GenomeNet

Database: RefSeq
Entry: NC_016461
LinkDB: NC_016461
Original site: NC_016461 
LOCUS       NC_016461            4396881 bp    DNA     linear   CON 29-NOV-2019
DEFINITION  Thermothielavioides terrestris NRRL 8126 chromosome 5, complete
            sequence.
ACCESSION   NC_016461
VERSION     NC_016461.1
DBLINK      BioProject: PRJNA79337
            BioSample: SAMN02744067
            Assembly: GCF_000226115.1
KEYWORDS    RefSeq.
SOURCE      Thermothielavioides terrestris NRRL 8126
  ORGANISM  Thermothielavioides terrestris NRRL 8126
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothielavioides; Thermothielavioides terrestris.
REFERENCE   1  (bases 1 to 4396881)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4396881)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.-C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.H.,
            Baker,S.E., Magnuson,J., LaBoissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4396881)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4396881)
  AUTHORS   Otillar,R., Salamov,A., Grimwood,J., Reid,I., Ishmael,N., John,T.,
            Darmond,C., Moisan,M.-C., Henrissat,B., Coutinho,P.M., Lombard,V.,
            Natvig,D., Lindquist,E., Schmutz,J., Lucas,S., Harris,P.,
            Powlowski,J., Bellemare,A., Taylor,D., Butler,G., de Vries,R.P.,
            Allijn,I.E., van den Brink,J., Ushinsky,S., Storms,R., Powell,A.J.,
            Paulsen,I.T., Elbourne,L.D.H., Baker,S.E., Magnuson,J.,
            LaBoissiere,S., Clutterbuck,A.J., Martinez,D., Wogulis,M., de
            Leon,A.L., Rey,M.W., Tsang,A., Berka,R.M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003013.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043154
            The DNA was provided by Paul Harris (paha@novozymes.com)
            The strain is available from the Northern Regional Reaearch
            Labortories (USDA) in Peoria, IL under NRRL 8126 and from the
            American Type Culture Collection under ATCC 38088
            Contacts: Randy Berka (RAMB@novozymes.com)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Thielavia terrestris NRRL 8126
            GOLD Stamp ID         :: Gi01746
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Thielavia terrestris V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 10.15x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4396881
                     /organism="Thermothielavioides terrestris NRRL 8126"
                     /mol_type="genomic DNA"
                     /strain="NRRL 8126"
                     /db_xref="taxon:578455"
                     /chromosome="5"
     gene            complement(<4379..>5133)
                     /locus_tag="THITE_2146717"
                     /db_xref="GeneID:11522625"
     mRNA            complement(join(<4379..4456,4521..4812,4886..4935,
                     5062..>5133))
                     /locus_tag="THITE_2146717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656072.1"
                     /db_xref="GeneID:11522625"
     CDS             complement(join(4379..4456,4521..4812,4886..4935,
                     5062..5133))
                     /locus_tag="THITE_2146717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656120.1"
                     /db_xref="GeneID:11522625"
                     /db_xref="JGIDB:Thite2_2146717"
                     /translation="MTTRRRARGFAKAGNLYIGHNRRRGTVVAYGACAGMLGVAAMTA
                     REKVEQFFTGRLSSEVPGKTLARLISAEPQTKEELWVLNMAMHYGQGAVAAVIRGVAS
                     FYGLRGPFTDFIFIGVRLIIDQTLENWTGVGAPPWYPVGEQVIDLLYKAVYAFVTGYL
                     IDC"
     gene            complement(5242..7614)
                     /locus_tag="THITE_2120510"
                     /db_xref="GeneID:11522634"
     mRNA            complement(join(5242..7133,7198..7614))
                     /locus_tag="THITE_2120510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656073.1"
                     /db_xref="GeneID:11522634"
     CDS             complement(join(5477..7133,7198..7604))
                     /locus_tag="THITE_2120510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656121.1"
                     /db_xref="GeneID:11522634"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="JGIDB:Thite2_2120510"
                     /translation="MASNRLLGAACSAAGEAVERATLAVSKFVQEVRECRCECDAIAT
                     ELHSLHSVLDLLESDATLVPASFAAHTAGVLDTCLALINELEGCVLVLNRPGVPRADK
                     KSRWLASRDHIDKLRRTLGEYKLVLGLAVDLVGIIKTHTSDRNQQDTSIYSLDPTADG
                     MNQQSELAAVADRVIDATHRLQPDLHQNAALLRLGRYLLVLQAQTASAREGMGFGLRA
                     HRRDASSSAGGAPDSAIDMSYEDADAVSHYAGEQTTTASPTDVSSEPYEEELDDFVGE
                     RCKLLAPASSSPPSPPPPPPRPPPRSASRLSSATARRPAVPRLHTSNSFIAGTPPSPS
                     VMSSPTAPTATLAYPSRNSYYTPVTALPEQTEPDPRQPAARVRSRRSSIFGHVLHTVR
                     ERPRADVPSAVRPTTSDGDSQTPYTSQRPSGFLRRGSSRLANAVRSLAMRRPAPAPNI
                     AEDQLEPDSNAVFGVSLTRSMQVAKGIASTAHSSGRRSERVTREYPLCVLRCVCHILD
                     CGLDAPHIFGLDGDQVRVAQLIEVFSSAETGYGKELDWSHFTVYDAADVILLFLSELP
                     KPLIPEPVGKRWIALSRQATAGLARLDQGLDFWEEALTGMHGPGRALFKLLLNLWGDI
                     ADAADANEMTAERLAGRLIRPLMHALAAHDHLDFMLGLAFLIRKRSEYNLAARGVMRK
                     SNAAF"
     gene            complement(8473..9565)
                     /locus_tag="THITE_2120511"
                     /db_xref="GeneID:11519352"
     mRNA            complement(8473..9565)
                     /locus_tag="THITE_2120511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656074.1"
                     /db_xref="GeneID:11519352"
     CDS             complement(8857..9459)
                     /locus_tag="THITE_2120511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656122.1"
                     /db_xref="GeneID:11519352"
                     /db_xref="JGIDB:Thite2_2120511"
                     /translation="MAADFEKQSYWHHRFETETAFEWLTSSSAFMDVLAPQLTKLPSD
                     ARILHLGPGTSDLHNQLRQRGFLNVTNIDYEPLALERGQQLERDRFGDVRMEYLVADV
                     TQLELKPVHRVAIDKGTADAVACGPADAVLSMAKAIHCCLDSDGFWVSLSYSASRFEG
                     VRSFFEVEVASRIPTPKLKPTDPDIYLYCYLLRPKRDVAY"
     gene            10700..12109
                     /locus_tag="THITE_2120512"
                     /db_xref="GeneID:11519353"
     mRNA            join(10700..11172,11242..12109)
                     /locus_tag="THITE_2120512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656075.1"
                     /db_xref="GeneID:11519353"
     CDS             join(10876..11172,11242..11925)
                     /locus_tag="THITE_2120512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656123.1"
                     /db_xref="GeneID:11519353"
                     /db_xref="JGIDB:Thite2_2120512"
                     /translation="MATAVAVPLSAINGELGGVLPPSAVVQHSPRHGRSRAMSVKGKG
                     GRQRGYSVVEERDVAIAKALMFVVKRAVQKEDVEEADDGEHLVADPEGWVSVADVLAH
                     PRISALGSTFEDIQRVVAAATKPRFDLRQTAKAGGTPDEPSSWQISRITNRETAASPV
                     PVGGRLTAESQDLPDFVIYETSYQRYPLLLALGAITRAPGGSEYRTFVPVTVGQDGTD
                     SRLTPGAGEAAEVSIWIHLPSALQAEPGITWQRSDSGMVITADDIPKSLWKKAVARRP
                     DIGTLFEDGEVRKEVPSNLRGKGAKGKARKGKGTLKREGSEDESGSASEE"
     gene            complement(<12160..>13866)
                     /locus_tag="THITE_2146721"
                     /db_xref="GeneID:11519354"
     mRNA            complement(join(<12160..12287,12378..13752,13852..>13866))
                     /locus_tag="THITE_2146721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656076.1"
                     /db_xref="GeneID:11519354"
     CDS             complement(join(12160..12287,12378..13752,13852..13866))
                     /locus_tag="THITE_2146721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656124.1"
                     /db_xref="GeneID:11519354"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="JGIDB:Thite2_2146721"
                     /translation="MEVKQVGMIGTGSMGSMLSLLFAELGIHTHFYDPSSQNVEVLQS
                     YARETGHTDKITYHSDHKSLCEALGATGGPRFFMFSIPHGAAADKSIDALEPYLEAGD
                     LIMDASNEQWHATERRQKRLEPRGVHYIGMGVSGGYQSARHGPSISPGGSKAALDAAF
                     PFLQRIAAKDWSGRPCVAKLGPGGSGHYVKMVHNGIEHGMMTALSEAWAILDAGLTMD
                     YEEIGDVFEKWNTDGPLRNSYLVGIGAQICRTRKRGDGGDFVLSHIRDKVVQDVDNSE
                     GTGTWAVEEGVTLHVPHPTIAASHIFRVASADAAKREAVTKTLGGGIVPSKINGIIDK
                     RKFVHEDLRQALYASFLMSFVQGLHILSRANEQHDWQLNFVDVLYVWRRGCIIQSDYI
                     VALLERVYLSEECDEHNLLACPTIASELQNAYLSLKTVVQQALEADLHVPALSASLEY
                     YKYSGSANLPTSFEEAELDYFGAHMYDLKTEGPGKPETGSHHFEWKPARGVQEEQ"
     gene            <14443..>15618
                     /locus_tag="THITE_2056364"
                     /db_xref="GeneID:11519355"
     mRNA            join(<14443..15296,15429..>15618)
                     /locus_tag="THITE_2056364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656077.1"
                     /db_xref="GeneID:11519355"
     CDS             join(14443..15296,15429..15618)
                     /locus_tag="THITE_2056364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656125.1"
                     /db_xref="GeneID:11519355"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="JGIDB:Thite2_2056364"
                     /translation="MSQGAASSYRHLVAFASCSIGLPRHTLHQKIEAVREAGFDGIEL
                     SFPDLQAYATRHFGREIAEDDYGSLCEAAKAVGTMCEGHGLRVLALQPFSKFEGWPPG
                     SQQRQDAFARAKAWIDIMEAAGTDLLQVGSSDSPDMSRDVDQLAADLASLADMLASRG
                     FRLAYENWCWATCAPTWKDVWTIVQKADRPNIGLCLDTFQTAGGEWGDPTTKSGRIEA
                     PGLTSADLSRAYAASLGELAESVPADKIYFLQISDAYLLDPPLNTAADPESGLRPRAQ
                     WSHEHRPLPYDGGYLPIREFVQAVLATGFRGWLSIEVFDGKFEEKYGDNLRGFAKRAM
                     EACQRLIAELRAE"
     gene            <17430..>19175
                     /locus_tag="THITE_2146723"
                     /db_xref="GeneID:11519356"
     mRNA            join(<17430..17480,17622..>19175)
                     /locus_tag="THITE_2146723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656078.1"
                     /db_xref="GeneID:11519356"
     CDS             join(17430..17480,17622..19175)
                     /locus_tag="THITE_2146723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656126.1"
                     /db_xref="GeneID:11519356"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2146723"
                     /translation="MNNKSPARWDIESTDSFWVRGVGFWRCFIGLCIPILLSAFEGSV
                     VSTALPTISQSLGLGPNSSWVATAFLLASIVFQPLYGQLADIWGRRHLMMVAVVVFGV
                     GSAIAGFARNCAVLVFGRIVQGMGSGGIDLFAELILCDIIPLKKRGHYVAIKAAVYAL
                     GTTVGPLLGGIFAQTNWRWCFGINLPICIIALVLMWFWLQLSSGKSWQGLSVLQQIGR
                     VDYVGLVLLTASVVLILCALTLAGTVFSWSDPTILVALAGGSSGVLAFILWERSQRCA
                     HPIMAPRVFSNRTTIAAMIITTVHGFITYGYQFYLPPFFQAVLAASPAQSGVLILPCS
                     LTIVILAAVGGPLLARFGKYRLMHRVGFALMVAGLLPCITFQDSGSVVLWILLSFLVG
                     VGSGIIVSTTLPTVLVELTDKENAAATGSWAFLRGLGSLLGVAIPNAVFNAQFSAVLD
                     SIQDARAKAELSNGQAYQHASAAFIAEFKDQVRNQILGAFTASFKLVWIIFLGMAVLG
                     LLTTFLERQVHLRKDLDSEYGLKDHQ"
     gene            21737..22825
                     /locus_tag="THITE_2120513"
                     /db_xref="GeneID:11519357"
     mRNA            21737..22825
                     /locus_tag="THITE_2120513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656079.1"
                     /db_xref="GeneID:11519357"
     CDS             21986..22519
                     /locus_tag="THITE_2120513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656127.1"
                     /db_xref="GeneID:11519357"
                     /db_xref="JGIDB:Thite2_2120513"
                     /translation="MSYPATAQNMAYMPQPVPATTVVPPRSHFSKWWPISFFISAVVF
                     FIIGGGLLGAWAASSYDDCLDYDYYYSCTTLSNKGEFYGGIACVVIGAICKLVAWILL
                     IVYCVKRRSQPMSVAYTYQPLDYQAAAPVAPAVPMNPYPTAPTPRPKEEAMGMRYCGH
                     CGAVVTTAFCPQCGSKV"
     gene            complement(23408..24960)
                     /locus_tag="THITE_2120514"
                     /db_xref="GeneID:11519358"
     mRNA            complement(join(23408..24283,24335..24468,24515..24960))
                     /locus_tag="THITE_2120514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656080.1"
                     /db_xref="GeneID:11519358"
     CDS             complement(join(23522..24283,24335..24468,24515..24839))
                     /locus_tag="THITE_2120514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656128.1"
                     /db_xref="GeneID:11519358"
                     /db_xref="JGIDB:Thite2_2120514"
                     /translation="MDADFCGQIRAAVAADRETVRRLICDIPPAAEPVGDYVTDLQER
                     CRLFDELRQLYQQHGRSPPNAATLGFVMVAPISEVRSQISTLQTMPHLFVLGGLVLEA
                     PLAMAAYIPKPRAAAVPPSSIPMPASSATLNEPNTPTPADQVKRSGAAARHAKERDGN
                     VCLFSGTSDPAAAHIFPFATSEKRQFASIAVLLQAFWGAEKAKAWCKHFEDAGITQSP
                     QNYLSLNHQIHFWFDNARFALKPLRHTPNEVVVQWHWLKRSALLPRTEIGQAQDAFLA
                     LAGLNDMTWGLCLAHRRSGVPIQTGQTFVIRAEKPEDLPSFELLEVQWNLLRVAAICG
                     AANVIDASYYDLDDDEVAHLVVSGRDEIVTTGQNEVVTEAPEGSESGSPSEQIEQTLP
                     HHHQTHAAKAFRNG"
     gene            complement(25207..27793)
                     /locus_tag="THITE_2120518"
                     /db_xref="GeneID:11519359"
     mRNA            complement(join(25207..26094,26214..27071,27134..27215,
                     27311..27793))
                     /locus_tag="THITE_2120518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656081.1"
