFCHAL
                     FKDGLLRLDDGTTTPAPASPKPCKGPKRYQRPSSLDVTRATPSPKPSPDRDSGAGPDI
                     QETFRFLEERFGRNLDVSLVQPAKSAIRRRIAGALRSDSEPTAAPPPEHEMESNSRGV
                     VNLKEDDVYLFPCGMSAIFHSHRALLAARGSLKSVNFGFPYVDTLKILQKFGPGAVFY
                     GRTSESDLDAFEQRLEAGERFLALFCEFPGNPLLTCPNLGRIRQLADKYDFAVVVDET
                     IGTFANVNVLPYADIVVSSLTKIFSGDCNVMGGSAIFNPNGRYYAALKRWARTEYEDT
                     YWPEDVMFMERNSRDFASRIDRINANAEAICEVLRSSPLVKDVFYPKYNETRANYEAC
                     KLPGGGYGGLLSVVFHRPQQAVAFYDAIDTAKGPSLGTNFTLTSPYVLLAHYQELDWA
                     KSFGVEPHLIRISVGLEETDKIVDVFEAALKAAAEEGAKSQE"
     gene            complement(1467304..1469082)
                     /locus_tag="THITE_2116809"
                     /db_xref="GeneID:11518181"
     mRNA            complement(join(1467304..1467540,1467610..1467747,
                     1467862..1468023,1468083..1469082))
                     /locus_tag="THITE_2116809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654056.1"
                     /db_xref="GeneID:11518181"
     CDS             complement(join(1467389..1467540,1467610..1467747,
                     1467862..1468023,1468083..1468923))
                     /locus_tag="THITE_2116809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654104.1"
                     /db_xref="GeneID:11518181"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="JGIDB:Thite2_2116809"
                     /translation="MKFGRAFQEALAADTYPQHWVEKAVPYRQLKKLLGKVREELIKA
                     GYDPDTLHRLLADHNAEYRLETDASHLLRPKLVVRPALGGPSPEPATEEPGSQAELAS
                     LASDGDDANLLGSSHEHDGAGDHDDWVKIPLASDARFFSLLQSDVTELDTLQDEERHS
                     MISKIHDLGAEIAEVAKPRKGVIKLSKSDLYRWREIFELYLAAQVFFSTTEASGGLRD
                     SEKARKQLVWFQDEVNKRQLPRKFKIESSAVAYSHFLALNATLLQNLQFQELNQTAVA
                     KIIKKFDKRTSLGVKTTFPKAMYSAHFISEAISKDICAQLAREVVNRVPQVVDYTCSI
                     CFSICWLPVRLDCDHLFCIRCMIKMQNQNKRYCPLCRADVVQRANETHIDEKLVRYLE
                     QWFPKETKEKQAYNEIERRKELLGDVYVSENPPHCLVM"
     gene            1469706..1471813
                     /locus_tag="THITE_2116813"
                     /db_xref="GeneID:11518182"
     mRNA            join(1469706..1469981,1470044..1471442,1471514..1471813)
                     /locus_tag="THITE_2116813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654057.1"
                     /db_xref="GeneID:11518182"
     CDS             join(1469872..1469981,1470044..1471442,1471514..1471645)
                     /locus_tag="THITE_2116813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654105.1"
                     /db_xref="GeneID:11518182"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2116813"
                     /translation="MGAEQSAPRGGGTQAAVARKTCYYELLGVDRDASDEEIRRAYKK
                     KALELHPDRNLNDTENATRRFAEVQTAYEILSDPQERAWYDSHRDAILSGEDNVADAG
                     PADRSGSGHTSANAIFALMSRFNSSVPMDDSQRGFFGILNAFFDQLAAEETAACERAG
                     LAPTEYPPFGQAKDDYNAVAKPFYNVWSSFSTKKTFSWRDKYRLQDAPDRQIRRLMQK
                     ENQKFRDEGIREFNDAVRSLVAFVKKRDPRYVPSKQSEAERQQALRNSTAAQAARSRA
                     ANQEKLADYVLPEWAQSRDKEDYDGEFSESEEEDEVEEIECVVCNKTFKSENQFEAHE
                     KSKKHLKAVQQLQRQMKKENAFLDLEESVPDSSPSAATRDGPGGEEDGTAEDETAARQ
                     KQRDVEERESEPLASGDDITDQGTPSQSDTEDDDYAPRSAVEERILNGMRKGTASPNA
                     ESSTSDIMGSVAASLDGVTLVDEKETEKKVGKAKLKREKKAARAAAEAQASASHKCAV
                     CQETFASRTKLFAHIKANPEHAAPVPVSNAKIGKKKRR"
     gene            complement(1471812..1474077)
                     /locus_tag="THITE_2116815"
                     /db_xref="GeneID:11518183"
     mRNA            complement(join(1471812..1472389,1472471..1472695,
                     1472792..1472960,1473018..1474077))
                     /locus_tag="THITE_2116815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654058.1"
                     /db_xref="GeneID:11518183"
     CDS             complement(join(1471999..1472389,1472471..1472695,
                     1472792..1472960,1473018..1473597))
                     /locus_tag="THITE_2116815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654106.1"
                     /db_xref="GeneID:11518183"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="JGIDB:Thite2_2116815"
                     /translation="MEVAIAAGAEVGRVGRRIFQRIWDPTPVNQRDLDQPVWCLGRSY
                     TLGAKPSGIPPPFAASTPPADSNIDNAAPGTKAATPPGTQQVLDTPPDSVASSFDSSL
                     VYEEDSDPDGGWPPAFLDDFESRIWMTYRTGFELIPRSTDPRANSALSFAMRLKTSFG
                     DQTGFSSDTGWGCMIRSGQSLLANALQISRLGRDWRRATDPDAEREILSLFADDPRAP
                     YSLHNFVKHGAAACGKYPGEWFGPSATARCIEALANQHESSLRVYSTGDLPDVYEDSF
                     MAVANPDGEHFHPTLILVCTRLGIDKINQVYEEALISTLQMEQSIGIAGGRPSSSHYF
                     VGVQGQWLFYLDPHHPRPALPYREAPEDYTSEELGSCHTRRLRHLHVEDMDPSMLIGF
                     LIKDEDDWDTWKSAVKHVQGKSIITVSPHDPARGAGSGRAEAIDEVETLSDDDDDADT
                     VLEA"
     gene            1474087..1476893
                     /locus_tag="THITE_2116818"
                     /db_xref="GeneID:11518184"
     mRNA            join(1474087..1474603,1474664..1476194,1476249..1476893)
                     /locus_tag="THITE_2116818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654059.1"
                     /db_xref="GeneID:11518184"
     CDS             join(1474477..1474603,1474664..1476194,1476249..1476720)
                     /locus_tag="THITE_2116818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654107.1"
                     /db_xref="GeneID:11518184"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="JGIDB:Thite2_2116818"
                     /translation="MPPKWDKRPPSGRKAPRGRPTPSRGRIRQSIPSTPTMAAASHGF
                     SMKDEARNTASHQYSLDWGSGDAKLRQKPVTFVSAGVVEPLKEQKPSSHVSESETADK
                     RAEDAVEVTGDSARMEAAEIQEMEIIDDREGETIIEGPRQETPMIKGASTEQFVVGAN
                     ESEDAQESEKKELFFFDLGEGESVLDTGLPPPRIPSPKSSLDGSDSSEEVILFKGRFA
                     GAPGASDRTEECRPKECRPSASATASVTPLKREAEALAGPSNSESRSITRPTRPLRKR
                     SRSRRGFRQTRRAMEDSDEDAILADYIANMTTNSDDDPLASHLRSLSGYRDLGGDDEA
                     VNFGFDDGKSPGRNDSSDDERSSAPGYDIGNSEMDDSEMDDSVNGDDDQEMDAAVDDE
                     TLARLLAKQEELGLGGDDLLLFTSSFAQRETTKSRGKHTASASSSRAPARHASAARVA
                     DALDDLDLANWSQLTGQSRKRRSKRPPNFNVSDSKIEAALQAAWQRDRERKKIRKLER
                     EALRAGGLLGKNMDSNDLRVKYPSGMKLDDIKAELTSFLLGSVERLDFPPLDKHARMV
                     LHEIANKLNIKSKSTGQGNQRRPVLYRTNRTFKYASTRIEDAASHVDKAATRVHRKYF
                     HRVDVKVQRTESPRSAGGRTSHKALTLREGEVVGASVPELGQDNKGRAMLEKMGWSKG
                     MALGALDNKGILEPVAQVMKRSKAGLG"
     gene            complement(1476934..1477869)
                     /locus_tag="THITE_136564"
                     /db_xref="GeneID:11518185"
     mRNA            complement(join(1476934..1477359,1477413..1477484,
                     1477596..1477869))
                     /locus_tag="THITE_136564"
                     /product="histone H2B-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003654060.1"
                     /db_xref="GeneID:11518185"
     CDS             complement(join(1477181..1477359,1477413..1477484,
                     1477596..1477758))
                     /locus_tag="THITE_136564"
                     /codon_start=1
                     /product="histone H2B-like protein"
                     /protein_id="XP_003654108.1"
                     /db_xref="GeneID:11518185"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Thite2_136564"
                     /translation="MPPKAADKKPATKAPATASKAPEKKDAGKKTAPSGDKKKRTKAR
                     KETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISS
                     REIQTSVRLILPGELAKHAVSEGTKAVTKYSSSTK"
     gene            1479736..1480662
                     /locus_tag="THITE_128218"
                     /db_xref="GeneID:11518186"
     mRNA            join(1479736..1479961,1480096..1480388,1480441..1480662)
                     /locus_tag="THITE_128218"
                     /product="histone H2A-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003654061.1"
                     /db_xref="GeneID:11518186"
     CDS             join(1479906..1479961,1480096..1480388,1480441..1480496)
                     /locus_tag="THITE_128218"
                     /codon_start=1
                     /product="histone H2A-like protein"
                     /protein_id="XP_003654109.1"
                     /db_xref="GeneID:11518186"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Thite2_128218"
                     /translation="MTGGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQ
                     RVGAGAPVYLAAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGH
                     VTIAQGGVLPNIHQNLLPKKTGKTGKNLSQEL"
     gene            complement(<1480925..>1481472)
                     /locus_tag="THITE_2051591"
                     /db_xref="GeneID:11518187"
     mRNA            complement(join(<1480925..1480947,1481008..1481049,
                     1481106..1481184,1481260..1481392,1481450..>1481472))
                     /locus_tag="THITE_2051591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654062.1"
                     /db_xref="GeneID:11518187"
     CDS             complement(join(1480925..1480947,1481008..1481049,
                     1481106..1481184,1481260..1481392,1481450..1481472))
                     /locus_tag="THITE_2051591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654110.1"
                     /db_xref="GeneID:11518187"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="JGIDB:Thite2_2051591"
                     /translation="MSSRQAALSLYRRSLKLALDWTVHRNLWRGQALYIRSLFEKNRD
                     VTDPRLQRALLKETEKLLEKWKHPDPYCHPTAPGGSKYERNLPAPILDPPPPLKF"
     gene            1482196..1484387
                     /locus_tag="THITE_128217"
                     /db_xref="GeneID:11518188"
     mRNA            join(1482196..1482637,1482703..1483062,1483118..1483510,
                     1483578..1484387)
                     /locus_tag="THITE_128217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654063.1"
                     /db_xref="GeneID:11518188"
     CDS             join(1482395..1482637,1482703..1483062,1483118..1483510,
                     1483578..1483874)
                     /locus_tag="THITE_128217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654111.1"
                     /db_xref="GeneID:11518188"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="JGIDB:Thite2_128217"
                     /translation="MLYRGLRFAARAAPRLSLYNTSSALRQLPVQFQHVRTYADKVIK
                     VPAMAESISEGTLKQWNKAVGDFVEQDEEIATIETDKIDVAVNAPEAGIIKEFFVNEE
                     DTVTVGQDLVRIELGGAPSGERPAAEEAKEAPKEPTPQTQPEQRTTQEPKPQETKPQE
                     TKPASQPTPVVEEAPSPKQPSKPAKAAPEAPATLGSREERRVKMNRMRLRIAERLKQS
                     QNTAASLTTFNEVDMSALMEFRNKYKDEVLKKTGVKLGFMSAFSRACVLAMRDLPIVN
                     ASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESMDMIGIEKAIADMGKKAR
                     DGKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKERPVAVNGKVEIR
                     PMMYLALTYDHRLLDGREAVQFLIKVKEYIEDPRKMLL"
     gene            complement(<1485908..>1487051)
                     /locus_tag="THITE_2051579"
                     /db_xref="GeneID:11518189"
     mRNA            complement(join(<1485908..1486120,1486206..1486416,
                     1486504..1486592,1486650..>1487051))
                     /locus_tag="THITE_2051579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654064.1"
                     /db_xref="GeneID:11518189"
     CDS             complement(join(1485908..1486120,1486206..1486416,
                     1486504..1486592,1486650..1487051))
                     /locus_tag="THITE_2051579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654112.1"
                     /db_xref="GeneID:11518189"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Thite2_2051579"
                     /translation="MAARKINLRVITLYSLAVLTASFVVPMDHPFINGQATSVSARSV
                     FIIAVVEAGMPKLAHFFNAVFTFSAFTCGVNSMYVATRVLHTLALRGQTGPEFITRRL
                     RACRSGVPVRAVLATGALMMVAYMGRSGAPGTRLDELANNCTVSCLLVYATICVTYLC
                     FFRTLEDAKQYGNTSESQAASYDRNHPLYPYKSHGQWLKGCYGLVACIILMLFNGVAA
                     FIKPFNIHKFVAAYISLPIFLILILGYNIRKHRLRFSDWWSDKSGDLSNTVQATSLKR
                     RGRLEFPDSGVTRENLLTFLEWVWVWLK"
     gene            complement(<1487173..>1487681)
                     /locus_tag="THITE_2049540"
                     /db_xref="GeneID:11518190"
     mRNA            complement(join(<1487173..1487360,1487420..1487461,
                     1487518..1487545,1487613..>1487681))
                     /locus_tag="THITE_2049540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654065.1"
                     /db_xref="GeneID:11518190"
     CDS             complement(join(1487173..1487360,1487420..1487461,
                     1487518..1487545,1487613..>1487681))
                     /locus_tag="THITE_2049540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654113.1"
                     /db_xref="GeneID:11518190"
                     /db_xref="JGIDB:Thite2_2049540"
                     /translation="QVFGELEYIFGCFKLMFITLLIVLMFFLSIIQPRSDAYYSEPLG
                     TRYWNTPYSFFNPTYIAKDEDLRVQQVFTGSLGTLLGVWCVHCRKSWWPSLSSLVADL
                     IRPPDN"
     gene            complement(<1487723..>1488279)
                     /locus_tag="THITE_2051761"
                     /db_xref="GeneID:11518191"
     mRNA            complement(join(<1487723..1487948,1488005..1488131,
                     1488198..>1488279))
                     /locus_tag="THITE_2051761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654066.1"
                     /db_xref="GeneID:11518191"
     CDS             complement(join(1487723..1487948,1488005..1488131,
                     1488198..>1488279))
                     /locus_tag="THITE_2051761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654114.1"
                     /db_xref="GeneID:11518191"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Thite2_2051761"
                     /translation="GLFLGCGSSLASAGPGGAVVAYVLMGTIISSVISCLGEMTALMP
                     VNAPVMEFPRRFVSRGVGFAVGWIYWFAYAVLAGEQLVAVSNAIKFRYDDGKTFLQWE
                     VGERVDNAVWISVFLVLVVIFNMFPVRVCVHRLWTLGNIDDR"
     gene            <1490622..>1494322
                     /locus_tag="THITE_2050653"
                     /db_xref="GeneID:11518192"
     mRNA            join(<1490622..1491257,1491417..1491998,1492079..1493068,
                     1493240..1494058,1494149..>1494322)
                     /locus_tag="THITE_2050653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654067.1"
                     /db_xref="GeneID:11518192"
     CDS             join(1490622..1491257,1491417..1491998,1492079..1493068,
                     1493240..1494058,1494149..1494322)
                     /locus_tag="THITE_2050653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654115.1"
                     /db_xref="GeneID:11518192"
                     /db_xref="JGIDB:Thite2_2050653"
                     /translation="MAAATPSALFQRLANAWRLLALRSDVDDIVLELLGRFSLERIYA
                     SASDRVAYQHLVIALLSQLKTIFDIQRLTIPSENAPLGRHLGFLVSWEVGLRSVEFVL
                     QTIAEGRESLWEHRKLRDKYLAEFLLSALRVLSVHPKTPSNQRARDRRERFARIHGAL
                     EQVFDSYPGPKSFSLEVCKEVAAQLHADPDVLMLPPKLRSELPNLASELVRDYPLPPC
                     LQPPSIAELAPPGGFGNWLAQLLALRDVAQFVLAASVQYAANGETRDVRLQAASAKAR
                     NAVLTALDNLRTPPGTSKVDMVAIFSTTFRTILPDTIDLSSRDVSEPPVDECELDALD
                     ALCTRLRERQVTHRVSDREAAHSISQVIENILAQDDPGGRHTPARPGLYVVNCPRCHL
                     AGASQLRSSGAKFPPASADASEIRLPPDSKCAYCKETITLAREVSVARRTWELVRPLL
                     PDADTINVERHLPTQFQLGPPKPEAHGLPSPGYSSIRVPGSERHREPELPGPPHSAKA
                     GMPSPTFGEMHPPGYPGLVSPQSPSMQPSSIHPQVELPRPGAPVNHGRNVLDEPEHTL
                     AHPDPTFLSDPPPFSRESPAVRGQAGEDEAPSIHTPRTVPIPASAEKGKSRWRFMFTG
                     SKKAPTGASGDSSSLSSSALEAQKLEEISLSALLSTPKTHARGKPSKNINVCLSQNST
                     LALFWTQLLIHVLDVSTSPPTMVRAILPESTCILAAVGKSHLAYIIGTRDHKLTLRIV
                     NLMQTTTTASVMEYRIPSPLWCKSMAIDKQENYVVVGFEDATVRFFNVRSMEQPREDR
                     LHAATRHGCRTCPPVDTLAFSSDGLVLLASMRSPKTGWIQTYSWRFPFHTFQELTACR
                     YQVPLHESEDNGVSAAIFRPGTHGEEDLVCITTWTQSGTPVLIQPHDGHRAEIRTELS
                     GRHSKLGNRVQCAAFSPSGRELVLVNDKGHVFQVSNLNSSPMDVRRIANTKELTAKSD
                     SFAMSFMTWSDEEHVVLAWADSSRAVGWVRKIPMMSRNHFASVDTPGLIYETSSLGGT
                     RELLDQPRPPIELAATERTLTVGDGYEASKKLLGEL"
     gene            complement(<1495508..>1497436)
                     /locus_tag="THITE_2050573"
                     /db_xref="GeneID:11518193"
     mRNA            complement(join(<1495508..1496278,1496336..1496678,
                     1496753..1496920,1496957..1497127,1497180..1497198,
                     1497259..>1497436))
                     /locus_tag="THITE_2050573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654068.1"
                     /db_xref="GeneID:11518193"
     CDS             complement(join(1495508..1496278,1496336..1496678,
                     1496753..1496920,1496957..1497127,1497180..1497198,
                     1497259..1497436))
                     /locus_tag="THITE_2050573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654116.1"
                     /db_xref="GeneID:11518193"
                     /db_xref="JGIDB:Thite2_2050573"
                     /translation="MRNQPIYANRHMRVVCIGAGASGLYMAYKLKHYFTDFTLNIYEK
                     NPQISGTWFENRYPGCACDVPAHNYTYSFEPKWDWSANYASSREIYTYFNDFADKYGL
                     REHIHCEHEVVGARWDEDNTELQQRCDFLINASGILNNWRWPAIPGLHSFKGELLHSA
                     AWDDTVQLAGKRVGLIGNGSSGVQILPEIQPVAAHLTTFIREPTWVCPTRGMEYHKYT
                     DEEKQRFRDEPGVLLNVRKKKEETLARFFSVFVTGSAAQTMAVDYMREQMKQKIGDAE
                     LAQKLIPNFSIGCRRLTPGPNYLESLTLPNVTVVHGEIKEITPDACITEDGRTWPLDV
                     LICATGFDTTFQPRFPVIGRGGKSLAAEWASEPRSYMGLAAHGFPNYFMFLGPNCPIA
                     NGPIIFAIELQGEYFARFLNRWQKEGLASIDPRREAVDDFMAQKDAFMESSVWASGCQ
                     SWYKDRKTGKVTALWPGSTPHYMEALASPRYDDFEIKYHGNRFAYLGNGFSQTELNPD
                     LDVTYYIREKDGGEPLFRSLQSTFNAKSLGDLLQAPPDLAI"
     gene            <1565946..>1566242
                     /locus_tag="THITE_2051656"
                     /db_xref="GeneID:11518194"
     mRNA            <1565946..>1566242
                     /locus_tag="THITE_2051656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654069.1"
                     /db_xref="GeneID:11518194"
     CDS             <1565946..1566242
                     /locus_tag="THITE_2051656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654117.1"
                     /db_xref="GeneID:11518194"
                     /db_xref="JGIDB:Thite2_2051656"
                     /translation="IFIDDIIIFSDTIDKYTKHLETIFSFFKKKNISITLAKSYIVYP
                     SVELLNFYVNRFRLTNIEHYIAAFRNLAFPNNLKAVEQYISVLEFLCHLILYYT"
     gene            complement(1574723..1577187)
                     /locus_tag="THITE_2116840"
                     /db_xref="GeneID:11518195"
     mRNA            complement(join(1574723..1576480,1576659..1577187))
                     /locus_tag="THITE_2116840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654070.1"
                     /db_xref="GeneID:11518195"
     CDS             complement(join(1574948..1576480,1576659..1576925))
                     /locus_tag="THITE_2116840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654118.1"
                     /db_xref="GeneID:11518195"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Thite2_2116840"
                     /translation="MASPETNGPGQANVLDGNSSPNGAVSPSQAQSQGPSESETDGLR
                     ARTPSLSSFALTEYSAKPSLPTEDRKTHMKKIVPDEFLLPNGNPDYLRLIITSYPRVR
                     EVCNEIPLQHAVNLSNRLECRVLLKREDEQPVFSFKLRGAYNKMAHLDPAESWRGVVC
                     CSAGNHAQGVAYSARKLKIPATIVMPKGTPSIKHLNVSRLGGHVVLHGADFDEAKEEC
                     SRREKQDGLINIPPFDDPYVIAGQGTIGIEILSQTNLQKLEAIFCCVGGGGLIAGVGV
                     YVKRIAPHVKIIGVETYDADAMTQSLAKGERVVLKDVGLFADGAAVKIVGEETFRICQ
                     EVVDEMVRVTTDEACAAIKDMFEDTRSIIEPAGALAIAGLKKWVAANPSSDMTRTVVA
                     ITSGANINFDRLGFVAARATYGEGREALLAAKIPERPGAFAELINAIMPHAVTEFSYR
                     YASEAEANVLVGISLTAPASQRTQELRTIMDRIKESGTMDVVDLSGDELAKSHIRHMV
                     GGRSSVPNERLYMFRFPERPGALERFLRTLRPRYNISLFQYRNYGGDIGQVLTGILCP
                     DEEVNELNLFLKEIGYPWEDCTESKVYKTFLRA"
     gene            1577436..1578413
                     /locus_tag="THITE_2116842"
                     /db_xref="GeneID:11518196"
     mRNA            join(1577436..1577617,1577685..1578413)
                     /locus_tag="THITE_2116842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654071.1"
                     /db_xref="GeneID:11518196"
     CDS             join(1577562..1577617,1577685..1578309)
                     /locus_tag="THITE_2116842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654119.1"
                     /db_xref="GeneID:11518196"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="JGIDB:Thite2_2116842"
                     /translation="MSDRPLSGRPLPSSFDDNEDFYNESGVQKVLRRMKEEPLVPIGC
                     ILTVAAFTSAYRAMRRGDHYKVQRMFRARVAAQGFTVLAMVAGGMYYAEDRKKQKELW
                     KLKQQQEAEEKRQKWIRELEARDEEERALREALEKKRKRAAERTTTEPGKEGVAAQAR
                     AALKGAKAANAEESAEASEDPADSKSKPSTSILGSLGGWFGGSSKAPQGSAKDSDDSK
                     PDPKDGHK"
     gene            complement(1578414..1580752)
                     /locus_tag="THITE_2116843"
                     /db_xref="GeneID:11518197"
     mRNA            complement(join(1578414..1580335,1580405..1580752))
                     /locus_tag="THITE_2116843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654072.1"
                     /db_xref="GeneID:11518197"
     CDS             complement(join(1578518..1580335,1580405..1580470))
                     /locus_tag="THITE_2116843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654120.1"
                     /db_xref="GeneID:11518197"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="JGIDB:Thite2_2116843"
                     /translation="MGQAQSGETPARYSHEELSKQLADKFARKCFTPLELYSFRDVFN
                     SLADHEHGIRYLKEDTIARFLEIPDALGVSAVLFQMVSCLGAFPFLEDAPAVLGLEQM
                     IVVVTLLTERYRRVLAGGAADRRKLLFRSLAVYDRKLSDTRPTDVGSASGESGRKGAD
                     QDDGAALATSSPRGFAIDEPGDDDGDVGPDDDDDELVLAAFDSLGYVGAFRHGGLSTY
                     HGAMIPADNWRKLIMLLLLAAPLGAQESLSSYSNRLSGEELDSLRSTAESVLASFLNV
                     EQVPGIKFARFDRVIAASMPFMFNGLTPLFEHFLFSRNLDFHRHKDEEPRPTARPPEL
                     VQPLLEKTGSIMNASVLSQMSFFIPGSSLFRKLRLLYSGEEDGYSMGSFESKVFNWRA
                     PTILLVSGTRLPDEAGYTHKGPASPFLASLPSLRFPPGNTSADRGETLTFGAYLSQPW
                     KHTHRECFGAEDTILFQLRPIHDVFRASTVNKDYVSFTKPSASIQVGGISFGCPPPHP
                     SQAYRRSNLISLGPVSLALEDGFEFGCFTHNYTSQGGAFQTSVSRRFDFQDRFEISSI
                     EVWGCGGDDEARQQAERWAWEAREAEARRRINLGTGDIEADRMLLEMAGLVGGNRSGG
                     SMG"
     gene            1582003..1582769
                     /locus_tag="THITE_2116847"
                     /db_xref="GeneID:11518198"
     mRNA            join(1582003..1582201,1582296..1582769)
                     /locus_tag="THITE_2116847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654073.1"
                     /db_xref="GeneID:11518198"
     CDS             1582370..1582657
                     /locus_tag="THITE_2116847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654121.1"
                     /db_xref="GeneID:11518198"
                     /db_xref="JGIDB:Thite2_2116847"
                     /translation="MACNELDRGYSGLAGILLGNAGILANAGILLGSRASWPTRASSW
                     VRGYLPGFAGIFLGLRASWPTRWHLPKFAGIFLGTVRKRIIWLLRINLRLV"
     gene            1582927..1583885
                     /locus_tag="THITE_2116852"
                     /db_xref="GeneID:11518199"
     mRNA            join(1582927..1583413,1583478..1583533,1583621..1583885)
                     /locus_tag="THITE_2116852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654074.1"
                     /db_xref="GeneID:11518199"
     CDS             join(1583281..1583413,1583478..1583533,1583621..1583788)
                     /locus_tag="THITE_2116852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654122.1"
                     /db_xref="GeneID:11518199"
                     /db_xref="InterPro:IPR004018"
                     /db_xref="JGIDB:Thite2_2116852"
                     /translation="MADQESAANTVDETPISPSRPNPARKNSLERHLAHRPGRQELVD
                     RNILPASTAAPGIQAQQRELEKHMRADSLNEKIAHRPSPEVLIKEGVLHEDPRSPEDK
                     YAEAIEEEYAKREGGA"
     gene            complement(1584442..1585736)
                     /locus_tag="THITE_2116853"
                     /db_xref="GeneID:11518200"
     mRNA            complement(join(1584442..1584871,1584934..1585232,
                     1585301..1585736))
                     /locus_tag="THITE_2116853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654075.1"
                     /db_xref="GeneID:11518200"
     CDS             complement(join(1584723..1584871,1584934..1584994))
                     /locus_tag="THITE_2116853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654123.1"
                     /db_xref="GeneID:11518200"
                     /db_xref="JGIDB:Thite2_2116853"
                     /translation="MDSSSSSQSTTDTLFRSGSSTGFYTDVKEVTSSRSGQTIVIVHH
                     GRPSYDKNEPRSSDYQHSWTASKSK"
     gene            1586818..1587940
                     /locus_tag="THITE_2116855"
                     /db_xref="GeneID:11518201"
     mRNA            join(1586818..1587224,1587313..1587370,1587431..1587546,
                     1587640..1587940)
                     /locus_tag="THITE_2116855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654076.1"
                     /db_xref="GeneID:11518201"
     CDS             join(1587041..1587224,1587313..1587370,1587431..1587546,
                     1587640..1587848)
                     /locus_tag="THITE_2116855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654124.1"
                     /db_xref="GeneID:11518201"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Thite2_2116855"
                     /translation="MQRILLSLSLLASAAVGALASEELKIDVTLPVECERKTQKGDTI
                     NVHYRGTLQSNGQKFDASYDRGTPFSFKLGAGMVIKGWDEGLLDMCIGEKRTLTIAPS
                     YGYGDRSVGPIPAGSTLVFETELMGIEGVPKPESIVTKSATEPADSPTSSASQKIAET
                     VASAVSEAAEAAETVVADTDDVQGHNEL"
     gene            1588536..1591149
                     /locus_tag="THITE_2116861"
                     /db_xref="GeneID:11518202"
     mRNA            join(1588536..1590136,1590207..1591149)
                     /locus_tag="THITE_2116861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654077.1"
                     /db_xref="GeneID:11518202"
     CDS             join(1588678..1590136,1590207..1590940)
                     /locus_tag="THITE_2116861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654125.1"
                     /db_xref="GeneID:11518202"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="JGIDB:Thite2_2116861"
                     /translation="MSRWPHHLDDAESGAASACSKFRAWLPPLNFITIHYAYFIVVCL
                     VASLVFWGSSDPARRISYADSLFLVVSAMTEAGLNTVNLSQMTTWQQTMLFLLIILGS
                     SIWVSIWTVVARKHVFEKRFQDIVRAERMRRASRAGSAVSLPKLQRFLSFRKLPTTIP
                     LQSPLVSQGGEHPEPKEGPPPSEPATGQIEPAAAAAAASIDAQLAVAAAAPREAALSP
                     ARVVFVHTPRPSEAVSTTAREHSEPSQLTRRSRNGKDGSQDDGKDDFSIRHLLAHRPG
                     GRNAQFHGLTREERERLGGCEYQALRVLSVIVPLYFFLWQLLGCLALGAWINKYQPEP
                     PLKNGINPWWLGIFNGVSAFNNSGMSLLDANMIPFQNSYFVLITMGLMILAGNTAYPI
                     FLRLIIWSLLKLLTAATREDDFCGLKDTLRFILQYPRRVYTNLFPARPTWWLLFMLIL
                     LNSVDWVCFELLNLGNRAMDSIPQGSRVIDGLFQALAVRSGGFYIVPIPSLYVGLQVL
                     YVVMMYISVYPVVITMRHSNVYEERSLGIYDEDEVRDADPEMATPWSVHGRRRSGNGG
                     MAAAVGRVISRTLTLHGVGARAPPLNQGSESHINFISQQIRGQLAHDTWWLVLAILVI
                     VTINTSKFLADPINNSVFNVIFEVVSAYGCVGISVGVPYDSFSFCGSWHTASKLVLCA
                     VMIRGRHRGLPVALDRAVRLPGEKLHDEEEEDHRIRRSMTIRRASTEA"
     gene            complement(<1591359..>1593341)
                     /locus_tag="THITE_160571"
                     /db_xref="GeneID:11518203"
     mRNA            complement(join(<1591359..1593071,1593198..>1593341))
                     /locus_tag="THITE_160571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654078.1"
                     /db_xref="GeneID:11518203"
     CDS             complement(join(1591359..1593071,1593198..1593341))
                     /locus_tag="THITE_160571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654126.1"
                     /db_xref="GeneID:11518203"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="JGIDB:Thite2_160571"
                     /translation="MTMTTEAQTTPDRKSVDAEEFGVNAATEHASLKYSLLGPSLTKA
                     GQDSVSEIIYNASKGSKFFNHEEARDKSLTAKIDSILAKKRQLEARDLSRELRAADNL
                     LAELELSRDLTQHIVHIDCDAFYAAVEQLDRPELKDLPFAVGGGVLTTCNYVARTFGC
                     RSGMAAFVAKKLCPQLIILPLNFDKYNAKAAEVREILADYDPRFESASIDEAYLNITE
                     YCAEHDMDPADVVSQLRREIHQKTHVTVSAGIAANARLAKICSNMNKPNGQFVLPRER
                     TAIMAFMRDLPCRKVNGVGRVLERELASVGIKTCGDIYAQRQYLAQLFGQKTYEFLLR
                     CYLGLGRTHIQPADEYERKSVGTESTFREMSDPDQLRRKLRQTAEELEADLRRAECKG
                     RTLCLKVKLHTFEVLTRQVVPPKAVHLADDLYSYSLPMLAKLEQEIPGLTLRLMGLRC
                     THLVSTKKPDARAFFGLRPQKHESAGSLEDGGVVVSESAGGEGKLPDEEVGSDHCPAS
                     GEASVITSPRQHGKEIVPNPPREQAPPPEEELWDCPVCARPQPADERRFNEHIDLCLS
                     RRAIRDTVQQDAAGHQQQQHENGTPEMRRVRERKRGRPPAPIDPRQKKLCFG"
     gene            1593673..1594662
                     /locus_tag="THITE_2116864"
                     /db_xref="GeneID:11518204"
     mRNA            join(1593673..1594109,1594170..1594662)
                     /locus_tag="THITE_2116864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654079.1"
                     /db_xref="GeneID:11518204"
     CDS             join(1593938..1594109,1594170..1594645)
                     /locus_tag="THITE_2116864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654127.1"
                     /db_xref="GeneID:11518204"
                     /db_xref="JGIDB:Thite2_2116864"
                     /translation="MLLKRKRSESELSLGAVFSSSQELDSGRLNRMSTPSHLPSRTMK
                     RFRDNRPSDSEVYKYTLDVLYSAQRRQHEVNHAALQLSRGAHSEAPIRLLSQSHSGGQ
                     QRSLHSFWNLPEPSSSTNSLASSPAASAASSPLPALAPPSIVTECEDCGAALSGVDDD
                     VMVDADAFGTDHACGACGKAVCFSCSVSNLGEHRRCLACAGPGRGGINSKAWMTR"
     gene            1595075..1596465
                     /locus_tag="THITE_2116866"
                     /db_xref="GeneID:11518205"
     mRNA            join(1595075..1595354,1595421..1596465)
                     /locus_tag="THITE_2116866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654080.1"
                     /db_xref="GeneID:11518205"
     CDS             join(1595203..1595354,1595421..1596294)
                     /locus_tag="THITE_2116866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654128.1"
                     /db_xref="GeneID:11518205"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="JGIDB:Thite2_2116866"
                     /translation="MGTREASHAGSWYDDDADVLSSQLDDFLNRVPATLNNNNLPIPG
                     ARVIIAPHAGYSYSGPCAAWAYKALDLRSAKRVFILGPSHTYYLRGCALTTFDKYETP
                     FGDLVVDKATTSELKRTGRFSNMPPGRDVDEHSLEMHIPYLWKRLEQTFGSDSTTYPP
                     IVPILVGDGSEEEEKSFGELLSRYLKDPETAWIVSSDFCHWGSRFSYRPEFHQGSIRN
                     LDAPRSQGSKRDVVQAAPDWSKVAEDPGAPQIHEVIKALDQMAMDAVESGTHSEFYKV
                     IQDTHNTVCGRHPIGVIMAALELVAKEQGLQEGKGKFRFIQYQRSNLVKKHWDSSVSY
                     ASAYAVI"
     gene            1597703..1599345
                     /locus_tag="THITE_2116870"
                     /db_xref="GeneID:11518206"
     mRNA            join(1597703..1597807,1597923..1597972,1598039..1598083,
                     1598149..1598898,1598962..1599345)
                     /locus_tag="THITE_2116870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654081.1"
                     /db_xref="GeneID:11518206"
     CDS             join(1598163..1598898,1598962..1599302)
                     /locus_tag="THITE_2116870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654129.1"
                     /db_xref="GeneID:11518206"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="JGIDB:Thite2_2116870"
                     /translation="MASSPSTNEPAILRECREVQNGIQNVERMLRELPAVQKRFLADA
                     DTSNDSEAKRKLDLFRQDIMDQYRKLADRVRKIKSMPESRQPMYTRQVERVEGRLRDA
                     IQEFQKLEAVFRKETEARLGRQLRIVRPEATDAEIRAAVEEGNTQVFQQAVLGNRSEQ
                     ASRVLGAVQQRHREMLQIERSMMELLELLNDMQELLTKQEVTINEIDTHAEQAAGDMV
                     KANEELEVAVATARKTRKKKWICLGICVLIVVIVVVVVVAYIMVNRAASGKKRSLFIK
                     RNVVDELQMNTARAVQISADSVTASQHPRSADADLTAAPRHSRRRSNAARGVRMGRNT
                     EVELSNTKRFIVDWHGIDPTDSDK"
     gene            complement(1599931..1601414)
                     /locus_tag="THITE_2116872"
                     /db_xref="GeneID:11518207"
     mRNA            complement(1599931..1601414)
                     /locus_tag="THITE_2116872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654082.1"
                     /db_xref="GeneID:11518207"
     CDS             complement(1600143..1600595)
                     /locus_tag="THITE_2116872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654130.1"
                     /db_xref="GeneID:11518207"
                     /db_xref="JGIDB:Thite2_2116872"
                     /translation="MEPTADGAGYQVTWASSLTPDWAVTSTQLSRVEGGGGGSASGPN
                     GNLVLKIEGVSIEPAAGPLGKAATPEAELHSPGGSGGRQPPPPAAEEYADLIQDFERR
                     MSTLRKAVEAGAARQRALGDTHGQFSEGTPLDNRVTDPFRPGTGVDET"
     gene            complement(1601415..1602327)
                     /locus_tag="THITE_2116873"
                     /db_xref="GeneID:11518208"
     mRNA            complement(join(1601415..1601726,1601785..1601848,
                     1601909..1601940,1602004..1602327))
                     /locus_tag="THITE_2116873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654083.1"
                     /db_xref="GeneID:11518208"
     CDS             complement(join(1601677..1601726,1601785..1601848,
                     1601909..1601940,1602004..1602145))
                     /locus_tag="THITE_2116873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654131.1"
                     /db_xref="GeneID:11518208"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2116873"
                     /translation="MKVKIQQWNAVATWRWDIPEDDVCGICQVHFDGTCPTCKYPGDD
                     CSLLSGKCGHNFHMHCILEWIKQDSAKGQCPMCRQRFEWTEPLNGTTADIT"
     gene            <1602737..>1603831
                     /locus_tag="THITE_2031990"
                     /db_xref="GeneID:11518209"
     mRNA            join(<1602737..1603728,1603786..>1603831)
                     /locus_tag="THITE_2031990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654084.1"
                     /db_xref="GeneID:11518209"
     CDS             join(1602737..1603728,1603786..>1603831)
                     /locus_tag="THITE_2031990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654132.1"
                     /db_xref="GeneID:11518209"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="JGIDB:Thite2_2031990"
                     /translation="MASIATLRQVRVSLPRCGAPQLCHGVARASVANVKFQARRSFSS
                     YLVTPQELAEALKKSPPSPISSEPRVIPVCASWFLPNDPQGRTGLQVFREKRIPKARF
                     FDLDKVIDKRSPYPHMLPTPKHFAEAMSELGIRHEDTVVVYDSHELGIFSAPRVGWTM
                     KVFGHPKVHILNNFRLWVEQGFPTESGNVWTVECGTYPIPKLDEEKVANFEEVREAAQ
                     DYNKEGAEGVQILDARSYGRWSGKEPEPRPGLPSGHLPGSINIPFDSLLDPKTKAFLP
                     ADKLREVFTKKGVDPEKPIISSCGTGVTACIIETALSEAQYGSPEKRKVYDGSWTEWA
                     QRVKPSDSLIHT"
     gene            complement(<1605964..>1608386)
                     /locus_tag="THITE_2049710"
                     /db_xref="GeneID:11518210"
     mRNA            complement(join(<1605964..1606011,1606076..1606871,
                     1606910..1607303,1607372..1607443,1607516..1607642,
                     1607727..1607811,1607888..1608089,1608182..>1608386))
                     /locus_tag="THITE_2049710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654085.1"
                     /db_xref="GeneID:11518210"
     CDS             complement(join(1605964..1606011,1606076..1606871,
                     1606910..1607303,1607372..1607443,1607516..1607642,
                     1607727..1607811,1607888..1608089,1608182..1608386))