                     /db_xref="GeneID:11519359"
     CDS             complement(join(25562..26094,26214..27071,27134..27215,
                     27311..27541))
                     /locus_tag="THITE_2120518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656129.1"
                     /db_xref="GeneID:11519359"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2120518"
                     /translation="MAISTPVQAMTSLETKLAPAEAEDDIRSQTLQGNTGEADGEKHE
                     SHKEGDAEAQHPSTTGLVLIAAGLCLSVFLVSLDQTIVSNAIPKITDEFGSTGDIGWY
                     GSAFLLAVAAFQLFYGKAYSFFSIKIIFMLAIGLFELGSLVCALAPTSPALIVGRAIA
                     GLGAAGIMPGAIIIISHSVPLRRRPIFLGSMGGMFGIASVCGPLLGGVFTDRLTWRWC
                     FYINLPFGGFAALTILLFFKPPDRPVLAQMSILDRVKKIDWLGLLVFIPSIVSLLLAL
                     QWGGVTYPWKNGRIIGLFVVFGVTAIAFGIVQFWRKDDAIIPPRIITQRSVAAGVWYA
                     LFNAAGFMIVVYYTPIWHQVIGHVSAVDSGVRLLPVLIGLVITVMLSGALVSVFGYYT
                     PFMILASILAPIGEGLMFTWTVDTTFGQWFGYEALTGLAVGMGMQQPLVAVQTVLPID
                     DVPVATSAVAFAQTLGGAIFIAIAQVVFQNVLIANLPAGNYDRSGLLTAGVTDIITKV
                     PPQLLPSILVAFNEALTHVYIVSICMSALTIVGSLAMEWRSVKKKTSSGASKEPAGGQ
                     A"
     gene            <29720..>32179
                     /locus_tag="THITE_2091299"
                     /db_xref="GeneID:11519360"
     mRNA            join(<29720..29931,30991..>32179)
                     /locus_tag="THITE_2091299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656082.1"
                     /db_xref="GeneID:11519360"
     CDS             join(29720..29931,30991..32179)
                     /locus_tag="THITE_2091299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656130.1"
                     /db_xref="GeneID:11519360"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="JGIDB:Thite2_2091299"
                     /translation="MTLRLLMCDLIEQQAGVDRDRLLQQHREALMVHAEAVLNAVPYS
                     SRSEIFDMTPLCFVPAFRMAEAVLVKDITSITLTSTPTAENPSSASLVQRRNIVNHAK
                     GASIMQDKLQSVGFRERLAAAYPWTRAPLIVGAPMRVMAGPELAVAVSRAGGIGFIGP
                     GLKPETTAVDLEAAKDLIAASGIPQLQQPGSVLPVGVGFQIWNGDLDVSAAAVSQHRP
                     AAVWLFAPRNGQPDVDAWTRRLREASPETKVWLQIGTLQEALDAVRSASPPDVLVVQG
                     AEAGGHGRATDGVGFITLLPEIADATRGSGIPLIAAGGVADGRGVVAALGVGAAGVAM
                     GTRFLASREARIKKGYQDEVVRASNGGANTLRTHLYNHLRGTFGWPEQFSPRTIINQS
                     WVEQQAGVPFEELKKRHDEAVGKGDAAWGPQGRTATYAGANVGLIRSVVAAGEIVEAT
                     RNEAAEIVRALSGVSD"
     gene            complement(32134..33676)
                     /locus_tag="THITE_2080974"
                     /db_xref="GeneID:11519361"
     mRNA            complement(join(32134..33273,33354..33676))
                     /locus_tag="THITE_2080974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656083.1"
                     /db_xref="GeneID:11519361"
     CDS             complement(32262..33221)
                     /locus_tag="THITE_2080974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656131.1"
                     /db_xref="GeneID:11519361"
                     /db_xref="JGIDB:Thite2_2080974"
                     /translation="MPASRTRRSASRAVGEPSLPTPVHSSHTTPLSSAYPSTYASEAE
                     NDAGDEVSMIPIHALTLSDSAAARLEGPGPTKQQAARKPFRFLDLPSELRIDIYALHF
                     EDCGPVIDLDSDNHKRIHKKLAILRTCRTIYHEASHVFYSTHTFRVFPTQPGRFFKTK
                     KPLLARLNARQRRSLTSLELRLGPGWNAPPRGWVVNQALGLAECVNVRKLTVFVEFDP
                     SHGYFKGFRKADGFYETFSRNLLDDVLGEMPFLDRVHFDAWSSVKKAGALMQGLFEVA
                     RARGRKICWGPERNWTDSDDADAPPHAESAIVSLGSSEQHLVY"
     gene            34002..36012
                     /locus_tag="THITE_2120529"
                     /db_xref="GeneID:11522676"
     mRNA            join(34002..35222,35305..36012)
                     /locus_tag="THITE_2120529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656084.1"
                     /db_xref="GeneID:11522676"
     CDS             join(34530..35222,35305..35928)
                     /locus_tag="THITE_2120529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656132.1"
                     /db_xref="GeneID:11522676"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Thite2_2120529"
                     /translation="MPDLSKLPDLTQGIPSTLEYETSGATNRAALAAVEGGGSGRAGG
                     GGGRPKGELPASAYISSTERRRQKWAMWAFVFAGVSAVVGVAYLGRNWDEKELAKNPE
                     VPNGWSIGLWWKRAMARMGDTVTYYQEPAFEKLLPDPDPSFERPYTLCISLEDMLVHS
                     EWSREHGWRVAKRPGVDYFLHYLSQYYEIVLFTTVPFATAEPLVRKLDPFRFIMWPLY
                     REATKYKDGEVVKDLSYLNRDLSKVIIIDTNPKHVREQPENAIILPPWTGDPKDKELV
                     SLVPFLEFIHTMQYNDVRKVIKSFEGTHIPTEFARREALARAEHNKRLQAKSSRGGGM
                     SWLSSHLGLKPSNMSLMVAPEGEENPQEAFAKGKMLQDIARERGIRNYLMLEEEIRKN
                     GEKWLKEEQEAMEKAQKEAMKSMKSSFFGWFTPSSEQQKEGETKRS"
     gene            <37237..>38061
                     /locus_tag="THITE_157646"
                     /db_xref="GeneID:11522677"
     mRNA            <37237..>38061
                     /locus_tag="THITE_157646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656085.1"
                     /db_xref="GeneID:11522677"
     CDS             37237..38061
                     /locus_tag="THITE_157646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656133.1"
                     /db_xref="GeneID:11522677"
                     /db_xref="JGIDB:Thite2_157646"
                     /translation="MHLRHVLSAIAFVVITVNGRPILRGSLAEECANRGMPNLSNADF
                     NTNVHEKRSNAVHPGLYPGGVDDKLASVYEGAKRDKVKNPSNSGPRPNLGSMPERAVH
                     LVRISESDSSSQGQGSDSSPIQQPMPLVYQRAHSSHLEADMANDVDVGNQPEVENMRE
                     TPTAHEKTSITESQNAVESQASSDPFPSVPHQQVRELHPIPATEKLNDGDNSMVANSN
                     RRVVAILRAWPHNGDTHQSTPREEENKQTRKAPQNQAMPQPELMDSLRAAMGDSHM"
     gene            complement(38496..40686)
                     /locus_tag="THITE_2120530"
                     /db_xref="GeneID:11522678"
     mRNA            complement(join(38496..38580,38726..40686))
                     /locus_tag="THITE_2120530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656086.1"
                     /db_xref="GeneID:11522678"
     CDS             complement(38747..40513)
                     /locus_tag="THITE_2120530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656134.1"
                     /db_xref="GeneID:11522678"
                     /db_xref="JGIDB:Thite2_2120530"
                     /translation="MTRLSATALLRRGLRVLVPLSALLTVYLYLYPVFKSCAFPLPPS
                     SLLPENQGSAFLETAKVHWHSVAGTGANATVFVPSHPPAPFRLLALGDPQLEGDTSIP
                     TDYLGVFPHLTSLLRHVTFRSSDLSLRHRIRLSLHDIIDIFLEDTFDALESLRKRIDL
                     FGNDFYLAHIYRTVHWWTRPTHVAVLGDLVGSQWLDEDEFYRRADRYWKRVFRGAERV
                     PDDLAAYPADEYDLAGNLGGGPFNESTAWTRRIVNVAGNHDIGYAGDITEERVERFER
                     AFGKLNYELRFELPLTNSTLAETVFEADGTSDRLVPELRIVVLNDMNLDTPAASTALQ
                     DDTYAFINSVINTAAAVEFKGHFTLILTHVPLYKPEGVCVDDPFFDFHEHDGSLKEQN
                     QLSGAASKGFLEGILGMSGNTKAPGRGRGRRGIILNGHDHEGCDTWHYINQSVADAEQ
                     RQWEVKRWRQAVGAGIVGRDELPGVREITVRSMMGDFGGNAGLLSVWFDEASWEWKAE
                     YATCPLGKQHLWWVVHILDLVVVVGILLLVFTAVLSVAGIDVDKAVEESILRLCTLQR
                     KVAQPSTSVRGSAPPKDGGSGS"
     gene            complement(41416..45042)
                     /locus_tag="THITE_2120534"
                     /db_xref="GeneID:11522679"
     mRNA            complement(join(41416..43520,43584..44306,44453..45042))
                     /locus_tag="THITE_2120534"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656087.1"
                     /db_xref="GeneID:11522679"
     CDS             complement(join(41577..43520,43584..44306,44453..44620))
                     /locus_tag="THITE_2120534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656135.1"
                     /db_xref="GeneID:11522679"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2120534"
                     /translation="MPKKRRSNAGDDAPNGASAPKVKLPRLERAPEDFSNVVKSKLQS
                     YTRTGQACDRCKVRKIRCDALPEGCSHCASQNLECYVTDRVTGRTERRGYLQQLEREK
                     GAMLVHIRELEKLLENNGVEVRPWQWPGYTTTYPPGVTSDALGNPVQDPSSKDQWHQV
                     GLVWVKNGGQKGSSNARAYTPWSLPAPRPTDSYLGVSSDTAPLSSIKGTMLSILGATI
                     DLTSFDAPDMDEPPPGTPIGSPLYNKSVMAFLQSALNVNPPLGNVELPAKKDAFTYAE
                     WYFRMVSPFLPILHKPSFLQLLTRIYDDPTFKPTVPELVIVHMVFATIYFQYGIRNLE
                     QPEKSAQLNELSNKHYHWSLSKFFDLAASQSVTAVQALAMIVSHTRNFPKPGCSVAVA
                     SVAFGKALEMNLHRAVQVPGGGTTLENEVRKRVWWAVLAILCTLNGRLGRPMPISADE
                     FDVDFPIAINDEYIGEEGILDPSKIGHCNFQAGLTGFKIAPLFMEMYSKIYSVRRDPS
                     RYTEVVNRLDAALQDLMDNLPDELRIEKCQPATQVFALYTQAFCLEFRLCLRHPSVCL
                     SDDPKTCAENTRVCEDTARKLLKVVAALLKMKSLDTTWYQLSVYVAAIFSTLVAHWQR
                     RFNTTTFEVAKLREEMSLWLTVIGEIGRLLGKPLSAASASLLCFVLLSSLTPQVGTGN
                     RLTAEIGAIIERTISWIEQDRGRKPGSSGSQGSLKASSSSAAYQQPPDAAKQDAEGQL
                     GPGSAGTAGSDQRSAGTTNGNGGYYDPGAAGPAGPYSSLGYNDQSSGGASVNANANGA
                     GDSADGAHYLYAAASAASAAAAPNTATAAAAAAEQAAAAQNPLIAFASQATQHVAGQA
                     AENWSAQTQLMAQNAAPNTWQAWTNAIQDSQDRYSANALLTLGSGRPGDVGAGPVVDH
                     VNQADALVNPNAGQWPMLLFHDGSGGVSGS"
     gene            45435..46243
                     /locus_tag="THITE_2120537"
                     /db_xref="GeneID:11522680"
     mRNA            join(45435..45810,45878..45943,45998..46243)
                     /locus_tag="THITE_2120537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656088.1"
                     /db_xref="GeneID:11522680"
     CDS             join(45535..45810,45878..45943,45998..46216)
                     /locus_tag="THITE_2120537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656136.1"
                     /db_xref="GeneID:11522680"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="JGIDB:Thite2_2120537"
                     /translation="MALERLQLEHIPPAYQVYAAFFRDVANTDFLQAQLLARNSEFEY
                     AFVDASSVISRLHLLSAVYSALNALLDGTLRTPNVHSEIVVSLNVNNNIADAYRRWGI
                     TPGKTKDLIVVKTQETIWAHLTEHVHGTPAPLTDVELALATDWPKIRKYYRLNGVPAL
                     ERLADEGARRKEGERLAIMGMALRGL"
     gene            complement(46663..48578)
                     /locus_tag="THITE_2120540"
                     /db_xref="GeneID:11522681"
     mRNA            complement(46663..48578)
                     /locus_tag="THITE_2120540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656089.1"
                     /db_xref="GeneID:11522681"
     CDS             complement(46848..48113)
                     /locus_tag="THITE_2120540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656137.1"
                     /db_xref="GeneID:11522681"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="JGIDB:Thite2_2120540"
                     /translation="MVQAAPLAVLPLANVLRSLMTTSISSSPFLLAPSLAVMSVLANT
                     TAPVLNPDKNPILRFILKKTFYAQFCAGEDAAEVRRTVESLKTIGFGGVILGYAREVV
                     LTGAQMKDLASCGSGSAAEECVRTEIEPWAKGTMETLQLASPGDFVALKFTGAGRQAL
                     YSLSQRLPPSGALASAIDSVCQLAASRGVRLLFDAEQQALQPGIDDWSLKYMRKYNTP
                     THAVVYGTYQAYLKATPSTLSRHLAAAREGGFALGVKLVRGAYLGSDPRHLIHDTKAD
                     TDAAYDGVAEALLRRQWNAHLQPQTGADTTAFPNVSLVLATHNRESVLKARAIISEGK
                     GGTEDVAFAQLQGMADEVSCELVTSDGTGEKPRVYKYLVWGSTGECMKYLLRRAQENR
                     DAVQRTKAGRDAMRAELIRRVKSLFGFAR"
     gene            complement(49248..50229)
                     /locus_tag="THITE_2120542"
                     /db_xref="GeneID:11522682"
     mRNA            complement(join(49248..49557,49626..50229))
                     /locus_tag="THITE_2120542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656090.1"
                     /db_xref="GeneID:11522682"
     CDS             complement(join(49382..49557,49626..50076))
                     /locus_tag="THITE_2120542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656138.1"
                     /db_xref="GeneID:11522682"
                     /db_xref="JGIDB:Thite2_2120542"
                     /translation="MASPDDNLPSRLARERPPPPSKAEVDEFYQNARLSLPTPLRLPL
                     ASVLSFLAGFTLGTAQGGKAAGLRFRAEHAHKLPTSVRGWYLYHKSKNYHMAYGGILE
                     GIKMGGKVSFWTTAMSAIEEMFDSYRGTADLFNTVTSCVTVAGGFSLWNRFSLPMTAR
                     TTKAALVAGIVYGGLQDLVGIARGRPIGYVDWIKGRLGSPRQEQRRSQ"
     gene            50427..51390
                     /locus_tag="THITE_2069336"
                     /db_xref="GeneID:11522683"
     mRNA            join(50427..50506,50598..51390)
                     /locus_tag="THITE_2069336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656091.1"
                     /db_xref="GeneID:11522683"
     CDS             join(50504..50506,50598..51020)
                     /locus_tag="THITE_2069336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656139.1"
                     /db_xref="GeneID:11522683"
                     /db_xref="JGIDB:Thite2_2069336"
                     /translation="MARTAANVLEDPQITVRLKHGIHTIFLFAMLDWSFSRLTTELLS
                     ILRDRYKDGLTTSIAPPKITPVPANDGDGVRVAYAVPANPSDLSQGWKNLKVKPEDTL
                     GKKGLTDMCSVAFSLLDSDADEEGVEFLVELPSLEGEEL"
     gene            51539..51627
                     /locus_tag="THITE_t127"
                     /db_xref="GeneID:11522684"
     tRNA            51539..51627
                     /locus_tag="THITE_t127"
                     /product="tRNA-Gln"
                     /note="Anticodon: TTG"
                     /anticodon=(pos:51572..51574,aa:Gln,seq:ttg)