                     /locus_tag="THITE_2049710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654133.1"
                     /db_xref="GeneID:11518210"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2049710"
                     /translation="MRYSRCHLLGTLLPLVPFSTAAPAESVRFPRHATVVDHRAVANN
                     YTFIIAGGGIAGLTLADRLTEDPNVTVLVIEAGPLDQGQDGILVPGAYAPYLYFWPNL
                     ITVPQAGLNNRTPGAITAQVVGGGSTINAMVFLRGDADDYDAWGSLGNPGWSWQGLLP
                     YFIKSENFTAPDASFAATANISWDDSIRGHSGPVMNSYPNYFYPGSANWWNAALEIGL
                     PAVKDPQAGSKEGVFWMPTDLDATTMTRDHARRNHYDRVKDSRPNYHLLTSNIVCQVL
                     FMGKVAIGVSYVPTSGGGSSCTSSVYASKEVILAAGGFGTPKILQLSGVGPRKLLNKL
                     GIPVVADLPGVGQNLQDQPTLTIPYNCELTAPPHVVTANVVPNYGTLLTNSTYNAEQR
                     ALYDSFHEGAYTIVSSLSTNIGALSLQQATSSYKDIIAAAKAANPAYSLPADVDPTVL
                     KGYKAQRAALLNQFASPNVGVGTVHWGTSDSALIYHLKPLSRGTVNINSTDPLASPLI
                     DFRTATDPVDLQVYTAIFRKNRELFAAPSMQLLGPTEAAPFGAHLTTDAEIAAVMRDQ
                     INPTNAHQCCTAAMLPLELGGVVSSDQKVYGVQGLRVADISHWPFQLSGAPMATMYAS
                     AERLADLIKKQYCLAGAC"
     gene            complement(1609448..1611411)
                     /locus_tag="THITE_2116882"
                     /db_xref="GeneID:11518211"
     mRNA            complement(join(1609448..1610470,1610546..1610857,
                     1610940..1611411))
                     /locus_tag="THITE_2116882"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003654086.1"
                     /db_xref="GeneID:11518211"
     CDS             complement(join(1609714..1610470,1610546..1610857,
                     1610940..1611070))
                     /locus_tag="THITE_2116882"
                     /note="CAZy_ID 269795"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003654134.1"
                     /db_xref="GeneID:11518211"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="JGIDB:Thite2_2116882"
                     /translation="MASIRFFWSLLFWSLLFLCFYSSVAEAVNLTSEREMRSIMYFTG
                     QHPVAPPIDQLRHVTHVAVAFMSPGIFNEPGRTEWPLFTSVDDVRAKFPKGTKVMVAI
                     GGWGDTAGFSAAALTDETRKTFAENVANMVTTTGADGIDVDWEYPGGNGEDYKQVPNS
                     AKAWEINAYPLLLAELRATLGPDKIISAAVPGLKRDMLAFTRETVPRIMRHVDFLNVM
                     TYDLMNRRDTVTKHHTGVELSLEAVDAYVAAGAAPQNLNLGFAFYVKYFKTAHDACAR
                     ASPVGCPTLLLEDPKTGADLGRSGSFSWHDSVPEHVAESFSRALEHGVYDDQQGGYYY
                     WDSLEDLWWTFDTPDAIRRKFPLILAKRRLGGVFAWGLGEDAPLFKHLAALNDGLEEL
                     LKARDEL"
     gene            1611631..1613982
                     /locus_tag="THITE_2116886"
                     /db_xref="GeneID:11518212"
     mRNA            join(1611631..1612148,1612231..1613982)
                     /locus_tag="THITE_2116886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654087.1"
                     /db_xref="GeneID:11518212"
     CDS             join(1611896..1612148,1612231..1613207)
                     /locus_tag="THITE_2116886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654135.1"
                     /db_xref="GeneID:11518212"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2116886"
                     /translation="MLENLCTLPLSGDLFTQVLHPSKPLLTVGLSSGRVESFRLPSDD
                     DDGSGDNSSTSNGRGLIKSVWSTHRHKGSCRYLAYSHDGEALYSAGTDSVVKHFSPET
                     GIVISKIGLPPRNSATSTTDCPAILHVLSPQTLLLGTDSGALYIFDLRENGSLDPKPV
                     RKHVPHADYISSITPLPPSTESTSGFPKQWVSTGGTTLAVTDLRAGIVATSEDQEDEL
                     LCSTIIPTGLGPKRMRNNAVVAVGTGGGVLTLWDRGSWDDQQERIYVAGGKSKRDGDS
                     LDAIVRVPDELGWGKKLVVGVGDGSMAVVDLKQREVQAVLKHDEIEGVAALTFDYQNR
                     LISGGGRTVKVWAESGVDEDEAERTAIKRSADSDEEDSDDDDSDSDEDRPRKQSKKKR
                     KKGKGVQGRTVAFPGLD"
     gene            complement(<1613955..>1615202)
                     /locus_tag="THITE_2089287"
                     /db_xref="GeneID:11518213"
     mRNA            complement(join(<1613955..1613964,1614044..1614175,
                     1614234..1614305,1614384..1614839,1614906..1614957,
                     1615016..>1615202))
                     /locus_tag="THITE_2089287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654088.1"
                     /db_xref="GeneID:11518213"
     CDS             complement(join(1613955..1613964,1614044..1614175,
                     1614234..1614305,1614384..1614839,1614906..1614957,
                     1615016..1615202))
                     /locus_tag="THITE_2089287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654136.1"
                     /db_xref="GeneID:11518213"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="JGIDB:Thite2_2089287"
                     /translation="MATRSITERELEEIYAFAVQLGKDAGRLLLEAAQSRFSDDGDSS
                     QDFSEKDSAVDIVTKTDEDVESFIRTSIAKRYPDHAFVGEESYSKGASRAYLIDDAVP
                     TWCVDPLDGTVNYTHLFPMFCVSIAFVVGGKPVIGVIYAPFLNQLFTACRGRGAWLNE
                     TQRLPLVRNPIPAMPKNAPGGCIFSCEWGKDRRDRPDGNLYRKVDSFLNMAAEVGGRG
                     GKGGMVHGVRSLGSATMDLAYTAMGSFDIWWEGGCWEWDVAAGIAILQEAGGLVTTAN
                     PPEDPLTAEIEEVKLGGRLYLAIRAV"
     gene            1615817..1616737
                     /locus_tag="THITE_2116889"
                     /db_xref="GeneID:11518214"
     mRNA            1615817..1616737
                     /locus_tag="THITE_2116889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654089.1"
                     /db_xref="GeneID:11518214"
     CDS             1616078..1616557
                     /locus_tag="THITE_2116889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654137.1"
                     /db_xref="GeneID:11518214"
                     /db_xref="InterPro:IPR001874"
                     /db_xref="JGIDB:Thite2_2116889"
                     /translation="MTRRILLINGPNLNLLGKREPHIYGSTTLADVEASARTQASSLG
                     VELETFQSNHEGAIVDRIQEAAGWGPNCLHDRAPKERVSAIIINPGALTHTSVAVRDA
                     LLAVDIPFVELHVSNVHAREPFRKHSHLSDRAVAVICGMGVYGYTAAIEFAARHMKV"
     gene            complement(<1616809..>1617888)
                     /locus_tag="THITE_160560"
                     /db_xref="GeneID:11518215"
     mRNA            complement(<1616809..>1617888)
                     /locus_tag="THITE_160560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654090.1"
                     /db_xref="GeneID:11518215"
     CDS             complement(1616809..1617888)
                     /locus_tag="THITE_160560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654138.1"
                     /db_xref="GeneID:11518215"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="JGIDB:Thite2_160560"
                     /translation="MPCKLAITSMSLGRCWAGHSFIAKLDAAHKYGYQGIELFHEDLI
                     DVAARLSSETPPPSDPPRSAQIAAARRILRLCRARDIEIICLQPFSQYDGLLDRAEHA
                     RRLEQLQFWIQLAHELETDIIQIPANFLPARYVTEDLDVIASDLREVADMGLRATPPI
                     RFAYESLCWSTRVDTWERCWELVQRVDRPNFGMCLDTFNIAGRIYADPAVASGRTANA
                     EEAVRESIARLVQQVDVSKVFYVQVVDAERLEQPIVPGHPFYDPEQPARMSWSRNCRL
                     FYGEKDRGAYLPIKEIARAFFHGIGFQGWVSLELFNRRMADKGPEVPEELAKRGADSW
                     IRLQNDLGLVVDKAPPPVERMYASL"
     gene            1619501..1620787
                     /locus_tag="THITE_2116892"
                     /db_xref="GeneID:11518216"
     mRNA            join(1619501..1619876,1619958..1620595,1620670..1620787)
                     /locus_tag="THITE_2116892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654091.1"
                     /db_xref="GeneID:11518216"
     CDS             join(1619630..1619876,1619958..1620595,1620670..1620765)
                     /locus_tag="THITE_2116892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654139.1"
                     /db_xref="GeneID:11518216"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="JGIDB:Thite2_2116892"
                     /translation="MAIATTTTVTSQQEQPLALTLESRIDQLEKHGFLFGKKLAASMS
                     PLLHDVVYRGIGLKWEQIRLDSTDMDLFLRLIRHPKFYGASITMPHKVAIIPHLDELT
                     EECRDVGACNTLFLRTLPDGRRLFCGANTDVIGVRESFVQNVPDPSVYENRPGMVIGS
                     GGAARSAVYALHKWLKATRIYLVNRDKSEVDAVVAECSERGYGDRLVHVETVEQAEAL
                     EGPGAIVACIPDFPPVTEAEKVVRRITEVMLRKEGKGAMLEMCYNPSPYTALGALAES
                     EGWQVILGTEALIWQGIEQDKYWTGRDTSELPVAQVKEAIATRLAQISKS"
     gene            complement(<1621740..>1623473)
                     /locus_tag="THITE_2145086"
                     /db_xref="GeneID:11518217"
     mRNA            complement(join(<1621740..1623061,1623200..>1623473))
                     /locus_tag="THITE_2145086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654092.1"
                     /db_xref="GeneID:11518217"
     CDS             complement(join(1621740..1623061,1623200..1623473))
                     /locus_tag="THITE_2145086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654140.1"
                     /db_xref="GeneID:11518217"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2145086"
                     /translation="MTILALKEDRPTPKAVYNWRVYACAAVASFASCMIGYDSAFIGT
                     TLALPSFTNEFDFASYDPDDLALLQANIVSVYQAGAFFGSLFAYATSHFLGRRKSLFV
                     FSATFILGAGLMLGANGERGLGLILAGRVLAGLGVGGASNMVPIYISELSPPAVRGRL
                     VGIYELGWQIGGLVGFWINYGVNTTLAPTRSQWLIPFAVQLIPGGLLFLGIFWIKESP
                     RWLFANGRREEAMRVLCWIRNLEPTDRYILEEVQYIDQDIERFEREVGKGFWKPFLAL
                     KQAKVRWRFFLGGMLFLLQNGSGINAINYYSPTVFRSIGITGTNTGFLTTGLFGVVKT
                     VLTFFWLLWLVDRVGRRRMLFVGAAGGSLCMWFIGAYIKIADPSSKPSGSMSGAGVAA
                     IFFFYLWTAFYTPSWNGTPWVVNAEMFDQNTRSLGQASASANNWFWNFIISRFTPQMF
                     LKMKYGVYFFFASLMLLSIVFVYFWVPETKSIPLESMDRLFEIKPVAKANSILMEELV
                     LQDAGADEDEKAKHSHLERPESA"
     gene            complement(1624275..1627302)
                     /locus_tag="THITE_2116894"
                     /db_xref="GeneID:11518218"
     mRNA            complement(join(1624275..1626963,1627025..1627302))
                     /locus_tag="THITE_2116894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654093.1"
                     /db_xref="GeneID:11518218"
     CDS             complement(join(1624427..1626963,1627025..1627208))
                     /locus_tag="THITE_2116894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654141.1"
                     /db_xref="GeneID:11518218"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="JGIDB:Thite2_2116894"
                     /translation="MTPPAAAGVKRSYAAMAVSWDGQTPDRPTESRPAARAFSADSRD
                     HAYLPPFHEPPAFSARREYGPASQTPARRVSTPTAAAHDADASILLAGIRGAGKTTLA
                     VIASSAMNRKVVDLEMAFREVTGHSSPAYKKMYGAAACQSRQLSVLRDVFERHKKNAV
                     LVFSWIERSLQSTLEHIGRSIPIIYVLRDPKAIQNHLKIDTIEKARNLLDASSTFFRR
                     CTRYEFFNVSEDHSTPQEFAGNRLPSPTAELDRPTAPYLTLKRAERHFLKFLSLILPS
                     GAIPFIESAFPLACVPAEERQFTYALSVPLSSFTEGDLDIQELEFGADAIEIVVDDLV
                     SDYANRLPSSPEISPHRASEISRVLAQVRRDTVVPILFHVLFPEAALSGEFWRSMYLS
                     YILHGLRLTPDYISVDLRLDTPLLTNMLSVKGTCKAVGNLQLLDPNPPPWDASFWRTY
                     YEKAQACGCDLARFTRKAINPSDNFDVRLVHHAVESVPGPRLPLIAYNTGMLGRTSAC
                     FNRVLTSVVPEGLRKERLGLASDLEAALWPSLTAREATQAIYSAFCYDPMRLYVFGAN
                     VSYSLSPAMHNAALKACGIPHHYQPHSTSTIASLQELVNDPHFAGASVGLPFKVEIIS
                     LTHSLSRHAKAIGAVNTLIPIRDIDPDGSIPDDVLLFNGRNRAGPVKALYGENTDWIG
                     IRACLRRGLSPANAVRPSSTGLVVGAGGMARAAVYAMLQLGVKHILIFNRTLANAEKL
                     VSHFETLLMRNGLPLFSAASGSNETARFHIIRSRDDPWPEGFKHPTMIVSCIPTHGIG
                     GNPAPDFTVPPSWLESPTGGVVLELEYKTLNSPLLEQVRREAHRGWVAMDGLDLLPEQ
                     GFAQFELFTGRRAPRRLMRREVFKSYPDDHGRSNLAQLQPRLDNINTEES"
     gene            1628130..1630639
                     /locus_tag="THITE_2116895"
                     /db_xref="GeneID:11518219"
     mRNA            1628130..1630639
                     /locus_tag="THITE_2116895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654094.1"
                     /db_xref="GeneID:11518219"
     CDS             1628227..1630614
                     /locus_tag="THITE_2116895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654142.1"
                     /db_xref="GeneID:11518219"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2116895"
                     /translation="MPPKRRTTETETPNNPTEVPLGRPEIPAPAAQPGPVKRQRVSRA
                     CDQCRAARERCDGKQPECYPCLSQSRPCTYEAIPKKRGVQTGYIRTLELALGWLLEKV
                     PGSEETLGALLAHESGQQGSSIMLGKDVGGADRLQKRWRKSRVYKGIDRILSGGTAQD
                     GGSPSADASDTEGDAARACSNQSLDGAGSESFPAESPNLPQTGAGHRPRSPSNDEPSS
                     VDWQRQRRPTSSISRFPPSSPDRLKLPPNHWRLLDIYFSYTHSWLPILEKQDLFRASY
                     LYPEQGVVIHPEDPSAAPHAELWAALALAALQDAASSPDDTETARPPPSEIYRIAREL
                     LPSENGPFRVHHARALLLLSLANLGQDKPTGAGLLLGSAIRILLGPDALQRGAPDRDG
                     QRTSLCMIACFILETVLSVRCNRPPHLMAEDLAAMPLVTEGGLDEWEPWTPCDGFGAG
                     HPGPRLSRSPAFCLSTFNLLYAIMKVVSVEMLARRRGQPRGVEAPEAFSSQLRRAIDP
                     NLPFGNFISSPSCGTASVPTPYVARATFLWASALADPHSESLLALLEDTLDQYQRRFG
                     KCGMPPFIVACIGSLANEEYMFGFSEQRRERLKSLVSAYKCGSFDERRTSSVAGTTVV
                     DGLTWPAAHEPVGVGDPAHFPRQSTPTTPFAGLAMPSLNDRLTAPQHQQTQPVRGGYK
                     PICGPGMTGSYQGHFRNPPIAVPQGSNAQIQLGTGAGALSATVPAMHQGHTSPHPLAP
                     PAGFGVSPDYDALLDDLASIECTDAVDADAQFMANLGFAPGCDIAEILRRDFGPV"
     gene            1630876..1630987
                     /locus_tag="THITE_t86"
                     /db_xref="GeneID:11518220"
     tRNA            1630876..1630987
                     /locus_tag="THITE_t86"
                     /product="tRNA-Leu"
                     /note="Anticodon: AAG"
                     /anticodon=(pos:1630910..1630912,aa:Leu,seq:aag)
                     /db_xref="GeneID:11518220"
     gene            complement(1630877..1632981)
                     /locus_tag="THITE_2116896"
                     /db_xref="GeneID:11519012"
     mRNA            complement(1630877..1632981)
                     /locus_tag="THITE_2116896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654095.1"
                     /db_xref="GeneID:11519012"
     CDS             complement(1631295..1632773)
                     /locus_tag="THITE_2116896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654143.1"
                     /db_xref="GeneID:11519012"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Thite2_2116896"
                     /translation="MASTHPPPVIVVGAGLAGLSAAYSALQAGAPSVRLLERAAKPGG
                     NSIKASSGINGAPTRFQDVAKHGVDQSFCEDTVKSAGSRLHASVAESVRKQRQDLISV
                     LTSRSASAIDFLVDLGVDLSVVAQLGGHSKPRTHRGAGKTPPGASIVTTLLAKLKEHE
                     GRFELVTEAEVTKLLLTANNQVTGVEYRKDGASHSLAGPVVFATGGFGGDTHGLLARY
                     RPDLDGLPSTNDPRPGAHDLLAAGAGAALVDMESVQVHPTGFVDPAAPRAPLKFLAAE
                     VLRGEGGILLHRGRRIVNELATRDKISGVIMDLPLPDAEGEGEDGAGGLRQWDVQLLL
                     DPGTAEAAAGHVGFYLWKGLLQKKKVADLDEATRETLREYAAVVRGEKPDEFGRTAFG
                     HWTLGADGSGIAEDAEVCVGRVTPIVHFTMGGVVFNEQAQVLSSALGEAQKPIQGLWA
                     AGEITGGIHGDNRLGGSSLLECVVFGRIAGEQAAQSVLKAEA"
     gene            complement(1633969..1635802)
                     /locus_tag="THITE_2155054"
                     /db_xref="GeneID:11518221"
     mRNA            complement(join(1633969..1634503,1634709..1635128,
                     1635221..1635802))
                     /locus_tag="THITE_2155054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654096.1"
                     /db_xref="GeneID:11518221"
     CDS             complement(join(1634410..1634503,1634709..1635128,
                     1635221..1635591))
                     /locus_tag="THITE_2155054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654144.1"
                     /db_xref="GeneID:11518221"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="JGIDB:Thite2_2155054"
                     /translation="MADTVNSAATEKEVGQATGAATPANGANAPHHRGFDTRNPMANV
                     HADDQPRLPAFGGEFQPGLWRPIEHRKFANPAPLGLSAFALTTFVLSCVNLNARGVTA
                     PNVAVPLAFGYGGLVQLLAGMWEMAVGNTFGATALSSYGGFWIAYGILLTPNWNILGA
                     DGPYSPAETKGDPLMAQSAVGFFLTGWFIFTTILLLCTLRSTVMFFLLFFTLDLAFLM
                     LACGAYATDNGNAEAASKLNQAGGGFGMLAAFLAWYNAFAGIADSSNSFFLIPVFHFP
                     WSEKGREARLAKTASATV"
     gene            complement(1642974..1644365)
                     /locus_tag="THITE_2116905"
                     /db_xref="GeneID:11518222"
     mRNA            complement(join(1642974..1643186,1643258..1643535,
                     1643612..1643869,1643945..1644365))
                     /locus_tag="THITE_2116905"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_003654097.1"
                     /db_xref="GeneID:11518222"
     CDS             complement(join(1643272..1643535,1643612..1643869,
                     1643945..1644211))
                     /locus_tag="THITE_2116905"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_003654145.1"
                     /db_xref="GeneID:11518222"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="JGIDB:Thite2_2116905"
                     /translation="MADRGTGARGGGFASRGGDRGRGRGGRRGGRRGGGKSDEKEWQP
                     VTKLGRLVKAGKIKSMEEIYLHSLPIKEYQIVDFFLPKLKDEVMKIKPVQKQTRAGQR
                     TRFKAIVIIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLSVIPVRRGYWGANLGLPHS
                     LPAKESGKCGSVTVRLIPAPRGTSLVASPAVKRLLQLAGIEDAYTSSSGSTKTLENTL
                     KATFAAVANTYGFLTPNLWKETKLIRSPLEEYADTLRDGKRYVH"
     gene            complement(<1644782..>1645208)
                     /locus_tag="THITE_160552"
                     /db_xref="GeneID:11518223"
     mRNA            complement(join(<1644782..1644805,1644873..1644977,
                     1645065..1645090,1645175..>1645208))
                     /locus_tag="THITE_160552"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_003654098.1"
                     /db_xref="GeneID:11518223"
     CDS             complement(join(1644782..1644805,1644873..1644977,
                     1645065..1645090,1645175..1645208))
                     /locus_tag="THITE_160552"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_003654146.1"
                     /db_xref="GeneID:11518223"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="JGIDB:Thite2_160552"
                     /translation="MGKVHGSLARAGKVKSQTPKVEAQEKPKSPKDRAHKRELYTRRF
                     VNITVTGGKRRMNANPTA"
     gene            complement(1645223..1646197)
                     /locus_tag="THITE_2116910"
                     /db_xref="GeneID:11518224"
     mRNA            complement(1645223..1646197)
                     /locus_tag="THITE_2116910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654099.1"
                     /db_xref="GeneID:11518224"
     CDS             complement(1645751..1646095)
                     /locus_tag="THITE_2116910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654147.1"
                     /db_xref="GeneID:11518224"
                     /db_xref="JGIDB:Thite2_2116910"
                     /translation="MSFMLFNSIWTLLVLAYLAVSPVYFARFFHALAALGVGWITMIF
                     WFAGSIALASYWGSPRCDGNTYCGSTEAAVAFGFFLWALFGFLVFVDTVAALRGRGHH
                     ASTAQPKPSVGA"
     gene            1646804..1649775
                     /locus_tag="THITE_2116912"
                     /db_xref="GeneID:11518225"
     mRNA            1646804..1649775
                     /locus_tag="THITE_2116912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654100.1"
                     /db_xref="GeneID:11518225"
     CDS             1647471..1649531
                     /locus_tag="THITE_2116912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654148.1"
                     /db_xref="GeneID:11518225"
                     /db_xref="InterPro:IPR013595"
                     /db_xref="JGIDB:Thite2_2116912"
                     /translation="MGRASDLARQPPPSPRRLSPGWIVAGVAASALVLFAAFPQLTSW
                     SGSSLASGAAEHFVHHPGQLDNSSPYGKFPQEGDSFHFLPCTPATLPPALEDSAPERT
                     WAARFDPVPEHWSWGAPQVGENGTAGGDPYAGRGIYLCGYLDVPLDYTNKSDTRIARL
                     AVTKFQVSGLARVGDAADSSAGRKSERTIVIEPGGPGGSGTSYAWRSAQNITERFTDG
                     KFDVLGWDPRGVNASLPAVACFPHDASRDHWSILTSLHHAVSKSPREQLEIADAMNAA
                     IMRACWERQGDLGRFLGTGMVARDLEQIRIALGEDELTGYLVSYGTGIGQTYASMFPD
                     RVGRLILDGTEYVRDHRLRGGFGWTALDNATDAWRDGFLGECVNAGPEHCALAKPKEG
                     KPVTLSDLEKRMDALLRSLATTPVPAYLPSSGPTLVTYSALVDAIYGAMYNARSWPSL
                     AQTLSELEDGNSTLAASILETSAWYYDPETPCSPNPVPPSDAELTNLVICADSYDASG
                     PDDLGWWLSLWGNMTSQNWIAGDSRFYTVLPCRHYTTYWPQPVGVYRGDLNHTLKHPV
                     LLIAETYDPATPLRNGRRLLHEMGDNARLIVHHGYGHSSRDTSSCTESIARAYILNGT
                     LPDSPETNCYADEKPYLYGVKTKAAAAALTETQDPVEAWQEHLRELVFLKPGLSPAMM
                     VWKR"
     gene            1651659..1654788
                     /locus_tag="THITE_2116913"
                     /db_xref="GeneID:11518226"
     mRNA            join(1651659..1651850,1651915..1651974,1652047..1652129,
                     1652219..1652370,1652436..1654788)
                     /locus_tag="THITE_2116913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654101.1"
                     /db_xref="GeneID:11518226"
     CDS             join(1651820..1651850,1651915..1651974,1652047..1652129,
                     1652219..1652370,1652436..1654644)
                     /locus_tag="THITE_2116913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654149.1"
                     /db_xref="GeneID:11518226"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="JGIDB:Thite2_2116913"
                     /translation="MWLLESDLFEGRKLWLRPGKLYLFGRTAAEPGQLAVSDKTISRK
                     HITIQVENVIEGGGRNLRSRSTVTVEDLDSKKGTILNGVQIRGQKKTLSEDENELKLG
                     MCPKILRIRWHPVVLSFSFTAKELSADPWTRLRESLEQLDIKYSAEYEKETTHVVSKK
                     RNTSKGLQALINGAYVVTDSFINAIVDAAAIPDDAEAGTNSALEEDFDAAWPNPIDHL
                     PPRGAEPVDRPPESYAPDDRRQEVFEGYTFVFYERKQYENLLPAITAGKGKALLKEVV
                     PGETGVDDFVRYVKGVAGEKGLGSFEDGSEGRGVVVVRYTPKTEDYEWFAQFLTSFAQ
                     RLDHRPIDQREFLEAILACDASMLRRPLEEASQPASAVSGAQEPIAGQGDRMDVDQPA
                     PQGSPSQEPVAKQESGPTTRRGRDRRAGRSRFKGFDFDDDAEGPIVETPPVEPPEPPQ
                     VAAASQDSLFVSQYREPSLPLEKEVEDAPPTRRTLRKRALSPLPEHDNSALMDEIAPT
                     TAAAKRRRIEAGQAPVPPPPEPEPEPEPQGDESEEMVPDSPQGKPKKGQARKGKGKKV
                     KEEGDILELARRKREEAEAQAAAKRKELEELPDDGIDYAAIRALHIIEECEVHFPDPD
                     ANKRGRDQDIADGRWDPRWNGRKNFKRFRKQGEPTGRPAPQIIIGLEEVKPKEYGIGD
                     DYWLEEEGSGRRKKDSQRDSQTRTQQQSQEKSGSAAKGKEKEKEKEKARPALRRTILA
                     VDSSDEEEERSELGTVPEDSYVPETEPSRSRAAKAAEKANSQRGRSQTQTQSQSQAPS
                     SNKRPAAAEPAKERAAKRPWRGFQPPSDDESEDSDDELKFRFGRRR"
     gene            complement(<1654933..>1656012)
                     /locus_tag="THITE_125400"
                     /db_xref="GeneID:11518227"
     mRNA            complement(<1654933..>1656012)
                     /locus_tag="THITE_125400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654102.1"
                     /db_xref="GeneID:11518227"
     CDS             complement(1654933..1656012)
                     /locus_tag="THITE_125400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654150.1"
                     /db_xref="GeneID:11518227"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Thite2_125400"
                     /translation="MALLGVSLILASFVLFCMRRQDWFPSIFRSLPPRLPIEPPPQNR
                     ETPEDDAHLDRRSDSDVASVARDEPKHESAAASGRALGEIPLSPLPRVVQREAEPDTG
                     LNSPSAHSTSDGQTTPKASATVLESSVPAFALSAPEDASSAAPKAKNSSAPTLSPSSS
                     SSSSSSLMPPPPRPPTLRPLPSASQASSTSSSLAPAPRARNNLPLPSRAPGCSTLAPP
                     PTHSSKPSARARPSRAVALSPGHSPLDWARLTGDPRGAERLRGLPPGTPYLRVTPRML
                     RRQTGRRGRDAWTVLGGRVYNISPYLPFHPGGEAELLRGAGRDGTRLFGEVHPWVNYE
                     GMLAACLVGIYVAEEEGGEDMEAMN"
     gene            1656699..1659503
                     /locus_tag="THITE_2116915"
                     /db_xref="GeneID:11518228"
     mRNA            1656699..1659503
                     /locus_tag="THITE_2116915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654103.1"
                     /db_xref="GeneID:11518228"
     CDS             1657272..1659260
                     /locus_tag="THITE_2116915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654151.1"
                     /db_xref="GeneID:11518228"
                     /db_xref="JGIDB:Thite2_2116915"
                     /translation="MPPHERPSVAGYRQPTVARVVNKLPLTPKVAARPPAPQHQNPTL
                     ATPLARRPAPEPALNPRGSGSRDKDERASPVPTFLSSNVTPRSGSRQSRVDSANSTPN
                     GTPNPDRHDHWETRSGVGVAGSGPDESHRRPVVTFSSPSEVGSGANPDRDSKFFYASD
                     AQKQPPQAANLKPSVMQQPKPATFFYANGNALPNRQDPPPKPYSPALPSPSSQDSLAT
                     KFVYANGTPELQPPAKIGPSSQSSSASVLSTSSRLPAARQGNLPRAPSPAKSPSQILV
                     RSPSSSTARSQRSPILVANPSSNPQASEMKANTEPQPRPAVSHTRSQSAAAIEPPAAA
                     KPAPSHNSVPPSGCTSPSFPPYSELMVPNNSAAAGSASLLPASEDSAEPEEAQPDSLN
                     SPTRASQDGQVIDLVASARRERKVQDLEITNASLEAINRTLERQLRKQTAELRRYQRL
                     SRSGRLSLGSIGSRIPSDSTVDGGALARAGMGLDDLSEEESEIEAEDAELEELEDLGE
                     DDMSGSEASSELSSGADALRRQKRRRDERRLQLDLSKHQQLLIDSQKINQSLKRCLGW
                     TEELIKDGMRALAYQVRVSDVKLGGRVLAPEEIERRELGGDDGEDATLGDDTIYAIDA
                     LGGGSLLAEAAEPAKWSKDPQDNPQDRDSGVELPADGG"
     gene            complement(1659995..1662585)
                     /locus_tag="THITE_2116916"
                     /db_xref="GeneID:11518229"
     mRNA            complement(join(1659995..1660522,1660600..1661855,
                     1661924..1662585))
                     /locus_tag="THITE_2116916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654104.1"
                     /db_xref="GeneID:11518229"
     CDS             complement(join(1660319..1660522,1660600..1661855,
                     1661924..1662029))
                     /locus_tag="THITE_2116916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654152.1"
                     /db_xref="GeneID:11518229"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Thite2_2116916"
                     /translation="MVVDTTYYDILGVKPTATELEIKKAYRKLAIVHHPDKNPNDPTA
                     HAKFQEIGEAYQVLSNEDLRKAYDKYGKESARPSEGFVDPAEFFTSIFGGEAFVDWIG
                     EISLMKDLTATMDIALAGADEEEAAAAAADPSHDGEFPGTAEAIKESLKTAGDAGAAS
                     SSTGEKKAAPTVVVEDEKGAAATADAPYPKSPSPSPGSGTSTPRNGRSTQIPLRPALM
                     DRPSDEAGPPQGDTAVHHSGKRKDKKSKSGLTKEQKEQLAALERERARVRQERVETLA
                     RKLLERISVWTETDKGRDVTMAFQEKIRLEVEELKMESFGLDILHAISATYMSKATAL
                     IRSQKFFGMGGFLSRMKDKGTLVKETWYTISSAIDAQQTMEEMARLEEQGGEEWTDEK
                     KSEYERRVTGKILTAAWRGSKFEIQSVLRDVCDLVLSDKKVPLAKRLERAEALYMIGE
                     ICGNAKRSPEEEGDYMAFEQLVAEAAIKKEKESKKKGKEKKDKANNHKFGSKAWTDAA
                     SAAAQDAPNVPKQ"
     gene            complement(<1662548..>1663535)
                     /locus_tag="THITE_2049831"
                     /db_xref="GeneID:11518230"
     mRNA            complement(join(<1662548..1662997,1663080..>1663535))
                     /locus_tag="THITE_2049831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654105.1"
                     /db_xref="GeneID:11518230"
     CDS             complement(join(1662548..1662997,1663080..1663535))
                     /locus_tag="THITE_2049831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654153.1"
                     /db_xref="GeneID:11518230"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Thite2_2049831"
                     /translation="MATTRNTNGTRKHRFLIWGGDGWVAGHLKALLESQGKETHTTTV
                     RMEDREAVLRELDHIQPTHVLNAAGCTGRPNVDWCEDNKEATIRSNVVGTLNLADCCY
                     LRGIHCTVFATGCIYQYDEAHPWDGPGFLETDPPNFAGSFYSMTKAHVEEIIKHYNNC
                     LILRLRMPVSDDLHPRSFVTKITKYEYVVNIPNSNTILTDLLPASILLAEHGETGVYN
                     FTNPGAISHNEVLSLFRDIVRPSFTWKNFSLEEQAKVIKAERSNCKLATDKLVAKLNE
                     FGYEVPEIHEAYRRCFARMKAAGIQ"
     gene            1664472..1666705
                     /locus_tag="THITE_76823"
                     /db_xref="GeneID:11518231"
     mRNA            join(1664472..1664849,1664916..1665975,1666049..1666204,
                     1666343..1666705)
                     /locus_tag="THITE_76823"
                     /product="farnesyl-diphosphate farnesyl transferase"
                     /transcript_id="XM_003654106.1"
                     /db_xref="GeneID:11518231"
     CDS             join(1664782..1664849,1664916..1665975,1666049..1666204,
                     1666343..1666459)
                     /locus_tag="THITE_76823"
                     /note="Orthologue of Saccharomyces cerevisiae Erg9;
                     Orthologue of S. cerevisiae Erg9"
                     /codon_start=1
                     /product="farnesyl-diphosphate farnesyl transferase"
                     /protein_id="XP_003654154.1"
                     /db_xref="GeneID:11518231"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="JGIDB:Thite2_76823"
                     /translation="MGVAKQAIYYAFHPNELRSIIQWKVWHEPVHKRDPSKETATEKS
                     CFHYLNMTSRSFAAVIQELNPELLMPVCLFYLVLRGLDTIEDDMTIDIKEKEPLLRNF
                     HKYMEQDGWTFDKNGPNEKDRDLLVHFDDVIVELKKVKKPYYEIIKDITVKMGNGMAD
                     YALNAEHNINGVNTIADYELYCHYVAGLVGEGLTRLFVKSELANPQLLVRMDLTESMG
                     QFLQKTNIIRDVHEDWLDKRRFWPKEVWSKYVDKWDDLFAPEHREKALQCSSELVLNA
                     LKHADECLFYMAGIRDQSVFNFVAIPQSMAIATLELVFRNPDIFERNVKITKGDACRL
                     MLESTQNLRVVCDVFRRYARRIHKKNDPRDPNFLAISMQCAKIEQFIESIFPTQDPKK
                     IAAGQKQVNEAGMDTGDAILLVLSAVFTLVVIGLLMVGTAWFLGAHLNKFFDGLDNSL
                     GGSVKKPTSVLGHEEL"
     gene            complement(1667380..1669500)
                     /locus_tag="THITE_2116923"
                     /db_xref="GeneID:11518232"
     mRNA            complement(join(1667380..1668257,1668334..1668487,
                     1668566..1669500))
                     /locus_tag="THITE_2116923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654107.1"
                     /db_xref="GeneID:11518232"
     CDS             complement(join(1667737..1668257,1668334..1668487,
                     1668566..1669165))
                     /locus_tag="THITE_2116923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654155.1"
                     /db_xref="GeneID:11518232"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="JGIDB:Thite2_2116923"
                     /translation="MAGRLLAALTFALAALGASGLPQPSKAEGFFLGVPISNPEAKNA
                     IPHKYIVVYNSTFSDAEIQAHQDSIIKTISKRNVGKRSPLTGKVLSPHVSTFSMGTWR
                     AMALEADDLMMNEIFAAKEVDYIEQDAYVSIAAQQVQSQATSGLARISHAKPGATTYV
                     FDSSAGQGMTAYVVDTGILVTHSEFEGRATFAANFVGDNQDTDLNGHGSHVAGTIGGK
                     TFGVAKKVNLVAVKVLDANGSGTNSGVIAGMQFVAQNATGSGLSGKAVMNMSVGGSFS
                     RAVNSAINQVAAAGVVPVVAAGNENQNAANTSPASATAAITVGAIDQTDDTRASFSNF
                     GRVVDVFAPGVNVLSVGIRSNTDTQVLSGTSMATPHVAGLAAYLMALEGITGGAQAVS
                     DRIKQLAQATGATVGNDVRGTTTLIANNGNRN"
     gene            <1670246..>1671438
                     /locus_tag="THITE_2129654"
                     /db_xref="GeneID:11518691"
     mRNA            join(<1670246..1670295,1670366..1670498,1670575..1670645,
                     1670677..1670694,1670782..1670831,1670910..1670927,
                     1670981..1671164,1671252..>1671438)
                     /locus_tag="THITE_2129654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654108.1"
                     /db_xref="GeneID:11518691"
     CDS             join(1670246..1670295,1670366..1670498,1670575..1670645,
                     1670677..1670694,1670782..1670831,1670910..1670927,
                     1670981..1671164,1671252..1671438)
                     /locus_tag="THITE_2129654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654156.1"
                     /db_xref="GeneID:11518691"
                     /db_xref="JGIDB:Thite2_2129654"
                     /translation="MFMRAPFAGCLAGQDARRLLDQLTIALRTAAGCGSMRLEEGAVD
                     PRHTQGLAINLSSQAEEAEASTLHTPQRFTSDEESGARDTERALLEYTLVPECDLRNQ
                     ELAPSYGFNSDVRRPLTERQAFILPNAAAVLMFGPVAQIFLVNSEAQSRQRRALELTE
                     TSNAKRGHRLRSPQRGRGAETSNMLTTGRRPLRPAERKPGPSWAGPPLGGARGRPCRS
                     TAADGYLRNMVITETGVG"
     gene            1672600..1674745
                     /locus_tag="THITE_2116925"
                     /db_xref="GeneID:11518692"
     mRNA            join(1672600..1674266,1674394..1674745)
                     /locus_tag="THITE_2116925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654109.1"
                     /db_xref="GeneID:11518692"
     CDS             join(1672886..1674266,1674394..1674653)
                     /locus_tag="THITE_2116925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654157.1"
                     /db_xref="GeneID:11518692"
                     /db_xref="JGIDB:Thite2_2116925"
                     /translation="MSTASNPVSPGTPSPPLDPVRMQDFIPPTRPSSTPFPHPEPRNT
                     ELRCISCPASRFLNTDAADPAGLLTLPSPGTGASTRLSLNDLPAEIHECILDHLFGFR
                     VSATSKSSVTRWGTALRHPRRKELSELSLVSGAWRVLVQERLYRHIKLKASVESLHAA
                     LDYLATRPHLRSYVKHIELWFPVFQPKCSPLALSNANTLPTVTPDGLTSASYVLPVDN
                     CSLEEAFHFVAEALPEVCVLTLQGGERKKAPKVRHWARESRRKEARAMPTVRSVRTLI
                     CKGQWNLIRWEEDFETIMSALPNLKEWHASYSKPKSKSYLSMADILVKPMRLTSLDLC
                     IEGDYRRELSFPSYFIKVSSRLHFCSRLAVAAASPTLEHLSYTGRVCKQFFADLVARQ
                     KDPRQSRLKSIDLTVKNCCRDAAHWNESGSGITDMSFINAFEELVIAGIRALGRIKSV
                     EHLRIRYVDLDSPFPPLNPYFLLHDGWCSGVWSDAIIAELNRARPNARFGELSESFGE
                     VAYRKDGRVTINPEFPKSRAMSLKLSNYALLSAGIAIS"
     gene            complement(<1675337..1677215)
                     /locus_tag="THITE_2116926"
                     /db_xref="GeneID:11518693"
     mRNA            complement(join(<1675337..1675973,1676090..1677215))
                     /locus_tag="THITE_2116926"
                     /product="glycosyltransferase family 50 protein"
                     /transcript_id="XM_003654110.1"
                     /db_xref="GeneID:11518693"
     CDS             complement(join(<1675546..1675973,1676090..1676907))
                     /locus_tag="THITE_2116926"
                     /note="CAZy_ID 270183"
                     /codon_start=1
                     /product="glycosyltransferase family 50 protein"
                     /protein_id="XP_003654158.1"
                     /db_xref="GeneID:11518693"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="JGIDB:Thite2_2116926"
                     /translation="MAKPSATRESAASSAPSPATPSLVASFFHHPLRLYLSAALLRVA
                     FLLYGLWQDANSPVKYTDIDYLVFTDAARFVSRGQSPYERETYRYTPILAWLLLPTAL
                     KTGHPLLDTALFSSGKVLFAAADLVAGWLLERVLAKSKSMDAATARKYAAIWLLNPMV
                     ATISTRGSSEGLLGVLVMALLSAVMARRITLAGLLLGFGVHFKIYPFIYAPAIVWWMD
                     QERMGSPSGGDKPRPSKEKPSWVTQLAAFITPKRLQLAAISLATFLSLNILMFFIYGP
                     PFLQHTYLHHVTRLDHRHNFSPYNTQLYLASAAVTPAAADAAAAAAAPAPTTLHPLLR
                     SLRVESVAFLPQLALSCALIPLALAKKDLPAAMLAQTFAFVTFNKVCTSQVSRFLFPF
                     FPFPPSFFFSRTRVQGEMMAIMM"
     gene            1677348..1679013
                     /locus_tag="THITE_2116929"
                     /db_xref="GeneID:11518694"
     mRNA            join(1677348..1677641,1677701..1677718,1677793..1679013)
                     /locus_tag="THITE_2116929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654111.1"
                     /db_xref="GeneID:11518694"
     CDS             join(1677448..1677641,1677701..1677718,1677793..1678528)
                     /locus_tag="THITE_2116929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654159.1"
                     /db_xref="GeneID:11518694"
                     /db_xref="InterPro:IPR002848"
                     /db_xref="JGIDB:Thite2_2116929"
                     /translation="MSGFKRDWNGNAKKRDGPRPPPKQAVRNAYTPMFENLRNELDEH
                     YDRRERIVKASRDITALSKKIIFSLQRVRKIENQLPANIQAEVDARLAEIAKLLAALA
                     PEVQGINRYRYARSLLCLEELVEALTFAHYLRTQTLVSLAELSPVIEDLSRKGAAPED
                     EVMADAGVDTAGNAEKPAETPTVSLTQDDYLYGVFDLTGEMMRFATTSTALTGTMASS
                     GAGGQAGGGGAAAADDDDDEQPRTIVQDMHELGTLFEMLPVAAGNRFAWGKKLEVARQ
                     SVQKVERLGYDRIIRGSERPKGWVPDLSAADQGPGDELE"
     gene            1679015..1680574
                     /locus_tag="THITE_2116933"
                     /db_xref="GeneID:11518695"
     mRNA            join(1679015..1679173,1679232..1679271,1679510..1679898,
                     1680003..1680235,1680298..1680574)
                     /locus_tag="THITE_2116933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654112.1"