                     /db_xref="GeneID:11522684"
     gene            complement(51964..53763)
                     /locus_tag="THITE_2120545"
                     /db_xref="GeneID:11522627"
     mRNA            complement(join(51964..52690,52762..53763))
                     /locus_tag="THITE_2120545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656092.1"
                     /db_xref="GeneID:11522627"
     CDS             complement(join(52170..52690,52762..53503))
                     /locus_tag="THITE_2120545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656140.1"
                     /db_xref="GeneID:11522627"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Thite2_2120545"
                     /translation="MLSAFALFVIALAIRPLVGVWAAALDGSGTGHPGTISLKQVRNP
                     NFVRNGPIQLAKIYLKYGAPVPDDLEAAVARIRAKAGKRSTGSAEAKPEANDVEYLVP
                     VSIGTPGQVLNLDFDTGSSDLWVFSSETAKNEVKGQAIYDPGKSSTAQKLQGYTWQIA
                     YGDGSTSSGDVYLDTVTVGGLTVLSQAVEVAQKVSEEFTSDANNDGLVGLAFSSINTV
                     EPVAQKTFFDNALPSLDAPLFTADLKAGAAGRFNFGYIDPSAYTGNITYVPVDSRNGF
                     WEWTCSGYAIGSDSLKNTTFQGIADTGTTLLLLPSSVVSAYYGQVSGAKYDPSQGGYT
                     LPCSGSAPDFSFGVGNNGARVTVPGGYVKYAPTESGSQTCFGGIQPDTGIGFSVFGDV
                     ALKAAFVVFDGGQKTLGWAPKILSSAKG"
     gene            54669..56823
                     /locus_tag="THITE_2120546"
                     /db_xref="GeneID:11522685"
     mRNA            54669..56823
                     /locus_tag="THITE_2120546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656093.1"
                     /db_xref="GeneID:11522685"
     CDS             54814..56583
                     /locus_tag="THITE_2120546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656141.1"
                     /db_xref="GeneID:11522685"
                     /db_xref="JGIDB:Thite2_2120546"
                     /translation="MGGQQPDLLPRSEHEDLPSASGSAPASRINRDKVKCLDGLRGIA
                     CLLVFNYHFFWPWTPMIMLGYGAFPPRAPEPYWGWQSLPIICLLHRGRPMVAIFFAIS
                     GYVICRHVLRLIHERKLDAAYQRLASSVFRRVFRLYIPPTISMFLVAVLAQTGAFKSE
                     FAIYKGPDSRYINATITHADLAEGNFCRDGTAVKGAAGIANYLGIEATAYLRNTTGYP
                     EGNTTDWTDMLLCVNHTTRSYGPAQLYTLKSEYEAQFPKLAEDTPGMERLAALGSVDD
                     NDNDLALSSGNVTEAAGPLNLTWVQMGGSWEEHPFIHPNLTYAMKNFTRSYAEWANPF
                     NFGHYHPRYDPHTFTIPMELRGSMLVYIFLLGTAAIKATWRTAIGSLLSAYSLFIGRW
                     DMAAFLGGMLLSEHDVRRSSDLPPLAPGARGRGGDVQRTTKGAAALRWAGIVLALYFL
                     SYPDSGAEYTPGFAYLSTWVPKYYNKLSGWMFYEAMGAVLLVACIMRSPGLVRLLESR
                     LPQYLGKISFSLYLVHGPVLHSLGFWIMPRLFDSFGKTGGYAIGWVVLLAVTFYLSDL
                     WNKKIDSWSVTVGRRVEKMLAED"
     gene            59842..62749
                     /locus_tag="THITE_2120548"
                     /db_xref="GeneID:11522686"
     mRNA            join(59842..60216,60291..62165,62240..62527,62660..62749)
                     /locus_tag="THITE_2120548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656094.1"
                     /db_xref="GeneID:11522686"
     CDS             join(59937..60216,60291..62165,62240..62352)
                     /locus_tag="THITE_2120548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656142.1"
                     /db_xref="GeneID:11522686"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Thite2_2120548"
                     /translation="MDEKQAAQANAASGAVRPFSESTPPIENTADLKVHNVEVEKAGT
                     ETEVEEEEDLYRPLAMDPAIPYEENPLTIRAVVVGCVLGSLVCASNLYLGLKTGFTFS
                     ANMFGAIFGYGILKLLEKSGGKLPIIGGLFGPQENSIVQAAATGAGGTAGIFVAGIPA
                     MYQLGVMGDRSPKEDIGLIFTITLVTSFIGLFYVTPLRRFFIIQVARELRLMFPTPTA
                     VALTIRAMHAGAAGSVEAVKKLKCLGICFIGALCHRVASYYAVGILYDWHVFTWIHIW
                     SGYTSWAMNIESWGWYFEWTPAFIGSGILIGLNPAISMFVGSLTAWAIIGPALVHYGE
                     CIGIQASDDPKWNGYYSFVSLADLGKRTPSPRYWLLWPGVMVMVCSSMAELFVQYKVI
                     WAAFKSVWNQSCAGINNILTARGKSSAFFAKHGAPVEKDETIVEDPFPPEQQVKHWMW
                     ILGLLVAVVIGMLIFHFQWEMHPGLTILAIVLAFLFSFLAIQIGAVTDNTPLTAASKA
                     SQLVFGGATSHSGYTIQHAQKINLVAGSLASGGADMATSLVSDFRTGFLIHTPPIKQW
                     IAQSIGAFVSVWLGPGLFVLFTSAYPCIYNPLTDAQVEAGEKCAFLVPSVSAWAAVAQ
                     AVTDPNVSIPLKSGIFAIVMGVVSIIQVVIRHFYLVGEREKWRKWLPNWGAIALSWVI
                     PAPVFANAALLGAIVAAIWRKWNMRTWDIYGYAVAAGFIAGEGLGGVVGAILTLAGVD
                     GATKGTNIACPADSC"
     gene            complement(62853..65178)
                     /locus_tag="THITE_2120553"
                     /db_xref="GeneID:11522687"
     mRNA            complement(join(62853..63386,63470..64584,64743..65178))
                     /locus_tag="THITE_2120553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656095.1"
                     /db_xref="GeneID:11522687"
     CDS             complement(join(63209..63386,63470..64584,64743..64847))
                     /locus_tag="THITE_2120553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656143.1"
                     /db_xref="GeneID:11522687"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2120553"
                     /translation="MSLSSRILQKIVRNEAMASDPPEIYGWRVYLLACSACFGAMSFG
                     WDSGVIGGVIVLDPFIKDFNLGDSKSVASANLSANIVSTLQAGCFVGSLAASPLTDRF
                     GRKWSLIAVSILIMVGVIMQSAALGNLGTMYAGRFIGGMGVGAASTINPIYVSENSPR
                     AIRGLLTGLYQLFIVTGGMLSFWINYSVSINFPPTKVMYVFPLAIQALPALLLCICML
                     LCQESPRWLARKDRWEDAKKVLSRTRNLPPTHPYIQEEFQEIVDQLEQERRLIGDASF
                     WNLQREMWTIAGNRRRVLVSIFLMICQQMTGTNAINTYAPTIFKNLGLSGTSASLFST
                     GIYGIVKVTSCICFLLFMADSLGRRGSLLWTSIAQGLAMFYIGLYVRIAPPVPGAPVP
                     AAGYVALVSIFLFAAFFQFGWGPACWIYASEIPTARLRSINVAYAAATQWLFNFVVAR
                     AVPTMLVTVGAYGYG"
     gene            66723..68647
                     /locus_tag="THITE_2120556"
                     /db_xref="GeneID:11519482"
     mRNA            join(66723..67248,67330..68024,68102..68647)
                     /locus_tag="THITE_2120556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656096.1"
                     /db_xref="GeneID:11519482"
     CDS             join(66905..67248,67330..68024,68102..68412)
                     /locus_tag="THITE_2120556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656144.1"
                     /db_xref="GeneID:11519482"
                     /db_xref="JGIDB:Thite2_2120556"
                     /translation="MALPEPQITVLARDPAQRQFNINCNSFQQDAVVSFNGWQYATFF
                     TFLQSDEPPVAASAEPLYVHLARRRLPRGEWEVMVLDDYAQTTDDGHNTVQMGICPGD
                     GTIHLSYDHHCDVLRYRYSVRGLATDPEKFDWTPSLFTPTLDYLPGLPSTHRHFGYVT
                     YPRFGFLGDDMFCSFRDGKAGLGNDYLYIYSGRTGRFDFVGAHLTGVQSNPYVHGMDW
                     RGGRLHVTWVYRGFVYYDGWDDPLDTKHKQQSGPNTNENNHNICYAYSEDKGYTWKNG
                     AGKVIADLRKGETIANDAEGIVAFKIPKNSGLSNQEAQAVDQDGGVHVLNRDKRDGGA
                     SAMWKHYYKPLNGAWTQRPIRPISGRARGRLAISKTGDLYVILPDFAASRLQILKASK
                     AGGYSSYDEVWTGQGLTGEPLVDSARLEHDNVLSVLVLAEEKAAPGERKVVVLDFQL"
     gene            69254..71775
                     /locus_tag="THITE_2120559"
                     /db_xref="GeneID:11519483"
     mRNA            join(69254..69846,69929..71189,71281..71775)
                     /locus_tag="THITE_2120559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656097.1"
                     /db_xref="GeneID:11519483"
     CDS             join(69634..69846,69929..71189,71281..71429)
                     /locus_tag="THITE_2120559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656145.1"
                     /db_xref="GeneID:11519483"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2120559"
                     /translation="MASHLSSGGRDAANSNVVVSAVPPLAQSIHCSQTSHKGRRTRAK
                     LTSDERERVLGVRRLGACLRCRILKIQCSLENPCQPCLQSAVKGSERKVLSFCYCVRT
                     RFADVNIFGCRSAGETASAVGMQTESLLLDMSNLLSRIAKPARFSFTSNPAAFNNTMV
                     SWLTDPDFRLPNGSIVGLCCSRLLGLQFRQETANGDAATDDLLTDFRRFLLATSLAHA
                     GWRDGGKALKMRDLCAAGQVSGCRLLRRLDRVLTPQFLARCERESCQVLFLLVLGAVL
                     GVGYSSSSLLEGDASPAFPAAGAETLLSPEFRRSPTLWLAMKEHLCQMLAHHLIFIGS
                     MLGIRLDTALEQRIIDTAVTRWNKAEEFVWAEMMGVAGPSALKVPGNGDVKTEEEEGD
                     PMGGSPRTKRPPAPLPPIRHNALPWSPLEAPQLVPIPCPEVSQFQPAAVEAWSENPQS
                     YLSLFEESKNGEPSGLESSTRDVEDPASVTGPRPEPSARLKGPEYGRPRETKRRSIWI
                     VRPLDAGPEHGLVNVHARLRGDSSLESLRTFV"
     gene            <79267..>81374
                     /locus_tag="THITE_2056623"
                     /db_xref="GeneID:11519484"
     mRNA            join(<79267..79547,79584..79858,79954..80082,80180..80444,
                     80540..>81374)
                     /locus_tag="THITE_2056623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656098.1"
                     /db_xref="GeneID:11519484"
     CDS             join(79267..79547,79584..79858,79954..80082,80180..80444,
                     80540..81374)
                     /locus_tag="THITE_2056623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656146.1"
                     /db_xref="GeneID:11519484"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="JGIDB:Thite2_2056623"
                     /translation="MWTKIRSSLLALAAATLALAGPNCPPLGPVYEKPNNFNTSSAMK
                     AALANLTAALTAWDQNNSSAVRADITSYSIEVFSTSKDHPVIFSWHHTAPSNSSTNST
                     AVGVSKTDGDTVYRLGSLSKIFTVLTWLAQDGDAKWNDPITKYVPELAAAADGRAKRD
                     PVANVPWDEVTIAALAGQLSGAIRDYGLMSEVTQEMNLTEAVSLGFPPLNSSDPMLPK
                     CGEWPQCNRTEFFNGLLRAYPSFAPFTTPAYTNTGFQILAYALESIKGKSFEAMMQES
                     ILEPLGLKHTYYRNAPAEEGIIPGGNRKAAEWDYQLGDEDPAGNMYSSVSDISALGRA
                     ILSSALVPPVVTRRWLKPAVMSSELIAGVGYPWGIRRVVVPYANGKRVVDAFNKAGNI
                     GYYSSLLVLLPDYDAGFVILAAGEAIPGNNNFNLADVVGARLVPALEAAAREQADAKF
                     AGQYIDEDAGANSSLRLTTQADRPGLGIEGWVSNGTDMQTIAVVLQGGYAPVNPSIRL
                     YPTGLETARPDGSRRVAYKAVFEDLNLPARDPATSMFSTDCGTWVSFTGVTYGTQPLD
                     QFVFEIDETGAVVSIENLALRSVMKKRR"
     gene            complement(<82252..>83454)
                     /locus_tag="THITE_2056759"
                     /db_xref="GeneID:11519485"
     mRNA            complement(<82252..>83454)
                     /locus_tag="THITE_2056759"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003656099.1"
                     /db_xref="GeneID:11519485"
     CDS             complement(<82252..83454)
                     /locus_tag="THITE_2056759"
                     /note="CAZy_ID 269966"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003656147.1"
                     /db_xref="GeneID:11519485"
                     /db_xref="JGIDB:Thite2_2056759"
                     /translation="MAARTLMNVAAMVAMVAALHTFFGWLSGNDSYLYWFMCLFAWRY
                     LRFFVNLAAFWCYSPAPPPKDREPTYMPSRDVTAVIPTVDPEGAAFRGCLESCAQNEP
                     AKIVVVTAGDELYAAALSKVKEFEERFPLTQFVVARTQEVSKRKQVALAVPHIETDIT
                     VLLDDHVFWGPRFLQSVLYAFEDSGVGLVGTNKQVRCPDGLGLWVRIWNMLGATYLCR
                     HNFEIRATNTVDRGVFVVSGRTCAIRTEILRHPEFLPGYTNEKFFFGLFGPLNADDDN
                     YVTRFVVRHGWHIKIQYTDDATMETILGVEHPPATKFLAQCRRWARTTWRSNVCSLVT
                     DRTVWRRQPYCVYAVYLTSLTNFAAIIDPLLVYLFSRSSACVSGAALGGLVSWILLTK
                     VVKVFDHFR"
     gene            complement(84843..86675)
                     /locus_tag="THITE_2096933"
                     /db_xref="GeneID:11519486"
     mRNA            complement(join(84843..85633,85711..85852,85917..86164,
                     86247..86675))
                     /locus_tag="THITE_2096933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656100.1"
                     /db_xref="GeneID:11519486"
     CDS             complement(join(84904..85633,85711..85852,85917..86164,
                     86247..86377))
                     /locus_tag="THITE_2096933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656148.1"
                     /db_xref="GeneID:11519486"
                     /db_xref="JGIDB:Thite2_2096933"
                     /translation="MSRLFRPLHSLVGSTRLISRLPSGQTVRVERVKVKRGKPATRFL
                     GNVLKGALVFQLVVSTLSPLVDDIDDDDDLVPGEDEENDEPLFVPFPFTTKKLPRQPY
                     SGSDPEWIEFIRISKDERLRDAIIKHTCKIVLGRAQRTPLLSQRLGKPTSVRRCWLDF
                     DYPFYAPPEYERSGILVTDEAIEWTTMRCDPYLVKYLNRVLWPQPMALGIWALGKEAA
                     KQTASDVARYFGFALEDPTRPQTRPAGPSSNPPPLPTSPGPEMQKALERIRQQTTRRP
                     AEVNDPSAAASSSAAAAPAPTPTAPQDKAVDAPSKPNLDQSNSPDLPSPRGWFRELVF
                     SIKKSRPWKTFQESFFREWQPLRPDPPRGSVLLSGVIELETPRAWIVVDTWAWYCPAT
                     NSIDTDSMRLVLRRIQHKVQKPLG"
     gene            86947..88623
                     /locus_tag="THITE_2120566"
                     /db_xref="GeneID:11519487"
     mRNA            join(86947..87251,87309..87695,87759..88623)
                     /locus_tag="THITE_2120566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656101.1"
                     /db_xref="GeneID:11519487"
     CDS             join(87072..87251,87309..87695,87759..88442)
                     /locus_tag="THITE_2120566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656149.1"
                     /db_xref="GeneID:11519487"
                     /db_xref="JGIDB:Thite2_2120566"
                     /translation="MRLVAGLAAAALSGVAAGSSSQPSSADVYIFPSSSAWQSSPGAE
                     TPRIPKEIARHILLQRTSRQRYGSDLRDIPSSIDTDAAVGHIARFGKGPTPLFTHSEK
                     TDPAQLVVLLEGAAPEQSSRAREKLAQHAAFAISDPPSATANSNLMALFRNLGVSTSR
                     QCDLPAAINPFDTDCWTGPSSVVKYDLRTSPTTLDSLFDSLARIDKFVTDGDLELTLV