                     /db_xref="GeneID:11518695"
     CDS             join(1679134..1679173,1679232..1679271,1679510..1679898,
                     1680003..1680232)
                     /locus_tag="THITE_2116933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654160.1"
                     /db_xref="GeneID:11518695"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="JGIDB:Thite2_2116933"
                     /translation="MGFTDLLTDAGLAVLDNWLLTRSYITGYSASQADVAVFKALSAA
                     PDAAKYPNAARWYKHIASYEDEFATLPGDSSKPYTVYGPETVEVTVNPAKAPAEEAKE
                     EEEEDVDLFGSDDEEEDAEAARIREERLAEYRKKKEGKPKVAAKSIVILDVKPWDDET
                     DLAAMEASVRSIEKDGLVWGASKLIPVGFGIKKLQINLVVEDEKVSLDELQEQIQEFE
                     DYVQSTDIASMQKL"
     gene            complement(1680527..1683386)
                     /locus_tag="THITE_2066991"
                     /db_xref="GeneID:11518696"
     mRNA            complement(join(1680527..1681640,1681733..1682336,
                     1682402..1683386))
                     /locus_tag="THITE_2066991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654113.1"
                     /db_xref="GeneID:11518696"
     CDS             complement(join(1681141..1681640,1681733..1682336,
                     1682402..1683148))
                     /locus_tag="THITE_2066991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654161.1"
                     /db_xref="GeneID:11518696"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2066991"
                     /translation="MNQPQQYQPPRRTGTFSSQHDELHMSSAMSHQNQPMSPRDYQAA
                     GAAPHIKLDQASSSLPQLPGYQSGGTVPNVLQPGGLGSRQQPTIPSNSVPSTMPGMQQ
                     QPEYQSHQHQKPNSLSLSHAYSRSSPAAPYESGGSNYIPYSPTTPGGTASSTQFMSPT
                     DTKYNPPNSQRNVSNTPLGLADIRPRADSTLSDGLPGTPGYETANLQPRTSNYMAPWP
                     LYAFDWCKWVPQGSGAGKLAIGSYLEDGHNYIQILEAQLTPTPSDVYVPGGSKWAMDF
                     TKIAEATHSYPVTRLLWEPPSSQKQSTDLLATSGDHLRLWSLPSEPQPPTPGSTITSR
                     NGRDMPVTKLTPLALLSNSKTPDHTAPLTSLDWNTVNPSLIITSSIDTTCTIWDIPSL
                     TAKTQLIAHDKEVYDVRFCAQSSDVFVSCGQDGSVRMFDLRSLEHSTIIYEPSAKDER
                     DANGGRISPTLAQQTLSHPPPLLRLATSPHDQHLLATFAQDSNVVRILDARQPGQALL
                     ELRGHAGAVNCVEWSPLRRGTLASGADDCQVLIWDLMNHHHHQPVNGAAADGSSSSSS
                     SSSTSVRSPVASWQCEYEVGNLGWVPHLATGEYGEWLGVSAGRGVWGVRL"
     gene            1684083..1685543
                     /locus_tag="THITE_2116935"
                     /db_xref="GeneID:11518697"
     mRNA            1684083..1685543
                     /locus_tag="THITE_2116935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654114.1"
                     /db_xref="GeneID:11518697"
     CDS             1684290..1685507
                     /locus_tag="THITE_2116935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654162.1"
                     /db_xref="GeneID:11518697"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="JGIDB:Thite2_2116935"
                     /translation="MGQDDLPSLLLLPFPPNPLTRPALDAAYKPSLTHALEKLKRSGG
                     TRLVVGVVCPILHGQFLESKTLSWPEAQALLAGMYSLISLVCDQLSIGTEMDGGPGSV
                     DTTVVLIDHDRNKRFPPNFRPAIETNNTIIVDMATFASAYFPWNSIFQVRSELGFQLH
                     RTYLELAEGKQTLRQSQLVLIDGGLTLHIAQADQSLPTQTPTYPVVCLGGTFDYLHPG
                     HKLLLTAGALLLQVPPRGEAAKPCRYIIGITGDEMLRNKKYAEYIQPWETRARNVMFF
                     LAQLLRLSSRGWKDGTRPQIEEKDGNFTATFRDRTIEVQCVRIQDAFGPTITVEEIDA
                     LVVSKETRSGGQAVNEKRAERGWRALAVYEVDVLDAKEAPDEPVETEDFASKISSTAI
                     RQQRAQSKMETKV"
     gene            1686730..1687542
                     /locus_tag="THITE_2116936"
                     /db_xref="GeneID:11518698"
     mRNA            1686730..1687542
                     /locus_tag="THITE_2116936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654115.1"
                     /db_xref="GeneID:11518698"
     CDS             1686782..1687405
                     /locus_tag="THITE_2116936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654163.1"
                     /db_xref="GeneID:11518698"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="JGIDB:Thite2_2116936"
                     /translation="MYAAQLVRRSCEVSGRRLVLIGAASRARFEMLRAEPYGYEALVD
                     YRDADWPEQVRRLAGGDGVDFAYDCISEGESVKKAASTLREGGKIAVVRSRKSGAWVA
                     AEGELRSEPIYGAVWEGLGVEIQYQGFVVPAPAEARRFAASFYSWLSGGGRLEPNPIR
                     LMPGGLDRVVPDGFSLLGTGRVSDRQRDGTDWLRPISAEKLVYKIQE"
     gene            complement(<1687773..>1688370)
                     /locus_tag="THITE_2129662"
                     /db_xref="GeneID:11518699"
     mRNA            complement(join(<1687773..1688084,1688137..1688149,
                     1688336..>1688370))
                     /locus_tag="THITE_2129662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654116.1"
                     /db_xref="GeneID:11518699"
     CDS             complement(join(1687773..1688084,1688137..1688149,
                     1688336..1688370))
                     /locus_tag="THITE_2129662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654164.1"
                     /db_xref="GeneID:11518699"
                     /db_xref="JGIDB:Thite2_2129662"
                     /translation="MSGAPIFDQTGRSCVHGFFHAHASSRKRVGRPSSTAASNTVTVL
                     RPDPFMANFVEPMIQCGYTETKKGTWTSSMRAESLLGLVDHVDIARFVAAAFQYPGHT
                     TAGIWVSKARISWFNTR"
     gene            1689059..1689981
                     /locus_tag="THITE_2116938"
                     /db_xref="GeneID:11518700"
     mRNA            join(1689059..1689674,1689779..1689981)
                     /locus_tag="THITE_2116938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654117.1"
                     /db_xref="GeneID:11518700"
     CDS             join(1689366..1689674,1689779..1689868)
                     /locus_tag="THITE_2116938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654165.1"
                     /db_xref="GeneID:11518700"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="JGIDB:Thite2_2116938"
                     /translation="MASLSVLSQTARSAASATRSLTSSMRALSLSSAAAARPAMQTQT
                     RSLSQAVLSTPRAPTTLGTRAATSATAPAVQSGVAVFQRQQVRGMKVRSAIKKRCEHC
                     KVVRRKANKRHNGYLYVICPANPRHKQRQG"
     gene            complement(1690119..1691247)
                     /locus_tag="THITE_2116940"
                     /db_xref="GeneID:11518701"
     mRNA            complement(join(1690119..1690265,1690322..1690462,
                     1690550..1691247))
                     /locus_tag="THITE_2116940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654118.1"
                     /db_xref="GeneID:11518701"
     CDS             complement(join(1690191..1690265,1690322..1690462,
                     1690550..1690708))
                     /locus_tag="THITE_2116940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654166.1"
                     /db_xref="GeneID:11518701"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="JGIDB:Thite2_2116940"
                     /translation="MGSAESWPLMFPGWSVSSLYRLMPSPAAPTWRTLRAYATDRQSR
                     PGPALTLEHFVQRARALALYRSILRSTRRIADPRTRAETRKFARGEFERNRGVTDIDH
                     IRYLLSTGKTEWESMERYIDGL"
     gene            complement(<1692071..>1692763)
                     /locus_tag="THITE_2089318"
                     /db_xref="GeneID:11518702"
     mRNA            complement(join(<1692071..1692217,1692303..1692418,
                     1692571..>1692763))
                     /locus_tag="THITE_2089318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654119.1"
                     /db_xref="GeneID:11518702"
     CDS             complement(join(1692071..1692217,1692303..1692418,
                     1692571..1692763))
                     /locus_tag="THITE_2089318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654167.1"
                     /db_xref="GeneID:11518702"
                     /db_xref="JGIDB:Thite2_2089318"
                     /translation="MIAPSSPATASRASRKRQSDFSVDPAALSPSKTEENSPTRFEPY
                     MMTTRFGRKPRMTAKVQAAGGRRNTEAPGDPHQFFDANGELEMPTLTTGPCLPTPEMD
                     CSRSHDVPYQAARRVPPTNPRPTQAPGRLKDAKNDNSSNVQSPESPLSA"
     gene            1695750..1696997
                     /locus_tag="THITE_2170615"
                     /db_xref="GeneID:11518703"
     mRNA            join(1695750..1696327,1696396..1696997)
                     /locus_tag="THITE_2170615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654120.1"
                     /db_xref="GeneID:11518703"
     CDS             join(1695789..1696327,1696396..1696897)
                     /locus_tag="THITE_2170615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654168.1"
                     /db_xref="GeneID:11518703"
                     /db_xref="JGIDB:Thite2_2170615"
                     /translation="MTPPRSDGATTPASRANLEVETGSPWGGKIRAEICQDQGAILAV
                     GPKQNTPTDSAEQEGPMSQSTEAGTMLDADSDMARSDALPPLDSPTGQSMTNPLRVVV
                     RCISHQIPGPRKKRKATMANIICQHCFGRDHDQNLDTINIAGLEDIDGKKLWVLLDSG
                     PPSASVSSKILSFRWTGKQLQSRPVDARTKERLSQVPFRRGMAGSASTKKDTKSRSMS
                     SAELRDSMTDDQWNRYMQEFLKRKLQYEKVACNLVKDWARKHPTLFFDVMQEYTAQKR
                     WHKLSLSLAEQQWVDAEKSRDQPASFMMQMEAVLSQMGRDTADEGPTLHAVADDEPRG
                     GSETGGPVGEET"
     gene            <1710297..>1710515
                     /locus_tag="THITE_2049415"
                     /db_xref="GeneID:11518704"
     mRNA            <1710297..>1710515
                     /locus_tag="THITE_2049415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654121.1"
                     /db_xref="GeneID:11518704"
     CDS             <1710297..1710515
                     /locus_tag="THITE_2049415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654169.1"
                     /db_xref="GeneID:11518704"
                     /db_xref="JGIDB:Thite2_2049415"
                     /translation="NAITIYNAFVPFTIEEFSKDFNSYKLISLLDLFSSYNQVNLDKR
                     SYDLTTFSTPISLFYIYTLLIGGINSIA"
     gene            1720990..1722108
                     /locus_tag="THITE_2116945"
                     /db_xref="GeneID:11518705"
     mRNA            join(1720990..1721171,1721347..1721685,1721766..1722108)
                     /locus_tag="THITE_2116945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654122.1"
                     /db_xref="GeneID:11518705"
     CDS             join(1721077..1721171,1721347..1721685,1721766..1722033)
                     /locus_tag="THITE_2116945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654170.1"
                     /db_xref="GeneID:11518705"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2116945"
                     /translation="MKQKRRRAPTSPLELANRKTDEEFIATYLQPSPADSAWVTTWTH
                     PRTAAEYSISLVRAGRLSEDDLTACFHLIEQTSKEDYENSAVKWHPEKKIAEMRSPDL
                     RYILVREADTSTIRAFTSLMPTYEEGQPVIYCYEIHLHPELQGTGLGTLLMGFHSTVA
                     ANLPPVTKVMLTCFLSNQRGLAFYRKLGFEKDEISPGPRKLRYGKTFVPDHVIMSKPV
                     RSSTESENSASDRVA"
     gene            1736438..1738667
                     /locus_tag="THITE_2116947"
                     /db_xref="GeneID:11518706"
     mRNA            1736438..1738667
                     /locus_tag="THITE_2116947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654123.1"
                     /db_xref="GeneID:11518706"
     CDS             1737102..1738649
                     /locus_tag="THITE_2116947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654171.1"
                     /db_xref="GeneID:11518706"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2116947"
                     /translation="MCFSCLGRRRRFGSVPFRLNAGFEDMYYIPPGGPVQAMFKNARD
                     LSMKPIIIVAMRDQFGMAPADLAIYERDGSGDSAKPLDGWENMDPAHRVFYHQHRDLN
                     AMLNGAPLDGMMARFIANYTARLRATPLVGDEWTELPDMYAFLRDEMFHAACTALAGE
                     RFFELCPDFCRDFWEFDSHVLRYLRRTPRWMAPKAYAVRDRVLASIEKWHKHAREQLD
                     YSDPSLADVDYEPVWGARLMRMRAEMFDKAGFSLAGCASMDLGFLWAANANVIPSTVW
                     VLLNVLLSQNLTERVMAEMAECFEDESGDSFSLSALCGKPLLNGLYLEALRFCVATTS
                     ARNPVVDDFKLCGWNMPRNSLMLSISWFGAHDPHFWNTGRVLPNGKPEHPVNTYWAER
                     FLQYPGDPASGPVRKPDEAIYRSGAKTSERTAQEDKTAKPISQTGALQGYFYPYGGGS
                     RICPGRHLAKQEMLVAVAVLMREFEIELLDPASARKARPDAKAFASGAIAPDRKLPVR
                     VRRRRRS"
     gene            complement(1738884..1741099)
                     /locus_tag="THITE_2116949"
                     /db_xref="GeneID:11518707"
     mRNA            complement(join(1738884..1740625,1740705..1741099))
                     /locus_tag="THITE_2116949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654124.1"
                     /db_xref="GeneID:11518707"
     gene            complement(1738916..1739005)
                     /locus_tag="THITE_t103"
                     /db_xref="GeneID:11518708"
     tRNA            complement(1738916..1739005)
                     /locus_tag="THITE_t103"
                     /product="tRNA-Phe"
                     /note="Anticodon: GAA"
                     /anticodon=(pos:complement(1738970..1738972),aa:Phe,
                     seq:gaa)
                     /db_xref="GeneID:11518708"
     CDS             complement(join(1739222..1740625,1740705..1740986))
                     /locus_tag="THITE_2116949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654172.1"
                     /db_xref="GeneID:11518707"
                     /db_xref="JGIDB:Thite2_2116949"
                     /translation="MTIQQPLDKGAAAADLQNSAAVAAPAATTSNGLPLPARKEPPPE
                     KPSDVRRRSYIILSFWLIVLCLGLPIWWKTTTIYRADLPLQEMLDWADGKACRPVFPL
                     RISIQANALQEQEAQNLLRLTQHALDDLNDFSGHHLRLQLAPPAASENRDHDHDSVLT
                     IRLLPGETTTASFDPHAPVLDITYPPNTLPSPTSSSSSLATYVAGQLRSTFAEEQATI
                     SYLLSTNSIPSEHRPQGLSPDVADSLSKRTTRSLKYAPTYHLTFSLFTSGPLPSSWDI
                     EDAIHQYMKPVLDVLSPIHNFTIDTQVQLYATPGVQNQVLNKEDLSSFINAAEWPLSP
                     SIGGAPTINFVVFAGNQTIAVPPTQDSADSSGTAPAPHSWLIPQWGTVYLLSLPSDTA
                     HLSSEALKQPLLTFTSHLLSLTGMPQSGSLPLRLSTLARIRSADLLLRASSTLGSLAR
                     LALALPSISIPSSVADGVSKTMAHLRLACETLGRPEGLAHARVAEAEAERAFFEKSMV
                     GQLYFPDEHKIAVYLPLLGPVAVPLVMGLLNELKAWRKRRREAAEVAQGKKKE"
     gene            1742090..1744382
                     /locus_tag="THITE_2116952"
                     /db_xref="GeneID:11519029"
     mRNA            join(1742090..1742402,1742554..1743066,1743203..1744382)
                     /locus_tag="THITE_2116952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654125.1"
                     /db_xref="GeneID:11519029"
     CDS             join(1742620..1743066,1743203..1744357)
                     /locus_tag="THITE_2116952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654173.1"
                     /db_xref="GeneID:11519029"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2116952"
                     /translation="MVALDFQNTDTFVFLLLALCALGAVPALINHNLTGKPLAHCVRK
                     AKARLVLLDPLVAGHVGEDVRSELSDVTFEVVTPELEKQMLSHEPVRPPDAVRNDASP
                     DSMAMLIYTSGTTGLPKAAIVSWGKVALVGGFSSRLAGTTKNDVFYSAMPLYHGTAML
                     IGFAHILSAGGTFAMSRKFSTSSFWDDVRKHGANIILYVGETCRYLLSAPERKDPVTG
                     ESLDRKHSVRVAFGNGLRPDVWSRFKERFGIDTIVEFYGATEGSFATWNKSRNDFSMG
                     AVGRSGALYNLLIGRTIALIEVDHETAMPYRDAKTGFCRRVAAGEPGELLFTLPPKDV
                     ESRFQGYYGDKDATSKKILRDVFRKGDAWFRTGDVLRWDKENRVYFADRIGDTFRWKS
                     ENVSTAEVAQVVGLHPDVQEANVYGVALPHHDGRAGCAAVVFEPSALAGDGGRPRPET
                     LKSLAQHVRAGLPKYALPLFLRVVQAGGMQTTGTNKQQKTGLRSEGVDPSKTGSDQLF
                     WLHGDSYVEFRPQDWEALQGGRVKL"
     gene            1745061..1746435
                     /locus_tag="THITE_65565"
                     /db_xref="GeneID:11518709"
     mRNA            join(1745061..1745208,1745295..1745618,1745704..1746435)
                     /locus_tag="THITE_65565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654126.1"
                     /db_xref="GeneID:11518709"
     CDS             join(1745180..1745208,1745295..1745618,1745704..1746031)
                     /locus_tag="THITE_65565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654174.1"
                     /db_xref="GeneID:11518709"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="JGIDB:Thite2_65565"
                     /translation="MASEAERPVPLRLGSIAPNFKADTTKGPIDFHEFIGDNWVILFS
                     HPEDYTPVCTTELGEMARLEPEFKKRGVKLIGLSANTLSSHEGWIKDINDVTGSLVEF
                     PIIADKERKVAYLYDMIDYQDTTNVDEKGIAFTIRSVFIIDPKKTIRTILSYPASTGR
                     NSAEILRVVDSLQTGDKHKVTTPINWVPGDDVIVHPSIKTEDAQKIFPNVRVVKPYLR
                     FTSLPNSA"
     gene            1747578..1751408
                     /locus_tag="THITE_2116957"
                     /db_xref="GeneID:11518710"
     mRNA            1747578..1751408
                     /locus_tag="THITE_2116957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654127.1"
                     /db_xref="GeneID:11518710"
     CDS             1748270..1751017
                     /locus_tag="THITE_2116957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654175.1"
                     /db_xref="GeneID:11518710"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Thite2_2116957"
                     /translation="MDSTSSVEMGGGLYARGQTGQGPDTNVNSSQSSLASSSRQEGSD
                     DRGDNLTPKSTGPLSAGPSPSIGQQRTQAGGTAVGTATPSAHLSGLMCNVHRTTGREP
                     PPLVGATTTILGDKLYVFGGRILSRSRPAPLTADLYELDLIRRHWTKLETTGDIPPPR
                     YFHSMCALGDTKMVCYGGMSPITSQKNIPADQQPEVTVMSDIYIYDLPTKKWTFIPTQ
                     DAPQGRYAHCACILPSSATFASHRAPLSALQHNPSTGNPNEGRIGISIDGTGGAEMIV
                     VGGQDGENHYIEQISVFNLRSLKWVSTQPLGKSCGAYRSVVAPLPPYVTAKLGKTFPG
                     SARQEPGGISQEAREPGSSMLIYSNYNFLDVKLELQIRTPDGRLTERQMNGTYSPPGL
                     RFPNGGIIDTHFVVSGTYLTSSKQEYALWALDLRTLTWSRIDAGGAVFSQGSWNRGVL
                     WNRRNTFVVLGNRKRSLVEDYNHRRINFSNVCMVELEAFGFYDNPRKTSPMSGFISAS
                     SPYTSPGLSLARKAGFTAGGRSHGRAAEELGEKALAMKELADMDILCIGGERIPINSR
                     IVARRWGPYFVQLLREGTATQDGSDAATLRSNSISAPGSSIRSSNLTITPTNMSGSTV
                     YSASSASSKGGASSMSSAGTLVDPAAINTAPTPRTLPPNSRPRCLYLPHTYLTVQALL
                     HFLYTSSLPAPSSPLCTPQILCSLLQIARPYRIDGLLEAVVERLHGLLDSRNAAAVFN
                     ATAMAAGGGRGIDGTLNPNFFPASAGLDGLGGPADAQQLNGGSAAGSEAGASTSTAAS
                     LAGGVAGLKISTAVPSAQPTSDELSATTSVSGSEFSSEVGDSERGGSREIWAGDLSSV
                     IGLQKRGLRGLMEGRRLRERTGTNTMAAGQLQPQQQQLQAGAGGVAYGQGRVGLGIAG
                     S"
     gene            complement(<1751374..1753640)
                     /locus_tag="THITE_2116958"
                     /db_xref="GeneID:11518711"
     mRNA            complement(join(<1751374..1751843,1752030..1752252,
                     1752419..1752541,1752622..1752752,1752822..1753221,
                     1753292..1753412,1753467..1753640))
                     /locus_tag="THITE_2116958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654128.1"
                     /db_xref="GeneID:11518711"
     CDS             complement(join(<1751734..1751843,1752030..1752252,
                     1752419..1752541,1752622..1752752,1752822..1753221,
                     1753292..1753412,1753467..1753548))
                     /locus_tag="THITE_2116958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654176.1"
                     /db_xref="GeneID:11518711"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2116958"
                     /translation="MWQVVLGRVISGAGASGMAGLVSILITDLLPLREVAQWRAYVNL
                     VATLGRSIGGPLGGWLVDVIGWRWSFFGQVPPIVLAILLVTFYLPGPSTDEPESPGPD
                     GTNTAGQKSRFSRVDFKGSVLFALTVLALLLPMELGGVKLPWSHPVVLALFGLSVLLL
                     FVFVAVEKRQEEPILPLEIFHRRDAVFSFLILGLQVAAQLGLMFSVPLYFQITARASN
                     TVAGAHLVPAVFGNALGGLISGLLIKRSGRYKALVILAVTLSSFSYLLLMLRWHGNTN
                     VWESLYIFPSGFGTGIAQSAVFISLQAVVDPAHTAPAISFMYLTTTIAVTLGLPVANA
                     VMQAALRRSLGARLPALGLAPDEVRRIIENTVSDVDFVDRITGRVRDAVVGSYVDGLW
                     WSHG"
     gene            1754970..1757373
                     /locus_tag="THITE_2116964"
                     /db_xref="GeneID:11518712"
     mRNA            join(1754970..1755381,1755474..1756603,1756707..1757373)
                     /locus_tag="THITE_2116964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654129.1"
                     /db_xref="GeneID:11518712"
     CDS             join(1755036..1755381,1755474..1756603,1756707..1757060)
                     /locus_tag="THITE_2116964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654177.1"
                     /db_xref="GeneID:11518712"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="JGIDB:Thite2_2116964"
                     /translation="MRFSRVALAASLQLPAALARGDEQRPLGPSLGAGGPFAAGAGGK
                     KPNIVFVLTDDQDLHMQSLDYLPLIKKHLIDQGTLYKRHYCTTAICCPARVSLWTGKL
                     AHNTNVTDVNPPYGGYPKFVSQGLNSAYLPLWLQEAGYDTYYTGKLFNAHTVENYNAP
                     FPAGWNGSDFLLDPYTYMYLNASFQRNREAPVSYEGQHSVDVLAQKALGFLDEAARGD
                     RPFFLGIAPVAPHSNVQASLLTNHTFDNPDDINKIVGAFTPPIPAERHKHLFADARVP
                     RTPNFNPEAATGANWVRRLRRQSAENVAFNDHFYRQRLRTLQSVDELVAAVVDRLAER
                     GLLDSTYVFYTTDNGYHIGQHRLQPGKECGFEEDINVPLIVRGPGVPRGEVAEVVTAH
                     VDLAPTILSLAGGKSRADFDGEPIPLSREELDRAATGRRHHEHVTVEFWGFAASEGKL
                     FRDDEARLVLNNNYKALRVIGSEYNLYYAVWCNNEHELYDLKTDPYQLDNLLHSTATP
                     PATLLGVPLAKVLARLDALLLVLKSCKGATCVRPWQALHPAGDVQNLRDALSARFDAF
                     YEQQQPKVRFDRCELGYILDAEGPQFEADGLVYRHGLRWSEWV"
     gene            complement(<1757403..>1759501)
                     /locus_tag="THITE_2129674"
                     /db_xref="GeneID:11518713"
     mRNA            complement(join(<1757403..1757752,1757827..1757984,
                     1758054..1758274,1758366..1758410,1758485..1758509,
                     1758572..1758640,1758707..1758740,1758800..1758811,
                     1758879..1759025,1759097..1759259,1759346..>1759501))
                     /locus_tag="THITE_2129674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654130.1"
                     /db_xref="GeneID:11518713"
     CDS             complement(join(1757403..1757752,1757827..1757984,
                     1758054..1758274,1758366..1758410,1758485..1758509,
                     1758572..1758640,1758707..1758740,1758800..1758811,
                     1758879..1759025,1759097..1759259,1759346..1759501))
                     /locus_tag="THITE_2129674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654178.1"
                     /db_xref="GeneID:11518713"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2129674"
                     /translation="MSSPNQAPVGAADRPDKLKIVQADDMDVSEQENAVGYREYLEAL
                     DVEPTVRELRKLRWKIDLIILPMFLITQALQFMDKTSLNYANLFNYQDALGLKGNQFN
                     YLSAMVYAGYFFGQYPCGWLIGRYPAQKVLAISVLAWGVLVILMTQARSYSSALAVRF
                     IMGIFEAAVTPGLTLMTGFWYTRREIPLRQCIWYSALGWGGIIGSYISMGISKLPTDL
                     GGVTCLWALVIWFFMADSPTNAHFLSHRERLIAVKRVASNETGIKNKRFDRKQLWVGF
                     TDPKMILLFISVFAAAIPNGVVNSFSTVIIRDMGFDTTKTTELKSVGDAVQVVALLIG
                     GAITLNIPNSRLLTATVANLLCTVAAACMAYLPRSNTWGRLVSFWLVNSQSVGFTVSL
                     TTISSNMAGYTHRSLASALVFTAYCWGNFAGPFVVKESDAPRYEGAAIGLLVGYAIKL
                     GCHLALLGK"
     gene            <1760087..>1763301
                     /locus_tag="THITE_53694"
                     /db_xref="GeneID:11518714"
     mRNA            join(<1760087..1760413,1760498..1760786,1760875..1761042,
                     1761367..1761461,1761922..1762003,1762109..1762129,
                     1762211..1762441,1762533..1762700,1762792..1763025,
                     1763132..>1763301)
                     /locus_tag="THITE_53694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654131.1"
                     /db_xref="GeneID:11518714"
     CDS             join(1760087..1760413,1760498..1760786,1760875..1761042,
                     1761367..1761461,1761922..1762003,1762109..1762129,
                     1762211..1762441,1762533..1762700,1762792..1763025,
                     1763132..1763301)
                     /locus_tag="THITE_53694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654179.1"
                     /db_xref="GeneID:11518714"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="JGIDB:Thite2_53694"
                     /translation="MGQWQSSQPSHTGPAPSDTHTHEKKDPYLAKPSGSCCLKGTIHE
                     GEPRGTWETIAGVETYISTPPEGKANGNVLLYFPDVWGMFTNGLLVMDAFADAGYTVL
                     GLDYFRGDPVWKHRKNRHDNSNPDFDYEAWKRKHTAFANEAVPKWVSCVASRYRQVNP
                     ETKFACVGYCFGAPYVCDELAKETVAAGAFAHPAFLKEHHFRNIKKPLFLSCSEVDHT
                     FDVPSRRRALDILQQEGKVYHYQLFSGVEHGFALRGDPNDPYQRYNFVGWGSSTIRPR
                     ASPVLKIFGLRVRWRRIRLLPNLRVLPMAPPRAFDFAGDVAIVTGAGSRMDGEIGNGR
                     ASAILLARHGAKVALLDYNVAWANETKRMIDEEGGISEVIQADVTDEESCKAAVAKTV
                     ELFGAVHILVNNVGVGGAMGDATVVNLDAWDRDFRINVTSMVLMSRYAIPEMRKQGRG
                     AIVNMSSVSGLLGGNPSLLYPTTKGAIIQMTRAMAAQHGRENIRVNCVCPGMVYTPMT
                     RGRGMTPEMRQARINQNLMKLEGTGWDVGYAVLFLSSKEARWITGLIMPVDGGVSNTT
                     RETQAITVRRMVLTDRCRPQPGEPTDPR"
     gene            complement(1763437..1765546)
                     /locus_tag="THITE_2116969"
                     /db_xref="GeneID:11518715"
     mRNA            complement(join(1763437..1764119,1764202..1765075,
                     1765235..1765546))
                     /locus_tag="THITE_2116969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654132.1"
                     /db_xref="GeneID:11518715"
     CDS             complement(join(1763528..1764119,1764202..1765070))
                     /locus_tag="THITE_2116969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654180.1"
                     /db_xref="GeneID:11518715"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2116969"
                     /translation="MATRGRYYSELLLTVICAHASKYQDSNYTEFLLARVRSLLGSAI
                     QQPSSIPTVQALLQLSAYELARGSISQAWVYSGIAFRMASDLGLQHSDAGIHGLGPVD
                     VELRKRLFWSCYFWDKYAMLDGGRVGMCLLTTMGITERQASIPGDCPPSRSCRKRAVS
                     TYVRRSSTPPTCLVAQNSNLDVIVDDSMELERWTPYYGDSVNLAKFAQTPYPPSTSHA
                     VSCFSNSCKLSIIINDIIVQLYSRRSRAITESALRDIRTRLDDWRTASPAHLRYDPDA
                     LPSVSPPPHIVSQNLLYYTTVILAHRPFWSVAAYYQVCITAAQNIEKLLLLLESTFGL
                     NHITYLMGYCIYTGASVVLEDAKRSNLGTEHPVLRTFLRALNAGTRRCPLLERSINII
                     VRGLSRTSSDQPNAPPDSSAASCHLGGGPQTAPDASGTHLNPYIPAFPYFEPSSPQDF
                     NPETYLGGVNAFGFLDCFPEMQLDPGGDFGSSIMGA"
     gene            complement(1766561..1766661)
                     /locus_tag="THITE_t102"
                     /db_xref="GeneID:11518716"
     tRNA            complement(1766561..1766661)
                     /locus_tag="THITE_t102"
                     /product="tRNA-Val"
                     /note="Anticodon: CAC"
                     /anticodon=(pos:complement(1766626..1766628),aa:Val,
                     seq:cac)
                     /db_xref="GeneID:11518716"
     gene            complement(1768960..1771283)
                     /locus_tag="THITE_2116972"
                     /db_xref="GeneID:11519028"
     mRNA            complement(join(1768960..1769307,1769387..1769691,
                     1769771..1770128,1770642..1771283))
                     /locus_tag="THITE_2116972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654133.1"
                     /db_xref="GeneID:11519028"
     CDS             complement(join(1769264..1769307,1769387..1769691,
                     1769771..1770128,1770642..1770879))
                     /locus_tag="THITE_2116972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654181.1"
                     /db_xref="GeneID:11519028"
                     /db_xref="JGIDB:Thite2_2116972"
                     /translation="MGSIPEPQSSVEGSTHPFKVLIVGGSYAGLSAALNLQDLCSGLP
                     PRCAPQPKEEDSGAERNERPQFSVDITIVDERDGFCAVGIEMAAELKLVQPQLRVTLV
                     HSRDKLLSSEPLPDEVKDRSLELLRDAGVDVLMGHRLDRTEEVTDEAGNRCLRVHFTN
                     GHSMLADQVSLAVSRSVPSTTFLPRHVLDDEGYVKIEANLAFAPSHFAVGDLVKWSGI
                     KRCGAAMHMGYFAAHNLHQLMMQATAKTEAEKAPPKFLELDEIPPMIGLAVGKKGVSY
                     WPQGGLSSGEEVMKLFFGDDLGFSICWNHLGLGGKKAV"
     gene            complement(<1771936..>1773416)
                     /locus_tag="THITE_2049423"
                     /db_xref="GeneID:11518717"
     mRNA            complement(join(<1771936..1772264,1772390..1772690,
                     1772751..1772816,1772933..1773123,1773290..>1773416))
                     /locus_tag="THITE_2049423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654134.1"
                     /db_xref="GeneID:11518717"
     CDS             complement(join(1771936..1772264,1772390..1772690,
                     1772751..1772816,1772933..1773123,1773290..1773416))
                     /locus_tag="THITE_2049423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654182.1"
                     /db_xref="GeneID:11518717"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2049423"
                     /translation="MTDTQQTAAPQFVPRFRSDVYPFISPSKFRGSLKDKVAIITGTA
                     GAIGQALAESFAVAGAKLVLTYNKTVPPPALTERCLRFGAGAVEFVQCDVAQLEGCEA
                     LVRKTLDLHGRVDILVNNAGANGLGPMYAQDPRDFIHDMAVNFHGPYYLMRLVVPEFR
                     RQRSGCVLNIASRAGTVAIPYSTSYCASKAALINLTACVQKEMDVEGLDDVHLYALHP
                     GGIKSAMTLKKYAADSISALPPPARASFANTLDVYNDSPYLNGMVCVALAAGVAKRAL
                     RGRYFDVGQDLEDVLAQEAALAADPDLYALHTRFLGGLANGGVPPGGYRGAEEGAWEF
                     PGF"
     gene            complement(1773877..1776937)
                     /locus_tag="THITE_2116976"
                     /db_xref="GeneID:11518718"
     mRNA            complement(join(1773877..1776425,1776495..1776937))
                     /locus_tag="THITE_2116976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654135.1"
                     /db_xref="GeneID:11518718"
     CDS             complement(join(1774287..1776425,1776495..1776773))
                     /locus_tag="THITE_2116976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654183.1"
                     /db_xref="GeneID:11518718"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Thite2_2116976"
                     /translation="MSELLVHSPGHEMRGTQVDCADLSPRQPHLLDDPAKFKKKKKPK
                     NHAPSPLSWIVRVASNLVLQLRDGLSASERENRRREEEQRQILAARMQNATTLKEWEA
                     AATQLDRLEGNDEWKLDDSSGEYEYHADLIRAKLRDLDTARNNFDISTMMYLIRTGLS
                     RDVGDMGNMGLYRHSYVGTKALIERYVDSAIKTIESVVEKSIYQTEISPRDLLEGMVY
                     ARQSFGRSALLLSGGATFGMAHIGVIKTLYEQNLLPRIISGASAGSIVCSVACTRKDD
                     EFPGLIKAFPFGDLGVFEGENENLSSHLRHLLTEGSWSDISNLTRVMRDWLGDVTFLE
                     AYNRTRRICNICVSSSSIYDVPRLLNYITAPNVLIWSAVAASCSVPFVFQGHPLLMKH
                     PVTGAHEPWIPTPQQFIDGSVDNDLPMTRLAEMFNVNHFIVSQVNPHVVPFLAKDDQP
                     APGKLRQNRSESTSEKLLYALASMAKEEALHRLHFTAELGVFPNLLTKLLSVLSQNYS
                     GDITILPEISTSDLRLVLKNPTPEFMLRSCLIGERATWPKLSRIRNRLSIELALDQAV
                     HALRARVVFSRSQVELRRAMGVWKPVAFKMIGGRVPSADSSELNPYGGFRVVQPPGSG
                     EVTPTEDRPFDRRRGSGASIQLVVARHRTPFQGNEDEQSDDDERLELKVRPRNTANRL
                     AGSALEPRLRRNAKSQSHMRDGKSVDFHARDETSSTQGQSTKLPSQTKRVSQADNVVA
                     TRERAEIAASPARGFGIMLTPDAEGGTQSSDGGLQSDSDPYAEGGRHSTGSPTKEQPS
                     KLRYSES"
     gene            1784586..1786430
                     /locus_tag="THITE_2116977"
                     /db_xref="GeneID:11518719"
     mRNA            join(1784586..1784994,1785089..1786430)
                     /locus_tag="THITE_2116977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654136.1"
                     /db_xref="GeneID:11518719"
     CDS             join(1784714..1784994,1785089..1786238)
                     /locus_tag="THITE_2116977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654184.1"
                     /db_xref="GeneID:11518719"
                     /db_xref="JGIDB:Thite2_2116977"
                     /translation="MSLAMLPRPSLTLTVPSLHDGLPIDCRVYHPPALAASPDAPPNA
                     PPNAPSWQKHAAIIAHPYAPLGGCYDDPIVDIVAGTLLRLGFLVGTFNFRGAQGSAGR
                     TSWTAKAERGDYMAVVGFVSHYVHFLDPFSPAGAGADHALEGGDAAGDAAGDVPSAIR
                     IRPPTPDYVPATTPILLLGGYSYGAMITSQLPSFEAIVALFISPECGSPAAEVRLRAQ
                     HLAEMQNTVLASARNAAIDRPTPTTPRRHVGLRVGGDEENRTSHDTRRSLSAESENKM
                     RHGVAEYLSRTKKRHSRSCSGQSLTSQNAGGKHDEPEGAPSTHLLSIPGWTAFRPAYL
                     LVSPLQGIVTNLVTLSVSPTLSSLPGKVWARLSTKGSREAAGLETPEPPGPAHAAAAD
                     AEAKLTQNTTLAIYGDRDGFVPVRKLRAWASRLQAVPDSRFRAHEVSGADHFWASGNV
                     AFTLREAVRAFGASLLDHNDIDDTLK"
     gene            complement(<1786892..>1787599)
                     /locus_tag="THITE_2011158"
                     /db_xref="GeneID:11518720"
     mRNA            complement(join(<1786892..1787293,1787375..>1787599))
                     /locus_tag="THITE_2011158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654137.2"
                     /db_xref="GeneID:11518720"
     CDS             complement(join(1786892..1787293,1787375..>1787599))
                     /locus_tag="THITE_2011158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654185.1"
                     /db_xref="GeneID:11518720"
                     /db_xref="JGIDB:Thite2_2011158"
                     /translation="PQPPPALHILAATWGGVTVTPELRALARASPDPARLTLDLRSLH
                     RVLAPDPAPGTLKVLTVLYRFGGGPDDGPADGGGVGGGTVTLSRFATGEQMRAQLGQR
                     RNVLGVHVRLEEEGPAWRAGPEGQVEILAVLYGPQRIKTPEVLAELAKFFEGKRGQIR
                     TTNAFFRTDPWPYKRKTWSVYFRFVGSTRVQVVTGWEDGALEVPWNRD"
     gene            1788503..1789698
                     /locus_tag="THITE_2116980"
                     /db_xref="GeneID:11518721"
     mRNA            join(1788503..1789026,1789144..1789497,1789579..1789698)
                     /locus_tag="THITE_2116980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654138.1"
                     /db_xref="GeneID:11518721"
     CDS             join(1788541..1789026,1789144..1789473)
                     /locus_tag="THITE_2116980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654186.1"
                     /db_xref="GeneID:11518721"
                     /db_xref="JGIDB:Thite2_2116980"
                     /translation="MDSNYLDRVTARRALIAEHTSAVHGAIPSGHAPVAELYSYLLGT
                     YLPARYPTMFELITSTDTATATTTTVFRNKVTHVDSPLHPPPRDPLEMLRLLGETVED
                     DMFLLLRDGDEHRAVAFVCCHPSGFAPAAKLGRRLAEIHAPVPAYEKIGPSMERYFRR
                     LEWAIQTHSQLYAPNGNHVLDEDVVEEEASIDVQEARFRVEQQTLTRLPETGAILFSF
                     KTLLYPLADIKAEGLGPQLANAIEGLKAGNAPGMWVYKGGVRWGRAMCKYLRA"
     gene            <1873749..>1874563
                     /locus_tag="THITE_2052012"
                     /db_xref="GeneID:11518722"
     mRNA            join(<1873749..1873928,1874241..1874387,1874408..>1874563)
                     /locus_tag="THITE_2052012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654139.1"
                     /db_xref="GeneID:11518722"
     CDS             join(<1873749..1873928,1874241..1874387,1874408..1874563)
                     /locus_tag="THITE_2052012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654187.1"
                     /db_xref="GeneID:11518722"
                     /db_xref="JGIDB:Thite2_2052012"
                     /translation="RGIPSKRKSSACVDYVPALCTHRPSLLPIEWLSEAFGLAQRGRQ
                     RPLRAGKLSKLGHLEENSVNHRIFERTLRPPAFRRACLSERHFDHQAPGLCWGPAAAR
                     RPRKPVARSSNHLAQGVLRVPAVKRKATPQRLTSDQVGGPAELKHINKRRKRNQQGLP
                     "
     gene            complement(<1874936..>1884184)
                     /locus_tag="THITE_2145127"
                     /db_xref="GeneID:11518801"
     mRNA            complement(join(<1874936..1875066,1883887..>1884184))
                     /locus_tag="THITE_2145127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654140.1"
                     /db_xref="GeneID:11518801"
     CDS             complement(join(1874936..1875066,1883887..1884184))
                     /locus_tag="THITE_2145127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654188.1"
                     /db_xref="GeneID:11518801"
                     /db_xref="JGIDB:Thite2_2145127"
                     /translation="MLRFDDRFARQNRCEPPPEFPLASPYPSIVHHLSGPRLNAPTQI
                     HPNTSGSVDDAPKLSPTFTFITRAGFTPKHSRKTLTPWSVFQDGSLVTITPASLQKRG
                     PRSPRGHCAPGYNTPGGATFPEPLSPRRNRCWPEPGRVHR"
     gene            complement(<1884352..>1884570)
                     /locus_tag="THITE_2049959"
                     /db_xref="GeneID:11518802"
     mRNA            complement(<1884352..>1884570)
                     /locus_tag="THITE_2049959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654141.1"
                     /db_xref="GeneID:11518802"
     CDS             complement(1884352..>1884570)
                     /locus_tag="THITE_2049959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654189.1"
                     /db_xref="GeneID:11518802"
                     /db_xref="JGIDB:Thite2_2049959"
                     /translation="YIRQVSCYTVLSGFRLPWPPSCCQDVLTPFVVSDERPLRHLNPA
                     FGSSRIASSAYQKWPTSVDTFECPRSAK"
     gene            <1885927..>1886076
                     /locus_tag="THITE_2050940"
                     /db_xref="GeneID:11518803"
     mRNA            <1885927..>1886076
                     /locus_tag="THITE_2050940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654142.1"
                     /db_xref="GeneID:11518803"
     CDS             1885927..1886076
                     /locus_tag="THITE_2050940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654190.1"
                     /db_xref="GeneID:11518803"
                     /db_xref="JGIDB:Thite2_2050940"
                     /translation="MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLL
                     SLTLV"
     gene            complement(<1886159..>1886533)
                     /locus_tag="THITE_2050206"
                     /db_xref="GeneID:11518804"
     mRNA            complement(<1886159..>1886533)
                     /locus_tag="THITE_2050206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654143.1"
                     /db_xref="GeneID:11518804"
     CDS             complement(1886159..1886533)
                     /locus_tag="THITE_2050206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654191.1"
                     /db_xref="GeneID:11518804"
                     /db_xref="JGIDB:Thite2_2050206"
                     /translation="MIGRADIEGSKSDVAMNAWPPQASYPCGNFSGTSSLKFRGTKGS
                     IGHTFMVCIHTENQNQGDFYPFVLLEISVLHEPPLGHLRYGLTDVPPQPNSPPDNVFN
                     PGRPAEDLKTRSWTKIQPRFIE"
     gene            complement(<1903096..>1903314)
                     /locus_tag="THITE_2050013"
                     /db_xref="GeneID:11518805"
     mRNA            complement(<1903096..>1903314)
                     /locus_tag="THITE_2050013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654144.1"
                     /db_xref="GeneID:11518805"
     CDS             complement(1903096..>1903314)
                     /locus_tag="THITE_2050013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654192.1"
                     /db_xref="GeneID:11518805"
                     /db_xref="JGIDB:Thite2_2050013"
                     /translation="YIRQVSCYTVLSGFRLPWPPSCCQDVLTPFVVSDERPLRHLNPA
                     FGSSRIASSAYQKWPTSVDTFECPRSAK"
     gene            complement(<1904778..>1905232)
                     /locus_tag="THITE_125366"
                     /db_xref="GeneID:11518500"
     mRNA            complement(join(<1904778..1904887,1904968..>1905232))
                     /locus_tag="THITE_125366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654145.1"
                     /db_xref="GeneID:11518500"
     CDS             complement(join(1904778..1904887,1904968..1905232))
                     /locus_tag="THITE_125366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654193.1"
                     /db_xref="GeneID:11518500"
                     /db_xref="JGIDB:Thite2_125366"
                     /translation="MNAWPPQASYPCGNFSGTSSLKFRGTKGSIGHTFMVCIHTENQN
                     QGDFYPFVLLEISVLHEPPLGHLRYGLTDVPPQPNSPPDNVFNPGVVVFHRRRSSHLF
                     YTSYVFSQCQTRVKLNRVFFPR"
     gene            complement(<1906177..>1907133)
                     /locus_tag="THITE_2050634"
                     /db_xref="GeneID:11518501"
     mRNA            complement(<1906177..>1907133)
                     /locus_tag="THITE_2050634"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654146.1"
                     /db_xref="GeneID:11518501"
     CDS             complement(1906177..>1907133)
                     /locus_tag="THITE_2050634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654194.1"
                     /db_xref="GeneID:11518501"
                     /db_xref="JGIDB:Thite2_2050634"
                     /translation="PTRPTLHLPTHLPCTSHPTYPAPPTRPTLHLPPDLPCTSQPTYP
                     APPTRPTLHLPPDLPCTSHPTYPAPPTRPTLHLPTHLPCTSHPTYPAPPNPPTLHLPP
                     DLPCTSQPTYPAPPTRPTLHLPTHLPCTSHPTYPAPPNPPTLHLPPDLPCTSQPTYPA
                     PPTRPTLHLPTHLPCTSQPTYPAPPLLSVSHPTYPAPPTRPTLHLPPDLPCTSQPTYP
                     APPTRPTLHLPTHLPCTSHPTYPAPPLLSVSHPTYPAPPTRHTQVSSLASVGASCLCL
                     CSCVWPPSVPADLPCTGLLPTAVALPCKAPLRSAPAGSRWEI"
     gene            complement(<2013436..>2013687)
                     /locus_tag="THITE_2050611"
                     /db_xref="GeneID:11518502"
     mRNA            complement(<2013436..>2013687)
                     /locus_tag="THITE_2050611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654147.1"
                     /db_xref="GeneID:11518502"
     CDS             complement(2013436..>2013687)
                     /locus_tag="THITE_2050611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654195.1"
                     /db_xref="GeneID:11518502"
                     /db_xref="JGIDB:Thite2_2050611"
                     /translation="VYAYIDDIIIASKNIEEHLKYVEIVLDIFDKVYVYISVEKSFVA
                     YLSVRLLGYMVNGEGVAKIDDRIAIFKKLKFLDTLETLE"
     gene            <2044739..>2045153
                     /locus_tag="THITE_2116993"
                     /db_xref="GeneID:11518503"
     mRNA            join(<2044739..2044935,2045001..>2045153)
                     /locus_tag="THITE_2116993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654148.1"
                     /db_xref="GeneID:11518503"
     CDS             <2045001..2045153
                     /locus_tag="THITE_2116993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654196.1"
                     /db_xref="GeneID:11518503"
                     /db_xref="JGIDB:Thite2_2116993"
                     /translation="TSSPRPSSHPSDRSNLRPINRSNQPPRLVAPIKEPNRPVAPIKE
                     PDRWIE"
     gene            <2056580..>2059639
                     /locus_tag="THITE_2052168"
                     /db_xref="GeneID:11518504"
     mRNA            join(<2056580..2056741,2059538..>2059639)
                     /locus_tag="THITE_2052168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654149.1"
                     /db_xref="GeneID:11518504"
     CDS             join(<2056580..2056741,2059538..2059639)
                     /locus_tag="THITE_2052168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654197.1"
                     /db_xref="GeneID:11518504"
                     /db_xref="JGIDB:Thite2_2052168"
                     /translation="YIVSFIGSKVIEAFILYFKEDIAKLITNFNKLFDFLDRFYTNST
                     KLYYIKNNFIYPITFSLKIISRLESNYLIYNKELFTIVYTIKE"
     gene            complement(2084213..2086769)
                     /locus_tag="THITE_2116996"
                     /db_xref="GeneID:11518505"
     mRNA            complement(join(2084213..2085101,2085248..2085572,
                     2085661..2085750,2085828..2086474,2086541..2086769))
                     /locus_tag="THITE_2116996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654150.1"
                     /db_xref="GeneID:11518505"
     CDS             complement(join(2084411..2085101,2085248..2085572,
                     2085661..2085750,2085828..2086474,2086541..2086668))
                     /locus_tag="THITE_2116996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654198.1"
                     /db_xref="GeneID:11518505"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2116996"
                     /translation="MADNGSSDSIRAGNDSKGVAEDHLEKGVLRTEHVDLNRNLEARI
                     KNPLEGIPRDELMSRVDAFAQEKGLTEHVALLRKGALVAQDPNAFEDITGPEALDEEE
                     KEVLRNEIQHKWRLPLRLYLTIFTCSIGAAVQGWDQTGSNGASIFFPNVYGIGTNSTR
                     DTILVGLVNAGPYIGSAFIGCWLSDPINNYLGRRGVIFVAAHFCLWPVIGSAFCQTWG
                     QQLACRILMGIGMGVKASTVPIYAAENSPAAIRGALVMSWQMWTAFGILLGTAINLAV
                     FSVDNINWRLMLGAPFIPAVPLLCLIYLCPESPRWYMKKDRYKDAWDSMVKLRNHPLQ
                     VARDIFYIHSQLELEYQLLRNSTYIQRFIELFTIPRVRRATLAAFTVMIAQQMCGINI
                     IAFYSTTVFKENGSDEFHALLASFGFGLINWAFAFPAFWTIDTFGRRSLLLFTFPQMT
                     WTLLAAGLFTLLDMGTARTALVALFVYLFGAFYSPGEGPVPFAYSAEVFPLSHREVGM
                     GFAVAVCLFWAAVLGITFPFLLASTGTLGAFGCYAGFNFVAFIMIFFWVPETKQRTLE
                     ELDYVFAVPTARFGRYQLTEALPWFIKRWVFFQRKAQLRPLYQFEQEKKAKKEGETAV
                     VA"
     gene            complement(2091042..2093134)
                     /locus_tag="THITE_2078668"
                     /db_xref="GeneID:11518506"
     mRNA            complement(join(2091042..2091540,2091635..2093134))
                     /locus_tag="THITE_2078668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654151.1"
                     /db_xref="GeneID:11518506"
     CDS             complement(join(2091373..2091540,2091635..2093053))
                     /locus_tag="THITE_2078668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654199.1"
                     /db_xref="GeneID:11518506"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="JGIDB:Thite2_2078668"
                     /translation="MAALIGDVFADSSSRFYGMMGGHSHDIHYQSRSVSRSRDRDAQS
                     HHPQRSTASPQRASGSVAAAQNQSRNRLDSQQQSGKQTRPGRTDTTARLPSPPPSSYA
                     PSETSSGSTQPQHDIPRDGSLDPIHGSFSASDSGASSASTAATVIPPPSRAMPSPGSD
                     SAPPWNSSDVQMTGASLAPPPLDDPPESPIQTQTTIRVRDLAHIQSLARADLLTGTRP
                     GVLSDPPLQQMKYDISGMPIGDIIEMVAALLTKITTTNDLQHDALNRNAHHLRQAQAQ
                     ARGDEGAGESSMSPLSSSVLAFHGKNVPAITILSYLSRIHKYCPTTYEVFLSLLVYFD
                     RMTERVNDMVLKSEEARRVQLEGHQPHQQQSQPAHTSAGPSDPDKDTDMRDDDDDSSE
                     GTETDSELADSTDGDDESVGQAGRKPGSVASNSHANIHAAAAHATYFVVDSFNIHRLI
                     IAGVTCASKFFSDVFYTNSRYAKVGGLPLPELNHLELQFLLLNDFRLAVPVEDLEAYA
                     TMLVEFYAREVVAQRSRPVD"
     gene            complement(2096377..2097621)
                     /locus_tag="THITE_2117002"
                     /db_xref="GeneID:11518507"
     mRNA            complement(join(2096377..2096710,2096866..2097141,
                     2097213..2097227,2097290..2097335,2097419..2097621))
                     /locus_tag="THITE_2117002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654152.1"
                     /db_xref="GeneID:11518507"
     CDS             complement(join(2096392..2096710,2096866..2097141,
                     2097213..2097227,2097290..2097335,2097419..2097452))
                     /locus_tag="THITE_2117002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654200.1"
                     /db_xref="GeneID:11518507"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Thite2_2117002"
                     /translation="MEFGNSGSLSEDGIHLDMDRLKKGEVNLGTSIMAVTFKDGVILG
                     ADSRTTTGAYIANRVTDKLTQVHDTIWCCRSGSAADTQAVADIVKYQLELFSMMNGKP
                     PTTQTAAAIFQEICYANKDRLTAGLIIAGWDERHGGQVYSIPIGGSLHKQPYAIGGSG
                     STYIYGFCDAHWREGMDEAAAVDFVKAALQEAIKWDGSSGGVIRLVVLTAKGADRHLY
                     LPDTGYKVRHQ"
     gene            complement(2097726..2099140)
                     /locus_tag="THITE_2117004"
                     /db_xref="GeneID:11518508"
     mRNA            complement(join(2097726..2098534,2098642..2099140))
                     /locus_tag="THITE_2117004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654153.1"
                     /db_xref="GeneID:11518508"
     CDS             complement(join(2098129..2098534,2098642..2098904))
                     /locus_tag="THITE_2117004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654201.1"
                     /db_xref="GeneID:11518508"
                     /db_xref="InterPro:IPR006863"
                     /db_xref="JGIDB:Thite2_2117004"
                     /translation="MARRHHLTLTLMAVMIFLGLTYIMSSGSAISDRYPAGMPSGKWS
                     NPEQGSRTGSAKGSDSDSNPALGLSESILQGGSIAPKLENATAKAELGRASWKLFHTM
                     MARFPEQPTPEDSLALKTYIQLFARLYPCGDCASHFQKLLKKFPPQTSSRNAAAGWAC
                     FVHNEVNKRLKKEQFDCNKIGDFYDCGCGDEDGKKKKEGESADLKERDGVTVEKQEGL
                     TRGG"
     gene            complement(2099491..2100429)
                     /locus_tag="THITE_2117005"
                     /db_xref="GeneID:11518509"
     mRNA            complement(join(2099491..2100048,2100172..2100429))
                     /locus_tag="THITE_2117005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654154.1"
                     /db_xref="GeneID:11518509"
     CDS             complement(join(2099678..2100048,2100172..2100301))
                     /locus_tag="THITE_2117005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654202.1"
                     /db_xref="GeneID:11518509"
                     /db_xref="JGIDB:Thite2_2117005"
                     /translation="MYTVAMEWVKEQYKKLYDIWVPWLEDLYLRYFTRDNKASYTTRE
                     NLNKAKITNVSRIDALQDGVHGLAADQLGQGGLAGPVGDLASREGVNRVERRGKDERG
                     EYVPQQLAGGEGTAAASAGGVGQAVAGAGNALVGAVAGGQQAAGAVKQGAEKAGDWLG
                     FGKGME"
     gene            complement(2102587..2105399)
                     /locus_tag="THITE_2117007"
                     /db_xref="GeneID:11518510"
     mRNA            complement(2102587..2105399)
                     /locus_tag="THITE_2117007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654155.1"
                     /db_xref="GeneID:11518510"
     CDS             complement(2102803..2105079)
                     /locus_tag="THITE_2117007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654203.1"
                     /db_xref="GeneID:11518510"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2117007"
                     /translation="MLKGEKYAGEKVDVWSLGVILYALLCGELPFDDDDDGVTRTKIL
                     TQEPTYPDHLPPDALDLLKGLLSKRPLLRPTLPDILAHPFLAEYAAQQQEILRVERPE
                     PFSTPLEKETLHRMRCAGVDIDSVIESVLAQRCDALAGWWTLLIEKEERKQRRRERKR
                     KEREAENRSSRRFSQASSRLNALATVEEGGFVKLLDPPPPRTRGRSERRSGHYPGLAI
                     PDMPDFSDLSKVANGNLSPDSEVPPPPIDKDSIRSVSSSRNRKPIPPPKEGVLRSARS
                     RGSTLHLVTTSDALEAKGASQAADPKKVKKRPSHAIIATWKNWTHWLFENTRRNKGSN
                     KRGSQSTPNLLPKPASGKDGKSKEDSPRPQTSKYPASGAASTPQTVSLPKGVVANGFA
                     ARGAAATGGHASSSSHAPISPGLTTPPIPGPRLHTSGSYKRHSLSPSPLTPRSARRRS
                     SGPNGLRGRKSTSSSVSSVRSLHHTHHHSHSKASSTSSNGSVSTSVSKTPLQTTRSPH
                     HSVKVLPATPTTGTFAGFPSNIRLVRDRHGPPLHFFNESLPISTAAAAGPSSGTPTPG
                     SPIPSSGSGGGVMFAKRKRNLFKGPMLTLSSHHFHHHHNHHLSGRESGGASAGPGGGS
                     GSGSASASHSRSASASGLGRRSGEITIQEEDEDEEEEAGGVDGGGSSGGVAVRGGSLG
                     GEGELDVGVEVGEDGVEEVDAFSPIVKRPGEIVEEKIYEEGEEVEGEEDAAARRDSPP
                     SGVPGLQPAAALHPSTGA"
     gene            2105748..2106595
                     /locus_tag="THITE_2117008"
                     /db_xref="GeneID:11518511"
     mRNA            2105748..2106595
                     /locus_tag="THITE_2117008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654156.1"
                     /db_xref="GeneID:11518511"
     CDS             2105986..2106168
                     /locus_tag="THITE_2117008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654204.1"
                     /db_xref="GeneID:11518511"
                     /db_xref="JGIDB:Thite2_2117008"
                     /translation="MLRTLAFRPSASAFTLVASIPPPRWGGIRPSSAAGSRTWESQCV
                     RVTVCEGRDQRLARPD"
     gene            complement(<2107361..>2109412)
                     /locus_tag="THITE_2078678"
                     /db_xref="GeneID:11518512"
     mRNA            complement(join(<2107361..2107595,2107683..2108074,
                     2108180..2108597,2108655..>2109412))
                     /locus_tag="THITE_2078678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654157.1"
                     /db_xref="GeneID:11518512"
     CDS             complement(join(2107361..2107595,2107683..2108074,
                     2108180..2108597,2108655..2109412))
                     /locus_tag="THITE_2078678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654205.1"
                     /db_xref="GeneID:11518512"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Thite2_2078678"
                     /translation="MVQKHKLAEKKEQLKQKTKPPGGFDPTPLPDAPPGYTLRFIFHR
                     AWNLPVGDFHLKSADPYLHATLTAAVPRRHKEDPLLTHRTRTLRRTTEPAWEDEWVVA
                     NVPASGFTLKCRLYDEDWPDHDDRFGNVTIRVPYVDEHWEGLGPDGRVFDVKKRAGSK
                     RAYLVKGAASVLCRAGPITPRLHVSIKVLGKSAPPHAQMYTVGPTTFVKHYSPMIGRL
                     TGVKVNKDEQADAASPSSSSSSAPKKRDRRTKKYDFQANEIQFSGPVPPRLYHRYVEF
                     RPMIGRMFSSRGLRGRILHKVLHKQHNRIYNFDASTEYGTFAPCSEAATLQFLRMAHF
                     DEGGRIFTYVLTLDGMMRFTETGKEFGIDLLSKHTMHSDVAVYVACAGEFFIRRLARP
                     PNSSTNKPHHPHTPSTHTHPPPEPPDPTANHPPTHPPHQPAGGPPSAPPPPNPRLYQL
                     IIDNDSGTYRPDAAVLPDLRGFLARNLPGLDVAALHCADPRLADLKRAQREAKRRAAG
                     GGVAVALGKKKKKRRAASSAESRLGRMEAEAEEEGARGGTGAAGAGAAAAAGGGAAVR
                     SKRERVFDVVSEPGRWREALGLRASRQGQAAGRA"
     gene            complement(2110393..2115534)
                     /locus_tag="THITE_2117010"
                     /db_xref="GeneID:11518513"
     mRNA            complement(join(2110393..2115329,2115398..2115534))
                     /locus_tag="THITE_2117010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654158.1"
                     /db_xref="GeneID:11518513"
     CDS             complement(join(2110531..2115329,2115398..2115431))
                     /locus_tag="THITE_2117010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654206.1"
                     /db_xref="GeneID:11518513"
                     /db_xref="JGIDB:Thite2_2117010"
                     /translation="MEQPFSTSKVTVEYFDPHDVYKLLAPGLIPRLPLRDLNWQSHAG
                     PLRSIGTLHVELVPAGANHSAVFSPVSSSSPNPNPKPPVPGDTAAPQSRDDGFQTAAI
                     GGRAGSTEQQPETTSSTLRPVVGAATKERRHQIPGLRRTPYLKVLLVRCDDNETYKST
                     TRAEIREWIKTNTAGSQGKSGSHAENHDAFEWLIIHVVLPNSVAATQPRFSGKAPDSG
                     SEATKTSAASRWRAGSSTLLEKIRADFNGSSKGAVDRVRQIRIGINDVPYHMLPRVVP
                     AVPTGYQETEQDSENAWADLIAKFKELILSSFDRRVSQYEEDIKEKDAQRSLPGWNFC
                     TFFILKEGLARGFESVGLVEDALVVYDELSVGLDNVIQEQAIAGSAETHGGALLQYTE
                     DLKELAQKAMAEIAGGHLEFDDEEAVDLQSGEKKQPDNFDSIPISSTKKLYRDLILAN
                     NVSLFDFRCYIFSRQIALLLRLANAWSSREELLAKLKEQQELVPRGVAPRTPLPKMAE
                     EPENLLRLAEVCRRTLEFVPAVSAVMRADIISAMASATRGDGGAAESQVSLDPLLSEV
                     VDNMVASFAFSVAQQILAQTSTKALPIPPSTLGPPEGHEQKTSIPEPKTIMLPTRSSS
                     LHMQPAQRPPPSPAGFPGPGRPEDSIPPPPYVKAGLEELAAQRAELCALSRNVLEECG
                     KKRGWTDGWAAVPTVGETRIAEMEDISLDAEDDKEKPQSETKAGERLQTSVAGVGNTL
                     LRTALANKDDFYRLYETLIDKALRHYTVANHTHSVQSNLADLAVLKFHLGEYSEAAFY
                     FYRVIPFFGESGWSLLELSMLVMYARCLKDLGRLDDYVNRALRQLLCKAAAAERDRLQ
                     QKSRFRLGLSSPTQYPERSAISGFLPDLLDVSASLEKDTRIPLTSLFCDMGLDGPPFY
                     DDGQDSFSLFLDLYSLLVDEFEATSVSMRISSPASLGNKEIWLQTKGPVTLRPGPNKV
                     KVQSTVMMTGTFEVDLVRVRSSKVLLQYERDGSQPTEKASTALKNPRVTLYQRTSCLD
                     VQLVGARDLQLDKKKSLDLELSTGWNEITSCEVKIKSATGGLRLVMSEAEVIGSPQPT
                     KSQGGVFTFGPMAAHNVIKIRFPFTVEQDLLDVAVRAEVTYSTDKGSFTFFKASSVPI
                     SLALEVNVQDIFKHDALFSRFAVSTANDSPLRLLKSELLSSDLFESHFGQPPSHPVLV
                     FPKQPASLLYKITRKPGSKLGPKVKKTLYLKLYYSIIQDEIDALFEQALTAALESTPL
                     KEFSKLIISKVRSRVRTGLSAYDLEKATLLGELPTSFLLSTNWEKQFAGLGSGPQDGS
                     GSAAAIATFLRNWLHSHPVLDLPQPEPSSASTSTTDATTVIQQQQKTILIPVDIPPVS
                     VVHTADIRLHPPLQSLAGLSGLDPGLSERESSSGTGASCPTAVVNQLLPATLHLRWTR
                     AWDTAADGRARAQDLEFGYEVSAPADTWLVGGRRRGHFVIPAMGEDAGKEGKPGESTV
                     IMMSSTVETEAEIPLVLIPLREGYLPLPSVEIREVGFGDGEGGAGGPGSGGGGAGSGP
                     GGGAYGHCEMDYKNVGEAVCVVADRGRVTVSLDASGASGGPLVLECESSGMGMGRVVV
                     "
     gene            2115681..2117375
                     /locus_tag="THITE_2117012"
                     /db_xref="GeneID:11518514"
     mRNA            join(2115681..2116035,2116100..2116165,2116233..2117375)
                     /locus_tag="THITE_2117012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654159.1"
                     /db_xref="GeneID:11518514"
     CDS             join(2115894..2116035,2116100..2116165,2116233..2117194)
                     /locus_tag="THITE_2117012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654207.1"
                     /db_xref="GeneID:11518514"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="JGIDB:Thite2_2117012"
                     /translation="MATLQAIKYSRGKLLVLDQLRLPHEHHYDEVSTAEEAFDCIRSM
                     RVRGAPAIAIVAALAHAVELHNGSCTATTPEDTIAYIESRLDFLKESRPTAVDLSNAI
                     ALLKLAARAAKLEGLAHPEAKEAILNSYIEAAENILAKDLENNTSIGSFGAAWLQQQF
                     DASPDRRISVLTHCNTGSLATSGHGTALGIIRTLHARGLLRHAYCTETRPYNQGSRLT
                     SFELVFEGIPATLVTDSMAGALFAQHRERMNIGAVIVGADRVVRNGDTANKIGTYALA
                     VLARHHGIKFVVAAPTTSIDLDTETGAGIKIEERKPEELTQISGAVVNADGSIDPSRT
                     ARVAIADQRIAVWNPAFDVTPHALIDAIVTERGTVVKGADGRFDFSQVLPERWRW"
     gene            complement(2118885..2121010)
                     /locus_tag="THITE_2117015"
                     /db_xref="GeneID:11518515"
     mRNA            complement(join(2118885..2119884,2119944..2119989,
                     2120065..2121010))
                     /locus_tag="THITE_2117015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654160.1"
                     /db_xref="GeneID:11518515"
     CDS             complement(join(2119184..2119884,2119944..2119989,
                     2120065..2120814))
                     /locus_tag="THITE_2117015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654208.1"
                     /db_xref="GeneID:11518515"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="JGIDB:Thite2_2117015"
                     /translation="MAEAPDQPEPVLDHERHLRYWKMCLQSPLPRHYLSNEGNRMALA
                     YFIINAISILTPPPAAASPMGGEQQQQQQQQEQQSASQRKPPLIPPEDRRRLRGWVLS
                     HQQPGGGFAGTSSLVFPLQAPYEQWERETGAREAEGAGLANLPATMFALQLLALLADE
                     DDPAGAFRGMDRVQTLRWLRRLQRADGSFGEVVKLLPGHGWFIGGGYDMRYCYLAAAI
                     RWMLRGDVKEGEPGWVEDIDTRGLANYILNSQTYDGGFAGSSQEEPHAGYAYCAIAAL
                     SLLDRPLENSTASHPSQTLHSGIRDMPGLIHWLVSRQFAYLEPNYNSDNTDNNNIEEG
                     EEEEEANFLLPARLSDLSLSHNLRHVACNGRCNKVADSCYTWWVGAALANLGRGDLLD
                     WPALRRFLLDKMAHRVGGFGKHPGDPPDVYHGCFGLAVLAVMGEPGLNRLDGALAVPV
                     GTVKIIELARAALVESAREEGAKLGGRAVEMGIAMRGAKPAWLIEAGG"
     gene            2121495..2122556
                     /locus_tag="THITE_2117018"
                     /db_xref="GeneID:11518516"
     mRNA            join(2121495..2121761,2121856..2122556)
                     /locus_tag="THITE_2117018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654161.1"
                     /db_xref="GeneID:11518516"
     CDS             join(2121624..2121761,2121856..2122383)
                     /locus_tag="THITE_2117018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654209.1"
                     /db_xref="GeneID:11518516"
                     /db_xref="JGIDB:Thite2_2117018"
                     /translation="MALISARTILTSLCLFHITLGFFFFTNPGTVADQAVVYLLGESM
                     GLPHSRAFETPSPALAFLAVVLATSGISDLATLSLPDDICLVHYWGMQAPLRLTLSLG
                     LALYSFFFSASSPLAFLLAGRNGDPNNHAAFPSSSSSSSSSSSSSSSPGRWFAHPSVV
                     GSSGDAGGGGAALQNRLFFTFVFVETMSWFWVWVTLQEERREVLARKARRRSSSSGYP
                     VGR"
     gene            complement(2123485..2126525)
                     /locus_tag="THITE_2117019"
                     /db_xref="GeneID:11518517"
     mRNA            complement(join(2123485..2123845,2123912..2124758,
                     2124813..2125119,2125181..2125521,2125581..2125670,
                     2125721..2125807,2125875..2126156,2126286..2126525))
                     /locus_tag="THITE_2117019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654162.1"
                     /db_xref="GeneID:11518517"
     CDS             complement(join(2123520..2123845,2123912..2124758,
                     2124813..2125119,2125181..2125521,2125581..2125670,
                     2125721..2125807,2125875..2126156,2126286..2126429))
                     /locus_tag="THITE_2117019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654210.1"
                     /db_xref="GeneID:11518517"
                     /db_xref="JGIDB:Thite2_2117019"
                     /translation="MSAYRYGRPALRGSVDVQLQTAFSDGNWNTVIRLAAKRAAATKD
                     PYYEAVKICAESQLDGTAEKCAVLAAVDELVKNKKTPDIDIIELYEWACRDLFNYDVE
                     YADTLGPLRARWAKANPSSPLALQCLQACLEKWDLVSAQQIATTLDKTHANTADRRYM
                     FWNITLTFLLSVSPQCTDASRKVYSLLAVRQLERAADLTESSAKLEPTDRGLLTEEEI
                     CLYYRVLRSHGTKEEFISRLQSPKLGAISQLKEGRKLLFCEGLDALESWGEWDLIYKL
                     CREALVLGLEGATSPFFVCDLQTWRKFATAASKTADPDGSLAEVQNILKRYIEIKDKA
                     SEMYKKNLSLALLETTFRLPATAVNPTRENERLSARVIQIGLFLDQYFERLSAFDDIK
                     GYVAELSFEEVKALMESVVPRILDEDANKTRKIVLEALSCKLRYLLSTCPQTLTPQPS
                     VVEGQPQDKPFQCRLCSSPASLPCECCLRKLILDAATAYERITGEKELLAAIPRLDKD
                     PRLDLALVMGAALLKLSGLRPRTSDVTRSLWQDVDPGLFLQAVLLLDAQLKETPGDTE
                     LRLLLVKLYLLLGCASYAYQLWIPLDVKRTIQDALSPLFFDRISALAPGLFQGNRGLM
                     EPLRSFYNQSLREKSPVRIWDAFWAGSYTSILDMTEFDGNLRRSCTLMMTLVEERRAI
                     RCYGGKIDCEIEEHPLTENIDDDTTLVDKTDHGPFPNLESFHGPAMHEFLSRGPGLSV
                     GFLHPRSVTPSSRFLTRRRTSVRTSPSCRNSTSISCCTSLPRTTNPPPKQTRSPCATA
                     TTRSRRSRV"
     gene            complement(2127029..2127808)
                     /locus_tag="THITE_2117024"
                     /db_xref="GeneID:11518518"
     mRNA            complement(join(2127029..2127156,2127233..2127260,
                     2127331..2127438,2127525..2127808))
                     /locus_tag="THITE_2117024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654163.1"
                     /db_xref="GeneID:11518518"
     CDS             complement(join(2127127..2127156,2127233..2127260,
                     2127331..2127438,2127525..2127592))
                     /locus_tag="THITE_2117024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654211.1"
                     /db_xref="GeneID:11518518"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="JGIDB:Thite2_2117024"
                     /translation="MMASTAINETEPWNRETKQKFESKDRSEFFDPCQEAAARSIRCL
                     NRNGGDRTMCTDYFQAYRDCKKSWIEKRKMEKR"
     gene            2128367..>2129855
                     /locus_tag="THITE_132251"
                     /db_xref="GeneID:11518519"
     mRNA            2128367..>2129855
                     /locus_tag="THITE_132251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654164.1"
                     /db_xref="GeneID:11518519"
     CDS             2128755..2129855
                     /locus_tag="THITE_132251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654212.1"
                     /db_xref="GeneID:11518519"
                     /db_xref="JGIDB:Thite2_132251"
                     /translation="MPRCYRRSRRAQSEHKGNATMSGNDPAAERVPEQGQKRDRTTTP
                     SPNLAKRPRRGSNNSSSSNAAGEASKGIDAAAQIGLNLSKADSSSSSLWPPPSSSVFS
                     SAGSSSASPAQAPLNQQLLTNIADRLSALADEAREASLHQQPQAPAHPSPTDLLRRVE
                     QLEADFAEYRQASQPRDRAANDRLFKMDIRLDRLDPRLGKQDVRFDKIDARINRQDSR
                     LDKMNAAITELRGRLGAAEGRFAALEATMARQERDIVSLLNAQTRAWHAGASTRTHAN
                     TAATGTANANVNAVAFPNATAGPSTSLVPRTTAHYPQGDGQSSAGDWIRREFGDVIGA
                     VEERPGQHQPPGGSWAPWRGAGRGAGYRRGGG"
     gene            complement(2130387..2132783)
                     /locus_tag="THITE_2117028"
                     /db_xref="GeneID:11518520"
     mRNA            complement(join(2130387..2131372,2131470..2132182,
                     2132254..2132783))
                     /locus_tag="THITE_2117028"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003654165.1"
                     /db_xref="GeneID:11518520"
     CDS             complement(join(2130785..2131372,2131470..2132182,
                     2132254..2132368))
                     /locus_tag="THITE_2117028"
                     /note="CAZy_ID 269856"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003654213.1"
                     /db_xref="GeneID:11518520"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="JGIDB:Thite2_2117028"
                     /translation="MGWVSTSKATALLSAVLLAATGAIAAGEAKLQVDLSSPDSIRAA
                     AKIVAANLFSYYHGNQPGQTPGILPGPPPGGPYYWWQAGAMWGTYIDYWFYTGDSTYN
                     DETVRAMEFQSENSYQPANWTLSLGNDDQGFWGMAAMLAAETNFQNPPDGQTPWLTLA
                     QAVFNTQAWRWDMEYCNGGLHWQIPTTNGGYDYKNSIANVVFLNIGARLARYTKNDTY
                     AKWVDTAWDWIEGVGYITKDYNVLDGGHTEENCTDINPVQFSANMAVLLHGSAIMYNY
                     TNGSEKWRARVAGLLNHTIDFFFPDGIMVERACELPDRVQCNTDQHSFKGYMHRALAT
                     TAVVAPFTREQIVRVLRSSTEGAVSSCLADGTCGFRWNTGSYDGDNVVGPAGQEMSAL
                     AALSTLLIDQQKVLNGPLTNTTGGTSQGDPSAGGTFNALAPPKPITTADRAGAGILTA
                     VVLATFLGGLVWMGMGWSEGS"
     gene            <2134312..>2135715
                     /locus_tag="THITE_160478"
                     /db_xref="GeneID:11518521"
     mRNA            <2134312..>2135715
                     /locus_tag="THITE_160478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654166.1"
                     /db_xref="GeneID:11518521"
     CDS             2134312..2135715
                     /locus_tag="THITE_160478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654214.1"
                     /db_xref="GeneID:11518521"
                     /db_xref="JGIDB:Thite2_160478"
                     /translation="MESKFFSSSAPAGPIKRGLAEELKQSPTAKRAKRAKRNKRRHFN
                     REKQSNAYNEQNDWAFSDISPATGSSVAGNQTPIRVPTPFQFKRAAKEIRLLNSAEKA
                     KVESKSKGKELAAEIIENPRNRAEPPTAQSGPKPEANIRKTRAEREIKKEEEDAINNW
                     NTYVPAIAGPSKPRTIKNWAADESAMDISSPSDIAPLVDYTFKAFPNPTTPSYIKESK
                     SQHSETTLPKTPPRESGETAQSPFSPILPGDSAPADTKTLKAINKHLKSLEAKLTAGV
                     SCADHANNNSHKIEDTALQSLRTDLAQLQDRVEIEGLREAARHQVLFNALVKVSSDVA
                     ALSARVQAQQQQQQQQQQQQQQYPWHPDYDSYGVASGNGGYAAEMGDAGEHAGTGSGG
                     AGRENLGTGGTPRSAKKTMDVKGKRRAGLEQSRKTLEQCLRIYTEDMNRASTKEEVER
                     YGWLCVQYAGDLFKTLG"
     gene            2136901..2138261
                     /locus_tag="THITE_2117029"
                     /db_xref="GeneID:11518522"
     mRNA            2136901..2138261
                     /locus_tag="THITE_2117029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654167.1"
                     /db_xref="GeneID:11518522"
     CDS             2136989..2137999
                     /locus_tag="THITE_2117029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654215.1"
                     /db_xref="GeneID:11518522"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2117029"
                     /translation="MPVGPVVSSYLDVTAGLIDLFDNTRLAADIDAWAERPRPRDRAT
                     NTSSAVNYLVLAIGCRKSDENTAQRYFDYARSLAFESLSGDLGVASVQLFILVTFYSL
                     TACQINAAFLFFGIAARAAYSIGIHRTAVNARFGPELHRQRDRLWKSLRVLDLFLSTS
                     MGRPPATSDLDCTVQYRAHDDEAGHETVDLLDAAAQIFLVIEAIVVEIYSRRKISPRL
                     TEGISRELREWSTRWLQQLKDIIEGTSRYHQPGMVNGACQILCSYYYAVILVSRPFLM
                     VELHRRLSEGGQFAAESRAYPMTGKSKLADACIDAAILMVEPVKDLIERGLMIRAAPV
                     IV"
     gene            2139721..2141649
                     /locus_tag="THITE_2117031"
                     /db_xref="GeneID:11518523"
     mRNA            join(2139721..2141013,2141198..2141649)
                     /locus_tag="THITE_2117031"
                     /product="glycosyltransferase family 31 protein"
                     /transcript_id="XM_003654168.1"
                     /db_xref="GeneID:11518523"
     CDS             join(2139882..2141013,2141198..2141607)
                     /locus_tag="THITE_2117031"
                     /note="CAZy_ID 269952"
                     /codon_start=1
                     /product="glycosyltransferase family 31 protein"
                     /protein_id="XP_003654216.1"
                     /db_xref="GeneID:11518523"
                     /db_xref="JGIDB:Thite2_2117031"
                     /translation="MLAHRCSARTSSSILLVFVLAIVFLTARRVHNPRAPPPPPDRAT
                     WRDGDMSKACPQDLEFLRTKDLALTQKIVYTRRCIRPVRGDVDRDVVANVSSPLVTTK
                     TILNLADGCSSAEPPPCEPLSLHVPPAYPKPEHQYQHLVFGVASSYGRLQDALPTFAH
                     WLSGSGAALIVVVADADQPDANFDLAALEAAYRNLSIDATVIAPKLKTGLPRKDTPAN
                     EPLPSPAPVEQLHFLLIRDMLEFATPQTQWLGVLDDDTFFPSLHPLSGMLQQHNHSAP
                     VWLGALADNLESIRKWGYMSYGGAGVFLSMPLARQLAPHLDSCIRKTTIISGDGMLRD
                     CIYLNTPTKLTVVPELYQHDMRGDPAGFYESGRRVLSVHHWKSWYNAPVDKMAAVVRV
                     CGDCFLQRFRLGDDTLLANGYSVSVYRAGLLPTLDLGRIEGTWGGWGGSDFDFVYAPF
                     RPPLAPEDKKSYRLVGVAEEPAATVNGVPAKLRQFYVHRTTTEEEKKGKDSAMDEVIE
                     LVWEG"
     gene            complement(2142425..2145183)
                     /locus_tag="THITE_2117033"
                     /db_xref="GeneID:11518524"
     mRNA            complement(join(2142425..2143068,2143121..2145183))
                     /locus_tag="THITE_2117033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654169.1"
                     /db_xref="GeneID:11518524"
     CDS             complement(join(2142568..2143068,2143121..2144857))
                     /locus_tag="THITE_2117033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654217.1"
                     /db_xref="GeneID:11518524"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Thite2_2117033"
                     /translation="MMTYERPLHDVVLPSPGSPPGMTASKSSKSSSLSSLPSDDGSVL
                     ADVNHFEDIGLDDAQIDPRALSDQHLKTAPNPYSASFSELRVVAKRPVSASSPRPQYT
                     RDSSRNRQQRDFTTLPKSRPSLPVLQSQLRTTNGRVASLGLLPEPCTSPLPVRGLGRQ
                     RSHTSMRHRSPSPNLSLSLSPRDPNVVMQPRRSSWQSNRERKTVLELELECDEDDGDE
                     IPDGLILDNVPISPRPPSERSHSRPPSKAPSPERAPKERVRSIGNGTPPVALAQGSLR
                     SPTWKSDSALSTHSSPASSRVSSPTSARAKSWSAALAALNDEAKALTEKLEEHAEEME
                     HKIQQRSSTGSMPNARRSSDPETAKPRVKSALAELPPLRRSNIMIDPLPISKEKEAVL
                     SRTRPSWLPPKDPAEERRHLKEYQKMMAQSLEADRRRQAAKRARSECRDVAADSIMQI
                     WEQDILPRWNDAIRERRTRDMWWRGIAPRSRGAVWTRAIGNELGLTKTSYEAALSRAR
                     EAESKAKSGHGRAEDMRALSWFSAISKDVRERTWPDLRIFQPGGPLHQSLVDILRAYA
                     MYRSDIGYVPGCNTIAALLLLNLPTPTDAFIALANVLNRPLPLSFYLSDAGAKSSAYN
                     LLLHNLSQKSPILHEHLTHLPDPDPDLYLNDVFTGLFTRHLALDAATRLWDVYVFEGD
                     ALLVRAGVALLLQKEMALLGTKSIAEVRTALGTAPGGGNSPRVVGGSDEEERWMKAVR
                     EAGKA"
     gene            2147953..2148841
                     /locus_tag="THITE_2117036"
                     /db_xref="GeneID:11518525"
     mRNA            join(2147953..2148399,2148491..2148621,2148683..2148841)
                     /locus_tag="THITE_2117036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654170.1"
                     /db_xref="GeneID:11518525"
     CDS             join(2148158..2148399,2148491..2148621,2148683..2148762)
                     /locus_tag="THITE_2117036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654218.1"
                     /db_xref="GeneID:11518525"
                     /db_xref="InterPro:IPR011058"
                     /db_xref="JGIDB:Thite2_2117036"
                     /translation="MRFSTLFFPAVASLFVTAMASSYGNFSRTCTDIKLVHTFFLRAT
                     CCNSSTDGVEAQSHNELILPMCIGMDQVSGYMKWEVYGKFSNFCKNCTMLEAAGGAKY
                     LYTCACTPLIGDRGPIWSTLNLDDGISNNMGTLQCAGGKANMIDPNED"
     gene            complement(2150374..>2152255)
                     /locus_tag="THITE_76756"
                     /db_xref="GeneID:11518526"
     mRNA            complement(join(2150374..2151108,2151220..>2152255))
                     /locus_tag="THITE_76756"
                     /product="bifunctional delta12/omega3 fatty acid
                     desaturase"
                     /transcript_id="XM_003654171.1"
                     /db_xref="GeneID:11518526"
     CDS             complement(join(2150696..2151108,2151220..2152255))
                     /locus_tag="THITE_76756"
                     /note="orthologue of bifunctional Delta12/omega3