                     VLPESSRSSKLHHWSAAAAGAGSGSDLRRRDDSEMVISEHGDGTGASPTVKPAAASSS
                     APARRPKSIPQCFATLSACMAQTNSCSGHGECVNKYAVGGGNSSTAAGAGAAPAASCF
                     VCACKASVVEGGDSSAARTQGRRTVHWGGNMCQKEDVSVQFWLFAGFTVAAVGAVSFA
                     IGLLFGVGEEPLPGVIGAGVSRSK"
     gene            complement(88624..90624)
                     /locus_tag="THITE_2120567"
                     /db_xref="GeneID:11519488"
     mRNA            complement(88624..90624)
                     /locus_tag="THITE_2120567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656102.1"
                     /db_xref="GeneID:11519488"
     CDS             complement(88804..90480)
                     /locus_tag="THITE_2120567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656150.1"
                     /db_xref="GeneID:11519488"
                     /db_xref="JGIDB:Thite2_2120567"
                     /translation="MSSFGAKRRGRVIQTFDDESDDLALSSNGGNEEQNDRKCLTSSS
                     RARLFQSPPLLILGPSKSKLADARPAESAPPGRIKFGRNKSGKPSALRKSLNLGDEDG
                     SLSAPASAPTASARDDDEDDTSSGPVVVRPAPGRSGSTRIKKRPAASRLSFGPSGGEA
                     AEEGEAAAAGEAVIKPSAPRKPLTQRILQNNALRRTGSLQNLTSSLPIRFGGEEDRPK
                     YSKEYLEELQSATPNTPQNLASLQIDDDGEAMELDEAELDGALVVQSTDVAAPAPPGP
                     ASTTQILTEAEIRERKERRARLAQEASFIPLEGGSDDEAAGQGGRMTVHFPSTKKKKE
                     SRLIAEDEDLGEGYDEFVSDGGLALGRRAERDAARRHRQEMAELIQAAEEGSEAETDD
                     SEAERRAAYEAAQRRAGLDGLHHHHRRLLDDPEADADGAMAPDAIPRMKPLPKLGEVL
                     QRMRDIVQGLEDEVVRKRARIEGLEKEKAEILAREKEVQEILNQAGAKYQAVLANAGG
                     TIVADVNKLAGQSPLRPPLPPGIAGELPVERGLESFGATPTKRDDVDETS"
     gene            90657..91533
                     /locus_tag="THITE_2120569"
                     /db_xref="GeneID:11519489"
     mRNA            join(90657..90784,90866..90937,91010..91084,91144..91533)
                     /locus_tag="THITE_2120569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656103.1"
                     /db_xref="GeneID:11519489"
     CDS             join(90755..90784,90866..90937,91010..91084,91144..91218)
                     /locus_tag="THITE_2120569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656151.1"
                     /db_xref="GeneID:11519489"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Thite2_2120569"
                     /translation="MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDDA
                     VEEKDNGEKAKLGMVVIRGNSVVMLEALERIGGDERGGR"
     gene            complement(92661..94056)
                     /locus_tag="THITE_2151656"
                     /db_xref="GeneID:11519490"
     mRNA            complement(join(92661..93031,93095..93469,93539..93781,
                     93883..94056))
                     /locus_tag="THITE_2151656"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656104.1"
                     /db_xref="GeneID:11519490"
     CDS             complement(join(92769..93031,93095..93469,93539..93781,
                     93883..93976))
                     /locus_tag="THITE_2151656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656152.1"
                     /db_xref="GeneID:11519490"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="JGIDB:Thite2_2151656"
                     /translation="MSFQNITDDFGRLGLESDRNPHRDERYSSPPGPYPPSSYPPQGY
                     GQASPEPYPGHYPPPHQSPYSSPPAQSSYAYPSEPGPRPPPPYAPPAGKPPIPAGWTP
                     RWDDHYQRWYYVEEATGRSQWEAPGFDHSAYRVNPPSGDNRGHSPVPGAHPPYGGGPP
                     GYGSPSPSVGGYQAGYGDNRASGAQGEKGHGGMLLGAAGGLAGGLAVGAVAGAVIGHK
                     IHKHKAHKHKAQKHKAHKRSDSSSSSSSSSDDEHHGGARIAKAHKYKHGEEVDSSDRE
                     ELEEDEEEDEEEDEEEDEEEDEEEDEEEDEEEDEEEDEEEDEESSDDD"
     gene            <94790..>96291
                     /locus_tag="THITE_115398"
                     /db_xref="GeneID:11519491"
     mRNA            join(<94790..95892,95988..96157,96266..>96291)
                     /locus_tag="THITE_115398"
                     /product="caspase-like protein"
                     /transcript_id="XM_003656105.1"
                     /db_xref="GeneID:11519491"
     CDS             join(94790..95892,95988..96157,96266..96291)
                     /locus_tag="THITE_115398"
                     /note="Shares amino acid sequence identity with the
                     putative metacaspase 1A from Neurospora crassa."
                     /codon_start=1
                     /product="caspase-like protein"
                     /protein_id="XP_003656153.1"
                     /db_xref="GeneID:11519491"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="JGIDB:Thite2_115398"
                     /translation="MSYGYPGQGYGPGGGGGSGYHHPPSPQYAGGGGYGQYPPPNQGY
                     GQYPPPQQQQYHQQPGYGHYPPPQHHHQHQQQYHPPPGPPPQGYDAYGYPIAHGPGYG
                     GSAPARTAPPPPSGVQHFGHGAPEGYTFQYSNCTGRRRALLIGINYFGQQGELRGCIN
                     DVTNVSNFLMERYGYKREDMVILTDDQRDPVLQPTKANMIRAMQWLVAGAQPNDALFL
                     HYSGHGGQTKDLDGDEEDGYDEVIYPVDFRTAGHIVDDEIHHYVVRPLLPGVRLTAIF
                     DSCHSGSVLDLPYIYSTKGVLKEPNLAKEAGLGLLEAVGAYARGDMGTVASTVFGLAK
                     SALRGNDAYERSKRTKTSPADVVMWSGSKDDQTSADATIAAKATGAMSWAFITALKQN
                     PHQSYVQLLNSIRDVLETKYTQKPQLSCSHPLDTDLLFVM"
     gene            complement(97385..100274)
                     /locus_tag="THITE_2120577"
                     /db_xref="GeneID:11519492"
     mRNA            complement(join(97385..98840,98894..98977,99047..99172,
                     99241..99368,99455..100274))
                     /locus_tag="THITE_2120577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656106.1"
                     /db_xref="GeneID:11519492"
     CDS             complement(join(97517..98840,98894..98977,99047..99172,
                     99241..99368,99455..100006))
                     /locus_tag="THITE_2120577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656154.1"
                     /db_xref="GeneID:11519492"
                     /db_xref="JGIDB:Thite2_2120577"
                     /translation="MILPREAGSPAARSPAATEGSEFGTTPDTKPQARLDGVAVWWLT
                     FAAVWTLLLAAGMTFLYKKRNTPTLRLRGLSLTFAGLVLLHLYWLSVQIAYSVGPLAP
                     EVAEFWIMSVWYPFGIALFHAGNSQFLHVAKAQSRFARPPSQMKTRYDEKRRLQKPTW
                     LQRIRQMDYSKRMFMFVTMGMTVQLLIVIIIYMVSRKFHPDFGVPGTEVTGKSAAEIA
                     MKQGRGWEWWPSIVWQFVWAWIVAPIVLWRSRGIRDTHGWQRQTIACCIAGLPAAPMW
                     LIALYVPGMAPVNQYFVPPQWIALSIFVIEICSVFVPCWEVHKHQTLRQETLESIANW
                     ESKKRFGAKSETSSEQTAAPPLSPTSTKVGDSAGFDSWKKLPGLESNTASQANVGGVP
                     DDGVLTMAALEHVLDKNPEPLRQFSARRDFSGENIAFLTAVAEWKAALPPEFVRSRFD
                     AASEGMVREQFTRALRIYTEFISPRDAEFPINIAWHDLRKLQGVFERAARSMNTAGAS
                     KTVDAATPFADSELADFTAKPPPPPPHQPPKRDSRDSQAHILEPSPTLPPAEAVTTTT
                     TTTTTTTARPRSTGATHIPLPVPAVLPPSHAHANSTNGSNTPSQPHAYVHTPSYALYE
                     GDIPTAFDAAVFDAAQASIKYLVLTNTWPKYVRERRSSETASSLSSSSSSSSNDGSGS
                     GSGSGSGGRSSRGSRGRRGRRRQGGAASTVGGESVGSKASVGLKGALEYLRGFIH"
     gene            <103948..>105380
                     /locus_tag="THITE_2055580"
                     /db_xref="GeneID:11519493"
     mRNA            join(<103948..104554,104643..105156,105239..>105380)
                     /locus_tag="THITE_2055580"
                     /product="carbohydrate esterase family 15 protein"
                     /transcript_id="XM_003656107.1"
                     /db_xref="GeneID:11519493"
     CDS             join(103948..104554,104643..105156,105239..105380)
                     /locus_tag="THITE_2055580"
                     /note="CAZy_ID 269851"
                     /codon_start=1
                     /product="carbohydrate esterase family 15 protein"
                     /protein_id="XP_003656155.1"
                     /db_xref="GeneID:11519493"
                     /db_xref="JGIDB:Thite2_2055580"
                     /translation="MRAISCTLIAAACGTATGVSLAARQGGAGNATIQCAAIPSPFPT
                     WQQLPQQSTLPDPFLPLKYTTPSDAQNIMAGKGQGRVQTPDEWYQCRQPEILQMLQEY
                     QYGYYPDHSQEKVEATRSGTTLNIAVTAGDKTGSFKASFTLPSGASASKPAPVVINIG
                     GMQNQPYLSAGIAIAQFDYTSVAPDSNSKTGAFWSIYNGRDIGVLTAWAWGFHRVLDA
                     INMTVPEIDATRVGVTGCSRLGKGALAAGLFDKRITLTMPMSSGVQGMGPYRYYTMSG
                     QGENLENSKQGAPWWTDSTLGTFVNHAENLPYDAHTIAAAIAPRALVIDQGTGDQFTN
                     SKATAVIIYPAAKLVYDWLGVGDQIAMSVRSGGHCDMSGYTSVLPYVQKIFFGTPTNK
                     DYNSLGSYGSPITTAYPWATATPPSKAA"
     gene            105691..107757
                     /locus_tag="THITE_2120584"
                     /db_xref="GeneID:11519494"
     mRNA            join(105691..105931,106022..106183,106245..107072,
                     107160..107757)
                     /locus_tag="THITE_2120584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656108.1"
                     /db_xref="GeneID:11519494"
     CDS             join(105904..105931,106022..106183,106245..107072,
                     107160..107518)
                     /locus_tag="THITE_2120584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656156.1"
                     /db_xref="GeneID:11519494"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Thite2_2120584"
                     /translation="MERLGLHANDPRWSSIPTDLLLAELSRRDDASNRPACGSGKKGS
                     YDTGIHVFALFLILTLSTLACGFPIFSQRLTKGSRRQRNIIFLCQHFGTGVLMATAFV
                     HLLPTAFNSLTDPCLPHIFSKGYRPLAGLIAMVSALVVVALESYLTTRGAGHSHSHHP
                     VWEDDDDTGDSDAHSGAPTPDDTPADGSAARRARRDRPASIIALDDLEASQGLVSGAS
                     PLAGSTPTMAPAREGLLKGGASGARKSHDHNDDDDRESLDLELSFEELRGPDADAGAP
                     QRKLERTLSALEHVPGPEEQKRLMLQCALLEAGILFHSIFIGMALSVAQGPTFAVFLI
                     AISFHQSFEGLALGTRIAALHFPRSSPRPWLMVLAFGATTPLGQAIGLFVHRFYDPMS
                     QTGLLMVGFMNAISSGLLLFAGLVQLLAEDFLTEKSYTTLKGRRRVNAFLAVVSGAGL
                     MAAVGAFA"
     gene            complement(<107836..>108652)
                     /locus_tag="THITE_2056800"
                     /db_xref="GeneID:11519495"
     mRNA            complement(join(<107836..108148,108270..>108652))
                     /locus_tag="THITE_2056800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656109.1"
                     /db_xref="GeneID:11519495"
     CDS             complement(join(107836..108148,108270..108652))
                     /locus_tag="THITE_2056800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656157.1"
                     /db_xref="GeneID:11519495"
                     /db_xref="JGIDB:Thite2_2056800"
                     /translation="MYAVSDILSLLLLLLLGISGEGQASPVSPRPNHLDARQSTPTTG
                     KYCNPSTSICYLEYSWGPTIPVYRVAIPDSASSGAPFQTLLQIVAPASLGWAGFSWGG
                     GMTLNPLTVVWPNGNTGVTVSSRWATGRTQPALYPSATYRTLSASRNATHWTVETVCT
                     GCSKWSGSGSGGLNPSGVNTFAWAVSKTAVAQPASTASSFSIHDDVGMFSESLSLGKV
                     PKATFDAYVNGGR"
     gene            109950..110631
                     /locus_tag="THITE_2120586"
                     /db_xref="GeneID:11519496"
     mRNA            join(109950..110429,110505..110631)
                     /locus_tag="THITE_2120586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656110.1"
                     /db_xref="GeneID:11519496"
     CDS             join(110032..110429,110505..110622)
                     /locus_tag="THITE_2120586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656158.1"
                     /db_xref="GeneID:11519496"
                     /db_xref="JGIDB:Thite2_2120586"
                     /translation="MDDFSKSIAATTSSALSGEAQATAAKIQKAVTAGVVGDGALQAR
                     LSGLSARLQVFRLHADQLSRCIADAPVVHPNLGDVLKSSLAESAHALRTVTGRLEPGS
                     DSLDSHAVSAFEALLAAYTRLFVLGTQLLTIETEQEQQAKLASPVAREIVAAAHNASQ
                     GVLSFSYAMEN"
     gene            complement(111459..113431)
                     /locus_tag="THITE_2120588"
                     /db_xref="GeneID:11519497"
     mRNA            complement(join(111459..112565,112639..113431))
                     /locus_tag="THITE_2120588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656111.1"
                     /db_xref="GeneID:11519497"
     CDS             complement(join(111589..112565,112639..113218))
                     /locus_tag="THITE_2120588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656159.1"
                     /db_xref="GeneID:11519497"
                     /db_xref="JGIDB:Thite2_2120588"
                     /translation="MASKRSKAAPTDDELGELFEGIGDDAAPKKTSKAKPGAPKSKPD
                     AAAENDILAELENELGETAPSRPHTPRVRDTAPKPSPAKRASTSTPPPPPPGTDTATA
                     SAPRRSVESTASRHTSLTPSATSSEPHEPEKKAQAAQPAASSGGSWWGGLLSTAAAAM
                     KQAEAAVKEIQQNEEAKKWADQVRGNVGALRGLGDELRHRALPTFTNILHTLAPPISS
                     HERLLIHITHDLAGYPSLDPLIYGVFSRVMSQVEGGDLLVIQRGQESTLRTPSAEKAG
                     GLFGGGGAQQSSAGWRDGPWWRQADAPRDLGLVHGLVEGTKLCRANAEGYAAEYFAAH
                     GGIERARQRAHEPVSESNPVRSSDLFLSVQAVRVPSDQTLFAGSAAEEKEKQESVVAE
                     EEEDDEVCFAVFILDPVHEIQYATVSQRVPARWIRWLDAPATPLTPASGDEDFQAEFG
                     RVPEEIREIIESGGVDPREWVAEWVEEALSLAVGVVAQRYVARRMGVGEGGIGKGKQK
                     VESVLEGGGN"
     gene            <114089..>118290
                     /locus_tag="THITE_157616"
                     /db_xref="GeneID:11519498"
     mRNA            join(<114089..117872,117938..>118290)
                     /locus_tag="THITE_157616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656112.1"
                     /db_xref="GeneID:11519498"
     CDS             join(114089..117872,117938..118290)
                     /locus_tag="THITE_157616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656160.1"
                     /db_xref="GeneID:11519498"
                     /db_xref="JGIDB:Thite2_157616"
                     /translation="MGRRRSSSRGRGAKKRASLPSHSLSHPPQTHHTPPFSDSASPST
                     PEASALPPALRMPHTAPQRGGKARQTNITTPHRASSPAADHALRATSRTDRPARSATF
                     HLSSSSFESPSAADSIMAAAGPSRKRSRTFETSYDGAADDEGHSKGGHSLRKRARIDY
                     TQEMIDDDLGLPAPKNDLFAKPAAVTPSARGRRRKGVHDDSGEESDGFASNPKRHHRA
                     DKSPAPARPASSRRRHPSKKLSPDASAYVDQPSDNEVQDTILVSVPNMGPGAPAEESD
                     RSSAREAESPQTSSDESDEARARGLPPTPRVQPSASIKHEVSVAAEDEVIDKSLIPEP
                     ADEKPPIAPEPISLTPGPEIELAEHAERAPEKDAASLPTDLIVSPTAVAEADSTSERP
                     VQLPEQTHHPQQEPSALAATIEKTAPENPAAQDATTVEEPSAPPASELDAGATSIPPV
                     SRAPSRQATKPTGPARLKQLERIYNSETPFASHLNLTPYEDEDVALPGPFTEWVYPAE
                     PAKDDSTPTSTPAAAPAPAEKKPAEMEWDARRRLKASEFFALYKKEKKRRQERGEPPI
                     SMIEFNNECARRYKSAHAQDGDSQTPSSTTESAETSTVVAVRPENPEITVEEELPQNS
                     QVAESGQFTAAPSPAPADDAADQEDAVDDEQEAEDAVDEQIPRNGPVEPVEVTRNPSK
                     QYLFPKIRDPNDFVEAFEGWQDFSNEHLYETVAAAIEAMHAYQQEYNELKKYLDDEEN
                     AKRRQANDKTIVNWENRQKADEPLPWRRHFDDVVKGPPAFEVRGVRAPKPYIDDPALE
                     HQKEEDRIMAQAHGFKLNTHPTQIGRQNPEEQRWEMPENRLRRRTEKGAELAEENVIE
                     GKRVRKPRYVSDQSKDPSRSGTPAVGVLFGPARRQRRRPGTATANGDEPEGQEQAQLA
                     ESFGELPRKGRAARSRGTVLPDDQDQIPAVAEADNNQTEDEDEANGKTKVLRRRGRAA
                     AAVAEPPTSVPAGFGGEVSKPKRVRGGKGPQAGGEIISSSFYSNASATATQPGSRPST
                     ASSEATARTAETVESAYSLRDKRKRNFALENDPELEPRPQRRRGPPAQKPEPVEQKKR
                     GPRKKETTQPPPPPAAASASVPAASTPPPLQQPVGTKFFNFMPSPAGHDAGNGSQPVP
                     AQASGPFLHTFNASPAFPPGAPPPPPPPPSVKKPITKIKLTNNGASSSQAASRPLTPA
                     NGPSSANNSKPGGKGARGNKGHSASETKAGAAAHGNGDFEKPYAEMTKSEKMSWSMRR
                     RWASGEMQGAVEKRRNTLANKKAEKAASSTNSTTPAPADQNTTTQATDASSAGRSGTA
                     TPASMHGLGPGPLALPQGPPPPPPPVLLQPAQPHQGYLQQPPPYPYPFGPTGPSGRMS
                     "
     gene            complement(<118940..>120898)
                     /locus_tag="THITE_115391"
                     /db_xref="GeneID:11519499"
     mRNA            complement(<118940..>120898)
                     /locus_tag="THITE_115391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656113.1"
                     /db_xref="GeneID:11519499"
     CDS             complement(118940..120898)
                     /locus_tag="THITE_115391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656161.1"
                     /db_xref="GeneID:11519499"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Thite2_115391"
                     /translation="MSSVHPRKRLSKQTPPADAARVTQAPDRRCPSINIPMVCYHNYE
                     ALDHPHLHKICRIDREIQQRCIMCNNSPNPDFLCRDCKGAQYCSWECKVDDQQHHALV
                     CGQWSSFAMGKRPNKDSARILIFPAKSATPVFAWARMTQSPGEETERLRVRHPEMVPF
                     RTENIAPWTTNPYAKAGRIGCINECRALAARGKPLGHGLFVLEWDLRPPPGSDQPPSH
                     VSIDWINKSIMTVTAPATGTAASLTDSIRPGHAWLWTGPIMVISLNLALTSAQAERHF
                     VLDHVDLRDFRHAVDFFSLNLRNPCLPFAHPHHAPLSPAPSLAPPTTPPSRPQSQHKQ
                     FQGFSKPTASSHARRSIAKMRSQLKTNRKHLTAPSKPPAPSSPGNHPRPAAPPAIRFR
                     LPTLPAIKLNEPHVPVMHALHQRRDPTALTPPPPPPPPLLEAVCISRDLPPPAGGTLQ
                     GVSALCARLGLAWVVRAVLAHGEELDWLYEGFYGAASAAAVAAGDGDGNGGGGSDEND
                     NKRSGGSGDTEQGNNSIPTLLDEVLSLDEKTGVLQRRRLPRSGDGMVIFHGAGGRLLT
                     EHVYALLRFIEETAGGVEQAEHTPEKFRAFWDRLKADDSENIPADIPSPYDLMPEPSG
                     QSGSKLAERFVVCKQVFGRLVEENAPLA"
     gene            complement(123767..124964)
                     /locus_tag="THITE_73720"
                     /db_xref="GeneID:11519500"
     mRNA            complement(join(123767..124122,124247..124493,
                     124607..124654,124894..124964))
                     /locus_tag="THITE_73720"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_003656114.1"
                     /db_xref="GeneID:11519500"
     CDS             complement(join(124012..124122,124247..124493,
                     124607..124654,124894..124907))
                     /locus_tag="THITE_73720"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_003656162.1"
                     /db_xref="GeneID:11519500"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="JGIDB:Thite2_73720"
                     /translation="MAKISRGAPGGKLKMTLGLPVGAIMNCADNSGARNLYIISVKGV
                     GARLNRLPAGGVGDMVMATVKKGKPELRKKVHPAVIVRQAKPWKRFDGVFLYFEDNAG
                     VIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM"
     gene            complement(125260..127481)
                     /locus_tag="THITE_2120596"
                     /db_xref="GeneID:11519501"
     mRNA            complement(join(125260..126039,126112..126355,
                     126421..126717,126772..126964,127059..127481))
                     /locus_tag="THITE_2120596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656115.1"
                     /db_xref="GeneID:11519501"
     CDS             complement(join(125265..126039,126112..126355,
                     126421..126717,126772..126964,127059..127343))
                     /locus_tag="THITE_2120596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656163.1"
                     /db_xref="GeneID:11519501"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="JGIDB:Thite2_2120596"
                     /translation="MPSKFERLPLSTSGPLECALKGTVLLNHPYFNKGSAFTAAERRD
                     FELTGLLPPSVQTLEQQAQRAYEQYSAGADDLAKNTFLTSMKEQNVVLYFKLLLDHLE
                     EMFSVVYTPTEGEAIQNYSRLFRRPEGVFLNIHDIDRVRHDLSLWGTEDDIDYIVVTD
                     GEEILGIGDQGCGGILISIAKLVLMTICAGIHPNRVLPVVLDCGTDNETLLNDPLYLG
                     LREKRVRGETYDELVDTFIRSARELYPKAYIHFEDFGFQNARRLLDKWRPQIPCFNDD
                     VQGTGCVTLAAIIAGLHVSKQKLADLRMVVFGAGSAGVGIADQVRDAIATERGISKEE
                     ASKQIWLIDKPGLLTTQVKNLSDAQKTYARSEDWGGKKTDLLGVVNEVKPNVLVGTST
                     VPKAFTEEVVRAMASHVERPIILPLSNPTKLHEAVPADLFAWTDGKALVATGSPFKPV
                     KGPWGSGGEEVEIEVAECNNSVVFPGIGLGGVLCRTKLVTEKMLIAAVNGVVELSPAL
                     RDDTAPLLPGVDVVREVSVRVARKVIQAAVEEGVATEQDIPEDEGELDEWIKEQMWDP
                     VYRPLKLVEAQTASRQAKGELRVVGSLPQRA"
     gene            complement(<128429..>129452)
                     /locus_tag="THITE_46900"
                     /db_xref="GeneID:11519502"
     mRNA            complement(join(<128429..129177,129281..>129452))
                     /locus_tag="THITE_46900"
                     /product="glycoside hydrolase family 75 protein"
                     /transcript_id="XM_003656116.1"
                     /db_xref="GeneID:11519502"
     CDS             complement(join(128429..129177,129281..129452))
                     /locus_tag="THITE_46900"
                     /note="CAZy_ID 269804"
                     /codon_start=1
                     /product="glycoside hydrolase family 75 protein"
                     /protein_id="XP_003656164.1"
                     /db_xref="GeneID:11519502"
                     /db_xref="InterPro:IPR009939"
                     /db_xref="JGIDB:Thite2_46900"
                     /translation="MWQLVRLLALLALALLPIGIARDTPQNLRDFYDLVRAKGRCSNE
                     LATGFYSTDKGPNTFSYCGDHLDSSGIIYIQGRNGALANMDVDCDGANGGGGGGAAVA
                     ADDGRCRPSTANSDTQGTTAFRDAVAGYNRNITDLNPYVHPYVVFGNAAGTRRRRGWR
                     AFDPTAYGVRPLSAVAVVCPGYRLYFGVWGDTNGDDGPKPMVGEASLALATFCGGQGV
                     SGTNGIDGNDVLYIAFRGADAVPGPDGADWAATDPATFESSIEPLGMRLVARVQPGGD
                     ASDAPSRVLSTGKRKIAVVVITLSAMWFCS"
     gene            <130650..>131480
                     /locus_tag="THITE_2091336"
                     /db_xref="GeneID:11519503"
     mRNA            join(<130650..130769,130830..131028,131251..>131480)
                     /locus_tag="THITE_2091336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656117.1"
                     /db_xref="GeneID:11519503"
     CDS             join(130650..130769,130830..131028,131251..131480)
                     /locus_tag="THITE_2091336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656165.1"
                     /db_xref="GeneID:11519503"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="JGIDB:Thite2_2091336"
                     /translation="MKCRTVLLIAAAAALILAAPAPKALSLAAQRIVDELPTCAAPAM
                     KDQLNRAPEYGCEHNADGTPNAACLCKNDKFKSDTRNAIRNNCLEMAELETVENWATR
                     QCGKAPKSRPVKRVRFANVSSDDSSSDEGSNTKKETITVAPNEALFDLEEIEDETAAA
                     AITQPVSTIALAAVLVAAFVVL"
     gene            complement(<133313..>134407)
                     /locus_tag="THITE_157610"
                     /db_xref="GeneID:11519504"
     mRNA            complement(<133313..>134407)
                     /locus_tag="THITE_157610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656118.1"
                     /db_xref="GeneID:11519504"
     CDS             complement(133313..134407)
                     /locus_tag="THITE_157610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656166.1"
                     /db_xref="GeneID:11519504"
                     /db_xref="JGIDB:Thite2_157610"
                     /translation="MPSRITMERVGDETLLPWDPRRSRPWIEDWCRVVETYSGRDLTF
                     PQDRLLALAGLAAFFEWKLRNPRDPDATFYAAGMWKQDLARQLAWFPDFASRTRVQEG
                     GEWPLPPRKASNFQNIEKFDFLSDWLPSWSWISHSGPVHYAYLSATTDAPPLTPNVIY
                     PEGFALPLAYHPMEVTGLKVMRLRHHAYQQFGSVTGGYMGLTGNVAVVTISEDNLIKN
                     EDDLLLLPSLGEQRPKLYTMFRRPQTAGLFKRLMPAHVRRRPASADGIIFFDADPHEL
                     PANTCIYCLRLGTGPSAFSSTNGAVDFGLALMQVYYSFELDVTGGVRRLGGQNPREPF
                     PRMWRVGLFEVDVWNKQWLEQAVRMSVVVV"
     gene            complement(<134738..>135184)
                     /locus_tag="THITE_2021069"
                     /db_xref="GeneID:11519505"
     mRNA            complement(<134738..>135184)
                     /locus_tag="THITE_2021069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656119.1"
                     /db_xref="GeneID:11519505"
     CDS             complement(<134738..>135184)
                     /locus_tag="THITE_2021069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656167.1"
                     /db_xref="GeneID:11519505"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Thite2_2021069"
                     /translation="LLNQWMDTCQRDHRSYCSYVGDRLLGTGFSSPARLLFCGASGLR
                     LVDAAELPRDEDGFGPTYTTLSYRWGKPASMHTTTKANLAASMQGLNFESLPLTFQHA
                     ILVSRAIGIVYIWIDALCIVQDDEEDKAREISRMDLIYSTSFCVISA"
     gene            complement(<137164..>137817)
                     /locus_tag="THITE_2131399"
                     /db_xref="GeneID:11519506"
     mRNA            complement(join(<137164..137726,137781..>137817))
                     /locus_tag="THITE_2131399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656120.1"
                     /db_xref="GeneID:11519506"
     CDS             complement(join(137164..137726,137781..137817))
                     /locus_tag="THITE_2131399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656168.1"
                     /db_xref="GeneID:11519506"
                     /db_xref="JGIDB:Thite2_2131399"
                     /translation="MVKLSAVAGILALAISAVHAAPDLSARQSLPDPAGEKNVGNGAG
                     KQFIGGQCLGAADCASGCCATLPKGGQTIGVCSGPGASTQNGKQGCGFESGAAGTTNT
                     NPAPSDTNNAAASAGGDTIKPSTLQPDPAGAKNVGNGQGKQFIGGECTSDADCASTCC
                     ALVNTGAQKFGICSGPGANTQNGKQGCGFPAGGQRLAPN"
     gene            complement(<138069..>142241)
                     /locus_tag="THITE_2091339"
                     /db_xref="GeneID:11519507"
     mRNA            complement(join(<138069..138123,139827..140066,
                     140137..140334,140388..141009,141119..141169,
                     141234..142142,142229..>142241))
                     /locus_tag="THITE_2091339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656121.1"
                     /db_xref="GeneID:11519507"
     CDS             complement(join(138069..138123,139827..140066,
                     140137..140334,140388..141009,141119..141169,
                     141234..142142,142229..142241))
                     /locus_tag="THITE_2091339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656169.1"
                     /db_xref="GeneID:11519507"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2091339"
                     /translation="METIATTTAALVPLSLYLNAKLHLHKDLRAIRRRAAARRAIARA
                     ARADRLSPYYLLEANAANPRLGAAQEAIWVRETTATTTTTTTTTTTTTTTTTTSSTND
                     DTNTNSNDRTGNASRAQHYTFQDLLHKANQFARWFLAHGVRRGDLVGLYAANSAEFLF
                     AWAGLWAAGAAPAMLNHRLRGDALAHCLRVSGARLVLVGPDPDGDRDGGGDGDGDGAW
                     RRVEEVVKQAGGVRFVTMEQVVREVAGLSGERLPDELRGGVKPTDPFALFYTSGTTGL
                     PKGCPLAVVAAFAQGDESTGAANADGGGERCYVCMPFYHGTGGITAMRQLIAGNTVCV
                     APKFSVSSFWRDIRDSRATIFVYVGETLRYLLAAPPSPLDRQHHVHTIFGNGLRPDVW
                     QRFRDRFGITQVFEFFNSTEGMLALDNASRNDFTAHAVGHHGFLQRWKYHKYYVPVAV
                     DAETGEIIRDPETGFARRMPYEVGGEILVRLPFERRFAGYWGDPESTEKKIVRDVFRK
                     GDCYYRTGDALRRDSEGRWFFLDRLGDTFRWKGENVSTTEVSEVLGRYPGVLEAIVYG
                     VQLPGHDGKAGAAAIHIDPARKQAFDHRDFLRHARTHLPRYAVPLFLRHVQAPSSTHN
                     NKQNKVPLKREGVHPDKVTPGDEVFWIERHGKGNTYIPFTRQDWEDLHTGKAKFLKPP
                     PPEKAAWDGASSE"
     gene            complement(142438..144646)