                     desaturases from Claviceps purpurea"
                     /codon_start=1
                     /product="bifunctional delta12/omega3 fatty acid
                     desaturase"
                     /protein_id="XP_003654219.1"
                     /db_xref="GeneID:11518526"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="JGIDB:Thite2_76756"
                     /translation="MAPVTGSSLPAANKPFLRRNLTATAIDSDSSTVVSPVDSPRPSP
                     STTSLSSLASEDAAPQKKSEQYGKLIDTYGNEFEVPDFTIKEIRDAIPKHCYERSAIR
                     SLAYVARDMIYLATTFYIWNKFVTPEYVPSQPLRVVLWGVYTFLQGLFGTGLWVLAHE
                     CGHGAFSPSQKLNNFVGWVLHSALLVPYFSWQLSHSKHHKATGHMERDMVFLPRTREQ
                     HATRIGRLAHELSELTEEAPIVTFLQLLGQQLFGWWNYLLTNVTGHDNHERQREGRGK
                     GKKNGFGGGVNHFDPRSPLYENRDSMYILLSDLGLAIAISALIYLGKTFGWSNMFVWY
                     FLPYLWVNHWLVAITYLQHTDPSLPHYTEEEWNFVRGAAATIDREFGFIGRHLLHGII
                     ETHVLHHYVSTIPFYHADEATEAIKPVMGRHYRSDTRDGPVGFIKALWKSARWCQWVE
                     PSEGAEGRGKGVLFFRNHNGLGTAPAKMPPVA"
     gene            complement(2154342..2156186)
                     /locus_tag="THITE_2117040"
                     /db_xref="GeneID:11518527"
     mRNA            complement(join(2154342..2155096,2155158..2156186))
                     /locus_tag="THITE_2117040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654172.1"
                     /db_xref="GeneID:11518527"
     CDS             complement(join(2154464..2155096,2155158..2156105))
                     /locus_tag="THITE_2117040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654220.1"
                     /db_xref="GeneID:11518527"
                     /db_xref="JGIDB:Thite2_2117040"
                     /translation="MTCTSNGRASGKSSSGNNLPVNHSPSRKRRGPYPSADTPSDRHS
                     GNQPLRNQSSGGRHSESHASASRPSGRITHNASSSRPSDNPPSNDRPSGNYGPRGPAS
                     PRNPSGSHTSGNGRAAPTEPRADQLRRESGSSRRSQTRSPRRPKGKQKQKEGSQKPAE
                     DRNAGHPGGDQKRNVPYLRSSREVKEDPVAERPSREKTLRPVQEAHSNGRQPTKPRTA
                     AEESRQPEEQDQGARGGIDVRNHGRDRESPNAENEESLRDLLLHMQETLDRERAMYRE
                     GLQQVKRMAEDILREQRQSNQALQEESKTITAQFKKCKKLLKRQQTWIQNHLPEEVVP
                     SVETTQPRGRSVDSREWDYIMRSVSVSEGDPDDETYRPSRSPSTEHSWEGSSIEEGSL
                     EAEEEELEDEEEPGDEPGDEPGDEQVEGSDEPEDEGSEEEKPAVDEEQPAPPRDPATA
                     DRGSRKRRATPSATPNPRPNKRPVRETPVVNPYLTRAIENLTLQKQAIGQQVLELMQR
                     RARALEGRGTRWNPLVLE"
     gene            complement(<2157696..>2160699)
                     /locus_tag="THITE_2089378"
                     /db_xref="GeneID:11518528"
     mRNA            complement(join(<2157696..2158130,2158195..2159737,
                     2159807..2160189,2160450..2160551,2160625..>2160699))
                     /locus_tag="THITE_2089378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654173.1"
                     /db_xref="GeneID:11518528"
     CDS             complement(join(2157696..2158130,2158195..2159737,
                     2159807..2160189,2160450..2160551,2160625..2160699))
                     /locus_tag="THITE_2089378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654221.1"
                     /db_xref="GeneID:11518528"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="JGIDB:Thite2_2089378"
                     /translation="MAGRRGSLEPGRHGFSAVNQVKLQSLAVGYLEQKRESQTSGDGD
                     FQTQVPRHPVTGGKVPPSKAPRQRNNEDCNPASLVLFAPTSQYRRSSQRVPSMAPSFD
                     RLREEDLDEELDDLDDVDISDLREKYEVQLEQGYDTFVVIDGLPKVNEERKPKLIKFL
                     LKKLNTVGRTREDLIYMPMGDDGNSLQFAFVEYSSPAEAAAAVRQLDYTVLDKSHTMR
                     VNKLTDIDRYGREGRIDEEYTPPEIEPFQEKEHLRSFMADPSGRGRDQFVMFRGDSVG
                     VFWNNEKDQPENIVDRQHWTETFVQWSPLGTYLTSVHAQGVLLWGGASWSRLKRFPHP
                     FVNLIAFSPNEKYLVTWSNRPISIPDSGHPALSLDDDGKNYVIWDIETAKPLRSFAQQ
                     DIPGTEEHAGVKKPPKFPWPAFKWSADDKYVARLNQGTSISVYELPKMNLLDKTAVKI
                     DGVMDFEWAPATPRRDGVKTYEQLFCFWTPEIGSNPARVALMSIPSKQIVRSLNLFSV
                     TDAKLHWQSDASYICVKVDRHSKSKKSQATTLEIFRVKEKGVPVEVVDTIKDTVINFA
                     WEPKGDRFVIITTTEPIGPTAVPPKTAVSFFCPEKTKGNTVGNFKHLRTLEKRNNNAI
                     YWSPKGRFVVIATVHNQQSSDLEFFDLDFEGDKPEAEKDLTANLQLMNTSEHYGVTDV
                     EWDPSGRYVASWASAWKHSMENGYHLYDFKGELLREEAIDKFKQWQWRPRPPTLLTRE
                     EQKQIRKNLREYSRVFEQEDAERISSADVAVVQHRRRLLEEFYAWRAVVEEELAEERA
                     ALGLPADPVAELLKAKTAEIAPQGEVQEQVIEEIMEEVLEETEEIVN"
     gene            <2160785..>2162583
                     /locus_tag="THITE_2145149"
                     /db_xref="GeneID:11518529"
     mRNA            join(<2160785..2160787,2160852..2161006,2161083..2162457,
                     2162524..>2162583)
                     /locus_tag="THITE_2145149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654174.1"
                     /db_xref="GeneID:11518529"
     CDS             join(2160785..2160787,2160852..2161006,2161083..2162457,
                     2162524..2162583)
                     /locus_tag="THITE_2145149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654222.1"
                     /db_xref="GeneID:11518529"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Thite2_2145149"
                     /translation="MASFSPTQIFDEGTTEEKGENARLAAFVGAIAVGDLVKSTLGPK
                     GMDKILQSASTGEIMVTNDGATILKSIALDNAAAKVLVNISKVQDDEVGDGTTSVAVL
                     AAELLREAEQLVAKKIHPQTIIEGYRIASQAALKALEATAVDHSNNPEVFKKDLQAIA
                     RTTLSSKVLAQDRDHFSKLAVEAILRLKGSSDLSHIQIIKKVGGKLSDSYLDEGFILD
                     KKIGVNQPKRLEKAKILVANTSMDTDKVKIFGARLKVGSTSQLAELERAEREKMKAKV
                     EKIKAHGINCFINRQLIYNWPEQLFTDAGIMSIEHADFDGIERLALVTGGEIASTFDD
                     PEHVKLGHCDLIEEVLIGEDTLIKFSGVAAGEACTIVLRGATDQLLDEAERSLHDALA
                     VLSQTVKEPRTTLGGGCAEMVMAKAVEGAATRVEGKKQTAVAAFAVALRQLPTILADN
                     AGLDSGDLVARLRKAIYDGMTTYGLDLMTPGGGIADMRELGVIESYKLKKAVVSSASE
                     AAELLLRVDDIIRAAPRKREKH"
     gene            <2165269..>2166705
                     /locus_tag="THITE_2050120"
                     /db_xref="GeneID:11518530"
     mRNA            join(<2165269..2165588,2166146..2166289,2166405..2166439,
                     2166512..>2166705)
                     /locus_tag="THITE_2050120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654175.1"
                     /db_xref="GeneID:11518530"
     CDS             join(2165269..2165588,2166146..2166289,2166405..2166439,
                     2166512..2166705)
                     /locus_tag="THITE_2050120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654223.1"
                     /db_xref="GeneID:11518530"
                     /db_xref="JGIDB:Thite2_2050120"
                     /translation="MSYIPKAVLLNFFPRAGFRWRRGQGSPRILRSGRRDDVVRRAVR
                     ELLGGGDMDKRSVQDLVVTALVAVTTAINDPSAGIRPSEGIIDFLERSAQLSALGQAL
                     PEDIWVELVYQIADARARYKRHTSAAEQEGDRDQLTALAHAIDDLVRAAGKKWDWSSL
                     EFYAYPHLMGEDDLDYEVDEEEDDDDDDAASANKKPEEDESMEDSAGEELPRRMEQLD
                     IQDVDGDVEMGM"
     gene            2168010..2168888
                     /locus_tag="THITE_2117049"
                     /db_xref="GeneID:11518531"
     mRNA            join(2168010..2168206,2168308..2168888)
                     /locus_tag="THITE_2117049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654176.1"
                     /db_xref="GeneID:11518531"
     CDS             join(2168116..2168206,2168308..2168666)
                     /locus_tag="THITE_2117049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654224.1"
                     /db_xref="GeneID:11518531"
                     /db_xref="JGIDB:Thite2_2117049"
                     /translation="MAPNGIPIATLGGNAKIAEGVSALLAPDYDFVHICLSPETALAE
                     LPQVCAGKLDGPNAAQLGSNAQRAVGERRTPKAVVFGAGVADAEADNIVAAIKEVAPD
                     INIVRVPREEVVAASGGKTPPEVGVIAKIVKEKLDALVAKGLLEAAA"
     gene            complement(2168969..2171018)
                     /locus_tag="THITE_2117052"
                     /db_xref="GeneID:11518532"
     mRNA            complement(join(2168969..2169341,2169405..2169567,
                     2169644..2169786,2169848..2170225,2170300..2170466,
                     2170530..2171018))
                     /locus_tag="THITE_2117052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654177.1"
                     /db_xref="GeneID:11518532"
     CDS             complement(join(2169267..2169341,2169405..2169567,
                     2169644..2169786,2169848..2170225,2170300..2170466,
                     2170530..2170902))
                     /locus_tag="THITE_2117052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654225.1"
                     /db_xref="GeneID:11518532"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="JGIDB:Thite2_2117052"
                     /translation="MLRSLCANWLLLLLGTGLAPIGATAQAAGQVRLAWPTQHHQVDP
                     AILDALRKHSDPVDALVSLHPEMAAQLAQPRLLHVFGEPAAKWMTEGDKLRLKRQGKK
                     FADITDHQEFYGQDLSAMAGEAHLPKLSHQRFVKPLFHHVSQRRIKDVLRHMTSYYTR
                     YFDSITGEHSAMWLHDHIADIIRESPFHTHISLEIFTHPFAQPSIIARFEPKVRNFSQ
                     PLTILGAHQDSMNYLFPLLPSPGADDDCSGTVSILEAFRVLAHSGYVPINGPVEFHWY
                     AGEEGGNLGSLAIARYKKESGARIGAMMEFDMTAFVARNATESIGLIETQADAALTKW
                     VVDLAKEYVSIPAKIYQLPSNAGSDYMAFTQFGYPSTFATEGNPSPFPGEYDPYIHTV
                     NDTMYVDDETGVFSIEHMARFSELAIAFAVEQGGWDNKWR"
     gene            <2172187..>2172744
                     /locus_tag="THITE_2089383"
                     /db_xref="GeneID:11518533"
     mRNA            <2172187..>2172744
                     /locus_tag="THITE_2089383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654178.1"
                     /db_xref="GeneID:11518533"
     CDS             2172187..2172744
                     /locus_tag="THITE_2089383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654226.1"
                     /db_xref="GeneID:11518533"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Thite2_2089383"
                     /translation="MRGQLSDSDLNWALGYACDMGDEDAVRALLADGAPASGPSNYKR
                     ETLPGASTPLHIAVHAQHAGIVECLAEKGADLDARDEAGRTPLHYAAARDVVGMLLKL
                     GAAVDVRDNAGETPLDAAVRERRHAAVVALLAKGAQPTQPIAPKLTPRWVRQVNMLGG
                     STQRVQPNNLRGLQPFTMQYWSRDT"
     gene            complement(2173686..2175567)
                     /locus_tag="THITE_2117053"
                     /db_xref="GeneID:11518534"
     mRNA            complement(2173686..2175567)
                     /locus_tag="THITE_2117053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654179.1"
                     /db_xref="GeneID:11518534"
     CDS             complement(2173892..2175172)
                     /locus_tag="THITE_2117053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654227.1"
                     /db_xref="GeneID:11518534"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Thite2_2117053"
                     /translation="MADFERLPPSGISVIIVGAGFAGLTAAIECDRKGHSVILLEKAA
                     ELQPLGDIISFGQNSSRFFDKWAGVREELNPLVHKSDSFNFYDWTGRFVTTQSFAEEH
                     RVWGPRVNGHRGEIHQAVLRHARARGIDIRLGCNVVNYFEDADRAGVETDTGERLTAD
                     VVLAAEGVRSRGRKLVLGFEDKPQPSGYAVFRTWFPTDELLKNEKTRHLVANGDSHNG
                     WIGKDVHFLVAAIKDGKEISWVCTHRDNGSIEESWQFPGKIEDVLRVVDGWDPVVQEL
                     VRLTPPDRLFDYKLVFRDPLPTFVSPKARTALIGDAAHPFLPTSIQGASQAMEDGVVL
                     AACLDRAGGPAGVPEAVRVWERIRYERVHKIQKTGVTTREQWHKADWDAIWKDPQSLH
                     LKREEWILNFDAEADAYARYDAVREQLEKERAQA"
     gene            2176871..2178195
                     /locus_tag="THITE_2117056"
                     /db_xref="GeneID:11518535"
     mRNA            join(2176871..2177016,2177097..2177233,2177307..2177807,
                     2177869..2178195)
                     /locus_tag="THITE_2117056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654180.1"
                     /db_xref="GeneID:11518535"
     CDS             join(2177004..2177016,2177097..2177233,2177307..2177807,
                     2177869..2178054)
                     /locus_tag="THITE_2117056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654228.1"
                     /db_xref="GeneID:11518535"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="InterPro:IPR014876"
                     /db_xref="JGIDB:Thite2_2117056"
                     /translation="MSTPLTDEETRTYTRIIDGILATVDLQTVTRKKIRQGLEAAIDK
                     DLSDQKNAIKTLIEARFDAISSEAAQAIPTPTSGAAAESSPNHDANGRSPSDDADDDR
                     GADGEIRVSLPPASKKQKRESSTEDADARLAAELQAQENRLSRGRVTRGAGAGNAKAK
                     PKTIKKKKSAKRVRSDDDDSNAEDSDGGDKPKRKAGGGFQKPFILSDPLAELCGESQL
                     SRPQVVQRLWKYIKGNNLQDPNDGRQILCDEKMRAVFKQDKVTMFTMNKLLGHQLYPI
                     DE"
     gene            2179118..2182354
                     /locus_tag="THITE_2117058"
                     /db_xref="GeneID:11518536"
     mRNA            join(2179118..2179825,2179889..2182354)
                     /locus_tag="THITE_2117058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654181.1"
                     /db_xref="GeneID:11518536"
     CDS             join(2179388..2179825,2179889..2181967)
                     /locus_tag="THITE_2117058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654229.1"
                     /db_xref="GeneID:11518536"
                     /db_xref="JGIDB:Thite2_2117058"
                     /translation="MASTGLAAPPSDGSGALDHAPSGPRGDGHRGRGRGRGGRGRGRG
                     DGQRGGRGSARGGPHHPSAQQPPAEAAADDANAKPPPSGKPPNFKVKNDTQDEGTDGE
                     VEVCFICANPFSHYSVAPCGHITCHICALRMRALYKNKDCPHCRTTAPFVIFTDDGAK
                     RFDEYTDADITSTDDNIGIKYASEDIVGDTVLLLRYNCPDADCDFAGLGWPDLHRHVR
                     SVHHKKMCDLCTRHKKVFTHEHDMFADKELTEHMRHGDDKPGAADQTGFRGHPLCGFC
                     GARFYDSDKLYEHCRNKHERCFLCDRRDSRQPHYYLDYNALEEHFRRDHFLCPDRECL
                     EKKFVVFESEMDLKAHQLSEHGGSWAKGRDARTVDLSNFDLRQRYEQERRGPGGGRDQ
                     QRRRGPDPNAEPLPVSSAQPLRRDELAFQRQMALQNGGASRPTPPGPSAPVSSGPVSG
                     SATPQAQARGPAGRPIIDVMENLRITDLSSLTPEQRASLTRHGAVIERASNLLGNDPS
                     KMTTFRSHISTYNKGSMTPQQLIDAFFALFSETSSHALGTLVREVADLFEDKKKGEAL
                     RRAWQNWRAAEEDYPSLPGLGGMRGATTSTTGWAAAAAASSSGPAGSSAQAAAAHAAA
                     QLRHSTRVLKLKNSTRRGSTSGQSVLSAASSSSTPNPTAASSSSSTSNSAPAPGRPPA
                     ASAAAFPALPGSQPQSQQPQQRPIWIGGSSSAIGGGGAKTPSAKKPGSAPGAALSREE
                     AFPALPAAPKPQTTIFGYGTGAVRRDLFSGPRDTGFSWGGGGAGASASAGASGGGQGS
                     GGAQGSGGGGGGGGAAGSEEAQGQQGGKKKNKKQVLAHWG"
     gene            <2183156..>2185471
                     /locus_tag="THITE_2049447"
                     /db_xref="GeneID:11518537"
     mRNA            join(<2183156..2185104,2185186..>2185471)
                     /locus_tag="THITE_2049447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654182.1"
                     /db_xref="GeneID:11518537"
     CDS             join(2183156..2185104,2185186..2185471)
                     /locus_tag="THITE_2049447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654230.1"
                     /db_xref="GeneID:11518537"
                     /db_xref="JGIDB:Thite2_2049447"
                     /translation="MLSAVWLFSVLPGYGALAQAVACSGSPSRLHIPDQQYDNYFLSD
                     CHSSAHVVVTNPLAAANPAQAVARLLVAWPAGNSGAAAFFSPENGTASTLGLHLENST
                     SSGEALDPVYEPAQGNGNPRVGVAGQVHFDSPAVLTLSILGSIRNIRDYTEGGGVLNN
                     DIQNAIQATKYGNSGATVSRMWFDNTTTTWLDFAPSDASDPVQIVPGGGARLRFGNGT
                     YSFRASFNYPQLQQLSPEQVLNNASQGLVAQNQDQTTSLSFLSYKEKLLAGTWRFLTY
                     FGRDTLITALLMQPVLSEGQGGAMEAVISAALERINQTDGTVCHEEVIGDFATLTNLE
                     NGVASNAPSCDYKMIDTDYYLPIVMKNYFVDSDTGRRRASDFLATKASFLPGNAGLTY
                     LELAQRTAEKIMRLAAPFAAPGGQTVDNLMHLNPGVPVGEWRDSNNGLGGGRIPFDVN
                     TALMPAALRAIAALSRAGFFSTHPDWKDAADRYAQVWEDETLQFFRVSLTQADARNLL
                     NDYVSSGAFAGPSNAANITRDGVVFYGLALRGDTTTTTSNQPNQPDANIIRAMHTDDS
                     FRHFLLNTTDQAQLSAFLSQTADHILAPFPAGLATSVGLVVANPAYYGADPAAALWTT
                     SDYHGTVVWSWPQAMMAAGLGRQLGRGTSSGKGKGDDDHGEEEPAFCRDKPLREKVRA
                     AYHRLWDLIEANAAQSSEEMWTWRWDPQSGFVAVPFSDVSSTESDVRQLWSLAFLAVR
                     REDL"
     gene            2190234..2192465
                     /locus_tag="THITE_2117062"
                     /db_xref="GeneID:11518384"
     mRNA            join(2190234..2190635,2190723..2190932,2191019..2192104,
                     2192193..2192465)
                     /locus_tag="THITE_2117062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654183.1"
                     /db_xref="GeneID:11518384"
     CDS             join(2190434..2190635,2190723..2190932,2191019..2192104,
                     2192193..2192320)
                     /locus_tag="THITE_2117062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654231.1"
                     /db_xref="GeneID:11518384"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2117062"
                     /translation="MPVINVGTSADPVVTRLVAEDKVVWYKKPNLRRMYIFLFLCCMG
                     VEMTSGFDSQLINTLQYAPTFHQYLGNGRKDAKGNYAIEPGLLGFVNSCYQLGSIFAV
                     PLAPWFAQRFGRRWSVMLGSWVMVVGAILQGFAQHVAMYIIARMILGMGILFCIVSGA
                     ALLGELGHPKERAVLTSLFNSSYFIGQITASAIAIRTPDLPGNWAWRVPSLLQICPSL
                     LQIFTIFLVPESPRYLISQDRDDDARDVLVKYHAEGDASSLLVQAEMVQIRETIHTEK
                     EVSRQSWWELLRSAGMRRRVLISIFLGIFTQMSGNTLLSYYSGKLFDMMGFTAEDTKT
                     RINLANACWGFINATTLALIITRFRRRVMFMVSATSMCLVFIAMTVSLQRIQVAQDAG
                     TTNQAAGISGLFWYFAYSPCYNLGNNALTYTYLVELWPYSHRSRGIGVQQIFGKLAGF
                     FSTNVNSIALDAIKWIYLAIYCGWIFFELCIVYWLYPETSGRTLEELAFLFEDSSLNE
                     RTVSAVEKQIHYGDAHDVKHDEGQPVAEVKSVV"
     gene            complement(<2193043..>2194975)
                     /locus_tag="THITE_2145156"
                     /db_xref="GeneID:11518385"
     mRNA            complement(join(<2193043..2194583,2194618..2194622,
                     2194800..>2194975))
                     /locus_tag="THITE_2145156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654184.1"
                     /db_xref="GeneID:11518385"
     CDS             complement(join(2193043..2194583,2194618..2194622,
                     2194800..2194975))
                     /locus_tag="THITE_2145156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654232.1"
                     /db_xref="GeneID:11518385"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Thite2_2145156"
                     /translation="MDRTGPDLPAPDLFDSTRFNLCEQWTTLNLNRRAKIRPAQCRPL
                     CTGCDILQRAVDLNVQGTPNPWGLAGDFSTTSAGFPAVIELARDWLAECSQEHQNCGS
                     AAEAPLPTRVLDLGLGSSDAVRLRELKGHMARYICLSYCWGRLEFLKTTRDNFERHKQ
                     GIKPEELPRTFRDAITIARALGVRYLWIDALCIIQNDVDDADWKRESATMVDVYRHSY
                     LTLAPTWADSAHAGFFLPPEDDGASASIGPVTVHQVRHFPRTATSEASVDFPVLARAW
                     TYQERMLAPRVLHFGRQEMLWECRDGSRCECGGAEYMASDVDKADFHGVVSLHQPRGG
                     LTPQHIWRRMIMQYSPLALTYPTDKLPAFGGLAEEMRRRTGQEYLAGLWRDTLILDMC
                     WYRDPWVDTRPSSETIRRRPTWSWASINEPVTYHANLWGSMLKVRKNVEEYPEVLNAG
                     CSLAGPSPTGPVHDGFVELMCSAIRAYPGGRKLAGCNTKRWDLRVGSALLECYPDWGT
                     KLEEDGKYYLIPMLTIDEDFCGLVVRPSSPDSEEMVRVGLAEKLRIPESEVQDMIGQE
                     KQRVRIV"
     gene            complement(2195551..2199820)
                     /locus_tag="THITE_2117067"
                     /db_xref="GeneID:11518386"
     mRNA            complement(join(2195551..2197179,2197234..2199820))
                     /locus_tag="THITE_2117067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654185.1"
                     /db_xref="GeneID:11518386"
     CDS             complement(join(2196011..2197179,2197234..2199715))
                     /locus_tag="THITE_2117067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654233.1"
                     /db_xref="GeneID:11518386"
                     /db_xref="InterPro:IPR002372"
                     /db_xref="InterPro:IPR010513"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2117067"
                     /translation="MLRRPPGHVAPQRKYLLAFALILLPWLPLADAQQQHQRQRSPVP
                     AHRQRSSPQDDQHAAPNLAATAVTGHQSVETPLVHQRRKTTVTREVEADDARLRNLAR
                     PHNSNNNFIPDDVRAHALAPDLSVRAPPPSNYRGPSSGVGLSQQLARSLEDWEVEDFV
                     LLATVDGDLYASDRKTGQERWHFKADHPLVETVHFRANSSTVDDDYDPIDHYIWVVEP
                     TRDGELYLWRPNERGAGLAKMAWTMKKVVEELAPYDDKANGVLYTGDKKTTMVTLNAA
                     TGTVIKQFGSTGSYVNKVESASCFEPNALADREEECSDDRTITLGRTEYTVSIHRSDG
                     RPIALLKYSEWGPNTQDNDLMQQNIITKDSRYVTGQHDGKVYGFEYGRFSEERPVFTK
                     TLSSPVARVFDVLHRSGTVPGMDPELIVLPQPPLPASDQDSLRLRSEKVFINQTEEGG
                     WYALSGSRYPLILSAPPARIDRLEWWEIRDAWEKLTEAQKSRVLVGTHQLPDRLGTVD
                     PAQYLLDAPPSQPAEPDSLPGGEMPPLLPSPRSEPSGILDTAKRLPGLAVLKVFDLVS
                     NPAAIVLMFVTLWFLYKDRLGSFGRKSVGKVDVLPPQIEVNPSIAPPREEPREEAPVA
                     VVPTEPKAEVVTPEAAPTEANPEKTPDEPSPANLSASPEPSPTVTFADPPETNDGPLA
                     EGGDAAAAGEPPKKKKGHRGRRGGVKHRKGNKDRRETSQSRDDDPAQDSVEEVVNKAK
                     TLVREPKLEPDIITMPGAADEVSGHILKMGSLEVNEAEQLGTGSNGTIVFAGKWDGRD
                     VAVKRMLVQFNEIASQETRLLRESDDHPNVIRYFAQQERASFLYIALELCQASLADIV
                     QKPHCYRELARAGERDMPGVLYQIASGLSHLHSLRIVHRDLKPQNILVNMGKDGRPRI
                     LVSDFGLCKKLEGGQSSFGATTAHAAGTSGWRAPELLIDDDAPGSTSMALTDPGSSLH
                     SASGSGHVGAEGPGPHSRRVTRAIDIFSLGLVFYYVLTRGNHPFDCGDRFMREVNIRK
                     GIYSLQQLDVLGDFAYEARDLIGSMLSANPKDRPTAVEVMAHPFFWSYKVRLNFLCDV
                     SDHFEKEPRDPPSPALAHLEAHAEAVVRGDFLKHLPREFVDSLGKQRKYTGSRLLDLL
                     RALRNKRNHYEDMPDSLKRTVGPLPDGYLAFWGRRFPNLLIVCWNVVWDLGWENTDRF
                     REYYRPVPPWSM"
     gene            complement(2214887..>2216579)
                     /locus_tag="THITE_2096060"
                     /db_xref="GeneID:11518387"
     mRNA            complement(join(2214887..2215215,2215289..2215902,
                     2215993..>2216579))
                     /locus_tag="THITE_2096060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654186.1"
                     /db_xref="GeneID:11518387"
     CDS             complement(join(2215076..2215215,2215289..2215902,
                     2215993..2216579))
                     /locus_tag="THITE_2096060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654234.1"
                     /db_xref="GeneID:11518387"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="JGIDB:Thite2_2096060"
                     /translation="MPAAPTPTVPFSDPPYLLGLPSPYFTESHRKWQAAIRPWLDTHL
                     HAHALEWEQTGTLPDSVFATFAAAHMLLPALPAPLPTAWLKRLGITTLLGGLPVEEFD
                     ALHGYIWGDEMVRSGLAGPSASLTAGMAFGVPLILRFGSAQLQERVLPGLLTCRQRCC
                     IAITEPEAGSDVAGIVTTAVRSECGRWWVVNGRKKWITNGIWADYASMAVRTGPPGSG
                     AAGISLLLVPLKNTPGVTMRRLSTSGTTSSGTTYIELDDVRVPVENLIGDENQGMRYI
                     MTNFNHERLAVATGATRQARVALSAAFEYVLKREAFGKPLVEQPVVRHRLAKAGALLE
                     SLTAWVEQFAFMMTRLPHEPANALLGGPTALLKAHAGMVFKECADVAVLLFGGNGYTK
                     TGQGQLVEMLYREVMGVRIPGGSEDVLLDLAVRQLVKLYRTQTNLLQVAGGSKL"
     gene            complement(2217138..2218100)
                     /locus_tag="THITE_2117069"
                     /db_xref="GeneID:11518388"
     mRNA            complement(2217138..2218100)
                     /locus_tag="THITE_2117069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654187.1"
                     /db_xref="GeneID:11518388"
     CDS             complement(2217282..2217923)
                     /locus_tag="THITE_2117069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654235.1"
                     /db_xref="GeneID:11518388"
                     /db_xref="JGIDB:Thite2_2117069"
                     /translation="MKTSSVAVLSTALAAASAAAAASTEPVAWWDPIRNVTCTGSADG
                     HITCQAGEVEALLKVGHPTVYNTRACAYANTLSFHSAPHSPTTSSTPTPRPPPPPSTP
                     SPSPREERKEPKKSTKPRARDERAERRAQRKPYRPAPTTQPRSPARATARPAAWAASR
                     AAWRRGSASPCATPRACAGAAARMGRLPVGWCVRRGLRRSVDSHRHVVLGLVG"
     gene            complement(2218633..2220793)
                     /locus_tag="THITE_2117070"
                     /db_xref="GeneID:11518389"
     mRNA            complement(join(2218633..2220072,2220156..2220406,
                     2220479..2220793))
                     /locus_tag="THITE_2117070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654188.1"
                     /db_xref="GeneID:11518389"
     CDS             complement(join(2218785..2220072,2220156..2220406,
                     2220479..2220655))
                     /locus_tag="THITE_2117070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654236.1"
                     /db_xref="GeneID:11518389"
                     /db_xref="JGIDB:Thite2_2117070"
                     /translation="MAPPRVLERSTSPEDGPRAILAAAETVTGLVLDDDADVEAFVAE
                     DSPSPVPEEDRVGSPKLPSATAGKTKSPTQQSGSRSGRHGGKGSAAAKAAHLPGQPIV
                     PRKVEDWEPWKDILHQLYITQNRILRDIIGIMETKYNVRATPKMYKNQFARWGFFKYA
                     VKRRSRAQAESPTGNHSDDSLDSIDSLDSFDTLDGALVLTRDALMHESEGAYVRQLGF
                     TAVRRFLHGHIDRNAAHLTTEEVAGFVDPCYRYFKVAMDLFDIEEYVEGGRVLRLAFL
                     QIERKMSNPTMKSFSDLCFLVPHLLLESGRKEILAAYLRYLARLAIVKFGKHPVAELA
                     ASFAKLADERPEDMMRYIMVLSQIHADTIAALPGMLERNRQWARNQYLACQRTVATTA
                     FSSSSSSSSSSSSSSSSRKLAAVGRPHDHHMIRLEAQSVYWAQALIMQDPEVDAMAQQ
                     WLRRQFDADFSAKCEAHLAALQARVAEGSFPAVFARLMECLFVGWLYDYYETVEDWDR
                     AFRWGRLGLDLCTDEQYAIWSIHLEKLMARHGRPGEAAELRRRRQQHAWMEKVRLEVD
                     RLTLG"
     gene            <2224248..>2226572
                     /locus_tag="THITE_2023894"
                     /db_xref="GeneID:11518390"
     mRNA            join(<2224248..2226104,2226153..>2226572)
                     /locus_tag="THITE_2023894"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003654189.1"
                     /db_xref="GeneID:11518390"
     CDS             join(<2224248..2226104,2226153..>2226572)
                     /locus_tag="THITE_2023894"
                     /note="Contains conserved domains HepA[COG0553],
                     Superfamily II DNA/RNA helicases, SNF2 family and
                     SNF2_N[pfam00176], SNF2 family N-terminal domain."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654237.1"
                     /db_xref="GeneID:11518390"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Thite2_2023894"
                     /translation="PREAYVEMIDALAAEYDVATAEDDDYGAVDLDVLDTYIGSYNSG
                     DSDIQWSACLDFFNINQAEYQKREALASRPGSGERKRVPMKKLPGMTVGLFDYQLMGV
                     FNLLRFILNDVPGGLLCDEQGLGKTQEMYGIIALVHNLRRCKAEVKAAWKKTAPAGKK
                     NAPLPSKHNLAGSVARTCPLDERYGFRCYCYNELTRELADRLPEGPNVLVVPERSAAS
                     TLRDAKAKLDTKVFKIRGCFSGVEKDDKLAAGDISALRATITATQGGDDGPVLQLQAA
                     GAGRGDYIIITDPVQVNHRNTPFAFALKAAKSAETPDKKSAFVVPGMVLADEYHEHAC
                     REDSATLPWLEQLKELCLDSQLSAPLAYFVSGTPLDDTIADLRSPLALLEQAAWGDET
                     HALHCASSAAVDDLIGTFKEVTIRQNLGEVVERSEIADCRRRLDRVLKQVMVRRLGTD
                     KFQGRNLTDIGPLKVNIVDHQLPAAALADLQALAERTSQSAARNAATCDMTLPEAIRC
                     GYTQHDLYKLRVASTFPGIARHPEPPFAFNDAEASAMLAAAGGEAARTPYFPHVPGWA
                     AGSPKLATITRTIATMLADNSPVPGAATTAKKYCIFTPLGAEALLIQCYLQHLPTLLY
                     EGQPAGARRAALEGFLNATTRAAPNVLVASLAAAGTGLNLQAARYATLTGPAWTKRAN
                     QQAYYRIHRVGQRVPTRLQLLLARWNPAERMILAGYRGAANRVRDGEEDTWWEVANRW
                     CVDAEEGENREDGIVERHQ"
     gene            <2241216..>2242192
                     /locus_tag="THITE_2145164"
                     /db_xref="GeneID:11518391"
     mRNA            join(<2241216..2241234,2241311..2241314,2241480..2241801,
                     2241861..2241968,2242025..>2242192)
                     /locus_tag="THITE_2145164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654190.1"
                     /db_xref="GeneID:11518391"
     CDS             join(2241216..2241234,2241311..2241314,2241480..2241801,
                     2241861..2241968,2242025..2242192)
                     /locus_tag="THITE_2145164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654238.1"
                     /db_xref="GeneID:11518391"
                     /db_xref="JGIDB:Thite2_2145164"
                     /translation="MRKMRSGLFHAVQADLSEKTEVIRLVDEAASASGNRLDVIISNV
                     GWTRMWNFSDLDDNVAEEDWDRCFSVNVKSHLWLFHAARKWLEESNAREEGAAVFVST
                     ASIAGCKPSGSSLPYAVTKAAQIHLMKSLAIIAAPSIRVNCVSPGVLLTDWGLSFPPE
                     RLDAVKEPNKLKRFAAVDDVARQVLTFVTSRTVTGQNAIIDAGFSL"
     gene            complement(2242448..2244045)
                     /locus_tag="THITE_2117072"
                     /db_xref="GeneID:11518392"
     mRNA            complement(join(2242448..2243480,2243533..2244045))
                     /locus_tag="THITE_2117072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654191.1"
                     /db_xref="GeneID:11518392"
     CDS             complement(join(2242576..2243480,2243533..2243860))
                     /locus_tag="THITE_2117072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654239.1"
                     /db_xref="GeneID:11518392"
                     /db_xref="JGIDB:Thite2_2117072"
                     /translation="MATTAPPPLQVHLPPAKQVELNSREDILFLHPGYDSRNILLSLP
                     RVDGATSTSTYGVHHRTALLACQIIARNAFANSFLALDKAGQQRVQEPLDGILTNAEY
                     YFFVQGSVLYPIVPSFRDWEFPHGRIPDWWPAITPTSVSSEDCAVTNAGYAVDEAHLV
                     PKEEQDWYIDNSMKRYGLDPPDIDNKANILPLRKDIHYVFDTRGFVVVPKICTTDPSL
                     QPSPQYVTHIISRNAAELWPTHHNTLVRSLHAESRAYLFARFAWAILFRVKPFIIEGL
                     ERYVIRISRAEAGGIEYKAKSYTGTELRDTYGGGGSKSATPLNAKKRKSLQGSAANDE
                     ASFTESSRDSDSDMMDTDSLWDVMSDQRGNGGNRIQESSEETAPDTKVCLAPDIEADL
                     REALRKGMAQQQETVLED"
     gene            <2247987..2250190
                     /locus_tag="THITE_2155092"
                     /db_xref="GeneID:11518393"
     mRNA            join(<2247987..2248070,2248143..2248250,2248390..2248482,
                     2248568..2249141,2249198..2249283,2249352..2249400,
                     2249482..2250190)
                     /locus_tag="THITE_2155092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654192.1"
                     /db_xref="GeneID:11518393"
     CDS             join(2247987..2248070,2248143..2248250,2248390..2248482,
                     2248568..2249141,2249198..2249283,2249352..2249400,
                     2249482..2249948)
                     /locus_tag="THITE_2155092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654240.1"
                     /db_xref="GeneID:11518393"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2155092"
                     /translation="MAADSINEVSAEKAAQDELRDVESATNEYTPTLTFTPAEHRALL
                     WRQDLTILPLSATIYFLCYLDRSNIGNARILNSSTHNDMQTEIGATAYQFNVALMVFL
                     VGYFAFEVPSNILLKKLRPSRWLAFLMFSWGAVTMGLGGVHTFAATAGVRFLLGAVEA
                     GLFPGLVYYLTFWYRHDERSVRVALILASATLGGAFGGAIAYGVGHMNGARGLSGWRW
                     LFILEGAPSCLSALLVLLFLPDYPEESLKGRQRELALARLRVEGSKSRDRSMTWQDAK
                     QTLMDWRLYGHYIIYFAVSLPFSSLSLFTPSIIAGLHYVDLDAQLFTVPPWAVAYVTQ
                     IVVAYSADRFNARGLHSAAFALIGAAGFIGSAVLPPDAYLHRYGCLIVAAAGSFACIP
                     PMLGWLTSNVRTTAAVGLAIAINVSIGAGIGQMPGVWIYKADEQARGYPTGHWVNAAM
                     LLVVAVGALGLRVLYGHRNKKLLRESGGQEVTLYKL"
     gene            complement(<2250344..>2251033)
                     /locus_tag="THITE_15576"
                     /db_xref="GeneID:11518394"
     mRNA            complement(<2250344..>2251033)
                     /locus_tag="THITE_15576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654193.1"
                     /db_xref="GeneID:11518394"
     CDS             complement(<2250344..>2251033)
                     /locus_tag="THITE_15576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654241.1"
                     /db_xref="GeneID:11518394"
                     /db_xref="JGIDB:Thite2_15576"
                     /translation="SILNLSTKQDPFAFLATFHTVLLVDDSTRGRRETPSRIMQEAAG
                     ALTAICAAHDMEGVDMYFFSLGSSGWFKLRSSEEARMPWQWATAAFTTPMGARIDQIL
                     TPYLDKYKAAAASGETIKPINMVVLTASVSADDPGPVIARIARQLDTLEAPPRQIGIQ
                     FVQVGTDEAVAEALQSLEDYLRRCPGGEFRQIVDIATFKTLKGRGSENFVTASSILTV
                     MLGAVMRRCCQR"
     gene            2252338..2253435
                     /locus_tag="THITE_2117075"
                     /db_xref="GeneID:11518395"
     mRNA            join(2252338..2252627,2252691..2253435)
                     /locus_tag="THITE_2117075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654194.1"
                     /db_xref="GeneID:11518395"
     CDS             join(2252417..2252627,2252691..2253244)
                     /locus_tag="THITE_2117075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654242.1"
                     /db_xref="GeneID:11518395"
                     /db_xref="JGIDB:Thite2_2117075"
                     /translation="MEGSGRELVDYVDRSLQEEEEFHFLRFEFLQRLNIAQLQLDLVR
                     LKSNIRRSNVLSNEDKQTLHTKLRDYATAIRDYKELRNKRSVPKKEMRKRRLLLQRYF
                     ASHGLGVDDFHSHYSYFSEDVDAHAKIDPLRQALMRRLPTWFTFSQHEKAERKKEYSE
                     GKRPKEVSAPVDRLARFLIAFTGGSFLIVPMVIMSLDPSQTKSLITVSLAVLLFILLL
                     SFGIRVSNVETLVATATYAAVLVVFVGTSSGNTGGQ"
     gene            2258281..2260330
                     /locus_tag="THITE_2117076"
                     /db_xref="GeneID:11518396"
     mRNA            join(2258281..2259336,2259388..2259602,2259658..2259747,
                     2259834..2260330)
                     /locus_tag="THITE_2117076"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_003654195.1"
                     /db_xref="GeneID:11518396"
     CDS             join(2258507..2259336,2259388..2259602,2259658..2259747,
                     2259834..2260045)
                     /locus_tag="THITE_2117076"
                     /note="CAZy_ID 269823"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003654243.1"
                     /db_xref="GeneID:11518396"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Thite2_2117076"
                     /translation="MKSIATLILLAGGAAGQQSAYGQCGGINYSGPTSCVAGYACTSW
                     NPYYYQCVPGTATPTPTPTSHTSTAVTTTSTSKSTSSTKTSTVSTKTTSSSTTGPTAT
                     GFAKTNGLLFEIDGVTKYFAGTNCYWCGFLTSNGDVDHVFADMAAAGFKVVRVWGFND
                     VNTIPLTGTVWYQYLSASGSQINTGEYGLQRLDYVVSSAAAHGLKLIINFVNNWNDYG
                     GINAYVNAFGGNASTWYTNTAAQAQYQKYIEAVVSRYKDSTAVFAWELANEPRCSGCD
                     GSVIYNWAATTSRYIKSLDPNHMVTMGDEGFGPLAGGDGSYPYQTGAGGYTWVDNLNI
                     STLDFGTLHLYPDSWGQPYSWGDLWISTHGAACVNANKPCILEEYGGGNNCTVENPWQ
                     ATALGTKGIAGDMFWQYGDTLPSCNCQTSQDGNTVYYNQGNWDCMVTQHVAAINAS"
     gene            <2260966..2267008
                     /locus_tag="THITE_2078736"
                     /db_xref="GeneID:11518397"
     mRNA            join(<2260966..2261363,2261421..2262003,2262055..2262811,
                     2264392..2264429,2264502..2264616,2264681..2264933,
                     2265077..2265129,2265195..2266280,2266345..2266391,
                     2266440..2267008)
                     /locus_tag="THITE_2078736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654196.1"
                     /db_xref="GeneID:11518397"
     CDS             join(2260966..2261363,2261421..2262003,2262055..2262811,
                     2264392..2264429,2264502..2264616,2264681..2264933,
                     2265077..2265129,2265195..2266280,2266345..2266391,
                     2266440..2266550)
                     /locus_tag="THITE_2078736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654244.1"
                     /db_xref="GeneID:11518397"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR011118"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="JGIDB:Thite2_2078736"
                     /translation="MALHRGLAAIAVFFLVANALAASSGFWRDRQTAPSGSGSRCNST
                     WFARTVPAGATVEKVAVVQQGGTYGEGVADSAYPTDPTDLPALCAVTVRVQSSASSSY
                     RFGLFLPDEWNSRFLVVGNGGWAGGINWLDMAVGPRSGMASLSTDTGHSSGTTDSAWA
                     RSEPEKKTDWGWRAVHGSTVLGKQLVSSYYGDKQRLTRSYYSGCSTGGRQGLKELQLF
                     AESFDGALIGAPAWWTSHLNTYLTQAGLYNLPATDGKHLSLADMSLIANEVTRQCDSA
                     DGVADGIVSSPELCKPDLTRLLCPSTTPNNTLAPCLTQAQINTAQNIYNPFTSASTNI
                     LHPGLTPSSEPQWWLVLGGDEPSPFGVGYARDFLYDDGGWDWRTFDAGVVAFAEAADP
                     GNATAADFAALARVRQRGGKLLLYHGLADGQIPAGDTELFFRRVVEVLGAGGGRGGSG
                     AAGGERAGKEEEKAAAADGVADFLRMFLVPGMGHCFGTSVDAPWDFGGAMQAGVLGSS