                     /locus_tag="THITE_2120602"
                     /db_xref="GeneID:11519508"
     mRNA            complement(142438..144646)
                     /locus_tag="THITE_2120602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656122.1"
                     /db_xref="GeneID:11519508"
     CDS             complement(142557..144458)
                     /locus_tag="THITE_2120602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656170.1"
                     /db_xref="GeneID:11519508"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="JGIDB:Thite2_2120602"
                     /translation="MAHLLENALLWLGLVLALLLSHASASPLSLATSIGKSPGRKTFD
                     LTLTWETHAPDGRSREMILVNGQFPGPTLEIDQGDEVLVRVHNQMPFNTTVHFHGIEM
                     HLTPWSDGVPGVTQRHIQPGRSFNYAWTATQYGSYWYHAHQSGQLDDGLYGPIIIRPS
                     KDLSRPFSLITGDEKTLKAIEAAAADSQPLMVSDFRHRPSQDIATITKNAGIELPCYD
                     SLLFNGKGSVDCWSSEYIASILTEDQKAFLQLANVSSFTAKGCLPGKAIADVIAAGYS
                     TNLSAVPPDIFDVCTPSNGTEEVIHVTKKLGEHEQWVALEVIGTFGLVTVSFSIDGLS
                     MYVYAVDGEYIEPQLVQVITVTNGDRYSVLVRLTDAQPGDYPIRIASTSTAQLIAASA
                     TLSYRVEKGGEAQNTSSPARYIQDNGLPTSSSVVFYNQTAQRQFSPPEPFNPAPADQT
                     FILHMKVTGNSYSWALNSTSLPENVTEDSSSSSSSEVILFSPQPNVHNNYTITTLNNT
                     WIDLVFVTATTPEPAHPIHKHGNKMWLLGSGTGEWTWPSVAEAAKALPEGTFNFVNPP
                     RRDSFATLPATAPGQPTWTAVRYHVTQPGAWFIHCHIQSHLLGGMAMVIQDGVDKWPV
                     VPEEYLTYQ"
     gene            complement(<145359..>146002)
                     /locus_tag="THITE_2131401"
                     /db_xref="GeneID:11519509"
     mRNA            complement(join(<145359..145587,145736..145910,
                     145969..>146002))
                     /locus_tag="THITE_2131401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656123.1"
                     /db_xref="GeneID:11519509"
     CDS             complement(join(145359..145587,145736..145910,
                     145969..146002))
                     /locus_tag="THITE_2131401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656171.1"
                     /db_xref="GeneID:11519509"
                     /db_xref="JGIDB:Thite2_2131401"
                     /translation="MPGFPAGSRCYAAAEMSTGVLKRSASLKPGEQCSTGVAHLTGCT
                     TTDIISRTGVSATHRWESISFDPDDQPLARTGPTTSGIRSRGSESVTANPWQRIRDAV
                     GDIMPALKDPSRWADCPYVALDNTDPRLNARSGTNGKNETGGY"
     gene            149245..151130
                     /locus_tag="THITE_2120603"
                     /db_xref="GeneID:11519510"
     mRNA            149245..151130
                     /locus_tag="THITE_2120603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656124.1"
                     /db_xref="GeneID:11519510"
     CDS             149295..150998
                     /locus_tag="THITE_2120603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656172.1"
                     /db_xref="GeneID:11519510"
                     /db_xref="JGIDB:Thite2_2120603"
                     /translation="MEATSSAVARLRQRLTVARKRVGCARAAGGPFKPIAQGFINFFE
                     SMFASVAMANADVIGTFAHFDMLGNEEEEYEVAITVKATPTAAVPANDIAIESSTAEA
                     ADPTEQTVGDEVPVAENPAVPAELTPPQQETETPTCGAEVAEVAENISVVDTTTVPAA
                     TDEPVAEVTAAETEVEDAPAVESASVAAEGQDSMSEALVTESALATDDISVAEEMAEF
                     PIEAPAIETISTSAVHDENCTTPTCQDEEPVHQLTENAPDDDIVAEQQNDVKDCDETV
                     EDLVKETEAAPESSGPEEPAQNTEETGGNMDAKHGSEDDTIPPQDAVPALEQASEESS
                     DEEDIAGEIISEADTIDKANNNAPATSADLAVPKWPLIFEDDFDAAASSVFDHQFTRL
                     MDIDYSWSIPHIGERIKTKRETERELVRQTLTSWLPTRAINLQDLLLEQAARGPSTNP
                     TTKGATPAEKDATPADFVATKKEADTRPTSEDTGATVDLADAIPAGRSHSRSPSSSSS
                     ESQLTSGSASENEACPGTPVTDYCSTPTKEGDSAAIAQPAPDADLDANPDDAKEDAAA
                     N"
     gene            complement(152694..154002)
                     /locus_tag="THITE_2120604"
                     /db_xref="GeneID:11519511"
     mRNA            complement(join(152694..153042,153109..153690,
                     153763..154002))
                     /locus_tag="THITE_2120604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656125.1"
                     /db_xref="GeneID:11519511"
     CDS             complement(join(152913..153042,153109..153690,
                     153763..153905))
                     /locus_tag="THITE_2120604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656173.1"
                     /db_xref="GeneID:11519511"
                     /db_xref="JGIDB:Thite2_2120604"
                     /translation="MAEFDPIEFFGTGCGRDIAIARHARSRSHGSISLASLDSRLHAA
                     LESSAPEGPRLISGVTKHPVSPSRTFVNITPEGSVVGPALDQPGASPVASPNVSSHSD
                     PTSASAKASPLTRYVSSRQRHEKIALSLPEGSVLDYDEGSRDHHHQSKSAAVEQFGAT
                     ANPCMENDSPIGRYLTDVHQAHERLALALERQGGAPQPEATASHPDTQDTETGSSISL
                     CDENDTETKEERDGMTAEMMLSVIHERRRRQFAGQDRSYMLKAPRARKRQSSSPLHGH
                     KDKTGRWS"
     gene            complement(<155636..>158530)
                     /locus_tag="THITE_2055663"
                     /db_xref="GeneID:11519512"
     mRNA            complement(join(<155636..155694,155783..155795,
                     155925..156322,156428..156466,156521..156583,
                     156639..157811,157876..>158530))
                     /locus_tag="THITE_2055663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656126.1"
                     /db_xref="GeneID:11519512"
     CDS             complement(join(155636..155694,155783..155795,
                     155925..156322,156428..156466,156521..156583,
                     156639..157811,157876..158530))
                     /locus_tag="THITE_2055663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656174.1"
                     /db_xref="GeneID:11519512"
                     /db_xref="JGIDB:Thite2_2055663"
                     /translation="MLKRLAGLGAASADKSTTNTTANTDSDDAQTPAPPPAYDATVGD
                     QQAATEDEAANLTAAFENLTLTNAPSHPSPETCLAHLKLLFAIQWMKEDVGFTDGLWG
                     LWDARAGPVSPALKGRPEKEKAKEQGEEERAPEPSIEEKINNKNLENLSRIREKRWAI
                     FVARAVFRYEVWWKLLSKTIHEHRLSQRDIEHGRPDYINFPTDVNAVLTWTEDMLPPL
                     DVLMVWHTHMLNPRAFLEDAMLSGLRRFWVTGMPWDLINKAIDTDFNYTVSDGCKARW
                     TQQTGLAWDNVDGRLTRTIRCPRCNGRVRIPWTTCGRAEDYQDPEPPVLTGTGYGDSN
                     LEHLCTACGTVIRRELLSVANFVADTKALLGSMNRPMPGTVLDPKTGTPAGPLMQGRV
                     VRKAAHSFPNRLLKSGCNSIRSRITELMSSGATPDPTMALVRREIEAVLAERTNIRQI
                     DGVSTVGRYALPAESRIAIRKMMSRYWQNCSMFAVELCGAVMRQGIFVEKMCKLDWLH
                     SPSARATMVRLLHKYVRFIEIMRKRPNQIVVPTLDVDLAWHTHQLSPSRYYMYTVAKT
                     GRFIDHDDKIDENTLSKQFEWTSKVYQELYGEVYSACTCWYCEAIRSAHISTVGSALG
                     LSKQAKIAESFHNTGAAALHPPSMSAHISAHNSVTLLPDPSVPPPTAARVAARLAAAH
                     RRRLDAAYARARARAEKKGRPTLPPRRDDALVYDHWGYPYVYAAPYAYPLWWTPGIYG
                     AWYPGYVVMCASGAWGNCVSGTCGGGVAAGACGGPGGCGGGGGGGCGGGGGCGGGCGG
                     G"
     gene            complement(159564..160777)
                     /locus_tag="THITE_2120605"
                     /db_xref="GeneID:11519513"
     mRNA            complement(159564..160777)
                     /locus_tag="THITE_2120605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656127.1"
                     /db_xref="GeneID:11519513"
     CDS             complement(159867..160730)
                     /locus_tag="THITE_2120605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656175.1"
                     /db_xref="GeneID:11519513"
                     /db_xref="JGIDB:Thite2_2120605"
                     /translation="MSPHAFFAPIPSPSEYDSWASYRAAAGRWNDFVAVGQKIDHSKN
                     RLAYCIAGQLLRDAVIPSLIFSDPSHTDGFPIGHPDLHLGNIFVDDDLNITCVIDWAS
                     TSTVPFPQLLACPRMMQNPSPLAAEDLLNATFQARLEQACHIEHMPPNIWKRADMMRL
                     FHRLVRMLSTRDYHDFVALYSLGRCSDGNEEGRSESDEGNPDIPALFAERARQSENMQ
                     LLAELREDDSPPDYVKRQEQASILARAQAHPEKLAVARKLTLMSEMNERFVADRKLWR
                     WIEDAMEDIHP"
     gene            complement(<166885..>167559)
                     /locus_tag="THITE_2091346"
                     /db_xref="GeneID:11519514"
     mRNA            complement(join(<166885..167302,167372..>167559))
                     /locus_tag="THITE_2091346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656128.1"
                     /db_xref="GeneID:11519514"
     CDS             complement(join(166885..167302,167372..167559))
                     /locus_tag="THITE_2091346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656176.1"
                     /db_xref="GeneID:11519514"
                     /db_xref="JGIDB:Thite2_2091346"
                     /translation="MAGSLNWAVFVSFDDGVKWVLRSPRRSFLSDEYASRILLSEVAT
                     LRYIKAHSQVPVPEVFAYSASRDNDIGIPYILMSRAAGQPLSQYNWPQPPCQPPSEGP
                     LGDALRPLSEEDMKKLATQLAHIVLQLSRLRFDKIGSLFQDDKGNYIVGECLSQSLTW
                     QYRDSLEDINRGPFDSERAYLESLVSAFIRHAKELPVGPLS"
     gene            complement(167710..169460)
                     /locus_tag="THITE_2069375"
                     /db_xref="GeneID:11519515"
     mRNA            complement(join(167710..168298,168533..168660,
                     168742..169460))
                     /locus_tag="THITE_2069375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656129.1"
                     /db_xref="GeneID:11519515"
     CDS             complement(join(167972..168298,168533..168660,
                     168742..169417))
                     /locus_tag="THITE_2069375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656177.1"
                     /db_xref="GeneID:11519515"
                     /db_xref="JGIDB:Thite2_2069375"
                     /translation="MDAVEVALVASPFANLAPLYEVDPDADALLIVPPVNQDFAPWRE
                     PHQPGEVNGVLKTSSTTAAAAPASRPGLRIKVSSKHLTLASRVFRNKLQFGSSRAARQ
                     SDGRIHLKLADGFDPKAVSIVMNAVHGRGSKVPKAVDLDTLAQIALFVDRFQLLDAVE
                     VYAERWIAKLESSVPDADGRDLVLWIYASHVFRHAAIFHAVTKSAAARSAGPIPTLGL
                     PIREKIIQTIDANRQTLLTRALSLVHSTVDDLLTTTPTPTATTATSSSAGGAKGGVVE
                     EEVEVEPWHRNGNGYGNVNGHAVNEQEGVKKTSGWGAVGGGLPVTPVASPEPVYRSAR
                     GVFEQVHECDATRVVARLDELGKLADEVDGLVLESSLGYQRY"
     gene            complement(171933..172011)
                     /locus_tag="THITE_t142"
                     /db_xref="GeneID:11519516"
     tRNA            complement(171933..172011)
                     /locus_tag="THITE_t142"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:complement(171977..171979),aa:Thr,seq:agt)
                     /db_xref="GeneID:11519516"
     gene            complement(172327..173792)
                     /locus_tag="THITE_2120606"
                     /db_xref="GeneID:11522937"
     mRNA            complement(172327..173792)
                     /locus_tag="THITE_2120606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656130.1"
                     /db_xref="GeneID:11522937"
     CDS             complement(172603..173700)
                     /locus_tag="THITE_2120606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656178.1"
                     /db_xref="GeneID:11522937"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Thite2_2120606"
                     /translation="MAPTTEAPQTVEWQGRQVPVWPMRTINYSLLLSQDPDEVEKVTK
                     ACLEDGYFQLDLNGIDGRRMLEDREEVLRLMHRFFSAPLEAKNEYGLIDSHLGYEPVG
                     NRTGAFGAGTRDGYEMLKVSRDEIQQGSPRVPSPIKNSDDLRVLEHAIGSCNTVTKVI
                     LSALSTGMGLTGAARFENSHRNDRPSTTTLSMMHYLPANETGQHKIGHQKHTDISSLT
                     LLFSDQWGLQIRPPGECGAREMGFVAPRPGCAFVHVGDSLRFASGMRFQSCIHRVVPF
                     DPAEHRYSIAYFLRAEDDTMFQDSEGRWVTAKEWHDQKFKAFTDPPVWQAMAPKSMIL
                     GGMVEDGADDPVPIVPADLVKGAAKETAVEA"
     gene            complement(<174232..>175086)
                     /locus_tag="THITE_2056926"
                     /db_xref="GeneID:11522635"
     mRNA            complement(<174232..>175086)
                     /locus_tag="THITE_2056926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656131.1"
                     /db_xref="GeneID:11522635"
     CDS             complement(174232..175086)
                     /locus_tag="THITE_2056926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656179.1"
                     /db_xref="GeneID:11522635"
                     /db_xref="JGIDB:Thite2_2056926"
                     /translation="MTNQTASGPNQKHHVLTTLNYWDDPGDGSRPTPIFIGKGRVTNK
                     RPHRPHEFLVTDITGDEAQYSLDAHGFQYCQHESQEKDFTDEQAIRSVYYEECRNLVK
                     DVTGARQVHIFNHKVRRGPTQWHHLGLDGNNLANRGPVTRTHVDQSYAGAELRLRWEF
                     RDEPGAAEELLKRRYQIINVWRPIATILKDPIAVAEAGSVPDADLVGAEMVEDDFRGE
                     SWVVRHNTAHRWCFKYRMTSRDVLLIKCFDSDASVARRALHSAFEDPAHRDEASRQSI
                     EVRCLVFY"
     gene            <175445..>176854
                     /locus_tag="THITE_2055209"
                     /db_xref="GeneID:11522636"
     mRNA            join(<175445..175793,175854..>176854)
                     /locus_tag="THITE_2055209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656132.1"
                     /db_xref="GeneID:11522636"
     CDS             join(175445..175793,175854..176854)
                     /locus_tag="THITE_2055209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656180.1"
                     /db_xref="GeneID:11522636"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="JGIDB:Thite2_2055209"
                     /translation="MEEDGFVLVANKGEECCSLMNPTPEQHQEGPAGYLSEIGTFIDS
                     LAEALWPLNRFIHDNPEIAFQEYKAHQALTDFMRSRQETWKVTPSAYGMETAWVAVYD
                     SGKPGPAVSFNVEMDALPGLGHACGHNLIATASVAAGLATAALMRRHRLPGKVLLFGT
                     PGEEGYRGGKIRLLEQGAYAGVDISLISHPGILHNSALVRTTAFARLEVTYFGRAAHA
                     AKNPWEGINALDALVVAYTAVAALRQQTMPGDVIGLAITDGGGDATNAIHARAACVCA
                     LRAASAARLEQLVARVRGCFRGGAEATGARVEIILTPGYKDHVPNRVLAASYARCWNQ
                     LPDVPDPPMPSPPTCGAAEPQFARIASSTDQGDVSYAVPSVNASFAIPPGPRGGQPHS
                     ADFAIASGTREAFERALRVGKALAGTAVDVLTKEGLLEEVKAQWKRDMEDAKNPSPS"
     gene            complement(<176928..>177569)
                     /locus_tag="THITE_2057025"
                     /db_xref="GeneID:11522637"
     mRNA            complement(<176928..>177569)
                     /locus_tag="THITE_2057025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656133.1"
                     /db_xref="GeneID:11522637"
     CDS             complement(176928..177569)
                     /locus_tag="THITE_2057025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656181.1"
                     /db_xref="GeneID:11522637"
                     /db_xref="JGIDB:Thite2_2057025"
                     /translation="MLCRRHLLLLVAGSVANSAAILPLTSNVSLSSLSAQGQGCPKNS
                     VSSQISPDGSVITFGFDDFAAYYGPAFPPTEQSKTCVINVTLSYPVGYSFSVLGATYH
                     GSALLDAGLNAIVSSSYRIATDEVGAGDVTPPVQTRATIEGSFEGIFTQAVPVGNGPA
                     LNSPCSQATAGLQIATRISIASRNSAPSGNLDGDPPLSLTYEQEQLGWTACTA"
     gene            complement(178069..179474)
                     /locus_tag="THITE_2120607"
                     /db_xref="GeneID:11522638"
     mRNA            complement(178069..179474)
                     /locus_tag="THITE_2120607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656134.1"
                     /db_xref="GeneID:11522638"
     CDS             complement(178697..179365)
                     /locus_tag="THITE_2120607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656182.1"
                     /db_xref="GeneID:11522638"
                     /db_xref="JGIDB:Thite2_2120607"
                     /translation="MRTPLRITNRIMLRATALRTISTRAAAIDALRGRRRPSPHPSEA
                     PATITSTIRPLEFSSNQGVFGRDCFSHWDTAAHNTPPWSLDKRARSMHTTHISHDQAD
                     PGARQPTTQSPAQHVAAGPATGAGTGAGTGASTGVPIAAQMFGADIKGNPTESEADVA
                     ADRCDVDPLPPELHHTIRMGAGGAAPRPTESEEDVVADRLGGADGDPLGKMRGAVGKG
                     GVTA"
     gene            <180781..>182010
                     /locus_tag="THITE_2057645"
                     /db_xref="GeneID:11522639"
     mRNA            join(<180781..181178,181227..>182010)
                     /locus_tag="THITE_2057645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656135.1"
                     /db_xref="GeneID:11522639"
     CDS             join(180781..181178,181227..182010)
                     /locus_tag="THITE_2057645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656183.1"
                     /db_xref="GeneID:11522639"
                     /db_xref="JGIDB:Thite2_2057645"
                     /translation="MTTTVLIGQAPTNLGPLTTTFTPPAACTVAVGARGGGLVGLLLG
                     GGTSDVAYLGQACTAGSAVDATSCWPSTSKGAQSQKPPLQGWGFYSPGLHCPVGYATA
                     CSATGGSGGGSGWPVQFKLRDGETAVGCCPSGYGCANINGQTCTMVATSTTVPTVTCD
                     GNKSGDLAVRTVPDAAASITALSLFAPMIQINWQSSDRPASSTESTRPTATSTSTDNR
                     ITASGTHTIGTGADSSAETTLVIDGHPQTSGTAHIVIGAGTPTSTPSLQGDDKAAASD
                     SSGGFSSAAKVAVGVGGAVAVLTLLVCALFYYLRRRKSRREEQELDRLFGTANAKHEM
                     TAAGDFTSSSDIPGWYRGQRLATLTKDPFRDAWGIREPEMPLPPPPPVAREPYFRPYR
                     P"
     gene            <182448..>184396
                     /locus_tag="THITE_2091354"
                     /db_xref="GeneID:11522640"
     mRNA            join(<182448..182825,182876..>184396)
                     /locus_tag="THITE_2091354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656136.1"
                     /db_xref="GeneID:11522640"
     CDS             join(182448..182825,182876..184396)
                     /locus_tag="THITE_2091354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656184.1"
                     /db_xref="GeneID:11522640"
                     /db_xref="JGIDB:Thite2_2091354"
                     /translation="MSTEPTRPLLLPQNRKLRHLRGISLRNLTFSRPRGHAIDDAALN
                     KSPAKLESLRDAPQLHHALSSEDLRPPAGRRRSTNLANDSPAARQKKLEDVFESRLAD
                     AFFSLHVDAEEDPVYISEVAERATNFNFRFFDLSELESPATQSPQVTIRVWAKRNSAW
                     TLLLQDEVDLRALNWLGSLQNVHFPPNSLAFHMTDGIYSLELSSKPAPPKHAPAVPTS
                     SYNALMKLATLDNSIQDALATRRLLAQQINDLLSREAKNEVPHAEDRLALANKYLAQQ
                     RRAVAAAKKRNEELRASIAARRDAIAKGRAAQQKAAQDVSNAAEQLAHSQALLAKTKA
                     DIRGQRRRICTDLSRIYNITPTPNAPPLSFQICGLPLPNTTDYDSATTTSSHPTSSSS
                     SASAPATTEDALSAALGLVAQLTDHLQYYLAVPLPYPLRPLGSRATVRDDISQLPGGA
                     GPAGGPLREFPLYVPRGGSGAHFRFDYAWFLLNKDVEALCASQGLKVVDIRHTLPNLK
                     YLLYVCSAGSEEMPERKRGGVRGLWAGRVKGLAAGGGGGGAASRDVHGAADDASSSVG
                     GGSRRGSDVSDAAGRRGEELRRAATAAAAGGGGGGKTGETGLALPFAEGEAKLSLRTK
                     GMRESAAD"
     gene            complement(<185308..>186355)
                     /locus_tag="THITE_2013732"
                     /db_xref="GeneID:11522641"
     mRNA            complement(join(<185308..185586,185833..185851,
                     185915..185993,186058..>186355))
                     /locus_tag="THITE_2013732"
                     /product="carbohydrate-binding module family 50 protein"
                     /transcript_id="XM_003656137.2"
                     /db_xref="GeneID:11522641"
     CDS             complement(join(185308..185586,185833..185851,
                     185915..185993,186058..>186355))
                     /locus_tag="THITE_2013732"
                     /note="CAZy_ID 270198"
                     /codon_start=1
                     /product="carbohydrate-binding module family 50 protein"
                     /protein_id="XP_003656185.1"
                     /db_xref="GeneID:11522641"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Thite2_2013732"
                     /translation="VTCSYAVQASNGDTCDSVASSWSISVSEFESLNPGVSCPTLVVG
                     HSYCVFGTITTSTTTKQSPTPPPASPTTSPSKTTTSTSTTSAFPYQPTQSGLAANCNQ
                     FYFVQAGDTCDAIDQKYQISFSQFYAWNPAREPNTTPDCHALLASTWVCVGVPGASHT
                     TGPQPQMPGVVASCKTYYFVQPGDSCWSIELAKGISDAQLHKWNTGINADCTNLWANA
                     YICVGA"
     gene            187040..188078
                     /locus_tag="THITE_2120610"
                     /db_xref="GeneID:11522642"
     mRNA            187040..188078
                     /locus_tag="THITE_2120610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656138.1"
                     /db_xref="GeneID:11522642"
     CDS             187144..187992
                     /locus_tag="THITE_2120610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656186.1"
                     /db_xref="GeneID:11522642"
                     /db_xref="JGIDB:Thite2_2120610"
                     /translation="MHLPSLLQALAWACSAVAQTYPATVEFDVVFPRNETYAPTTLMP
                     LVFAFRNSPAWIPLIPLLEWSIRILPTGEFVDYGATDLAWGINTTTDPYFKFVSSQAL
                     TVEGNYMLVWTLAYGNCTADPYSDFEILDIDYLHVNDTTNHTSFSIAKGAQAVDLAAA
                     SSSCPAQQGMALNVTTALKVGVTEEWKRRDVCGVLAHQQPSPKPCALQLDTAAASSIA
                     AALTASACSAPHPRYTGPCPPKPTQSTSAGTRTRGFATARLTSSAGIAVLIIHALVFI
                     GLVCSF"
     gene            <189009..>193383
                     /locus_tag="THITE_2057765"
                     /db_xref="GeneID:11522643"
     mRNA            join(<189009..189940,190003..192945,193149..>193383)
                     /locus_tag="THITE_2057765"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003656139.1"
                     /db_xref="GeneID:11522643"
     CDS             join(189009..189940,190003..192945,193149..193383)
                     /locus_tag="THITE_2057765"
                     /note="CAZy_ID 269734"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003656187.1"
                     /db_xref="GeneID:11522643"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Thite2_2057765"
                     /translation="MTALGEPLVRFVVLVAALVNAVAGQGGNPKDPCPAHCYTAGAAP
                     TNWSVYHNLDQLHRCPQRFFFDFSVDDNVDEPNTLHRLRACGLWGADWNRLPASPTPP
                     LPATEVNATFQLGWLDAGSTTVLSGDATSLLSHLGAYLSKGFGTDSGSTVLFGLTGNA
                     TFGFYLGSALQREGTGNTFVLNTILSAFRSRGLGGGLVAQLCGPGRAADHVLGLAVAV
                     NGSFQAVQAAVRKWRQAECVEPAVPFSERLNVTGPLYVTAPPLYPVSNDTDFTAPNST
                     LGNSTALHASLLPRSECRTIQVVSGDSCGSLAAKCGISGATFMSYNTQPNLCATLQPY
                     QHVCCTSGTLPNFQPQPNADGSCATYTTVADDSCWKIAASRSLKPDDLESFNKNTWGW
                     NGCSNLWVGVNICVSKGDPPMPAVIPNAMCGPQVPGTAKPPPGTDLSTLNPCPLNACC
                     DVWGFCGTTAEFCTNTSTGAPGTAAPGTNGCISNCGTSIIRSGDVNWQRIGYFEGYNL
                     GRPCVHLDVSQIDTSQYTHIHYAFATLTKDYQVVIGDIAAQYEFRKFAALTGVKRILS
                     FGGWTFSTDPSTASIFRTGATAANRLAMATSIADFIKSNNLDGVDIDWEYPAAPDMAG
                     ASPSDGPNYLAFLVLLKNMLPGKTVSIAAPASFWYLKGFPIKQISAVVDYIVYMTYDL
                     HGQWDFGSKWNDPGCPGGSCLRSDVNLTETINALAMITKAGVPSSKVMVGVTSYGRSY
                     GMTTPGCWGEMCTFGGGPHNESMAEPGPCTGVAGYLSDAEIKDIAASSSRVVTSFFDS
                     KSQTDVLVYDNNQWVGYMSPTTKSNRAALYKSLGLGGVSDWAIDLEDNPGPPANTEPS
                     WNSFISRVYAGGDPDLGRRCGNWTSIPCDAEIAENDIGHTAASRWAALDCDDAWADAL
                     DHYRKVDRPMGTSLMNSLQHSFKITEAADCGYMDESNGCSNMAQCPTGHAGDTGPAGW
                     VIWNSLINLNRMYLQYYDSLFQAGVIIDATLGSFHDTFDPVPEDKDGETWLQVLLDIV
                     GMGAILVAAPFFNNFLARLPYFNAADRVDTPKDITYGALATGISIAKDLLAGQSSVDS
                     WTSQNQNNVSALLGQVLEGWGNATEQAALSWFSGTDESLAKLSKLIGGGHLMPVGLSD
                     GNPPEKITQTELQGIILRSFYAFAIPKAWILSKHSPVIIDSGASCGADLGPFAGTSFS
                     DGRPFFVPGVINQVWACYPPKTGKLYFLGTPSGNALDCDNGCDPLSTFGDPCDPKCRR
                     NPFDSLPGMDALASGDNVFGGVTLQDVITGALRTFEANGRKNGGLKIDPGSSAFLDSA
                     MARDITTPGFINIPVCSYDEAWSNWESATDWRAPVKVDPNYATYPCNKV"
     gene            <194342..>195426
                     /locus_tag="THITE_2057949"
                     /db_xref="GeneID:11522644"
     mRNA            join(<194342..194736,194820..195132,195193..>195426)
                     /locus_tag="THITE_2057949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656140.1"
                     /db_xref="GeneID:11522644"
     CDS             join(194342..194736,194820..195132,195193..195426)
                     /locus_tag="THITE_2057949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656188.1"
                     /db_xref="GeneID:11522644"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Thite2_2057949"
                     /translation="MPALLDVLIIGGGPAGLSAATALARQLYTAVVFDSGVYRNARAT
                     HMHAVPTWDHRDPADFRAAARADLLARYDTIRFEQTSVSAVRRTDDGRFEATDANGIA
                     WRGRKLVLATGVRDVYPDIPGYDDLWGRGLYHCLFCHGFEDRGSASVGVLAVGDLAKV
                     GPALHVSRMAKRLAKKVVIYTNGSSALLDSLATAVAEDPVFVLDNRRVVRLEKGENSS
                     SKAIVHLEDGTAASHGFVVHKPKGEVNGPFVQQLGLELNEEGVIKTTQPFCETTVTGV
                     FAAGDCATPITSVVNAMSMGALAGAGICAQLGAENTA"
     gene            <196087..>196977
                     /locus_tag="THITE_2056840"
                     /db_xref="GeneID:11522645"
     mRNA            <196087..>196977
                     /locus_tag="THITE_2056840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656141.1"
                     /db_xref="GeneID:11522645"
     CDS             196087..196977
                     /locus_tag="THITE_2056840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656189.1"
                     /db_xref="GeneID:11522645"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="JGIDB:Thite2_2056840"
                     /translation="MEAWQGLEEALLRLVYGSNLIESAGSSYQVTAKLCRAVFRGEKV
                     PIEIEERDADYQQHLEHLLSTNHPAGHSHVLRSRREIVQHAQALDYMIEHIVVNKEPW
                     SEELILEAHRILQTGLDDDGEVEAGKYRTHEVAVKYEKPGDGGKRKKASICIRARAVP
                     GYMKDMVAHLNDDILAAEQAGTLDPYTLAARYHHQFVNIHPFGDGNGRISRIILNCLL
                     LRYAGHVSEIGLDQAERDDYIAIATRGAKVFHQEDMEVEFAEHTGHLELARFVLAKSK
                     RSLERIWTWALGMKGDDEAV"
     gene            <199589..>201008
                     /locus_tag="THITE_14746"
                     /db_xref="GeneID:11522646"
     mRNA            join(<199589..199735,199796..199832,199900..199976,
                     200094..200361,200453..200536,200692..>201008)
                     /locus_tag="THITE_14746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656142.1"
                     /db_xref="GeneID:11522646"
     CDS             join(<199589..199735,199796..199832,199900..199976,
                     200094..200361,200453..200536,200692..>201008)
                     /locus_tag="THITE_14746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656190.1"
                     /db_xref="GeneID:11522646"
                     /db_xref="JGIDB:Thite2_14746"
                     /translation="PHDSLKTNIIVSSAICWAIAVFFVALRFYTRGVIIPVLGASDWS
                     VLLALIFAGATCAAVIEQAVHGAGQHVWDLDATDTADSIGWARAAWYGILFYNLSLCF
                     SKIAILLLYIHLFAFKWARRAGQVLLGIVVLTSVYMALVAFTACIPLQSYWDPSVPKK
                     YCQPQSVWWSSTGMHMVTDFLIFLLPMPVVWTIHLPRRQKLILSVCFISILRLLQLIR
                     SQSDLDFTYAAAPLSYLTGVEVNGAIVCACVMTLKPLLARLCPRLFLSGGATGSSASA
                     GGGGRGGTRGRGGAGGGGGMGAGGPPTIGSIPSK"
     gene            complement(<202421..>203101)
                     /locus_tag="THITE_2131416"