                     VRSVPGFEDADHDALMALVEWVEHGRPVDRLVATTWNSPLDAASGVKRQRPICAWPKK
                     AVWDGKGNVDAAARVGKGIIASSTGLLLKTLGLRVSCIKIDPYVSVDAGLMAPAEHGE
                     CFVLCSGGEVDLDLGNYERYLSVRLTSDHNITTGKTYLNVIERERRGDYLGKTVQIVP
                     HITDSIKDWIRRVSKIPVDGSSDEPDVCIIELGGTIGDIESMPFIEALTQLRHEAGSG
                     NFMVIHVSYVPTVHGEQKTKPTQHAVKSIRSYGLIPDIVACRCETPLAESTIAKLALH
                     CQVEKDQVLVVRDMPTIYQVPLLLSEQKLIPQLRSKLALDRVTISPAMAARGADLWET
                     WKTVVTPIYQDEVKIALVGKYVTCQDAYLSVVKALEHSAMRIRRKLNLMWINSEDLEP
                     TNKGGAAQTKYHKAWHDVSTASGIIVPGGFGHRGTEGMMKVSQWARENEIPFLGVCLG
                     FQVAAIQYARDKCGMPEATSEEFDAQAKDRVVVNMPELDREKMGGTMRLGLRKTIFQP
                     DSEWSRARSLYGGVEVIEERHRHRYEINPELVETLEKAGLHFVGKDETGQRMEIFELK
                     DHPFYIGTQFHAEYQSQVLNPSRPYLGFVAASAGCLDAVIKQQPVEPFNMITVNGTAK
                     "
     gene            <2267441..>2268223
                     /locus_tag="THITE_117774"
                     /db_xref="GeneID:11518398"
     mRNA            join(<2267441..2268023,2268117..2268139,2268191..>2268223)
                     /locus_tag="THITE_117774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654197.1"
                     /db_xref="GeneID:11518398"
     CDS             join(2267441..2268023,2268117..2268139,2268191..2268223)
                     /locus_tag="THITE_117774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654245.1"
                     /db_xref="GeneID:11518398"
                     /db_xref="JGIDB:Thite2_117774"
                     /translation="MDAQPLTTSQLAIRTKQSLDPSNHGHGAPSTPRGPGLMILPVEL
                     LSEICRLLCLHCYAEHDAEAAFAPPKRDEQVALRSLCLTCRLLRTVAQPFLFHALATS
                     RRDTLGLFVRSLLDRADLRPSVFQVVVTQSPQDRSPVYPRTGPVIEEVMDRLRAGAWP
                     PFWCDLISESEAVREYLLEPLRRLRKMKLSRRKQSSRWILISVEPPAPAYQI"
     gene            2273918..2275249
                     /locus_tag="THITE_2117082"
                     /db_xref="GeneID:11518399"
     mRNA            2273918..2275249
                     /locus_tag="THITE_2117082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654198.1"
                     /db_xref="GeneID:11518399"
     CDS             2274213..2274947
                     /locus_tag="THITE_2117082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654246.1"
                     /db_xref="GeneID:11518399"
                     /db_xref="JGIDB:Thite2_2117082"
                     /translation="MAPILREASSLETLECHGWRQTSIETKPLSAVLGWMMPADTALY
                     GLTELSLVDIWLPFEYFQDLMKLVGPQLSRFTIQQHTVVFFSLAAVIAELQPWRGTLQ
                     SLAYRLKEDALKDHPHQAPPVAHLLREFGALERVDTHVHCFGTEEGAPPEDTFASALA
                     PSLRHLRLRGDMIDNSMPLQGLLDAVRVGDFPRLAEIVVDQCPSVSPVDGVTSESEGE
                     AKLSALALAFRERGVRLVADEAPETY"
     gene            complement(2275250..2277660)
                     /locus_tag="THITE_2117084"
                     /db_xref="GeneID:11518400"
     mRNA            complement(join(2275250..2276937,2277012..2277092,
                     2277168..2277660))
                     /locus_tag="THITE_2117084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654199.1"
                     /db_xref="GeneID:11518400"
     CDS             complement(join(2275553..2276937,2277012..2277092,
                     2277168..2277525))
                     /locus_tag="THITE_2117084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654247.1"
                     /db_xref="GeneID:11518400"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2117084"
                     /translation="MDHKPRPSSQHHLDSEVPTLAPSQTSLSDDGKISARGEQTDLDI
                     GSTSAVDAPAFDEKRIEETHDERNNALDRQATAASKTGAGLEQAPTREDGTEYPKGVK
                     LAMIVLALCLSVFTMALDNSIIATAIPKITDQFHSLPDVGWYASAYMLTTAALQLLFG
                     RFYTFFSIKWVFLLAIFLFEVGSLICGVAQNSVTLIVGRAVAGMGAAGIFSGALTILA
                     YSVPLAKRPIYTGAIGSMYGLASISGPLMGGAFTDHVTWRWCFFINLPVGGVTMLVIA
                     IFFPDPKRDTTVGGGDTLRQRIMRFDPFGTVVFMPAIISLLLALQWGGTEYAWNSWRI
                     ILLFCFFGVLILVFVAIQIRQGDRATVPPRIMRKRSVWSAGFFILCLAAAFLGSVYYL
                     PIWFQSVKDASAVGSGLMNLPMLVAVVLASVVAGGAVSTWGYYTPFMIAGSVVASIGF
                     GLITMFRPDTSEGVWIGYQIVIGVGIGISFQQPLMAVQTVLDIADVATGTSVIVFLQT
                     LGGALFVSVSQNVFTNKLVHYVAEYLPQIPDPSFILGVGATGVRDAVAPALVPALKQA
                     YNDALTQTFIVFTALSAVSLLGALVVEWKSVKGKPVEIGMA"
     gene            complement(2279779..2282218)
                     /locus_tag="THITE_2117088"
                     /db_xref="GeneID:11518401"
     mRNA            complement(join(2279779..2281299,2281371..2281574,
                     2281633..2281688,2281750..2282218))
                     /locus_tag="THITE_2117088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654200.1"
                     /db_xref="GeneID:11518401"
     CDS             complement(join(2280035..2281299,2281371..2281574,
                     2281633..2281688,2281750..2282051))
                     /locus_tag="THITE_2117088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654248.1"
                     /db_xref="GeneID:11518401"
                     /db_xref="JGIDB:Thite2_2117088"
                     /translation="MRYEDWDVILFPTGRDSKIPLKEFKVACHVVPDVELAHIHGPAG
                     VPVMTCFVPSLPPGVPFQISLHSWRRPEISQFTRTYSKHSDLVKFEARIMIDGRLVAS
                     AILDRDVNGPHLVTSTFEFTKTGELERLRFPQFRRELLFQSHWNPGDDIGRIKIIVSE
                     GFPRDSLSAPIERVKNVVVFSFQHAPLEILETNGIAWPNPSMWRCAVFNSAMPVPTYQ
                     MDDGVSSHAHSPGKKSLLLKNFKNQGFPPPATASGMCQPQPGTGVFANQALQVPYLGR
                     STMGSVGTPSYSELSAESAYADWFSAMTSGSSGNPWDEKAFCAATGRNPSKQPSDTLM
                     ADYDSSQQPEPMHISGSSLEDDPMCLKVPTNTPTGVPTDDGQNPPFPTTQLGVSLPSD
                     FTSSLTQSLLNQPFPLPSQQPNLFFPQPEAKASKENRQSMRGPVDATMQSATAQAGTS
                     GPRRASQQLFGINGLDGTLPVSTSDDRAGKDDNTSPALETLFPGSSRNDSAGEFGSLL
                     ANLGCHNAGSSLATPNSTGQAEPGSSNAPNGVAALGSGGGGTNSASGGGNGSGNAVAK
                     RTRNFTPASVRAIDEEDEPRRASPRVRVAGYGGADIPGDVGQ"
     gene            complement(2282747..2284014)
                     /locus_tag="THITE_2117090"
                     /db_xref="GeneID:11518402"
     mRNA            complement(join(2282747..2283133,2283206..2283517,
                     2283586..2284014))
                     /locus_tag="THITE_2117090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654201.1"
                     /db_xref="GeneID:11518402"
     CDS             complement(join(2283104..2283133,2283206..2283517,
                     2283586..2283774))
                     /locus_tag="THITE_2117090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654249.1"
                     /db_xref="GeneID:11518402"
                     /db_xref="JGIDB:Thite2_2117090"
                     /translation="MLSRRVMRASPFRAAALPAAARRLPFIQQRGFLPESMAGRSKID
                     EKYPDSDYPTLSPEEDPDMNGGYINPPRIKRQFRDPHADWWDKQERRNFGEPVHEDHD
                     ILGMFSPYEYTWITPGKGLFQIGVFVAVFLSVCYAVKLTYPDRASYPREFEGGLEREL
                     GGPGGVRARMPGDPDP"
     gene            2284153..2289660
                     /locus_tag="THITE_2117092"
                     /db_xref="GeneID:11518403"
     mRNA            2284153..2289660
                     /locus_tag="THITE_2117092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654202.1"
                     /db_xref="GeneID:11518403"
     CDS             2284355..2289622
                     /locus_tag="THITE_2117092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654250.1"
                     /db_xref="GeneID:11518403"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Thite2_2117092"
                     /translation="MTTEIASPSPTQAGPPPTPGDNAPHHARRPSTTPPKQAESVKQS
                     VSRPSETVNGASNDEHNSEHPAGTPRASGLRSTRDEPAATGVNDGPPAKRRRVRDTTP
                     NNAVRKPKPESPPWKKIEADGPSTFTTEDGRRKSGRINAVPLELQPGDKRITRGVLHS
                     QQQQYSPSKTRYGATNGHGAGPVSTPASAAVKRSVSSTKQTLAKQSTSKPPPKKPPAQ
                     EPRSSTRSHRRSASPKRVVTPAKSSLGTRRSARHLRETANDDETTPAVTRTTPRIKLR
                     MRPPLTTIPLVHRDQANLRPKLGPTFEEFFTRAADIPAEEGGLFVPSEDGPRYTEEAA
                     REDAQLILRVEKEVEPGGVLAPDRCSVFEPEPEEEPPRQWAHMDHLTKAMSNFRRLML
                     LEHQRHRATAKRLAVACEAEWRRRNPQPKTAEEIELEEIEQSKARWRQVNKVIAGMWE
                     NVKTEVNRRRLAEWEAEEQRRVKAALNQAVNRSEQQLQARQTRFDTEELSEEDLDGDD
                     ILSETSDGDDSDGGTEGSGDVSSEEGSDEDMSSSDDEEDAESELSDEALTQEQLREKY
                     ANLPDLDVSSEAKKDSPGAELADGIAEAASEVDTSDESIDMDDDLGSTEEESEAEDGA
                     EGSGSADESEDEPSGLLGLFFKKSELKKLKAEAAAEEPGTSQDDVEMADANSVPHPEA
                     ATHNGGDEIPSEDGRRATTPRPTAVPTHQTTQEPTGNGEPSLAPQEPPPQSAVASAGS
                     ERAMDAKQEPTEDVSMLDAPLAPVTFSQPVANSTESIPPSIITQPYSPATEPITNILS
                     PSRSQSPRTSDDTKPTDFETPRSVSLLNAPKTDSRSASPQPAAPRTEIPFLLRGKLRE
                     YQHHGLDWLASLYANNTNGILADEMGLGKTIQTIALLAHLACYHEVWGPHLVIVPTSV
                     MLNWEMEFKKWCPGFKILTYYGNQEERKRKRQGWTNDDVWNVCITSYQMVLQDQQVFR
                     RRRWHYMILDEAHNIKNFKSQRWQTLLGFNTHSRLLLTGTPLQNNLTELWSLLYFLAP
                     PENGEGGFVDLQEFHNWFSRPESQILESGREQLDDEARAIISKLHKVLRPYLLRRLKA
                     DVEKQMPAKYEHVEFCRLSKRQRELYDGFLSRADTRATLASGNYMSIINCLMQLRKVC
                     NHPDLFVDRPIMTSFRMQRSVASDYEPNERLVRKKLLAVPPMQVVSLSFLNMIPTLYE
                     GMSTRDADRISQLSSHRILVDLREAQKTRANNAYHALDPASVTSNLVYLESAARWGRF
                     EELQHCVYINALRRQQRPIYGKRLIEMLTLDTHRRPYKPRPKVPQKIMSWFEEDSYLL
                     HNAIPTLQQRADAMETTISKFACVTPAVVTGDMTRLLLGDKGVEAFQEADLKLSAPVK
                     YAPYMPKERPPDPWHEARMRLTIQFPDKRLLQYDCGKLQVLDKLLRRLQADGHRALIF
                     TQMTKVLDILEQFLNIHGHKYLRLDGATKVEQRQILTDRFNYDTRILCFILSTRSGGL
                     GINLTGADTVIFYDQDWNPAMDKQCQDRCHRIGQTRDVHIYRLVSEHTIEANILRKAS
                     QKQMLDDVVIQEGEFTTDYFNRLSVRDVIGTNGEVRANEDDVAANAAMDRVLGGVESG
                     NPRSAGRVLEQAEDKEDVAAARVAEKEITQDDADFLEQQPGSGGASGVSSVRQGTPRE
                     GTSEPQASAAGRSGLGLFAESADYGEGSGAAAAAEPAEVEYNAFGERMRTVDDYMLGF
                     MARALEGTPLELPRDKKKSKKKGKDTRKR"
     gene            <2290879..>2292216
                     /locus_tag="THITE_2089412"
                     /db_xref="GeneID:11518404"
     mRNA            <2290879..>2292216
                     /locus_tag="THITE_2089412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654203.1"
                     /db_xref="GeneID:11518404"
     CDS             2290879..2292216
                     /locus_tag="THITE_2089412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654251.1"
                     /db_xref="GeneID:11518404"
                     /db_xref="JGIDB:Thite2_2089412"
                     /translation="MKAIPSLVLAGAGLALAATGRSSGRRDASLFKRTGYNLCESDCN
                     LAGMAYPDKHTLQLMLENYWSEQCPPIYIGSDANAPTATSKVCLDIIDADVYFNFSSF
                     PGYTYQDAVVTWKLIGNLATPDQWSPPPPPASTVSCGPNPSGDGLACKLPFSDILGAS
                     ASSSIEELLAGMCPNGDSAGLGLYLEFAGDVLSAADGSVAQFHQSPPCTARDATGQCT
                     ARDTSYSYIEMAYRCSVCDTAPACPTSTSTSTSSTSTTTSSTSSTSSTTTTSSRTTTS
                     TPPPVATSCSGGTAFGYQPPAGTTPKSTQLDTLSGQGCNRWGWYMTPTLAELQAGSVF
                     GTLYVGAGGNDISKATNVGIWSAAADGAGRVTVVYTLNPGYGLAEVHVDLACLPLAKC
                     APGQYTFGQSGLRDLPTFVAGAGGELKYPSCRAGSKAALIVHAAVDVIGGACK"
     gene            complement(<2292669..>2294298)
                     /locus_tag="THITE_2031644"
                     /db_xref="GeneID:11518405"
     mRNA            complement(join(<2292669..2293725,2293795..2294041,
                     2294112..>2294298))
                     /locus_tag="THITE_2031644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654204.2"
                     /db_xref="GeneID:11518405"
     CDS             complement(join(2292669..2293725,2293795..2294041,
                     2294112..>2294298))
                     /locus_tag="THITE_2031644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654252.1"
                     /db_xref="GeneID:11518405"
                     /db_xref="JGIDB:Thite2_2031644"
                     /translation="SLYQLPATRVVESRLCREHYRAHDPSALLPDGSVPEELCKVEAV
                     QQRLGRIQGLGEMLWVAGDFFMTIPLVSLADHRGHHFVLCLNLVPRAVLLGWTFAVGY
                     FDQGLPVHAILAAPALSLLGGDCVFNSIVYALVSELTDDHVLRATFFGYVNAVTSIFS
                     LQLGPALASASMSALLWLPLWIGIFLLLLAVPAVSALRLPSRPQHRNLHLDSDPEAND
                     PSTPLIPPQNSPPRTSSSDSDSESNRTRPALAARTTARLRALRRLLAAPSRNLALLLA
                     VFFLAALASADTRLLPLYVSARYAWRLADVGYLLSAKAGWNFVWLSLVVPWALRWRRK
                     QRRRRQGWRGGCYHRAEDAVTGDADTDTDTDADADAENVVLARACLAVSVLGALAIAL
                     APSIAVLLPALLLYALGIALPMFTYSLLRSPSMGVVADAPGGPGSHLFSLVMLVRTVA
                     SLLGAALMPSLWVAGLGLGGAALGLPFMASAACYAFAWVLVARIEV"
     gene            complement(2295398..2296181)
                     /locus_tag="THITE_2117093"
                     /db_xref="GeneID:11518406"
     mRNA            complement(2295398..2296181)
                     /locus_tag="THITE_2117093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654205.1"
                     /db_xref="GeneID:11518406"
     CDS             complement(2295409..2296026)
                     /locus_tag="THITE_2117093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654253.1"
                     /db_xref="GeneID:11518406"
                     /db_xref="JGIDB:Thite2_2117093"
                     /translation="MDTASQQARRRRGPGGGFRLPNFALIATVFLHPSQFSPTAAAAV
                     DIAPRLMLPAALHDDLSGQMHALHRRSQGEHVVLADCRDRNGVVSSQMAYFPGDPGPS
                     PQDVAVVATAKGQAALWVNTNTSGLFTDTGTTFTATLGPRVEDGQFAGTGNNGYGNFS
                     CYQKYVSRLYTYDNTVCSQVYVCDHSTPPPPGGLCRLRSRISSAR"
     gene            2296619..2297781
                     /locus_tag="THITE_2117094"
                     /db_xref="GeneID:11518407"
     mRNA            join(2296619..2296993,2297098..2297350,2297444..2297781)
                     /locus_tag="THITE_2117094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654206.1"
                     /db_xref="GeneID:11518407"
     CDS             join(2296765..2296993,2297098..2297350,2297444..2297453)
                     /locus_tag="THITE_2117094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654254.1"
                     /db_xref="GeneID:11518407"
                     /db_xref="JGIDB:Thite2_2117094"
                     /translation="MADIFARIQSATDHEVRTVLAGLCADRRVRESAGELFDRLERAS
                     KHYAADALYICINCRQAYVEALNAAGGCRYHPGHLVLDPDSDAWVDCYGDEIRDDEDM
                     RRDNPDGFEWSCCGKSGSEPGCTRASHKQGGAKRARTGGAHPQPVPRGQSDGGSAKRA
                     RVE"
     gene            complement(<2308898..>2309092)
                     /locus_tag="THITE_2049609"
                     /db_xref="GeneID:11518408"
     mRNA            complement(<2308898..>2309092)
                     /locus_tag="THITE_2049609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654207.1"
                     /db_xref="GeneID:11518408"
     CDS             complement(2308898..>2309092)
                     /locus_tag="THITE_2049609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654255.1"
                     /db_xref="GeneID:11518408"
                     /db_xref="JGIDB:Thite2_2049609"
                     /translation="IQAFIDNIVIYLDDAKDYIQYLDTIFSLFANKNIAFSLAKLYIG
                     YLSVELLSFYVDSLSLTTTI"
     gene            complement(2357071..2358627)
                     /locus_tag="THITE_2117096"
                     /db_xref="GeneID:11518409"
     mRNA            complement(join(2357071..2358210,2358291..2358627))
                     /locus_tag="THITE_2117096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654208.1"
                     /db_xref="GeneID:11518409"
     CDS             complement(join(2357275..2358210,2358291..2358329))
                     /locus_tag="THITE_2117096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654256.1"
                     /db_xref="GeneID:11518409"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Thite2_2117096"
                     /translation="MSTKPLEKIAIIGATGRIGGAFAKALVRTGKHTVTALTRPGGSS
                     KLPEGVKPVEVNYDDEAALVEVLKGQQFLVITLGVRAPADLHGRLCAAAAKAGIRYIM
                     PNVYGYPERQSDDPYSKAVLSRIEEAKNNGATTSIVLACGFWYEWSLGLGEGWFGFTI
                     EDRKVTFFDDGKRSITVSTWNQCGNALAALLSLPEAGASPSLADFANKTVRISSWSVS
                     QRDMLDSLHRVLGTTDADWQIKYEPTAKRIEDGKVQLQKGDMRGFAKQLYGAIFLASN
                     KTSDYARTDGTANAVLGLPQEDLDEATKRTVEMVEGGWDPLGIRNLKD"
     gene            complement(<2359391..>2361316)
                     /locus_tag="THITE_2129735"
                     /db_xref="GeneID:11518488"
     mRNA            complement(join(<2359391..2360658,2360731..>2361316))
                     /locus_tag="THITE_2129735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654209.1"
                     /db_xref="GeneID:11518488"
     CDS             complement(join(2359391..2360658,2360731..2361316))
                     /locus_tag="THITE_2129735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654257.1"
                     /db_xref="GeneID:11518488"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2129735"
                     /translation="MRYRLLSALAAASAAIVADASPAASATYDYIVVGSGPGGGPLAA
                     DLARAGYSTLLIEAGTDQGDNPTYADIANFNEAANDETTRWDFWVRHSDDAARDLKFK
                     HTTWDTGDGTFYVGLDPPPGAKLLGIQYPRAATLGGCAMHNAGVCSLPAADDWDTIAN
                     RTGDPSWAADNMRKYWKRIEKNEYLPAGDASHGYDGWLATSVADMSWAKNDSLPETRI
                     LKKLAELTGQNPDDVASLVNRDILAAGKDVDETTSFYSMVTHADNQGKRSSPNNYIRA
                     TLADPAKYPLTVKLNTLVTRVVFDEATVNKTGTTPRAIGVEVMEGGSLYRADPKHVAN
                     ATGPVSQILARREVIVSGGTFNSPQILKLSGIGPAEELAQFNISVVADLPGVGENLGD
                     NYEGSILAIGAAPVNSGLITLLFRTPSAPTKKRNIFTWCGAFSFEGFWPGFPTDYGPN
                     EYTCAMVHMAPKSQAGSVRLASADPQDRPAINFRFFERHGDEDLRELVEGANLLRASF
                     AAAGAPAVPLVEQHPCANGTDCTDAAQAEFFKLQAYSHHATSTCAIGGDGDRMAVLDS
                     KFRVRGVRGLRVVDASAWPVVPGAFPSCPTMMLSAKAADDIIADAKQEQAA"
     gene            complement(2362549..2364591)
                     /locus_tag="THITE_2117098"
                     /db_xref="GeneID:11518489"
     mRNA            complement(join(2362549..2363711,2363781..2363889,
                     2363976..2364114,2364204..2364591))
                     /locus_tag="THITE_2117098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654210.1"
                     /db_xref="GeneID:11518489"
     CDS             complement(join(2362838..2363711,2363781..2363889,
                     2363976..2364114,2364204..2364395))
                     /locus_tag="THITE_2117098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654258.1"
                     /db_xref="GeneID:11518489"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Thite2_2117098"
                     /translation="MSQFYRVVEHTVDCHHSREYVTATVHGDADKPRLAVKQYIPLDN
                     PDPQPGDVTIIGAHANGFPKELYEPLWDDLYARAAKSGIRIRSIWIADMWNQGQSGVL
                     NEAILANDPSWWDHARDLLHLINQKRDEMPHPLVGIGHSMGGAQLTLIALSNPRLFRS
                     LVLLDPVLQLTGTGIAPAMASTRRRDLWPSRAAAAAMFRQSKFYQAWDARVFDRWMRH
                     GLRPLPTALYPSPPSTNTTTNPPATSGGGGDDDQPVTLTTTKHQELFTFLRPTYSRLN
                     DGSSSSPLDRPVDLPAHFDAGGSGSGGSGSGGYPFYRPEPLYAFSRLPELRPSVLYVF
                     GGESDMSTPELRRAKMAATGTGAGGSGGAARGRVREVVLEGRGHLVAMEAVAACADAV
                     AGFLKDEMQLWRAEMAAFERSRAAADRRELMVIDERWKRELKPKI"
     gene            2365243..2366761
                     /locus_tag="THITE_2117100"
                     /db_xref="GeneID:11518490"
     mRNA            join(2365243..2365644,2365719..2365987,2366043..2366266,
                     2366351..2366761)
                     /locus_tag="THITE_2117100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654211.1"
                     /db_xref="GeneID:11518490"
     CDS             join(2365487..2365644,2365719..2365987,2366043..2366266,
                     2366351..2366698)
                     /locus_tag="THITE_2117100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654259.1"
                     /db_xref="GeneID:11518490"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2117100"
                     /translation="MSSTAARHSTATSQQPLAIGTQITSPSGKSYKIDEIIYQRSRGS
                     MLCCLYRASHEGKQYVLKDILPGDFQYILELQKLVDCSAHVRTLVDSIPDRHMFVYPF
                     LDTNLQLVETTAIPPSVKKNILRDALAGLADLHDKGIYHTDIKPANIMMNSFKQSDGT
                     IAFKNVQITDLEDAVVLPPDSQGLGKRLSGNQFWRSPEAWARAAQHTPADIFSFGIVA
                     IYVWLNRMVFYSDEANQAADPSDMILRLHVSHFVNDIDDFDGFVEYHGGEEAPFVQRF
                     IGLLDSFNGEDKKRRPFSRWYPVDPQFKDLVCKMTCLDPLRRITAREALQHPWFSE"
     gene            complement(2367273..2368988)
                     /locus_tag="THITE_2117102"
                     /db_xref="GeneID:11518491"
     mRNA            complement(join(2367273..2367446,2367548..2367819,
                     2367890..2368084,2368148..2368988))
                     /locus_tag="THITE_2117102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654212.1"
                     /db_xref="GeneID:11518491"
     CDS             complement(join(2367375..2367446,2367548..2367819,
                     2367890..2368084,2368148..2368775))
                     /locus_tag="THITE_2117102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654260.1"
                     /db_xref="GeneID:11518491"
                     /db_xref="JGIDB:Thite2_2117102"
                     /translation="MASSDSDRDAADNAGTLPRRSLLILIWTCCSAAFLLVAVRTIIR
                     LRSPSGSRTPPADDCFIFFALASLITLCVLETVQLPSLYYITGILSGAVPLTSAETII
                     AETENYLRFQFPIVILFWTVLWSVKASFLALYFRLFRDLKWYRRVWFVLAVFTFLVYG
                     GCIVTLSLSCGPDVRNFFRFAQCAGPQHVWSSNFSVYFSTASDVVTDLCIMAMPLRLI
                     YNIKVSFKQKAGLVCVFSLGFVMIVFSIIRANQSLAQQGFVNLTLLMVWSTLAASISV
                     FVGTLPALKVLITTNARSSANRSGHAGGSSAATTRITSATMQKNSTLGTPTNSVALGS
                     LRRDSHNLKAANMSNSEASESQEEILVQRDVTVSYSQAPRPSPTRYHQRFNNDR"
     gene            2370160..2371698
                     /locus_tag="THITE_2117103"
                     /db_xref="GeneID:11518492"
     mRNA            join(2370160..2371444,2371528..2371698)
                     /locus_tag="THITE_2117103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654213.1"
                     /db_xref="GeneID:11518492"
     CDS             join(2370614..2371444,2371528..2371653)
                     /locus_tag="THITE_2117103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654261.1"
                     /db_xref="GeneID:11518492"
                     /db_xref="JGIDB:Thite2_2117103"
                     /translation="MLRRSKFNLTSLAARTWALVLALALFLLAPQAHALPTQTAWPPH
                     SKSVRPQRPCFAQRNFNTISRIYNLTVYPNNVPIIQAGGAAVPRGLFSQDVVGRVDPV
                     GNFTSFEDSIEYFFALAPLPTGNAAEAAITGYQITEFSSQCRDVASSVVYLYCSVWNP
                     GQADHLKPLPPLKQVAFWRFDKHGAVLYYDAWIPNLNSWVQTTTAAYVGDAAYQAASI
                     EQICGGTQARCTGANTQWNSTAECVAALSAKPYGTYDEAWGDNIVCRSIHLVLTQVRP
                     DVHCPHVGPTGGGKCVDIAYPENYFSDEELYGQPAGETFMCK"
     gene            <2374613..>2374921
                     /locus_tag="THITE_160423"
                     /db_xref="GeneID:11518493"
     mRNA            <2374613..>2374921
                     /locus_tag="THITE_160423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654214.1"
                     /db_xref="GeneID:11518493"
     CDS             2374613..2374921
                     /locus_tag="THITE_160423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654262.1"
                     /db_xref="GeneID:11518493"
                     /db_xref="JGIDB:Thite2_160423"
                     /translation="MERETYTITSFNRRALLNILKDSGFPQNTPQILYTDSLTARLAV
                     LNPLNVARIRCIDIRYKWIIEQVKQDKFAVQHIRGIEMPADGLDKATGQGTTPQVSWF
                     "
     gene            <2375970..>2376873
                     /locus_tag="THITE_2050849"
                     /db_xref="GeneID:11518494"
     mRNA            join(<2375970..2376243,2376367..2376704,2376772..>2376873)
                     /locus_tag="THITE_2050849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654215.1"
                     /db_xref="GeneID:11518494"
     CDS             join(2375970..2376243,2376367..2376704,2376772..2376873)
                     /locus_tag="THITE_2050849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654263.1"
                     /db_xref="GeneID:11518494"
                     /db_xref="JGIDB:Thite2_2050849"
                     /translation="MCIHAVRLCPGCGAATNFRDLDACDQALHCPETRSYELPLRREH
                     FHKWDCPTPECAFNNTHLRDVEREYLLVRLAQKGGDPEALIPPLTADVHVPPDTAHGS
                     SSAQVANVTNHSNDGLDSKTVQSASRQSKSRMTTERVRVSELPGSVQQQIQALVDTIA
                     SKRQAPRGRTCSAASPRKSERWLAEEEELLLLLKNNGFGYSQIEDFLSWRHINPLRRR
                     VTKLQRNGERRRSEGAVGR"
     gene            complement(<2378196..>2378546)
                     /locus_tag="THITE_2049774"
                     /db_xref="GeneID:11518495"
     mRNA            complement(<2378196..>2378546)
                     /locus_tag="THITE_2049774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654216.1"
                     /db_xref="GeneID:11518495"
     CDS             complement(<2378196..2378546)
                     /locus_tag="THITE_2049774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654264.1"
                     /db_xref="GeneID:11518495"
                     /db_xref="JGIDB:Thite2_2049774"
                     /translation="MSRSPPKHATTGFVIDLSTIVSTSRSGDKTLLPGSREAIAALQE
                     KDVPFVIVSRDTGMTEKEVAKDLEKKFNIEVRPSAVVLPQTPFRDHVAEYKDKTVVII
                     GGDGEKALKIASRYG"
     gene            complement(2378751..>2380423)
                     /locus_tag="THITE_2117105"
                     /db_xref="GeneID:11518496"
     mRNA            complement(join(2378751..2379585,2379679..2380157,
                     2380244..>2380423))
                     /locus_tag="THITE_2117105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654217.1"
                     /db_xref="GeneID:11518496"
     CDS             complement(join(2379051..2379585,2379679..2380157,
                     2380244..2380420))
                     /locus_tag="THITE_2117105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654265.1"
                     /db_xref="GeneID:11518496"
                     /db_xref="JGIDB:Thite2_2117105"
                     /translation="MTNRGVGFPNNGVDDQGWKLYITSLVMILAAGLVVIARVSIRLA
                     RRNFGYDDVAIVAALLFSIVLSVSIQLAVEHGYGMHKADLTKDEQEEALKWFFIAQTP
                     YKVTVCLYKISVILLYLRIFVTKTFRIAAFVVLSIVVGYSLGGIGATIFQCVPIRGAW
                     VKNSGATCINSDQFWVAYAVLNILTDVLVLALPVGPIMNLHLRWRERFLIWGVFMLGA
                     FVTVSSILRVASVQNSLKNIQDQTYNFIPRGIWTLVEANLGIISACLPVLKPPLSALF
                     PRLFGSTGKKSTAPARSEGSRPGGQSNDPWSSVSAANRSNPRFWRVPLKHELSVSISA
                     ARPNRNSDEHQIIGASDKGSTNDSVELNERAPNLKRGDSGGISKTVEVVRQSFHEQRG
                     LASI"
     gene            2380836..2382751
                     /locus_tag="THITE_2117106"
                     /db_xref="GeneID:11518497"
     mRNA            join(2380836..2381412,2381484..2382751)
                     /locus_tag="THITE_2117106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654218.1"
                     /db_xref="GeneID:11518497"
     CDS             join(2380920..2381412,2381484..2382664)
                     /locus_tag="THITE_2117106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654266.1"
                     /db_xref="GeneID:11518497"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Thite2_2117106"
                     /translation="MRSTDVTWWFCAALVAVTPTGLAAATGTPSCSKTGPGKLLTVAT
                     SNGPVTGHIAPNTSCVVEYLGIPYAKPPVGDLRFAAPQPLDCSDQRPYVAANFGFDCP
                     LTPSKPVDYPGFTPQAQRIINYFASGAGTPQSEDCLTLNIWSKATATAATAKKPVIVF
                     FYGGRFTIGNTDSPFYNGRHLADAQDLVVVTVNYRINIFGFPGAPGQTQNLGLRDQRL
                     AVEWVQKNIARFGGDASRIVLAGQSSGGVAVDYWAYAHEQDAIAAGLILVSGNAFSFP
                     LPAPATATKNWNTVVAAVGCNTTTDQSAVMACMRAANWTDIKAAAAAIKPGASTSVLR
                     SVPAFYPQVDNEFVFADYLNRTQAGRFARLPLLGGNNNNEAGYYRIPAFASGVVPTDA
                     QVAAFHLESFTCPVARQAAARTAFGVPAWAYRYFADWDNTRLYPGSGAYHGVDLHMVF
                     GASAEVSGLPTTAEQRALTALVQRAWYVFASDPWNGLQRELGWPRWQVGRPTLAVLGQ
                     NNTAQPRFVDPNVYAAPCSTVTLGALGTPTATATASASASAAATATPTP"
     gene            complement(2382734..2383287)
                     /locus_tag="THITE_2117108"
                     /db_xref="GeneID:11518498"
     mRNA            complement(2382734..2383287)
                     /locus_tag="THITE_2117108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654219.1"
                     /db_xref="GeneID:11518498"
     CDS             complement(2382839..2383048)
                     /locus_tag="THITE_2117108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654267.1"
                     /db_xref="GeneID:11518498"
                     /db_xref="JGIDB:Thite2_2117108"
                     /translation="MGWPVSCPNRGPARFLLLLLTRLQTWPLCFPCFIIGHSSTASRM
                     AIMSHHLDDLEKSPETERHRPGPYL"
     gene            <2383424..>2386141
                     /locus_tag="THITE_117756"
                     /db_xref="GeneID:11518499"
     mRNA            join(<2383424..2383527,2383836..2383865,2383952..2385057,
                     2385138..>2386141)
                     /locus_tag="THITE_117756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654220.1"
                     /db_xref="GeneID:11518499"
     CDS             join(2383424..2383527,2383836..2383865,2383952..2385057,
                     2385138..2386141)
                     /locus_tag="THITE_117756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654268.1"
                     /db_xref="GeneID:11518499"
                     /db_xref="JGIDB:Thite2_117756"
                     /translation="MESHRIDLQTPSSLRRHPETLPGNRTDSDVPKPQGVADKSEAAA
                     VWTEPIADLKSEKEKRGVGLKRSQMFRSTPGAHHVGQTREQQKITGTGVTRAAGAEKS
                     QHCNWDDRDLIVKSTSSVPLSHGNSSKQSSQGHDQAAPRTPDVLSFLENDSPPVTQES
                     ILQAIAQASENWSPRSISSFGSLGSSRRSASGTDTTTPDQSIDGGTRPSTASDPSASR
                     ARANSGEKPTCRPRRPQPHPHSHPRLEGEVHDRYGTPEMARGPAKHPHLAPSELQPRL
                     VAPGQGYPKYLPRAEKLPMSGYELLAAKLSSSGLTSRSRRGSGGTSTSSEGDDEYPTI
                     RPIYRKFEALNHRLLLHLQDELSELEEQLHRLDTADTQTRRLQNCILPASRRAEFMAG
                     GELQWRKTDILGKIGFKLGQYNHALESFTKTLRLPAPSAAAVEHYRTYLATHHPIAEV
                     ETRFLDHPATDLACLAPDTASCASRSPSPSPSPSSSSWRGVEDSDGLLTPVPRRGSPA
                     SSGSSGACVGDAPDGAAAIHATRTRSSSPASSGSRASFFPEWRTQQLERHRPQQQQRL
                     LTQQQQHAIAGGTNRSPQAAPSISASTAAPARPPWPSVDGTTTPTATATATDRSPTAT
                     ATDTDRSPAAAQTDHNPADLEAELNLETQTAILAAAAALAPIITFRVVHDFVGRVAVV
                     VVAGRAVAALTRRLREILILKGGRASAAAGDAGSAAAAAAATAAGGGWHVVVAYGLVM
                     VVVAAVF"
     gene            complement(2386171..2388537)
                     /locus_tag="THITE_2117110"
                     /db_xref="GeneID:11515925"
     mRNA            complement(join(2386171..2386305,2386387..2388537))
                     /locus_tag="THITE_2117110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654221.1"
                     /db_xref="GeneID:11515925"
     CDS             complement(2386525..2388465)
                     /locus_tag="THITE_2117110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654269.1"
                     /db_xref="GeneID:11515925"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR006107"
                     /db_xref="JGIDB:Thite2_2117110"
                     /translation="MGRIPTAELCRYLLSGQLSRRGCVHLRRPIAATAAWHPTTRPLQ
                     PSRPSRARPVTTRSFASQAHNAGANADTLDTATSSSLTPPRAPVPPVVALRKQLKEQK
                     KKKKKKNVDNQTVPGWELTVGIEIHAQLNTARKLFSPAAASFNDPPNSHVALFDAAVP
                     GSQPLFQPETVIPAVRAALALGCAIQPVSRFDRKHYFHWDQPAGYQITQYYHPFARDG
                     RIVLYARDGIAPEDGDRVEIGIRQVQLEQDTAKTTAHPGGVHWLDLNRVGLPLIEIIT
                     LPQIRHPATAAALVRKVQTLLAAVDACVYGMEAGGLRADVNVSVRRAEDAHAPAGPLG
                     TRTEIKNLSSFKAVEDAIIAERDRQIAVLEAGGVVQGETRGWSLGSTETRRLRAKEGE
                     VDYRYMPDPDLGPLVIGDDLVAHLASSLGVLPDTEIDELVERRGLSSKDALSLTTLDN
                     GARIQYFYNVLGALEERLGLGGGDADGDQRHALLAANWCLHELGKLTELPSELGMTRD
                     GECRVPSADLAAILSHLHRREITARVAKELLWCVFRGEIATGGVTQAIDEHGLWFKEL
                     SEAEYAEIADLVAEGETKVLGEFLRFKQGKAKAYPHGKLMFLVGKMMRAGPEERMDPA
                     AAERIMRARIEDVYLPAMEAGV"
     gene            complement(<2390494..>2391556)
                     /locus_tag="THITE_2023945"
                     /db_xref="GeneID:11515926"
     mRNA            complement(join(<2390494..2390910,2390980..2391316,
                     2391390..>2391556))
                     /locus_tag="THITE_2023945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654222.1"
                     /db_xref="GeneID:11515926"
     CDS             complement(join(<2390494..2390910,2390980..2391316,
                     2391390..>2391556))
                     /locus_tag="THITE_2023945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654270.1"
                     /db_xref="GeneID:11515926"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Thite2_2023945"
                     /translation="AVSPPSQHLAPFQLDGSAKRAGPARPVNIDLSVWRPGKTDLQWS
                     GDVFVGTPPQKFNLIFDTGSPFLLIPAKNCTTCGTHPRFDPTASSTFDAQPGYRAYVG
                     FGSAGGGTVASPEPQGANCTIVSDTVGMGTARGAHSQFLACDVYSSLLTAEPPDGLFG
                     MPSTPNITLPRPEFSFSLIPDGCRAGVLTLGGTDPSLYVPGTLRKIPLDWPLSESRNW
                     FVIDVRGARVVDGGGRGGPAAGGVAAPPLANTTDGVALVDTGSANMVTPDRDTTRALY
                     GRMSDQIVPIDEMGSWGAPCALLDRVARDVV"
     gene            2392478..2394202
                     /locus_tag="THITE_2117113"
                     /db_xref="GeneID:11515927"
     mRNA            join(2392478..2393351,2393430..2394202)
                     /locus_tag="THITE_2117113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654223.1"
                     /db_xref="GeneID:11515927"
     CDS             join(2392606..2393351,2393430..2393877)
                     /locus_tag="THITE_2117113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654271.1"
                     /db_xref="GeneID:11515927"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="JGIDB:Thite2_2117113"
                     /translation="MSSTEQDHHQDGGEKKTAPTEPGAVSSAPEAAAPASETNETDKA
                     AQEEAPATKEEAPATQEEAPATTTESDKAAQEEAPATTTEADKAAQVEAPATTTETDA
                     PASSEPKPAAAATATTTGTTDTAVPAPIAQLWALAKASGHPEIWGVTLADPADHVPTR
                     IILQKYLNANDGDLPKAKDQLSKTLEWRAKMKPLDLVRKVFSKAKFDGLGYVTKYAQE
                     GSAEPEGVEVFTWNIYGAVKSIDDTFRKLEEFLEWRVALMELALQELDLGSATKPITA
                     DYDPYKIFQVHDYKSLSFLRQSPLVRSASTETIRVFAQNYPELLKEKFFVNVPAVMGF
                     IYAFMKLFVAPKTIKKFHPMANGANLAKEFAASKVSGLGERLPANYGGKGGELSAQGK
                     GPLLE"
     gene            <2394662..>2404096
                     /locus_tag="THITE_2089433"
                     /db_xref="GeneID:11515928"
     mRNA            join(<2394662..2395146,2395285..2395339,2404085..>2404096)
                     /locus_tag="THITE_2089433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654224.1"
                     /db_xref="GeneID:11515928"
     CDS             join(2394662..2395146,2395285..2395339,2404085..2404096)
                     /locus_tag="THITE_2089433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654272.1"
                     /db_xref="GeneID:11515928"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2089433"
                     /translation="MAETIVLITGANRGIGRGLLELYLARPNHTVIAAVRDPRHATAQ
                     ELASLPRGQGTSLVVVKLDLTVPTDPAAAVEALATKHAIDHVDILVANAGIALKWVKV
                     SEVTPDDVQRHVDVNVYGFLRLFQAFLPVLKKAKDPKWVTIGSSAAFLTVRFPATLQI
                     SVNFIPMKNAAYAPTKLVDTTDS"
     gene            <2418399..>2425710
                     /locus_tag="THITE_2089435"
                     /db_xref="GeneID:11515929"
     mRNA            join(<2418399..2418407,2425399..2425463,2425539..>2425710)
                     /locus_tag="THITE_2089435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654225.1"
                     /db_xref="GeneID:11515929"
     CDS             join(2418399..2418407,2425399..2425463,2425539..2425710)
                     /locus_tag="THITE_2089435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654273.1"
                     /db_xref="GeneID:11515929"
                     /db_xref="JGIDB:Thite2_2089435"
                     /translation="MATHWLTKAIHTEEPWLTAFPIDPGWVQTDIGQRGAAAFGYEKA
                     AITVEESVNGLIRVIDAATRETHSGVLWKYTGEQSPW"
     gene            <2426593..>2428280
                     /locus_tag="THITE_2145189"
                     /db_xref="GeneID:11515930"
     mRNA            join(<2426593..2427027,2427096..2427216,2427279..2427612,
                     2427671..2427870,2428003..>2428280)
                     /locus_tag="THITE_2145189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654226.1"
                     /db_xref="GeneID:11515930"
     CDS             join(2426593..2427027,2427096..2427216,2427279..2427612,
                     2427671..2427870,2428003..2428280)
                     /locus_tag="THITE_2145189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654274.1"
                     /db_xref="GeneID:11515930"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Thite2_2145189"
                     /translation="MGPAFETEVRVPWSQTCWTRAAAYVRLQTAAEVARALAIIKETG
                     TNFSLRTTGHNPNAGFSSAGDTAVVLDLRGLASRELGADGIARVGAGNTFGEVYAWLA
                     EHGRSAIGGRDQQVGVAGFLLGGGMGAFPNLYGFGADGIVNAEVVLADGRIVNANAQE
                     NPDLYRALKGGGSNFGTSGTVDLSIGIVTRFDLHTYPLIKTQYTINLYSPQDYVGIID
                     ATVKVQEAMEKDPKIGSFTNFNAQFVAVGLLYADTPSERPSAFEPFWDLKSLITTACP
                     TTEGTLLSLAQTMRHEETDGKRRICSITTRVSRELYEGIYQLYQEALKALPEGYVLHF
                     TAQPVGTAAVQAGEDHGGNSLGLEKIPQCWWVFTCEWPNERADAPAESALSFLEEKVE
                     ALARERGLLLAYKCANFATGHQKVLRSYGAESLGRLRETAARYDPEGVFQRLQCGGFL
                     LRDNV"
     gene            complement(2429412..2431075)
                     /locus_tag="THITE_2117115"
                     /db_xref="GeneID:11515931"
     mRNA            complement(join(2429412..2429809,2429888..2430482,
                     2430551..2431075))
                     /locus_tag="THITE_2117115"
                     /product="carbohydrate-binding module family 1 protein"
                     /transcript_id="XM_003654227.1"
                     /db_xref="GeneID:11515931"
     CDS             complement(join(2429735..2429809,2429888..2430482,
                     2430551..2430825))
                     /locus_tag="THITE_2117115"
                     /note="CAZy_ID 269953"
                     /codon_start=1
                     /product="carbohydrate-binding module family 1 protein"
                     /protein_id="XP_003654275.1"
                     /db_xref="GeneID:11515931"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="JGIDB:Thite2_2117115"
                     /translation="MVRQQATSLLALAFLSVASAQVSNDFESGWDQTAWPTYAPDCNQ
                     GGKVTLDSTTAHSGKNSIRVDGAGGYCGHIFFGTSQVPSGDLYVRVYLKAANALTSSH
                     VTFITMPDPAQGTNKHLRIGGQSQILMYNRESDDATLPDLSPQGIASSTALPTGSWQC
                     FEYHIGTDGTIETWLNGAAIAGLEAGPGINNPYADQWERSSIKPTPAGVYFGWESYGG
                     DTNTFWYDDIVISSSRVGCSGSTGTSPPATTTTPGGSTPPPATSTTTSTAPPATSSTP
                     SCTAAHWAQCGGIGYTGCTTCASPYTCTALNDYYSQCL"
     gene            2433117..2434820
                     /locus_tag="THITE_2117118"
                     /db_xref="GeneID:11515932"
     mRNA            join(2433117..2433489,2433701..2434820)
                     /locus_tag="THITE_2117118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654228.1"
                     /db_xref="GeneID:11515932"
     CDS             join(2433448..2433489,2433701..2434789)
                     /locus_tag="THITE_2117118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654276.1"
                     /db_xref="GeneID:11515932"
                     /db_xref="JGIDB:Thite2_2117118"
                     /translation="MAPTPKRPSSTVGMEPAAGTESAQQNSITVAAGVGTPTGSIDSE
                     TGSARRSSNSSSSPPAGVSKPVDVEEEVPRPPANARHTKDGSTTTSNGHAMPSAANNR
                     PPGRDYYHEYEFSDLDAITIRQLNEDICAYNYDLDYCKAQLEDADLTPQETRTLQLRT
                     LDLGHQIRHCKHRIQTIEAQTRKKRPYPVAHTFRTAHRSSTDPTAAYAAGNGVPSTSS
                     PPHATAGGSLSTEVGPGRRGAASGKRLPADEDGGSAKRVKMASPESDVLGPGGGGPGG
                     GGSGSGGRENGGGGGVNTALQRLGFWKCRLCSAPKYLLAGAGRTPAAPCKWPLKDISK
                     MITHFTEMHAEHTPAERCAELGAALVQNRAYFPTSPHFLASI"
     gene            2435585..2436801
                     /locus_tag="THITE_2117121"
                     /db_xref="GeneID:11515933"
     mRNA            join(2435585..2435962,2436112..2436801)
                     /locus_tag="THITE_2117121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654229.1"
                     /db_xref="GeneID:11515933"
     CDS             join(2435680..2435962,2436112..2436512)
                     /locus_tag="THITE_2117121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654277.1"
                     /db_xref="GeneID:11515933"
                     /db_xref="JGIDB:Thite2_2117121"
                     /translation="MGLLRRLTFATGVLTGLGTGALGYLGTSTTIISPLQEDDPLWRS
                     QSYAKYNPHRNPSVQDICVKRIPLSKIKPELLQREGDLAVEFCRGVWSGLGYRFQRAY
                     LARKYHGPATASQLWTVDQLSRSTYEPGTQLTDHFEVVEKTPSEIVMRCGDSPRNAGP
                     RDSDGLFVISAEIDRARGEAVLGLKSCFFTSGRKVEGSQGPAPAWIEVLHQWYARLWM
                     ETGSWRVTR"
     gene            2437510..2439612
                     /locus_tag="THITE_2117123"
                     /db_xref="GeneID:11515934"
     mRNA            2437510..2439612
                     /locus_tag="THITE_2117123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654230.1"
                     /db_xref="GeneID:11515934"
     CDS             2437875..2439446
                     /locus_tag="THITE_2117123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654278.1"
                     /db_xref="GeneID:11515934"
                     /db_xref="InterPro:IPR015798"
                     /db_xref="JGIDB:Thite2_2117123"
                     /translation="MRDPGNPSEPDSCHYAFPLPISPVIDPITLELVRIDILPSGLDE
                     KVEPLRPWQPVGPSEYIPEAQSLRTDLKALRVVQPEGVSFTVENFSELGRLIRWQKWD
                     FKVGFNQREGMVLYDVHYDNRPLFYRLSLSDMCIPYADPRSPFHRKAAFDLGDAGAGI
                     MANNLQLGCDCLGSIYYMGGVLADSHGKPVDMPNVICIHEQDAGILWKHTNYRTNRAV
                     VVRNRELVLQTILTVSNYEYILSFVFNTAGDLAYEARATGILSTQPVDVGLTKTPHPF
                     GTVVHPGVLAGFHQHFFSLRIDPMVAGHGNTVVYDEAVAIPRDPKLNPHGVGYTVRRT
                     EIGTSGGFDLDANTNRTFKVINPAVRNPVNGAAVGYKVMVPPMQPILADADSFHHRRA
                     EFADRSVYVTRYADGELYAGGLYTNQSRGGAGVRSWAERRDSLAGGDPVLWVQFGINH
                     IPRVEDFPVMPAETLRVTLRPVNFFDRNPAIDVPPSRQEVNCSVSVDGNSHGPGGEEG
                     GQGQNTACCASAGCT"
     gene            2440120..2441948
                     /locus_tag="THITE_2117124"
                     /db_xref="GeneID:11515935"
     mRNA            join(2440120..2440368,2440472..2441948)
                     /locus_tag="THITE_2117124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654231.1"
                     /db_xref="GeneID:11515935"
     CDS             join(2440262..2440368,2440472..2441858)
                     /locus_tag="THITE_2117124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654279.1"
                     /db_xref="GeneID:11515935"
                     /db_xref="JGIDB:Thite2_2117124"
                     /translation="MAQQASQPSQPSQPSHPTFIDLPPPPLNSDTPSEAPGTPTSTTT
                     SLSALSTTAIKDGQRGTLHHRGHHHSPSANSLEAERADRISRLTGLSGVAALRGPPAA
                     GLNQQNPSFLQTGAVSTGFPGNPAAAAGAGGLAPAYFDAAGQPVAATKVSTVGSASAT
                     ESVGGRTSTTTEVGGDQSTLGEDRDEDMLTEMDSASASGYMGADTMDEDLDNLASQSV
                     GGFEDRMSDDGSASLVGFGEGAGSTLSGPIYHRRPLPASGAAATAASAAWGLERSSSG
                     LSEGGPAAASPHSPHHPPPQPHPHHLAHHHSSSSSSRRDLTTAAAAATARPPERETFN
                     SDTPASPSAARERREARMMDGVALDATTLAGGAGASDDDDVFIDTTTRGPVPVAVPAQ
                     HQQQQQQPATPGTTTAATSTSPVRQRQPHRRQQQRQQHPRRRRPAHSQHEGPSPPPLP
                     PSAPQSPDEGEARGGGSPMRGSSKGGRSGGGGGGGREQLGRVDFEDR"
     gene            complement(2442808..2445868)
                     /locus_tag="THITE_2117126"
                     /db_xref="GeneID:11515936"
     mRNA            complement(2442808..2445868)
                     /locus_tag="THITE_2117126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654232.1"
                     /db_xref="GeneID:11515936"
     CDS             complement(2442843..2445770)
                     /locus_tag="THITE_2117126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654280.1"
                     /db_xref="GeneID:11515936"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Thite2_2117126"
                     /translation="MGNESSRPEGHPARSRSLSPLPRDEMSPYEGDDDDTRPVPSSMP
                     ASLATADPRLRLPSGADPPPGGRGRRQPRQPRESSSESSNPSDPGASSDSSEPGDPGV
                     DSSGSSDSGEPPSPSPSSSSSSTKNRLLPARQPRRVRTAPRQKATVTLTQPQEPLGEP
                     EPDAVASFGGKPSKKGKGKAKEMPETTAVASPSRTDAGDESPPSAQPLTSHGRRNSGS
                     EARKKPRRRHSSPDEEGVDGRLKAEPPDEDGLDRTLPEHVAGGLQSAATVPSQSLPYP
                     SSQRSHSDSGYAEPDVPPKSAPEREMNPALSGGLDALPHAGDDGASAEDDQPPASTLP
                     TSSGGSPGSRQITKRKTKRPFFSQEEEENARALSELPPDGAVSPPEPRRSRRLRVTAQ
                     GKARPPTASRGVKKQKTPERQADVDTSGADSDDEEQTEKPQYQSGPLSDAEKSRINRV
                     VERFLEDEGMTQQELNQLIQENPQTSAHPATRQFWSSIQEACPSRRRRKLIHWCRQHF
                     HNFAGRGTWTQEQDNELAELVEAHGKKWSHIAGLINRHPMDVRDRWRNYLVCRGNNRT
                     DPWSEDEEERFREVVETAIEKIRERLDEASGKSPEDLINWLTISEAMGHTRTRLQCME
                     KWKRMRASEPVPDEVPTVLPPGSSWRLEKARKELRSFTAAEKYALVRAIRDSGVGTDA
                     KIPWKQIIHRTFDGNYERQSLMVTWGRLKQTVPDREWKTTRDCAGYLCDMYEEEGNFA
                     PLNRREAEEDVIKETPKSTKKQRRKGKAAASSPSGSKKKSRQTEPDPSPELGAEPSDA
                     GPDDVVTEAQVHPEYASLVAGQSHRAARAPSPELGANPPEPSPTVEAQAARTKRRERR
                     ASLVASTNSNEGKGKGQEVPVSPPQPASQTGNAKASKRTRRGSIGVEDSPRHKKQKTN
                     KASSANVAKVNRAKAVSAEKGVGEGARMPGRPSSVISSDSDDDMEDIPATLPWSSSNR
                     AAR"
     gene            complement(<2446767..>2448077)
                     /locus_tag="THITE_117745"
                     /db_xref="GeneID:11515937"
     mRNA            complement(join(<2446767..2447321,2447655..>2448077))
                     /locus_tag="THITE_117745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654233.1"
                     /db_xref="GeneID:11515937"
     CDS             complement(join(2446767..2447321,2447655..2448077))
                     /locus_tag="THITE_117745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654281.1"
                     /db_xref="GeneID:11515937"
                     /db_xref="JGIDB:Thite2_117745"
                     /translation="MDRAELNLPRLTSEELADPFTSVTINGFEVKLWQVAHHYDAHHD
                     IPEPARRIGATSADFRSRHPKPLVSANLPSTDDHVNEGQARPDSPPLPTEAPPSQSPS
                     QGRPTRRDPLEIGDLLSLVDDLANRVRALEAAQARETNSQRRVVSADPPWVKEAHAAK
                     TNAPARAVSDPQPGGLGEGQTKSGLKPPLLNQVQQLHPTPGLLQRRPSFLKYPYEEDK
                     PADRSSAEAGSKARSNRATSSASSSSGPAGPAASQPLHRPVTPAPAEAEKSEAEGDEP
                     VLTSRWSPDSSPEPLSKMKRVKKVLSLARLRPRKSKAALARAAANEADG"
     gene            2449112..2451393
                     /locus_tag="THITE_2117129"
                     /db_xref="GeneID:11515938"
     mRNA            join(2449112..2449511,2449664..2450772,2450905..2451393)
                     /locus_tag="THITE_2117129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654234.1"
                     /db_xref="GeneID:11515938"
     CDS             join(2449759..2450772,2450905..2451360)
                     /locus_tag="THITE_2117129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654282.1"
                     /db_xref="GeneID:11515938"
                     /db_xref="JGIDB:Thite2_2117129"
                     /translation="MLEAAATSFASILVLGAGFGIAAYVYHKSYKYMVLRKMAKAFEP
                     GDPVLDLAAIGKDLPLSKTAAATHWVERPEQATVDAIVAGRSVGHYHLFIGEKGTGKS
                     SMLLEAMRKIDGDGVAMFEAHADLEIFRIRLGKALDYEFHEDYIGSYFSERGPRDTTA
                     LLDIERALNKLEKVALRRRAKVGRPLVLIINQMHLIRDDEDGKDLIELLQQRAEQWAA
                     ANLVTMVFNSDDYWVYERLKQLATRMDVLTIMDLPKAQATAALRNYRQRYFGESPSPE
                     TLEQVYDRVGGRLSFLNRVAKSRDMLATCDAIKEAEKTWFLNQCWILGAEMDDDVMDQ
                     QKWATAAVVLATALVDKEAEMESTYDREVGHILPSFPLHEAQEIMTRADFVRALDRLN
                     LFSITSDAQVRASSVPMHLAFREIVARPGFRAHLAATIDRIAAIESLGRTRELVAKDL
                     VLGGRYQFRKVPGGTDVTLKEGENAGDAGDGDKGNSAKG"
     gene            complement(<2452288..>2454756)
                     /locus_tag="THITE_2050890"
                     /db_xref="GeneID:11515939"
     mRNA            complement(join(<2452288..2453828,2453917..2454003,
                     2454066..>2454756))
                     /locus_tag="THITE_2050890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654235.1"
                     /db_xref="GeneID:11515939"
     CDS             complement(join(2452288..2453828,2453917..2454003,
                     2454066..2454756))
                     /locus_tag="THITE_2050890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654283.1"
                     /db_xref="GeneID:11515939"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2050890"
                     /translation="MDSDDDGHSAGLSSPWLASFSTGSTSVSAASSTTGFAHTGQLSP
                     VSNGNSVDLPCGPASSAADSSANLASPSPSPIMAAVAHSASSSVRHPPALLGRAGFGD
                     ADAADGISRDVVWDEMREAGEAGEAKEAGLEDEEAASKLSAVPKLEPLEDDDFCMGDL
                     QEAPPGSIQTHESAPQGVLDQPKPKRPRGRPRKHPLVPNIVPNKVTKGRSKTGCLTCR
                     KRKKKCDEAKPRCMNCEKNAVVCEGYPEKQIWKSGKERAEEARLRSRGFPSITMHPLF
                     PGLETLEDRIFWKHYNEQLSTVLTVEGEHKNAFKELMVPVAVQHQGLMHSILSLASKH
                     IDFDTPYGLSVLKNNTGTSLEALKERSRYHHNQARLQFYNNIEFTKRKQTPDDRSLMA
                     ARYGQMLCFLIEALVEGSTRGEHRLHLTVYRSLISTTPPGDSAFLAFIAEFFQYHIFA
                     DELIHSVVGQPGRPPPKPLPPLPDIQSPRLLGVADGLLGYLAEITAIRNTIRNRMLAQ
                     TDLVIDYYDLYPAVDIDAAIQQWMPLWPPGDSRDLVSLLYKQMMWIYLDRTVYPPSAS
                     PPPSVAPSAQSLPLGPHSSPSLSRHAPSAVNTPPLSATTSRASSPRLASSVPGPNRPN
                     SQSDPSFPPPGPSDDPGDDDGGGESPAAARSRPGSPPPARQPPRLDPRVTLAVDESLA
                     LLELFKPSDPCQRLLLLPCFLVGTACFSPAQQRRVRAAIRTVRGYTGLRNADRVAELL
                     EEVWRLMAAGDWVAAWDWAGVAQRMELDFIPA"
     gene            complement(2458324..2460175)
                     /locus_tag="THITE_2117135"
                     /db_xref="GeneID:11515940"
     mRNA            complement(join(2458324..2459073,2459148..2459319,
                     2459368..2459536,2459614..2459898,2459960..2460175))
                     /locus_tag="THITE_2117135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654236.1"
                     /db_xref="GeneID:11515940"
     CDS             complement(join(2458406..2459073,2459148..2459319,
                     2459368..2459536,2459614..2459898,2459960..2460015))
                     /locus_tag="THITE_2117135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654284.1"
                     /db_xref="GeneID:11515940"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="JGIDB:Thite2_2117135"
                     /translation="MVHQHGDHVEIPHEHRVHKPGAWLPADHRVHRKWLAHAIDHIDK
                     HGEKELVPVLREFKELIENNPRIYMYFTEMWDEIPNKPPYNKDPTGKRQIRDYHHMLQ
                     VLNHVFGSAPEWTDAAASVGMVGVPMCAIFDYAMGTPSGHAAFLDPDVNRMLKKILNE
                     WGEYLKVSQLSPESAKVLGSHRAGWFGEVGYADLMEVANAPSKTSFKFEDMYKCDPTK
                     PHFGFKSWDDFFTRQLQESARPVASPDDDNVIANACESKVFNVVRNAKLRDKFWIKAQ
                     PYSVVDMLGNDPLSRHFDGATVYQAFLSALSYHRWHAPVSGTVRRCFVRDGTYFSEPL
                     FESPVEGGQIDTQGIRVAQGYLTALATRAVIFFEAASPAVGLMAFVGVGMDEVSSCEI
                     TVREGQRVRKGDEIGMFHFGGSSHCLLFRKGVKVGRFPELGRQENVPVRGQVAVVEP"
     gene            complement(<2460336..>2461172)
                     /locus_tag="THITE_2089449"
                     /db_xref="GeneID:11515941"
     mRNA            complement(<2460336..>2461172)
                     /locus_tag="THITE_2089449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654237.1"
                     /db_xref="GeneID:11515941"
     CDS             complement(2460336..2461172)
                     /locus_tag="THITE_2089449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654285.1"
                     /db_xref="GeneID:11515941"
                     /db_xref="JGIDB:Thite2_2089449"
                     /translation="MSGEHPAAALVDSLTPAATTPSKERKRPLRTYSRRPVQAREQAR
                     EYSPNEPTKSETDTRDAALADSSRLPALSSQDKNRGQPPSRGSILAYFKPLPPSSDKA
                     PSGAASSDPAELPPSSPASSSTSPSTRPRKRRRLTTRPLLSEPGQYSTGAAADETGVP
                     PECCPMTKDASIVVVPSKECGTLRSALSEVAVNRRDHPGAGPGGALANGSAGSKKRAG
                     KRAAKDMTQTTLSLSVQKEPGFTMCGVCDILYNPLNEKDRREHNRRHAARCRIRQKAA
                     GR"
     gene            complement(2461535..2462641)
                     /locus_tag="THITE_2117138"
                     /db_xref="GeneID:11515942"
     mRNA            complement(join(2461535..2462220,2462287..2462641))
                     /locus_tag="THITE_2117138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654238.1"
                     /db_xref="GeneID:11515942"
     CDS             complement(join(2461672..2462220,2462287..2462538))
                     /locus_tag="THITE_2117138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654286.1"
                     /db_xref="GeneID:11515942"
                     /db_xref="JGIDB:Thite2_2117138"
                     /translation="MTPSIVEGLQRLNPAAAHQHSQALQAQGDEPSLEDAAVGKPVSH
                     SQVVDLWRALQDAGHGEFSLESLLRGSKVYIPPPAPKPEPSDEYKALMARLRHQQEQQ
                     EYARMTSPSRPMETFSQRFPNGASIAQAFAAVNRPSREEDLGDDDVTYSDVHRQLMLI
                     LNFVASILGVAATLWILARWWSTPARLLLTMGGSVLVGIAEVAVYSGYVWHLGQAKKQ
                     DRTLKEVKEIVQTWTVEGPEPQPSVVGGRSRTEDGTVRAVRRRQREVK"
     gene            2462810..2464605
                     /locus_tag="THITE_2117141"
                     /db_xref="GeneID:11515943"
     mRNA            join(2462810..2464245,2464326..2464605)
                     /locus_tag="THITE_2117141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654239.1"
                     /db_xref="GeneID:11515943"
     CDS             join(2463037..2464245,2464326..2464487)
                     /locus_tag="THITE_2117141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654287.1"
                     /db_xref="GeneID:11515943"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="JGIDB:Thite2_2117141"
                     /translation="MQLGPGPSMARAAKSASRLGRLRVPSTCPECLRAASLDVRIHRI
                     HQAMAPFHSGRPRPSAWAAAVSVAGNIVSNAVTRASKGDMPTIDPLRIVAKEMKFLTG
                     NIRKLLGSGHPSLDRVAKYYTQAEGKHVRPLIVLLMSRATSLCPKAPQRQQATIQASA
                     AIDVSISPLSILSDFNPSAGAESEPLPADPDILPSQRRLAEITELIHTASLLHDDVID
                     HSVSRRGAPSANLEFGNKMAVLAGDFLLGRASVALARLRHAEVIELLATVIANLVEGE
                     FMQLKNTARDETNPRWSEDTLTYYLQKTYLKTASLISKSCRAAALLGGADAQTVDAAY
                     NYGRNLGLAFQLVDDMLDYTRSEKELGKPAGADLELGLATAPLLFAWKTIPELGALVG
                     RKFAKDGDVARARDLVMQSDGIEQTRALAQDYAEKAIAAVSQFPESEAKQGLIEMAVK
                     TLKRKK"
     gene            <2465536..2467225
                     /locus_tag="THITE_2078771"
                     /db_xref="GeneID:11515944"
     mRNA            join(<2465536..2466241,2466321..2466433,2466530..2466564,
                     2466632..2466801,2466882..2467225)
                     /locus_tag="THITE_2078771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654240.1"
                     /db_xref="GeneID:11515944"
     CDS             join(2465536..2466241,2466321..2466433,2466530..2466564,
                     2466632..2466801,2466882..2466931)
                     /locus_tag="THITE_2078771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654288.1"
                     /db_xref="GeneID:11515944"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="JGIDB:Thite2_2078771"
                     /translation="MTRQSLQLELAERPTGAIVPGRTFRLRRVAAPTEADLRDGQLLL
                     ESLYVSFDPAMRGWLDDRRSYVPPVRLGEVMRAQALCRVLASRSARAAPGDIVTALMG
                     IREVGILPEDQVEPAAAPWRGAGSAGGGFRMTDLLGVLGPTGLTAYFGMTKIGAPRPG
                     ETVVVSAAAGATGSVAAQIAKIAGARVVGTAGSDEKCRWLTEELGLDVALNYKDPDFR
                     DKFKAATPKYIDVFFDNVVGGEQLDMALGRANKNARFVMCGAISQYNSQTKPGPTRNF
                     ANIIAQRIKMQGFIVFDYAKEYGAAKAQLAKWLSEGKLKRKETIIKGGVAAADEAFQQ
                     LFQGGNIGKLLVEIKNPEEVARL"
     gene            2468090..2470196
                     /locus_tag="THITE_2117145"
                     /db_xref="GeneID:11515945"
     mRNA            join(2468090..2468785,2468867..2470196)
                     /locus_tag="THITE_2117145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654241.1"
                     /db_xref="GeneID:11515945"
     CDS             join(2468267..2468785,2468867..2470021)
                     /locus_tag="THITE_2117145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654289.1"
                     /db_xref="GeneID:11515945"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Thite2_2117145"
                     /translation="MTVSALPDDSVVVIASSRTVITLPDDTLLLTPATITISPATGKI
                     TSVVQELLPRSSFPEAWVYHDYSPKLLLPGLVDAHVHLNEPGRTEWEGFNTGTKAAAS
                     GGVTTVIDMPLNAIPPTTTLAGFRKKLAASRGQCWIDVGFYGGVVPGNAAELLPLAEA
                     GVRGFKGFLIDSGVEEFPAVSSKDIALAMTTLKDEPTTLMFHAEMVPPLDGVPAGGSL
                     SDAVQQSELPARPAGELDSYSTFLESRPPAFETCAVGEILSLAHLAPRLHLHIVHLSA
                     AECIPLLREARRRGVNITAETCFHYLGFAADDIPDGDTRHKCCPPIRSQTNQLGLWRE
                     IADPAGCIQTVVSDHSPCTPELKLLPPHLQTEFQDGPRPPMQHADSGIDVSPPEDEKK
                     EEEQEEMKQAEVETASLTADETRPTKTQGDFFAAWGGISSVGLGLPILHTAAAAAAAD
                     GALSVVDIVRLCSQATAKQVGLAHRKGGIRAGMDADLCVFDDADVWTLRAADMRWKNR
                     CSPWEGHTFRGRVHETWLRGRKVFQLGGENGGFVGGQPIGEAIVERRTA"
     gene            2471306..2474682
                     /locus_tag="THITE_2117149"
                     /db_xref="GeneID:11515946"
     mRNA            join(2471306..2473710,2473801..2474682)
                     /locus_tag="THITE_2117149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654242.1"
                     /db_xref="GeneID:11515946"
     CDS             join(2471560..2473710,2473801..2474658)
                     /locus_tag="THITE_2117149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654290.1"
                     /db_xref="GeneID:11515946"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="JGIDB:Thite2_2117149"
                     /translation="MPSFLPDATTAIDSQSSGTVYLDGDAEYALSQSKVNEPIARQPH
                     SQSHTSNDSFDGSSAKSTSSSITSETSLEPDQQLSRNLTSSPRSMNSPPTAIAGGGEN
                     GRDTVGSVTRKSLPLDNSAPLVDRTVPCSTTGARGCGSAGHKQNDHAPSHTTPTAEEL
                     LPQQPGVEVYLHPVAKGDVRTVENGSPRPPAPVASSPASAAQHSPATSQKSLKPPHRY
                     SSPPVYDQAAAGPSGGLQSPTVPGTRHRHTLEVPKITPAGRGSRDGPDTAVYASGRFS
                     PTLAATGPRRASLSLARRTTRSLHSDGPRDEVVPDEDALRWAEAYRQKRASKRRRREL
                     EDDDRVLVGTKVDESHANWVTAYNMLTGIRVSVSRTNAKVDRPLTDADFEVKQKSTFD
                     IAGNELVPSAKYDFKFKDYAPWVFRHLRALFRLDPADYLISLTGKYILSELGSPGKSG
                     SFFYFSRDYKYIIKTIHHAEHKFLRQILKDYYQHVKENPNTLLSQFYGLHRVKMPYGR
                     KIHFVVMNNLFPPHRDIHQTFDLKGSTVGRDYKEEDLEKNPRATLKDLNWLRRKRHLE
                     LGLQKKQLFLAQLQKDVRLLQRLQIMDYSLLVGIHDVQRGNEENLRDKTLRVFNPGGN
                     NTPEDFDPNSVLMRTPSKLENQRKARELRQMIQSEKPVPMGETSSRMPDELEEGHSRP
                     GFIFNQDDGGFRATHEDNAPGDEIYYLGVIDCLTHYGIIKKIEHFWKGLSSDRSQISA
                     LPPQEYGERFINFISNVTMSQEEALRVAQEREAAQAAEPAAAVPPVPNYQPPLPPSSS
                     SLGQRPADAQPGRVGTIGEEEDVPNRTLRTVVTGPTPSGKANHGPSASVSERRETTVL
                     PVVEEAAEGPSTGDRSRNSRVSSLLTESDGRPLTPAKDGDEMEPGFGNPLLGVRNGSK
                     GSNGMARPPPTPPKTGQGFDGRAKPDSADSGYGIGSGSGSTSGSNGGLKSLTGSQKSL
                     NIRPQISRDSLDKALPPLPKASSSRPHNVS"
     gene            complement(2475273..2476561)
                     /locus_tag="THITE_2117150"
                     /db_xref="GeneID:11515947"
     mRNA            complement(join(2475273..2475800,2475904..2476561))
                     /locus_tag="THITE_2117150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654243.1"
                     /db_xref="GeneID:11515947"
     CDS             complement(join(2475681..2475800,2475904..2476158))
                     /locus_tag="THITE_2117150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654291.1"
                     /db_xref="GeneID:11515947"
                     /db_xref="JGIDB:Thite2_2117150"
                     /translation="MGLLPGFLSTAPKSEAEKRADEVRTGAVAPTRAERARCWAARDA
                     FYACLDAHGIVDTLNSEGRAAAARACPAEGAAFERDCAAQWVTYFKKWRVQDIQKKAR
                     LKELEAQGATRMDVQTDFTPRR"
     gene            2476700..2478080
                     /locus_tag="THITE_2117151"
                     /db_xref="GeneID:11515948"
     mRNA            join(2476700..2477321,2477423..2478080)
                     /locus_tag="THITE_2117151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654244.1"
                     /db_xref="GeneID:11515948"
     CDS             join(2477071..2477321,2477423..2477822)
                     /locus_tag="THITE_2117151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654292.1"
                     /db_xref="GeneID:11515948"
                     /db_xref="JGIDB:Thite2_2117151"
                     /translation="MARRRRPPRSGALAELPPLKILSQIAILQGLYYAGALVLMLFTA
                     LVAGTKFGIDLVFGWDAVRGDTTQGWLMGFIWVLDGGLLMAAAIIVLIGRSKLVLDFA
                     LSLHAIHLVVVTLYSGQLPRHTAWWLSMAAASAVSVALATWGCRYRELKPISFGGGGA
                     SSTAGGGGGENSSGGNGGEGNGADEEQGFSRGRGRGRGRDGAGEYEMVNMDNSTAR"
     gene            2478325..2479907
                     /locus_tag="THITE_2067133"
                     /db_xref="GeneID:11515949"
     mRNA            join(2478325..2478525,2478605..2479630,2479698..2479907)
                     /locus_tag="THITE_2067133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654245.1"
                     /db_xref="GeneID:11515949"
     CDS             join(2478360..2478525,2478605..2479630,2479698..2479744)
                     /locus_tag="THITE_2067133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654293.1"
                     /db_xref="GeneID:11515949"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Thite2_2067133"
                     /translation="MNPALHGRSYASASAVPQFNWEDPLGSRNLLTEEELAVSETAER
                     YCQEQLLPRVLQAYRDEHYDPKILREMGELGLLGATINGYGCAGVSTVAGALITRAVE
                     RVDSGYRSSMSVQSSLVMGAIHDFGSAEQKEKYLPEMAQGKIIGAFGLTEPNHGSDPG
                     SMEAIAREHPHKNGYYLLKGSKTWITNSPIADVLVVWAKLQATGKIRGFLVDRKTCPP
                     GTLETPAIKNKTGLRASITGMIHLEDCPVPQENMLPEVEGLKGPFTCLNSARYGIALG
                     VMGALEDCVARARAYALERRQFKGNPLAKYQLVQKKLADAATDAAYGTLAAIQVGRLK
                     DQGKATPEMISMVKRQNCDRALHNARVLQEIFGGNAVSDEYGVGRHVANLYVTQTYEG
                     QSDIHTLILGRAITGIQAFV"
     gene            2480352..2481867
                     /locus_tag="THITE_2170642"
                     /db_xref="GeneID:11515950"
     mRNA            join(2480352..2480428,2480577..2480682,2480890..2480935,
                     2481043..2481072,2481166..2481349,2481414..2481867)
                     /locus_tag="THITE_2170642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654246.1"
                     /db_xref="GeneID:11515950"
     CDS             join(2480639..2480682,2480890..2480935,2481043..2481072,
                     2481166..2481349,2481414..2481553)
                     /locus_tag="THITE_2170642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654294.1"
                     /db_xref="GeneID:11515950"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2170642"
                     /translation="MALKRINKELADLGRDPPSSCSAGPSGDDLFQWQATIMGPSDSP
                     YAGGVFFLQIQFPTDYPFKPPKVHFTTRIYHPNINANGSICLDILRDQWSPALTISKV
                     LLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV"
     gene            2485727..2487968
                     /locus_tag="THITE_2117168"
                     /db_xref="GeneID:11515951"
     mRNA            join(2485727..2486027,2486095..2487609,2487683..2487968)
                     /locus_tag="THITE_2117168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654247.1"
                     /db_xref="GeneID:11515951"
     CDS             join(2485834..2486027,2486095..2487609,2487683..2487716)
                     /locus_tag="THITE_2117168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654295.1"
                     /db_xref="GeneID:11515951"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Thite2_2117168"
                     /translation="MASYGGYEKYGYPSGGGSAKPSERSRWTPLTRMLLSGEMTQEKQ
                     RELTPREKFDRWMVNEGYRRIFVFVFMFLHALVFAFGFVHYSLKDNLQNARDTFGPTF
                     QIARASALVLHVDVALILFPVCRTLISLARQTPLNGIIQFDKNITFHITTAWSIFFFS
                     WVHTIAHWNNFAQIAAKNNLGFYGFLLANLVSGPGWTGYVMLIALTGMVITSVEKTRR
                     ANYERFWYTHHMFIIFFFFWSIHGAFCMIQPDFAPFCISIGTSAIGVFWQYWMYGGFA
                     YLAERIAREIRGRHKTYISKVIQHPSNVCEIQIKKEHTKTRAGQYIFICCPAVSLWQY
                     HPFTLTSAPEEDYISIHIRVVGDFTRALAETLGCEFDKKGDSSKVVGVNQENDEVDPA
                     LRRVLPRVYIDGPFGSASEDVFKYEIAVLVGAGIGVTPFASILKSIWYRMNYPQKKTR
                     LSKVYFFWICRDFGSFEWFRSLLLAIEAQDVENRIEIHTYLTAKIKADDATNIMINDA
                     NADKDTITGLRSPTNFGRPNWDMIFRGIRKLHAPAEAGVFFCGPKGLGSSLHIFCNKY
                     SEPGFNFVWGKENF"
     gene            2488701..2490193
                     /locus_tag="THITE_2117171"
                     /db_xref="GeneID:11515952"
     mRNA            join(2488701..2488780,2488832..2489460,2489534..2490193)
                     /locus_tag="THITE_2117171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654248.1"
                     /db_xref="GeneID:11515952"
     CDS             join(2488903..2489460,2489534..2490055)
                     /locus_tag="THITE_2117171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654296.1"
                     /db_xref="GeneID:11515952"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="JGIDB:Thite2_2117171"
                     /translation="MSIYSFLIAVRSDGQQLMNESGDTTSHLMGMFYRTLRMVDNGIK
                     PLYVFDGAPPKLKSGELARRFQRKQEANEGLEEAKETGTAEDVEKFSRRTVRVTKEHN
                     AECQRLLRLMGIPYIVAPTEAEAQCAVLARAGKVYAAASEDMDTLCFDTPILLRHLTF
                     SEQRKEPIQEIHLAKVLEGLNMDRKQFVDLCILLGCDYLDPIPKVGPSTALKLIREHG
                     TLEKVVEFMRNDPKGRYTIPDDWPFQDARELFFSPDVRQPDDPLCDFKWDKPDIEGLV
                     QFLVHEKGFSEDRVRAGGARLEKNLKSSQQARIEGFFKVLPKTEAEKAAHKRKLEEQQ
                     EARKKKLKEEKKEKAKARAKPRGTA"
     gene            2491195..2493262
                     /locus_tag="THITE_2117173"
                     /db_xref="GeneID:11515953"
     mRNA            join(2491195..2491405,2491501..2491790,2491871..2493262)
                     /locus_tag="THITE_2117173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654249.1"
                     /db_xref="GeneID:11515953"
     CDS             join(2491291..2491405,2491501..2491790,2491871..2493109)
                     /locus_tag="THITE_2117173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654297.1"
                     /db_xref="GeneID:11515953"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Thite2_2117173"
                     /translation="MSKTFTQSDVASNNKPESLWIVIDGDVYDLTKFQDDHPGGKKIL
                     QRVAGKDASKQFWKYHNEGILKKYKKQLQIGSLDTKPKPPAAAPAPAPAPAKKEAPKP
                     KAAAAVAPSEQPAEALEPFGDQIPFSDPSWYQGYHSPYFNETHAALRAEVREWIETEI
                     EPHVTEWDEKKEVPPEVYKEMGRRGYLAGLLGTRYQKEYVQGDGVRSVPPEKWDLFHE
                     MLLTDELSRVGSGGFVWNVIGGFGIGCPPLVKFGKKSLVDRILPGILAGDKRICLAIT
                     EPDAGSDVANLTCEARLSDDGKHYIVNGEKKWITNGIWCDYFTTAVRTGGPGMNGVSL
                     LLIERDFGGVSTRRMDCQGVWSSGTTYITFEDVKVPVENLIGKENQGFRVIMTNFNHE
                     RIGIIIQCLRFSRVCFEESVRYANKRRTFGKKLIEHPVIRLKLAHMARQIEASYNWLE
                     NLIYQCQRMGETEAMLRLGGPIASLKAQATVTFEFCAREAAQIFGGLSYSRGGQGAKV
                     ERLYRDVRAYAIPGGSEEIMLDLSIRQSMRVAKMLGMKL"
     gene            complement(2493997..2495116)
                     /locus_tag="THITE_2117176"
                     /db_xref="GeneID:11515954"
     mRNA            complement(join(2493997..2494247,2494321..2494515,
                     2494606..2494725,2494820..2495116))
                     /locus_tag="THITE_2117176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654250.1"
                     /db_xref="GeneID:11515954"
     CDS             complement(join(2494147..2494247,2494321..2494515,
                     2494606..2494725,2494820..2495000))
                     /locus_tag="THITE_2117176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654298.1"
                     /db_xref="GeneID:11515954"
                     /db_xref="JGIDB:Thite2_2117176"
                     /translation="MASTGDDQYHPKDAIHSGLYGTVTYGGVGLLFAAVRNSLAKKNV
                     GPWTTFTRNTSIIATFAAAGGVFEFARDASANLRETEDHWNHGIGGFLAGAVVGLRTN
                     SIPRIVGCGLLTSVVLATYEYTGASLRGYLKSPEVDEYERKEMLRKNRRRPIEETLAE
                     IGEGRGIRPPGYEERRRARLKEKYGIDINPVCADPDVA"
     gene            2495742..2500248
                     /locus_tag="THITE_2117180"
                     /db_xref="GeneID:11515955"
     mRNA            join(2495742..2495897,2495985..2496020,2496075..2497594,
                     2497685..2498102,2498170..2499628,2499720..2500248)
                     /locus_tag="THITE_2117180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654251.1"
                     /db_xref="GeneID:11515955"
     CDS             join(2495897,2495985..2496020,2496075..2497594,
                     2497685..2498102,2498170..2499628,2499720..2500116)
                     /locus_tag="THITE_2117180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654299.1"
                     /db_xref="GeneID:11515955"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Thite2_2117180"
                     /translation="MIQIAEPRVPGKGGRLASRLIQDWFAGRLAQNEQGDSGSVGLPT
                     DCPSLRVFPPRPEAGPEHDLLIIQSQSYDDAHDPENQGRSLVCCMCRYCRYHFVFHIY
                     PPAREDGMTHMQHHLRLKEFQRLPFASPPPSPPSTRRPQPCRFLYDCTVCGMVVCLDM
                     SLPRLQSGWIELITDENRIREALRIAREQDPGRYGDISPEKENHYLTTALSTLNQYLK
                     NILDDDGSGPRKRISCRNKTFLVQFGQDCDQMFRYLGFEQQHDPATGEWYWLPPVLPP
                     QSGKTPLNSPRAFIEDVRSEVQSLLDDKPLPNGQPVVKPFSARDQLEKALGCDKTPRS
                     AGPPSIDSSELQHFTTLGAPVGASDELLKFAYRRQVETDPEGAPSYLEALGTLSGRRA
                     EELQMFVFGEQELLAEKDKQAVATATAADPETAAIERAYAHFALRRDCPEAPAYFINV
                     YRNYREQSPAQKSDHRLALLTIGRDRHSEEIEYEVYMTDMELSEACRFLGVDAEWPLD
                     NIAAMAQSVASEMDLKLVLMALDTIGRSRPADDPNRYAFDETVLMLRSGLPSSPLDSS
                     ATPTAEPSREVVDMELPVGLANLRNTCYLNSILQYFYSVNAVRDLAMNADLPALQPTE
                     ENLSNLLRATNSGGSDSSPTGSSLETGRAFVGHEFTRELSTLFRELDATGSSWITPRQ
                     RLANAALLRPEKLRPRSEGSETAPSSSNDAGPPLPPRTAHESSVPRVPDAPMTEPECC
                     ETASAASSQTLVNNAGEEGAAGATTEPRNAEKDAPTAADEAVAQTSASPKSNQPAQRG
                     VRMSKLTVEELAVELDKPNVGSDQMDVDEVMGNAIDHLRAAFKVSRIGSSEAAPDPIQ
                     QAFFSTFIDNRKKIGDSEWNRSRRSDRWVTAYPAQSGTRDLYDALANSFDLEPLPGDL
                     LSFTTIERPAPHFHICIQRSDGVRKNSNPITIPNVLYLDRFMHAADNQSVLSRERRRR
                     WDITTRLNEISSSKSADGRPETAKADSRVAGHALKVGMQEDDLTEEEIDGFLIVGSSG
                     VPAVDSSSSTAAAVNGTRGAEEVTPDSELKRLLVKYGLAEPAFARSGSAEPPPYNNTN
                     STKTTTLLPSDIDAFWERFAAEEDAERQRLTAERDRIFADAHNVAYLLHAVVCHAGAR
                     PTSSSRSSTPRASRTTWPTSGPTRSRTWSASRAATRPRRRRCPRVPSRPSRNGISLWS
                     MRTGPDRPRPPSSTWRTWICRPTRSTTASEGLFRARKHMHGDIGELPIACSHMPSVGY
                     STTKRPVHQHTCFS"
     gene            complement(2500945..2504366)
                     /locus_tag="THITE_2117183"
                     /db_xref="GeneID:11515956"
     mRNA            complement(join(2500945..2503762,2503859..2503990,
                     2504062..2504366))
                     /locus_tag="THITE_2117183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654252.1"
                     /db_xref="GeneID:11515956"
     CDS             complement(join(2501141..2503762,2503859..2503990,
                     2504062..2504085))
                     /locus_tag="THITE_2117183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654300.1"
                     /db_xref="GeneID:11515956"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="JGIDB:Thite2_2117183"
                     /translation="MASRPELKVDDEHGFIRFFKSLPRVDEDVIRIFDRGDWYTAHGD
                     NANFIARTVYKTTSVVRQLGRNDHTGLPSVTMTVTVFRQFLREALYKLGKRVEIYASP
                     NGRMNWKIVKQASPGNLQDVEDDLGSLAEAAPVILAVKISAKASEARAVGVCFADASV
                     RELGVSEFLDNDLYSNFEALLIQLGVKECLVQVEKADRDRDPELAKLRQIIDSCGIAI
                     SERPVADFGTKDIEQDLARLLKDERSATLLPQTDLKLAMGSASALIKYLGVLHDPSNF
                     GQYQLYQHDLAQFMKLDAAALKALNLMPGVRDGAKTMSLFGLLNHCKTPVGSRLLAQW
                     LKQPLMDKDEIEKRQQLVEAFVNDTELRQTMQEEHLRSIPDLYRLAKRFQRGKANLED
                     VVRAYQVVIRLPAFLGTLEGVMDEAYRDALDEAYTNKLRELSDSLAKLQEMVETTVDL
                     DALDNHEFIIKPEFDDSLRIIRRKLDKLRSDMDREFADAAYDLGQERDKKIFLENHKV
                     HGWCMRLTRTEAGCIRNKSRYLECSTQKNGVYFTTKTLQGYRREFDQLSQNYNRTQSG
                     LVNEVVSVAASYSPVLERLAGVLAHLDVIVAFAHCSVHAPISYVRPKIHPRGEGQTIL
                     REARHPCMEMQDDVQFITNDVELTRDKSSFLIITGPNMGGKSTYIRQIGVIALMAQIG
                     CFVPCSEAELTIFDSILARVGASDSQLKGVSTFMAEMLETANILKSATAESLIIIDEL
                     GRGTSTYDGFGLAWAISEHIVKEIGCFALFATHFHELTALADQYPQVRNLHVTAHIGG
                     ADSKSKARREVTLLYKVEPGVCDQSFGIHVAELVRFPDKVVRMAKRKADELEDFTSSN
                     KHDGDAAADYSKRDVEEGSALLKDLLVRWKDEVRAGALSGADVVARLRQLVAADEKLL
                     ANPFFQSIKAL"
     gene            2504508..2506207
                     /locus_tag="THITE_2117186"
                     /db_xref="GeneID:11515957"
     mRNA            2504508..2506207
                     /locus_tag="THITE_2117186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654253.1"
                     /db_xref="GeneID:11515957"
     CDS             2504798..2506093
                     /locus_tag="THITE_2117186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654301.1"
                     /db_xref="GeneID:11515957"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="JGIDB:Thite2_2117186"
                     /translation="MTTEALQHAAAEVDMVDPPPPSTASSAPAANGKRKAETELERPA
                     TKPSPAPGNSDQDPTASDAATVDSASQPLSKNQLKRLRRQQQWEQYKAERRAKRKDKR
                     HERQARKRAEREAKIAEAEAAGIDPATVLQPKEPWRHRPVPVAFIIDCDFEQYMREQE
                     IVSLSSQIVRSYAMNRKARYHASLHLSSWKGKLRERFETVLKNAHRNWKNVGFHEGDF
                     REAARLAREQMAGPNGGEAIEIIKPRSESRQGEPSRAGTENTTPTVDAEPEGEDVDRT
                     IVYLTSESPYTLDRLEANTSYVIGGLVDRNREKGLCYKRAREYKVRTAKLPIGEYMAM
                     QSRYVLTTNQVVEIMAKWLECGDWGKAFMDVIPKRKGGTLKDKTPVGAAEDKDGEGED
                     DDEDEDDGVRDATPEGQTPSEDKIELSSEPAAQRQGISQ"
     gene            complement(2506208..2508327)
                     /locus_tag="THITE_2117187"
                     /db_xref="GeneID:11515958"
     mRNA            complement(join(2506208..2506997,2507078..2507524,
                     2507582..2507776,2507846..2508327))
                     /locus_tag="THITE_2117187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654254.1"
                     /db_xref="GeneID:11515958"
     CDS             complement(join(2506322..2506997,2507078..2507524,
                     2507582..2507776,2507846..2508195))
                     /locus_tag="THITE_2117187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654302.1"
                     /db_xref="GeneID:11515958"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="JGIDB:Thite2_2117187"
                     /translation="MPHSDPPVAAEDDTAPESTARLEEDPAAAAASSSAEEEDVIMAE
                     ADGVQGVVEEHIPGAEPPSAQAQAGAEEADDDMVEITQEQRPGVKLEDLFDGEDSEDE
                     EFPSSSNALKVEDQGAATADDAAAFELLRTYYQRCFPWRYMFQWLNHSPVPTNDFKHR
                     EFSLWLHNDAVMRYQSYMTSDLFRKDVLRLMPRRIEIGPVYTADPRDHKTFRNSTAFQ
                     ALAKELCFDIDLTDYDDIRTCCDKANICHKCWRFITMAIKVLEAALREDFGFQHILWV
                     FSGRRGVHAWVCDKKARTLDDQQRKAITGYLEVVTGGTQGGKKVNLRRPLHPHLSRSL
                     DLLKDHFQQDVLEVQDPWRTAEKAEALLQQIPDPSLRAALRSKWEASPGRSSAAKWAD
                     IDALAQSGASSAALDPRDLLDAKQDVVLEHTYPRLDAKVTQQLKHLLKSPFVVHPGTG
                     RVCVPIDRARLDAFDPLAVPTLQDLVREIDAWGGGGGGGGAEGVMADGGGLDVKPVQD
                     WEKTSLKPYIEYFRSFVTALMKDEKEAAVKREREEEGVQVKVESLEF"
     gene            2508666..2511592
                     /locus_tag="THITE_2117189"
                     /db_xref="GeneID:11515959"
     mRNA            join(2508666..2509138,2509242..2511592)
                     /locus_tag="THITE_2117189"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_003654255.1"
                     /db_xref="GeneID:11515959"
     CDS             join(2508755..2509138,2509242..2511191)
                     /locus_tag="THITE_2117189"
                     /note="CAZy_ID 269784"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003654303.1"
                     /db_xref="GeneID:11515959"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Thite2_2117189"
                     /translation="MTGLRLIIEDGKFCDGHGRQVVLRGINVAGEAKYPSRPHQPSHV
                     PDDFFDGDNVSFVGRPFPSHEAHLHFSRLKRYGYNTIRYVFTWEAIEAAGPGIYDEAW
                     IAETIEVLRAAKRYGFYIFMDPHQDVWSRFSGGSGAPMWTLYAAGLNPQSFAATEAAI
                     VHNTYPEPDKFPKMIWSTNYYRLAAATMFTLFFAGRDFAPKCILDGMNIQDYLQGHFL
                     RACAHLARRIHEAGDIENDVVFGWETLNEPNKGMIGYEDISVIPKEQALKKGTCPTIW
                     QAMLLGSGRAVEVETWDMGGLGPYKVGRTLVDPHGEVAWLPAGYDESRYGYKRDPGWK
                     LGECLWAQHGVWDPSTDTLLRKDYFRKHPTTGDTIDYPYFTNTYFMDFYRKFRDAIRA
                     HHADAIMLLQGPTMELPPLIKGTPDGDDPRLVYAPHWYDGITLMTKKWNRNWNVDVIG
                     VLRGRYWHPAFAIKLGETAIRNCFRDQHAAMRKEGLDRMGNHPCVMTEFGIPYDMDDK
                     YAYRTGDYSSQSAAMDANHFAVEAAGLEGYTLWLYMATNDHERGDQWNGEDLSIFSID
                     DKLLPLSALPRSPGIDGASTTALRSSVPRKELDDDDSVTPANLKRSLTNPSISSEATS
                     RQPELTACPGYRAAEAYVRPAPTTVAGVIASYGFDLRQCVFTLALTAPRAADPLAPTV
                     VFLPEYHFPRDACVVEASSGKWEISCDEDEAVLVQRLRWWHGPGEQTLRVSGVVRKLL
                     AAEAVGGGAAAAGAAVAEDAGYYEQCNQGAWSNCALM"
     gene            complement(<2511994..>2513771)
                     /locus_tag="THITE_2051060"
                     /db_xref="GeneID:11515960"
     mRNA            complement(join(<2511994..2512326,2512447..2512669,
                     2512754..2512987,2513056..>2513771))
                     /locus_tag="THITE_2051060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654256.1"
                     /db_xref="GeneID:11515960"
     CDS             complement(join(2511994..2512326,2512447..2512669,
                     2512754..2512987,2513056..2513771))
                     /locus_tag="THITE_2051060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654304.1"
                     /db_xref="GeneID:11515960"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2051060"
                     /translation="MTTTTTTTTTTTVLLPRFRAVIVTVQLCGLMFFSSFCNGIVVVA
                     LPAMQSGLGLDEGLLVWPSSSYYLTAGSCLLLAGSIADAAGAKRVQLVGSLLAAAFTL
                     GCGLARTGGELIAFRALQGVTNAIISPSSISIISSSLEEGRPRNMGFACLGFSQPLGF
                     GVGLVLAGVLTDTIGWRPAFYLAAAASLALFLLSIWALPPDPRRPEADQPVWRRLALH
                     IDWVGLLFASTGLAMLSYVLASMSSDINNIHQAPSIVLLVISGFSIPAFAAWMHYQSK
                     NNRTALIPNSLWRSRVFTSSCILILLTNAITNCMELYSSLFFQQVQGISALGASIRVL
                     PSLLAGVLTSILTGIFVNRMPVLWTVLISSALSATAPLLMAFIRTDQVYWENAFFGQI
                     LSPISCDMLFTVGLLIISDVYPKHMQALGGAVFNTCAQLGAAVGLSVAQVVASSVTSN
                     VASSSADKSSPDALMKGYRAAFWLMFGCMVAVCFVSALGLRKVGVIGVKRD"
     gene            <2516601..>2517313
                     /locus_tag="THITE_160376"
                     /db_xref="GeneID:11515961"
     mRNA            join(<2516601..2516966,2516993..2517241,2517302..>2517313)
                     /locus_tag="THITE_160376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654257.1"
                     /db_xref="GeneID:11515961"
     CDS             join(2516601..2516966,2516993..2517241,2517302..2517313)
                     /locus_tag="THITE_160376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654305.1"
                     /db_xref="GeneID:11515961"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="JGIDB:Thite2_160376"
                     /translation="MYYRVQNLEDFPEALTPARAMLQSLLAQELLMARDKASPFNVLD
                     IEEFDPARLRKPMEAKYAHVRHEFESYVQRRQAGGGPELFKTFEEACQFLKSSAPWNY
                     VDGAWLARFHQITTRFALRDIFSEELGDGDLEKNHVVLYGGLLRSIGVNLPDGDSADF
                     IDPRDGMEDRRPSAGTGATSPMTKRRVCLAYSGGLDTSCILKYLLVMR"
     gene            2518254..2523916
                     /locus_tag="THITE_2117199"
                     /db_xref="GeneID:11516263"
     mRNA            join(2518254..2523566,2523656..2523916)
                     /locus_tag="THITE_2117199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654258.1"
                     /db_xref="GeneID:11516263"
     CDS             join(2518513..2523566,2523656..2523782)
                     /locus_tag="THITE_2117199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654306.1"
                     /db_xref="GeneID:11516263"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2117199"
                     /translation="MYQNGQRDATRPFQVPPPPPPMSPPPSVAMGSLMAIPPPPPRYP
                     TAPAAANVLLPPPPGPPPNPPFGSAAMGPPSALGSAPWQGSWGRAYDGRTTFNIPPPP
                     PGGAGAPVLQAYNPKLHAQALAAANAAAASNAAAAASGPTTLPVAPPPPPSEQMSATY
                     IPHGDTYGEGVGIPGLGFADDVGYAWSAGDSAAATPQDDTSGRDRLYAGAMGQRGQST
                     ATNASTVSSSSLPPGLAAQWTLDKVLAWLQANNFSREWQDAFRALNLCGAPFLELGSS
                     HGGRGNFGMMHQQVYPQVHRECEKSGTPFDLPKEREEGKRMRRLIRSIVTGKPVDPSK
                     VAPSHARKESATVAPPPSAATESAAESPNTPIKAPGPGFGGRRFSQSRATTAPTLNGS
                     TTNTMSSEANHRNLMKNIDTEITRRHSPSASVSVSDSGEAGSFRGSTPRGRDSPSGSP
                     VPPSALFTPSSTAGNASASPHTTRFGHRSRNSTDSTSSNAAIYGSGVPPDAAAILKSG
                     MNIADAVNAATRASEASGRRYGQDGGRPSPQDTGDRSAGTDPPGSAKTSTSFLSFLRG
                     KKKNEDQDSPTSPGLLVKMHLPGSRHANESEASLDRPASKRAGSGRVFILATADGWNY
                     RMVDVTDVGSSTELRQLVCINLGLPDPESAQLYLTELGKFEHDEEPLDDSKLMIAKNH
                     MGDAVGSLKLFVRPIGSPQLRPPGAQTSSSGHLSVPMDEEAYAKLHGRQRSSSSPPTS
                     RLNTLTTTDKERDEKMLTAEAIQYRTEQLRKQQEYLAKRKQAAEAKEGSPSADVTPFG
                     IVGRNVDFDQPRLSPYEDRKLDNLLPLRKAPAPPGDPSATLLKANSLSKKHAARLSQG
                     SQGSADGGRQKRTSSDMREDAALEKQRRRGGPVMPSPEGGSIHGLLVGMAGMAGGMAG
                     IGHPAVGGHRGLSPHRVSSMPVTDHEVNDRGKGAMSTVDFGQRARSGSGSGGTSPRIG
                     PVPGSPGSTTWSSKNVPFLVPDYSPGGTQGRGDRGSAGAGPSPDQSHLGTDAKITRAA
                     RAPSPGDVSPSSRRPSHTFPPPASSASKRKSHGPDTDFQDNDVRFSQASTLAGNAKTA
                     AGATADDDSDDDSDDGLFAVPLSVRNASAAKKAASGPADGGEFEGTGKRPSLRVNTER
                     SGKTRSVAFKSPHSSADGKTPAGEDGEGATGGPSSQRRTPGTPGSEGWESEDRDSRLS
                     RRKSFIEKDVWANRPPPDTLINNLEDFFPNVDVDQPVLEEGEDGPPSPIAEGDESQAD
                     QNPAQAAAAAAALPPMPPLPAGLSSSGNARSSSIYNESDTLGSDESTLKALDSRPVSM
                     QTLAQRSVRRSGGLGRMKSIREVARGAHEASKRYTRTSGQLQAQTAGAGGAADKNTNL
                     MRRKSTKMFNANIVQIQPQRGSLNLGMGAGAMQQDDGLNRRDNNNNVPKRQTTFRWFK
                     GQLIGKGTFGRVYLGMNATTGEFLAVKEVEVNPKAAQGDKKKMQELVAALDQEIDTMQ
                     HLDHVNIVQYLGCERKETSISIFLEYISGGSIGSCLRKHGKFEEPVVSSLTRQTLSGL
                     AYLHREGILHRDLKADNILLDLDGTCKISDFGISKKTDNIYGNDKTNSMQGSVFWMAP
                     EVIRSQGEGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAVGAIYKIANGETPPIPDDIR
                     EEISPIAIAFMLDCFTVDPTDRPTADVLLSQHPFCELDPNYSFLDTELYAKIRGTFTT
                     "
     gene            2526006..2528986
                     /locus_tag="THITE_2117203"
                     /db_xref="GeneID:11516264"
     mRNA            join(2526006..2528460,2528518..2528986)
                     /locus_tag="THITE_2117203"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003654259.1"
                     /db_xref="GeneID:11516264"
     CDS             join(2526113..2528460,2528518..2528818)
                     /locus_tag="THITE_2117203"
                     /note="CAZy_ID 269731"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003654307.1"
                     /db_xref="GeneID:11516264"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_2117203"
                     /translation="MFRLRRSRVLLACAVVITVLLYHVYKNSAQWDHSPEIWRAKTAP
                     QAGAPQAQPKPAHDRDHDHEKRPGDTRPQKPSHDPRPPPPPPDAAAAAADDEPSPTQG
                     APTIRIPELKTSDGVKGGYSLPTKVPSVPEAQLPSGHEEHGKQIGDEGIHFVDPPAKH
                     QADVIATATTVHWTKPSEWFPVPEESLILLPTGKPKTIPSVQFAFADESPAAKAKREQ
                     RLAKVKEEAVHAWSGYKKYAWTHDELTPVSNGTKDPFCGWAATLVDALDTLWIMGLKD
                     EFEDAVEAVKEIDFTTTPYRDEIPVFETTIRYLGGLLGAYDVAGGHDSKYRVLLDKAV
                     ELAEILMGVFDTPNRMPVLYYNWKPDFTVNPKRASTGAGVAELGTLSMEFTRLAQLTG
                     KNKYYDAVARITDALEDLQNRENGTAIPGIFPEHLDASGCNRSAPLPSTLEISSEAAQ
                     NQANDDPQRASIEYDTGNNSSPDANEGDHGVQSGAGSHSGFHRGPRKRDGRPTTAPTP
                     FTAKGLPADWDCVAQNLTAGGWGPGQYSMGGNQDSAYEYFPKQYVLLGGLVPKYRAMH
                     EKVAEAVKKYLLFRPMAEGDPDILFSAKVLSSDGTAEKLTYDYEVTHLTCFLGGMFAL
                     GGKLFDRPEDVEVGKKLTDGCVWAYEVMPTGIMPEYAKAMPCKSQHDCHFDQAAWYEA
                     LDPNKEQREKEMEEYHAKTAEWQHQVDDLKTRQAEERNPRLTGGDESASPPDATGSPT
                     KELVLPPKPQKPLTHEEFVSQQIQEQHLPSGFVSLNDKRYILRPEAIESVWYMYRITG
                     DTEWQEKGWRMFNAVVRATRTAAGHSAIRNVAAVDGPPTLEDSMESFWLAETLKYFYL
                     LFAPPDVISLDEWVLNTEAHPFRRPT"
     gene            complement(2529476..2531515)
                     /locus_tag="THITE_2117205"
                     /db_xref="GeneID:11516265"
     mRNA            complement(join(2529476..2529516,2529577..2530608,
                     2530748..2531075,2531153..2531221,2531284..2531515))
                     /locus_tag="THITE_2117205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654260.1"
                     /db_xref="GeneID:11516265"
     CDS             complement(join(2530236..2530608,2530748..2531075,
                     2531153..2531221,2531284..2531317))
                     /locus_tag="THITE_2117205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654308.1"
                     /db_xref="GeneID:11516265"
                     /db_xref="JGIDB:Thite2_2117205"
                     /translation="MPTTRFQLGWYRWLPFLGYHHVLMILIAVAIILLSLLLAGCSSS
                     SPLIPDIFLLSLYYQRYTAVPDTAQTDYNVNNAIANIVGGARLQARVGYFGICVSPDG
                     GSWLCSNNATTLANEVTVDQDPLNLIWLASQFKDMIVFPYLLIIAIIFAFICLLLLAT
                     FPGWHEEEDSEGSEREVKPFPSRPVSQVALAIIFIASIFVLVSVLWQHTASVAASIIA
                     QDLANGSVLSGVGTSAMVMGWFSFTLLIIVTIGLLVMILSMEVLEHIMD"
     gene            complement(<2532730..>2533599)
                     /locus_tag="THITE_2145225"
                     /db_xref="GeneID:11516266"
     mRNA            complement(<2532730..>2533599)
                     /locus_tag="THITE_2145225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654261.1"
                     /db_xref="GeneID:11516266"
     CDS             complement(2532730..2533599)
                     /locus_tag="THITE_2145225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654309.1"
                     /db_xref="GeneID:11516266"
                     /db_xref="JGIDB:Thite2_2145225"
                     /translation="MQGMFSRTFFVSLADGREVVVQFRTEKLDLNAFKVAKGALGQFV
                     PDAVALEDEELENEGVWAYSLERLPGKLWVHGVAGKGADGRIAINKSLGRVLSKGWRA
                     DSSGEAVSTNIRPHLEAILASPLDEVATYRPLLQGFLGKLDGISKLPLWVSHYDLNDV
                     NVLIDESCEVTGLIDWELSVPKPFAVGLGRIHTLAGEFTGGEFWMPDEFEVAERAFWK
                     ELFAGMSPKTREMLEDNLDLVQDAVILGTLLDTFFWENGKVGCGEVSMKALPKFLTYR
                     IPQVRGDEPPYKM"
     gene            2535890..2537040
                     /locus_tag="THITE_2117209"
                     /db_xref="GeneID:11516267"
     mRNA            join(2535890..2536091,2536161..2537040)
                     /locus_tag="THITE_2117209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654262.1"
                     /db_xref="GeneID:11516267"
     CDS             join(2536044..2536091,2536161..2536808)
                     /locus_tag="THITE_2117209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654310.1"
                     /db_xref="GeneID:11516267"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="JGIDB:Thite2_2117209"
                     /translation="MTNFNIKIVSDAICPWCYVGKKRLERAIEMYKRDVPGGASDTFT
                     ISWHPFYLDPTLPKVGVDRNTHLARKFGPERAALATAHLKRLGEAEGIRFSFQGKVGN
                     TRDAHRLVQLAKTKSGETENRLVSTMFKSHFEEDADITSRDALVEIGEKAGMDRTEVT
                     DWLDQGKGGQEVDREVEEAYRRGIHGVPNFTINGQYEVSGAQDPEVFLEAFARARKSS
                     SDVSTRSSEGVSC"
     gene            complement(<2537046..>2537773)
                     /locus_tag="THITE_2017150"
                     /db_xref="GeneID:11516268"
     mRNA            complement(join(<2537046..2537640,2537709..>2537773))
                     /locus_tag="THITE_2017150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654263.1"
                     /db_xref="GeneID:11516268"
     CDS             complement(join(<2537046..2537640,2537709..2537773))
                     /locus_tag="THITE_2017150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654311.1"
                     /db_xref="GeneID:11516268"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="JGIDB:Thite2_2017150"
                     /translation="MSLLSAHLEQISISCQGIDSLPFPPPKIFTNALLSNPDITSLIR
                     DTEAHERALFSVPPPPPTATHQRNADAPKPSARRQTVFNVAGGEVTTGPPPNSTRSGP
                     TARRNTAVAAVLGGDLHAQIVRRGGAAGGGGGADGRAAGDVDIEVLLHGAEKLCAVYP
                     LPGALERIPAQRQKYAQQSNTLAYYEAKVAEQQEALERMNLERVLEEEDKDGEGDDEA
                     AG"
     gene            2539852..2541176
                     /locus_tag="THITE_2117212"
                     /db_xref="GeneID:11516269"
     mRNA            2539852..2541176
                     /locus_tag="THITE_2117212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654264.1"
                     /db_xref="GeneID:11516269"
     CDS             2540078..2541055
                     /locus_tag="THITE_2117212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654312.1"
                     /db_xref="GeneID:11516269"
                     /db_xref="JGIDB:Thite2_2117212"
                     /translation="MWPAAPKNSKISQIVGPTSPPQTPRTASPVFGRKSSPRLGELPS
                     KVPLHPMAAPPLETGHTAVNGPGFGHATPIRPQQLSPRPTSSSSSASSVASSDSEDSA
                     LPSNAAGPSAPASASATPERRPGPAPHAPQARMGRIVTQADFVVEELSDFGDSDDAER
                     PGVIRPCAIEYAESDRSRSRSRNRPEIDHRMMFNFVNLNCSDDSDELDLDEHEYQEFL
                     LKRRAERRRKRMSSGSIGKRTISESIGSDTDREDIRSFLGADEAGSSARRLRRRVGDR
                     RSLQFQDPPPPRIDELDEPASSEDEIFIGESLARELPFFEYVMMEVDSP"
     gene            2542795..2545858
                     /locus_tag="THITE_2117214"
                     /db_xref="GeneID:11516270"
     mRNA            join(2542795..2544751,2544838..2545858)
                     /locus_tag="THITE_2117214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654265.1"
                     /db_xref="GeneID:11516270"
     CDS             join(2543006..2544751,2544838..2545095)
                     /locus_tag="THITE_2117214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654313.1"
                     /db_xref="GeneID:11516270"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="JGIDB:Thite2_2117214"
                     /translation="MMRNITFLAEDEKLKYEKGLAALWKVHDTAAPGSPEQNEAKRKI
                     GEFGKILLAKLHQRRQQLQQQQQQQQQQQQQQQQQNQQQQQNQQQQSPQQPGQGPSAP
                     LAQQPPVATGPSGNMSNAPPQASAPGAQAAPNPGPAAGQARQLPAHIISHVNEMQFQA
                     PPGVADKAKWIEEVRQKYAKALYSMDNARNMIKSIDQTLQENQSLAPEERKKLEDRKA
                     QLQKQHTDAITFANSVRKQYAVGGGNQRPGQNGGAATANAGNQAQARPQTAGAQGGNS
                     SGAPAAAPANSLQNSSAAVNAAIEAAKQQQVLAAARVPGAANSLSAQQGAHAQAPATP
                     AQALQSPVTQAPPAQPAGPQSQPQQSQPAAQQPAPVKIEPGTQPLPAPLNTAIATAAA
                     GGMPSAGTPTQQNSARLQTPQSATPTGLNANIRPLTHAAAVNLASQPRPGAIPAAPTA
                     GPGNSVLGAVGPAQQQQGHPHAHPPQQPQPTAHNLQSKLPIPKVLHEKATQMPTPAPN
                     IGGIGPGRPTYSGGGGIGGGVMNQPALPKLPAYQLEGEGERILNKKKLDELVRQVCGG
                     TAEGQEGNLLTPEVEESVLNMADSFVDSVLHQACRNAKERGSKVLEIRDIQLVLERTY
                     NIRIPGYSSEELRTVRKVQPNSSWIKKMSAVQAAKVVPGKGDN"
     gene            2546506..2548848
                     /locus_tag="THITE_2117215"
                     /db_xref="GeneID:11516271"
     mRNA            join(2546506..2546893,2546962..2548292,2548404..2548848)
                     /locus_tag="THITE_2117215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654266.1"
                     /db_xref="GeneID:11516271"
     CDS             join(2546620..2546893,2546962..2548292,2548404..2548547)
                     /locus_tag="THITE_2117215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654314.1"
                     /db_xref="GeneID:11516271"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="JGIDB:Thite2_2117215"
                     /translation="MPGKTPDKEPVENGGYRGGKDITEKDLKSKAKKASKKEGDDEMT
                     VVVPPAKSSKQSSAPPPNDADGDVLMDDAEKAAEGEVKVDPVVQTINDIKSNFALLDR
                     AVAQFDARFSLRALRSISSIRRRLTPDILAQAISETYASSSASADVAKRMLLAIGRPD
                     VSLGRQPGPEMEIDSEPKAAAAKNGARKEVKEVIPEVDVFLGILTQVLLHDSKRHQQG
                     LEFSQYLAERIRSLNRRTLDSLSAKVYFYYSLFAEQIAPLPPSPLSPIVSIRPTLLAA
                     LRTAVLRKDVDTQASVIVLLLRNYLLTSHISQADLLVSHTQFPENAANNQVARFLYYL
                     GRTRAIQLRYTEAHEHLTAATRKAPSSACALGFSQTATKLLLVVELLMGDIPDRATFR
                     QPNMETALRPYFLLVQAVRVGNLEDFEGIIADHADTFRRDGTYTLILRLRQNVIKTGI
                     RMMSLSYSRISLRDICIRLHLGSEESAEYIVAKAIRDGVIEATLDRERGFMKSKEVGD
                     VYATREPGEAFHDRIRACLALHDESVKAMRFPMNQHRLELKNAQEAREREREMAKEIQ
                     EGDLDEDDLGGDFEGM"
     gene            complement(2549628..2551288)
                     /locus_tag="THITE_2117217"
                     /db_xref="GeneID:11516272"
     mRNA            complement(join(2549628..2550555,2550620..2551288))
                     /locus_tag="THITE_2117217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654267.1"
                     /db_xref="GeneID:11516272"
     CDS             complement(join(2549882..2550555,2550620..2551151))
                     /locus_tag="THITE_2117217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654315.1"
                     /db_xref="GeneID:11516272"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2117217"
                     /translation="MDTGARSDDTDDANDIHAQVLRTTLGEIETSQRESEDGTADSRD
                     CCVICLDSISDACAALPCGHAHFDFLCLLSWLQQHPNCPLCKANVYKVRYADAQQAEA
                     IYRVPNAARPRGGMRDERTGDARRQSPLDSAFRRRFTSQNGLLRETGSRRPRTPPSPN
                     EALERRRYVYRHQLYSLHIGSNRTSQYRPPPTPVQFSSTPHLVSRARMWIRRELQVFP
                     FLCSPDPDPIPTGLSIEEARHRQRLRNNAEFLLEYIIAILKTVDLQDSAGQAEAMLAD
                     FLGRDNVRLFLHELRSWLRSPAPTLAAWDREVQYPCRPEPVAAAYPEDESWSARRSSS
                     RSRIVMASTGDDVEGRVGGSGMSWRDRGGDHWRAETGQRLRKRKVRDGDGVAKGRVSR
                     TRGRGDVGM"
     gene            2551744..2553654
                     /locus_tag="THITE_2117218"
                     /db_xref="GeneID:11516273"
     mRNA            2551744..2553654
                     /locus_tag="THITE_2117218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654268.1"
                     /db_xref="GeneID:11516273"
     CDS             2551889..2553571
                     /locus_tag="THITE_2117218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654316.1"
                     /db_xref="GeneID:11516273"
                     /db_xref="JGIDB:Thite2_2117218"
                     /translation="MPPPGSTEISRGSTHGNSRRLEQSRKRAHPEAQAEAHAHPRTPS
                     KRPRPAHTGTTSAITAAPALTPSLDRTASTPVAAVPTSISPTPQKDGRVLGLFDLLAG
                     TPSRSATIPDGLAAAVAATTPSASAATPSKRRSTADPLPPTLAAAVTPTTARFASTPR
                     TKRTAQLLFPKSGAAAQATATPLQERRDKGNANAAFKTPTTTRVSSETKLGFTPTSST
                     PSFLRRRTVGYTATVAGLSRVDEHGADKNAAGEDEAGDGEDSWKSVGPLRLPRKLVGL
                     GRSLSSVVAGLRKMEEEAFNDEEEVLREMERETGIGRTERVIGRKEAVQEAVEVADSQ
                     RHLGGAPRESDILEKQPVALLSGFDDEALADGVDGDNNPTQEPPLRKFKKRGPKRTTR
                     LVNMRPTRTKRPAQATGEEEEDEDEDEFVPETQFNASKPAPLPTTATDETADDDLRLS
                     DPDSASLSDPDFSGSESEHEERQRRQYRSKGDQATTLVTRPKQQTGPSDKSNNNSNKK
                     QPSEAAGSGPGIVKRAARKVKATAHANFRRLKLRNSGAKGGQGQGGRWRRRR"
     gene            complement(<2554339..>2556405)
                     /locus_tag="THITE_2129788"
                     /db_xref="GeneID:11516274"
     mRNA            complement(join(<2554339..2555461,2555499..2556116,
                     2556161..>2556405))
                     /locus_tag="THITE_2129788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654269.1"
                     /db_xref="GeneID:11516274"
     CDS             complement(join(2554339..2555461,2555499..2556116,
                     2556161..2556405))
                     /locus_tag="THITE_2129788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654317.1"
                     /db_xref="GeneID:11516274"
                     /db_xref="JGIDB:Thite2_2129788"
                     /translation="MRTTTLIYHALSLVAAVKAGPLRRRLQPWAPAANVPRQASSQTA
                     SSNGQATLTVLSTGPQLSSIATATTTAATTAATAGVVSHRLPTPFDACYVDGSGELCV
                     IRRGELSSHQLAKLDIYNCRDRGHCQLHHFGARWSCKHSPGQRSQLVASQLVASQLCD
                     SCFSCRPIESIRIAWQHPHASSCKDGHLPDIACIGIEPPVDCSEHPKRFVFSRSKHAC
                     LVISHGVGAKYRQRTQCIFGRRPCYGIQRTGVVSSPLQHARLSRIYRNVSPYRFIVHP
                     HRHLFHPAHRHGIPPATSTVSPDVYQSNLQIARGYNNVFATLTEQSACEVGQAACVAG
                     GLGLCPSGQSFKVIPCPDPGAACFALPMNTTEGVLVGCANIVEAKRILGSVPDAMIPT
                     SSLGASSTAPSTTSPASSTDPASSVPGGASSKSAASTAASSTDNSRITSTTTVTVVAG
                     TGTVTVTANPDAAGPTSSETSTSPSESIPSSASLLTDPITRTATVSLSTGLGTITLTI
                     NPNPTDDPAATATTASESHPAVSVPLSVGVPASSVAFSLPSTIVFTTIAQPTTTSSTS
                     SSPRLVVIPITDDPTTTTTAAAAATATTQPTRTGAGTSAGAANGAAVTSSSSSAAVTV
                     TVTKMQTQLVTVTETQRETVTATTTATVTAKSVVVQV"
     gene            complement(<2557941..2566684)
                     /locus_tag="THITE_2155132"
                     /db_xref="GeneID:11516275"
     mRNA            complement(join(<2557941..2558563,2558648..2560750,
                     2561168..2561699,2561988..2562170,2563276..2564104,
                     2564192..2566074,2566276..2566494,2566583..2566684))
                     /locus_tag="THITE_2155132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654270.1"
                     /db_xref="GeneID:11516275"
     CDS             complement(join(2557941..2558563,2558648..2560750,
                     2561168..2561699,2561988..2562170,2563276..2564104,
                     2564192..2566074,2566276..2566311))
                     /locus_tag="THITE_2155132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654318.1"
                     /db_xref="GeneID:11516275"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="JGIDB:Thite2_2155132"
                     /translation="MKHPVPKGVFEPRRDFRDEEHEFPLLELPTDPAKLKALPTGFHD
                     MTEVEQQEELWIVHAEDHMGREWQLPDPGKHKPYNHNYPPYSPSKVLGILYRFRLRRW
                     TTREFQLARAIAGNRNLRLSVLTAQAFLRRHTLLARRRGVELQMERYLGSTQEWKLRL
                     AELERKTGITEADIKQWLWILAPGNGDLKLHRFFKSNCRKPLFLLHVLVAKDKRIQEP
                     AMFLRLLDYIRENYVLADRPQDELAHPRYKRQGRAMSWRHFLIFLYRLVWHCRETWPV
                     AMPLLARLTADYIEKMPLECNARVLTGYQARSLVLNKALQYFSWPARVRPVDHMEHNW
                     AAQRHLLRLAAMAEPPLVMDQNGYRAVRAVLIALSKTKGEARNAERAAKTWPPYRRTL
                     DGIDERRDPEDDLSRSVKAGILVRAAGYNDDIVDRALSALGGSTFGQAPTIQTRSLPP
                     PFFSGRLSSQNMYSEWASQVKATRNAREAWMVFQNPPEPGIRPDAQVYGEMFEKLYAR
                     PVTESPVIRPGDVKEVFPVYDGNLSEFEIARLTPPSPDELYDLMLMRDKVKPSGHCLV
                     VLVKNARSKMEALRYLSDSPHEPYIQAFRQSVPNLDGTSLDKLSHLPPPVFNAWIAML
                     CRLHKRAPREASGRAEEISHGGSILEAIALTKSFQARDTKAAWRDKMPWHTIMQALAG
                     RKMLYSRLGPEFNVFTTLKVFLQVYEQTTSSKGMDPVSFEALCIMIRKTLKLATFERT
                     PDGNMVPRRSIVGSGLLEKLLVKAHRHAMKSFAYLVAPVPVVPGWDEALGLDPGRSVG
                     ERDDGVPPEMLRYNVVGRPLHRYMLALACCGNHNEMVRVMDWLFDGWDLEHIREEAKA
                     THSLDYHYTMRTIAYFAEMGRELVDPAEMARLKQRLEDLRLHKGCTWFWPPEDDGQSQ
                     ADFSMAVSAAWPFAGQGLDEGLPLPDYSLSVDGHYHEGAAERPILHPLLPVFDSWPVT
                     DHADDAVEAQGIAAKSEFVEFELDAFCFYIDNSIYPCEMRPLQHMATRFGHDQFYFDG
                     VLSIGGVKHYVQKIRVAELPIGNYGTSNATVQGQIWVRSELNKKREIYYRLTKPSSEY
                     ARFYTPFLWVADLAKHIVDYSAAMLERGRQVGLGSFESDFIRWLSETHGEASQFRHWR
                     RKHPSDDYLGDTISTPRDGETTTDTKWRSMVSKGAVEDNRWFGLVQKVHVAGNGSRSF
                     DVIWFYRPVETPCCMMKYPWPNELFLSDHCTCEDGAQVRVKEHEVLGIHNIDWFGGPN
                     TGAGEFFVRQTYMVEGRRWVTLKNSHKTCSHDRQRLGFRTGDTVLAALADSAAFSEPY
                     EVVKIFRQGAITFVRLRRLLRRRQIDPRSGAAPNELVYTDQLVVAKAAKVIGRCLVRF
                     FRPGDTIPTPYDRGGAGNAFFITHELKEQDDGGEPRCVPFEGEFPTSLRQGFDPTRQT
                     FRKLRGMDLFCGSGNFGRGLEEGGAVEMRWANDIWDTAIHTYMANTPNPSSTHPFLGS
                     VDDLLRLALEGKYADNVPRPGEVDFISAGSPCPGFSLLTPDKTKLVQIKNQSLVASFA
                     SFVDFYRPKYGILENVITIVQARHNRSEDVLSQLFCAIVGLGYQAQLILGDAWSYGAP
                     QGRSRVFFYFAAPGLRLPESPTPSHSHFPGVKARGLGEMCNGEPFVSRSFAPTPFKYV
                     SAAEGMADLPYIGDGKAEPAIAVPDHRVCTGITPALRAQIAAIPTHPHGMNFVKTCNA
                     GVMTPGDRALFPAGGFRVSQRSHGWGRVKPSDVLSTVTTRSQPTDARAGTGLHWHEDR
                     PLTVQEVRRAQGFPDHEVLLGRVADQWKLVGNSVARQMALALGLKFREAWAGSLVEGG
                     GGSSRMESREMSETKLNGGSSIRRRSTPRETTTDGVPAARHQQATSLVDLTSEPDQEA
                     AQRPGPDTSRQFVDLTGASRSASPDFIETGSRSRTTPASAAYEPAKTGGARKRLMSQS
                     LGPEAEDMRSPKALRLGHVESAPAPAPAPAPTPTPVPETSRHSSGPAPIHIAEAEAPS
                     APDRALDGEATPARTGPTIVRLDWPDEMEGDRLTVEDGEGSDWIRQ"
     gene            2566897..2569377
                     /locus_tag="THITE_2117221"
                     /db_xref="GeneID:11516276"
     mRNA            join(2566897..2568232,2568301..2569377)
                     /locus_tag="THITE_2117221"
                     /product="histone acetyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003654271.1"
                     /db_xref="GeneID:11516276"
     CDS             join(2567021..2568232,2568301..2569245)
                     /locus_tag="THITE_2117221"
                     /note="102]Contains conserved domain: COG5027, SAS2,
                     Histone acetyltransferase (MYST family)"
                     /codon_start=1
                     /product="histone acetyltransferase-like protein"
                     /protein_id="XP_003654319.1"
                     /db_xref="GeneID:11516276"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="JGIDB:Thite2_2117221"
                     /translation="MPAHLKRKRPHGGSEPRAAVTATTPPVPAVPRRATRQSSVPPLP
                     APPDPEPRRRRRRLAAANGQPDENPQYPRSPRGKENMPVHSVHPDPRRQQQRQEEQLV
                     QLPEQQQPLKPMTRSARHNISVVSGLEAPPARRPQSANANRATSGRTPPPASAVPAPA
                     PDVPSWTTPMAVKPLRGRQGSRRARIDPLRQQSVSVGRNKPIIMTTSLAPSAQTSTAT
                     SNASPNRGARGAESAGQTDRNIDKVVLGDICFRAWYPSYYGKEVLGDISGSSTKGGKE
                     SRTGTNGVSSLHDETKDTTGGERPHGRRDRDHHPPMLDRLYVCPSCFKYSKELVTWWE
                     HVRWCERHGHIPGEKIYTHPKGKRTVLVPSEPPPKQWRGKRGNVGHRMVEEVVQDEGE
                     WSIWEVDGEKDVLFCQNLSLFAKLFLDNKSVFFDVTGFNYFLLVYTPPAPPTDPNADV
                     AETVPPRSQIVGFFSKEKISWDNNNLACILIFPPWQRKGLGSLLMGVSYEISRREGLL
                     GGPEKPISDLGKRGYKRFWAGEIARWILSLEPQQQPPQQDPSSLSSPSSSGSAAEVVT
                     DIQACSQATWIAPEDCLLVLREMGVAEDAGRGPPSRRTDDDAAPTTTADTAVTHTNNK
                     ATGSSSNTTNHHISNGPGPAAGAATATTGAAEAAAAPAGAAAGDQVQRVRISQAAVRA
                     WVAANRISLERTCDPAGFVDGYAVKKKSAAASEEPA"
     gene            <2572207..>2572700
                     /locus_tag="THITE_2014962"
                     /db_xref="GeneID:11516277"
     mRNA            join(<2572207..2572318,2572411..>2572700)
                     /locus_tag="THITE_2014962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654272.1"
                     /db_xref="GeneID:11516277"
     CDS             join(2572207..2572318,2572411..>2572700)
                     /locus_tag="THITE_2014962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654320.1"
                     /db_xref="GeneID:11516277"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Thite2_2014962"
                     /translation="MASTRVLASRLASQMATKAARPAARLTLANTSKRTLTAASKASP
                     LQAVKRQQMSSIINATTRQAFAVQRRAYSSEIAQAMVEVSKNIGMGSAAIGLTGAGIG
                     IGLVFAALLNGVARNPALRGQLFSYAILGFAF"
     gene            complement(2574475..2576886)
                     /locus_tag="THITE_2117229"
                     /db_xref="GeneID:11516278"
     mRNA            complement(join(2574475..2575574,2575643..2576015,
                     2576077..2576429,2576539..2576886))
                     /locus_tag="THITE_2117229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654273.1"
                     /db_xref="GeneID:11516278"
     CDS             complement(join(2574769..2575574,2575643..2576015,
                     2576077..2576429,2576539..2576566))
                     /locus_tag="THITE_2117229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654321.1"
                     /db_xref="GeneID:11516278"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /db_xref="JGIDB:Thite2_2117229"
                     /translation="MAPDHKACLIVIDGWGIPSDESPKDGDAIAAADTPVMDEFSKSP
                     TGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTIKKGEFASNDVI
                     KKVMEAVKNGNGRLHLCGLISHGGVHSKQTHLYALLEAAKQYGVPNVYIHFFGDGRDT
                     DPKSGAGYMEELLSKTKEIGVGQLATVVGRYYAMDRDKRWERNEIALKGLVLGEGEQS
                     DDPVKTVKERYEKGETDEFLKPIIVGGDERRIKDGDNVFFFNYRSDRVRQITQLLGDV
                     DRSPKPDFPYPKINLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQGVEQVHVAETE
                     KYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVPTYDKAPEMSADGVANQVCKRLA
                     EQRFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEACKKEGYILFITADHG
                     NAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLEAMGLPVPP
                     EMTGTSLLVKA"
     gene            <2577878..>2578513
                     /locus_tag="THITE_2089488"
                     /db_xref="GeneID:11516279"
     mRNA            <2577878..>2578513
                     /locus_tag="THITE_2089488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654274.1"
                     /db_xref="GeneID:11516279"
     CDS             2577878..2578513
                     /locus_tag="THITE_2089488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654322.1"
                     /db_xref="GeneID:11516279"
                     /db_xref="JGIDB:Thite2_2089488"
                     /translation="MASQPLPTGLSPDAVDTLSELTWLLTRLRNSQRQTSASTTAPTA
                     GNTTTTTTGPGIPPTAAPTATAISTPTPTSGPVPPGVTGTTPLPTTTATSTQPQQQPQ
                     PHLPPQQQQQQQPPAAPSPAPAPPVTPKDVAVAADRIKHKLQRARAALAGAGDARRGV
                     GAQASELRALAARRAAQAGMLARAQAEGLVFVSGGSTPGTGTGAGEGMVVD"
     gene            complement(2578719..2580586)
                     /locus_tag="THITE_2117232"
                     /db_xref="GeneID:11516280"
     mRNA            complement(join(2578719..2579126,2579202..2580372,
                     2580456..2580586))
                     /locus_tag="THITE_2117232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654275.1"
                     /db_xref="GeneID:11516280"
     CDS             complement(join(2578920..2579126,2579202..2580149))
                     /locus_tag="THITE_2117232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654323.1"
                     /db_xref="GeneID:11516280"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="JGIDB:Thite2_2117232"
                     /translation="MIRYLTYEIIPGLQEQIDLLPSFSTVGGEQQDAVDHVLSGISQL
                     SNRVADAADFLPAYDQRTYSEAVKDLRDKLNKTTAQFAPRNRFQFKHRTGNATAATAK
                     PDTRRLNPTATPANPVADGAASSSTSKPADVKDSAGAAPTSSSNDNDNNNLKSNDSAT
                     ATGSKNYNAEITNQTRSGASSLGVRRPSFSTARDIMLSGHSGVHIVVPASASHATSAG
                     SLLDLNRCVIDMTAPTTAAGGSPFASLVLLDISGCAIAAGHVDGPVFVTRVRDSAVVV
                     AARQVRIHDCENVVFYLHCVSRPIIENCKGVRFARAPEAYLTDKEKGETNLFDQVDDF
                     KWLKTTASPNWSLLPESEAIPGDVWKQALAGGPAVAVDDTLRMLGIGKGT"
     gene            complement(2581629..2584286)
                     /locus_tag="THITE_2117236"
                     /db_xref="GeneID:11516281"
     mRNA            complement(join(2581629..2581972,2582039..2582667,
                     2582730..2583861,2583927..2584155,2584234..2584286))
                     /locus_tag="THITE_2117236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003654276.1"
                     /db_xref="GeneID:11516281"
     CDS             complement(join(2581652..2581972,2582039..2582667,
                     2582730..2583861,2583927..2584040))
                     /locus_tag="THITE_2117236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003654324.1"
                     /db_xref="GeneID:11516281"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="JGIDB:Thite2_2117236"
                     /translation="MRVFWPADLPRSDLRGVVVGWRNSDLDVFVLAILEEVEPRNVEF
                     ALKIGALLRDAPHPVSRIYELCGQSSIHVLGLSNAPESVELDPSWIRVTIGPGRRVPA