                     /db_xref="GeneID:11522647"
     mRNA            complement(<202421..>203101)
                     /locus_tag="THITE_2131416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656143.1"
                     /db_xref="GeneID:11522647"
     CDS             complement(202421..203101)
                     /locus_tag="THITE_2131416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656191.1"
                     /db_xref="GeneID:11522647"
                     /db_xref="JGIDB:Thite2_2131416"
                     /translation="MDAPAKINFFHLPREIRDKIYREVLVSPNPIHLVRGLFAEPWKV
                     VAAFPPTRGLALLYVNRQLYDEGRIVLYRSNTFTLVGPNAVLLGDLQEFLACIGSVNS
                     NLLKHICMPFPRVTTADGGAKLNDNDVRCLELLGSSCGGLKTLELTIYSQEVHGPSFA
                     SHDSTNAVLIRSALAQLVEHLKVIPSLHSVHISSLRRIAPPIVEVMKGYGWEVSVSEM
                     GVTSNQAL"
     gene            <204173..>204601
                     /locus_tag="THITE_157586"
                     /db_xref="GeneID:11522648"
     mRNA            <204173..>204601
                     /locus_tag="THITE_157586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656144.1"
                     /db_xref="GeneID:11522648"
     CDS             204173..204601
                     /locus_tag="THITE_157586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656192.1"
                     /db_xref="GeneID:11522648"
                     /db_xref="JGIDB:Thite2_157586"
                     /translation="MSRSYRDPQTEHMVRHTHDLRDGCMNEPAGGETAQERAQNTPKQ
                     VSEHNGTELSPNNNKWGTQVFSSVVQQQEPIGEALCPSHLQGGEKNAPAPAPVAVPTR
                     GAKIDDAGEGRAQEGLASPSGKGSQGVGGLEGHASKMGGS"
     gene            <204989..>205853
                     /locus_tag="THITE_2056534"
                     /db_xref="GeneID:11522649"
     mRNA            join(<204989..205138,205209..>205853)
                     /locus_tag="THITE_2056534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656145.1"
                     /db_xref="GeneID:11522649"
     CDS             join(204989..205138,205209..205853)
                     /locus_tag="THITE_2056534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656193.1"
                     /db_xref="GeneID:11522649"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Thite2_2056534"
                     /translation="MTADKISAAAKTNAATYLSRIPNAADPARRILVEYSGIAPDAVD
                     AHIYEIRDKAWAVFPYGCIGSFSFLDLTAQAQDPRFRAVVDRLKAPGSAEAFLDVGCC
                     FGHVIRQLIVEGIPGGRLYGTDLQPRFLDLGYELFRDRAKSTATFLAGDMLKEDDSRL
                     QGLDGKVDIIYASAFFHLFRREGQVRVAKRMVRFLNPDNPGVMIFGVNGGPKVPGWED
                     YVLDVETWQQMCREVGEATGTDWRTETDVEDTDERITVRFAVYRAS"
     gene            <206547..>207215
                     /locus_tag="THITE_25922"
                     /db_xref="GeneID:11522650"
     mRNA            <206547..>207215
                     /locus_tag="THITE_25922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656146.1"
                     /db_xref="GeneID:11522650"
     CDS             <206547..>207215
                     /locus_tag="THITE_25922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656194.1"
                     /db_xref="GeneID:11522650"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Thite2_25922"
                     /translation="DTESILSFAITNNVLELDGILGDIAARHEATKGVLLLRARDSEG
                     RNAVHYAAIGHANDTLEYLLDPELFPGQPHLHLALFYLKNNNGENTALYAIRQRCPPA
                     FLDRILTLTGRDLLRETNNDGLGPLHCAAAYDAGELLRHLVAHHHLDPNGRLGTSPRA
                     SPLQSSVFLPEEGDTPLHLAARYNAASAFEALYGDLRADSLVRNRAGDTPFHVAAKVD
                     AKAVL"
     gene            208984..210996
                     /locus_tag="THITE_2120612"
                     /db_xref="GeneID:11522651"
     mRNA            208984..210996
                     /locus_tag="THITE_2120612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656147.1"
                     /db_xref="GeneID:11522651"
     CDS             209210..210802
                     /locus_tag="THITE_2120612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656195.1"
                     /db_xref="GeneID:11522651"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="JGIDB:Thite2_2120612"
                     /translation="MSGHPSWRLLPASAPGIPALLVSTAFAADSYSVHLSDLANLWVE
                     RMDRRPIIMRGMVEDTSIDPSDGPDQIRKMLELLRAAFDSSDPEHGNTSLTLARGEDG
                     DSLTVQVTCLLPKPLKPFRWPLHLKKCPQSTVASELVLPMIQAHEARTGEIAELIALL
                     REKDAVITRLIDKLEATGTGLEHVFNALSGKRRVTRATAEGKVKGLAVFSESEFRSKA
                     TDLRPVAQASDVSALLRSVFGGAGLQYKSDVDLEASTELDNWWTKLAKGQTIALSERA
                     EKKETQKPSRSQEQEPEPRNEEEDDFQVQATPPGVRSARKRDSASRAADDDETSDGED
                     AATTTAAPAPPPGARAAGSRLGAIGKNKKPSPSPPPPKASQRSSTTETIPADNNSETA
                     SEPDVSDSQPASPRPPPKPAARRGGLGLIGGKPKQERPAARSPSPAAPPAASTEESSQ
                     LPRRHKLGMIGKKAPSPSPEASAASGSDHARGRSKTPAAEAKKDQIRETSRERADRKR
                     AELQKEIEKRAAAGPAKKKRKF"
     gene            complement(<214028..>216183)
                     /locus_tag="THITE_115365"
                     /db_xref="GeneID:11522652"
     mRNA            complement(join(<214028..214170,214281..214517,
                     214802..214827,214904..214966,215625..215708,
                     216063..216117,216147..>216183))
                     /locus_tag="THITE_115365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656148.1"
                     /db_xref="GeneID:11522652"
     CDS             complement(join(214028..214170,214281..214517,
                     214802..214827,214904..214966,215625..215708,
                     216063..216117,216147..216183))
                     /locus_tag="THITE_115365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656196.1"
                     /db_xref="GeneID:11522652"
                     /db_xref="JGIDB:Thite2_115365"
                     /translation="MFAQISARGEEKDTLSDAECRAQPMAWVPNSVFSTCSLGSAVAV
                     RADVHEISPRALLKRTWRIADQFPKRRTVGSRWSNSRLKPVPTACWCPLPQIAAADPG
                     PRSIEIGSATPPSTTDAQPGSRDRFHCGASTAARKLFAGDAIRKWPTAQYLPFLAMSG
                     RQLAAAISPSSHFRFHSRSRVGPPAPAPEPKLSGTGIGPITSCVCVADSVFPHF"
     gene            complement(221752..223547)
                     /locus_tag="THITE_2120613"
                     /db_xref="GeneID:11522653"
     mRNA            complement(221752..223547)
                     /locus_tag="THITE_2120613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656149.1"
                     /db_xref="GeneID:11522653"
     CDS             complement(221910..223367)
                     /locus_tag="THITE_2120613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656197.1"
                     /db_xref="GeneID:11522653"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="JGIDB:Thite2_2120613"
                     /translation="MAAFPDMGPPYAPSRPVARTSSSPDPGIVEDQLVAGMTALQSHD
                     GDCKRAYLPSHWSGCLGAPPGTDEFEHYALHSSPALSSLSCPESSAKSSPRSWDSPEQ
                     LGPTPWEAATEQLQNRYHGLDPQLSGVSYVATSHSTEVPTSYPTDAAPFVPTQDFHHP
                     ETGSQHVRSQTEPYPAGYRAPPRDGYPTPPESGPPLSTCTAAGDSPSPTDEQRSSQGS
                     KQQPDPNAGRTSVPSGGADDSDKDESYAQLIYRAFMSHPRRAMTLQEIYQWFRENTDK
                     GKDDSKGWQNSVRHNLSMNGVRPALRFTGRQLSANRGSSRPLPDATADPATPRTATLR
                     AATATVVAKTARSPPSGTLSHGPAPRACRARPGIAASPTSAAAQPATASPPASTGATR
                     RIATATHPRAARAPPTTTTAAACSPLAASCAPARARAWPRHCAATRTPSTSPRPPPTT
                     PSRPTPSPPPRAQHSSTQTPPPRSTTRPPPPPPPQ"
     gene            complement(224982..227630)
                     /locus_tag="THITE_2120615"
                     /db_xref="GeneID:11522654"
     mRNA            complement(join(224982..225546,225615..225647,
                     225969..227630))
                     /locus_tag="THITE_2120615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656150.1"
                     /db_xref="GeneID:11522654"
     CDS             complement(join(225529..225546,225615..225647,
                     225969..227423))
                     /locus_tag="THITE_2120615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656198.1"
                     /db_xref="GeneID:11522654"
                     /db_xref="JGIDB:Thite2_2120615"
                     /translation="MDPGRQAMINGWKSPRRDRDRDRHRDLTAPRYDPANRIAKPPRQ
                     PPPKSSNASAPGRYLTQDEQAEQFIAGEDKFVLKQAKKKADIRVREQRAKPIDYLAFA
                     LRFIDPDRDVFDDDDGDVEIPIPAPEAVLQGLDVPQLTELEEDIRSYNTLETNARNKD
                     YWTALLALCADRRQKLKPQGPEGRAVTSVAADVDRILSPKTLEQLEALEKQIRTKLQS
                     EEPIDTDYWGELLKSLLVYKAKAKLKSVCAAIKEARVEALRARDPEKAKAWEASDGFA
                     GTAPAASAGATKTAPRPAPRPAASTTAGAQSTSSAPPPGTARFASAGNEDFSQATKAL
                     YDREVARGVSENEEIFTAEEAVPGIQKPLWADKYRPRKPRYFNRVLMGYEWNKYNQTH
                     YDHDNPPPKVVQGYRFNIFYPDLIDKTKAPTFKIIREHGRRKGESFAPAGKEDTCLIR
                     FIAGPPYEDIAFRIVDREWDYSAKKERGFKSSFDKGILQLHFQFKKIYYRK"
     gene            227753..232386
                     /locus_tag="THITE_2120617"
                     /db_xref="GeneID:11522655"
     mRNA            227753..232386
                     /locus_tag="THITE_2120617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656151.1"
                     /db_xref="GeneID:11522655"
     CDS             227967..232223
                     /locus_tag="THITE_2120617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656199.1"
                     /db_xref="GeneID:11522655"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2120617"
                     /translation="MYSIGNQGKIMRKLLGKPLPDSAHDAHVHAHSHSPSPTAAATAA
                     AAITSSPLAPNYRPTASQDVLYHAGVPIACLDSSPDGRSAVLAGRHVLKTITFDGLAV
                     KEGIDLRALLLAQPSQRYNTPASVADQLSVKAVRWGESQGNPAIFTAGTGGKIFQYDL
                     VRAGFIGPGAPVDCVQIREDSRQVNALDINPHRNSWLLSGSQDGIVRCFDVRQPTQAR
                     AGATFRSIQAFRCHADGVRHVQWNPRDGFLFACATEQGSVMKWDMRKPNAAVLRIKAH
                     DRTCTAMAWHPDGIHLASAGVDSKCYVWDMSRQDKRQKPKWTLSTPAPAGTLAWRPGQ
                     WSATARGKRASQLAVSYDESSQKRYGISAVHVWDFARPTMPYKEVCWFESSPSAMLWR
                     DQYLLWTAGQDGIFSQCDISFAPNVIDRQAVSTMTFSPQGDVLMLLDERPPPQRRPRP
                     HIVHHDAVAVPSFSSSPTTPQFSVSRSDSEDDAIGSFIGPRWRGSRRRRPSTRSTATL
                     STTPPAGPGMEEVMSLEQTIRATGTYKPQQAMAVSHVPAAANAEVYGYLAVNYLEALH
                     RDLPYSPGASPLPDRIATILEHYARAAAHVKKFRLAQTWRILAFAVDMLLHRRAQYHL
                     ERRMDRHHYAVRRKSEAKAKAKAKALAELFSAPMQTTLDGEDTPRKVISLTSFDNALR
                     PRSLLSEELESTSNVPTPLARPVPDRPDVDRPDVRERGRKLTPIVEPESFTLPPAARP
                     PSLESRKRLDSVPLSVASHESEATYASTEGYDFYDTEALANAIDVPRMRSAPTQVPDY
                     SRPGSPPRGARHHLVRHDSGESYVHLFSISDESRRTTGLTTSSDGSLTGRTAEAAALA
                     ELQNRDREQFESRMRGDEVRNTPNSTAAMSPHRLLQRTETDMTTFTDEHHAITQTTTD
                     SFESRFPSQPEPDALPESPLQQPSPPESPLCFEDDQSPFIVETDYLCWPDDHPYPYPA
                     HPSTGAAATPATPSSPLQPYDLISRALAFEAKSSALNASAIVLLLKPLLPDDVIDRFQ
                     ASAILRQHHSRLMSMKLFTQAALLRKLCMQGWPGAPLSHWGENYPAIFSPAQQGVQAG
                     FVCTACHKPRDIDRSAASTESVWTCERCRAVMAPCAICGERDSAPALTAALPLPSPSH
                     PPAPASATDPAPTTTSPASLPTWWYCPGCAHGGHASCMQAWHAALLEPAAATAAGESD
                     PLADPAGAAEPADGRCPLDGCGHACLPSRRAAEAGIVRAEEVRRVVGEATRAVAKATA
                     AAAAAAAAAAVAAGGAGGGGSGGGAAAAAAGAYYGPGTGEVGLSGQFGDDHLVHGEAG
                     GAAGLGGGGSGAGGGGHGGGGGRYAAAAVRSDGYDVPQSRAVETVREALAGAAGLGGG
                     SARAAGAAGILSSSPGRSPVGLERERRKSVKFVASPDERR"
     gene            <233073..>234563
                     /locus_tag="THITE_157579"
                     /db_xref="GeneID:11522656"
     mRNA            <233073..>234563
                     /locus_tag="THITE_157579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656152.1"
                     /db_xref="GeneID:11522656"
     CDS             233073..234563
                     /locus_tag="THITE_157579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656200.1"
                     /db_xref="GeneID:11522656"
                     /db_xref="JGIDB:Thite2_157579"
                     /translation="MAVPTPTTSFSTTCLVVSVPESSYTVHYTSGEVGIYPPTTYTAP
                     TDIVRTETATIEASCFTLAPGQSIPSSVAFVGVSCETYYHPATTETWTYTSTPGQPFV
                     VFDKTLDVYTGTTTRYVTETYTRPPFSGVYCTPLPDVRNPDTCDHVTPLTWASLVITF
                     ITVHLTWWLFDLPLLWKKKKKKKKTECESGEQKERAAAAVAPAPTTTPIANADDDRAG
                     FHAFLYTVTWACLRVNAPGCAAFYSVAAGRDTGEFAAMYYLGVRRSKRDGAAPQFTAW
                     KLATCVVADLLSIVAVAVTVYQACTLPEYAPRRFGDGLWAYPSLPTALIGLCLLAGRA
                     WFPRTRLAAIGLVLMVVGVLVLVGVALALLLWRFDQPNNTWFVPVIFYGIMAFPVVVV
                     ARILVLFAIPLGGFGRVGGVSIAASEHYSGGQPYCKMPGAGFTATYVVLGVISGLLAL
                     QWFKLHHPALHNRSMGALTSPSASQDNAAAEIAQAGGAGFEAEKAR"
     gene            complement(234618..235225)
                     /locus_tag="THITE_2120618"
                     /db_xref="GeneID:11522657"
     mRNA            complement(join(234618..234820,234877..235225))
                     /locus_tag="THITE_2120618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656153.1"
                     /db_xref="GeneID:11522657"
     CDS             complement(join(234673..234820,234877..235124))
                     /locus_tag="THITE_2120618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656201.1"
                     /db_xref="GeneID:11522657"
                     /db_xref="JGIDB:Thite2_2120618"
                     /translation="MAVVKKLAGLVDPSEVLVTAVCPGGVATNLSRGWTGVVATVVKA
                     VLNALALRTPEYAARSVVSGALLGSEASGKLWYDDELHELSNLAGDEGEELASKIWAE
                     VTEALRRDLPEVDEVVKTLPEHRTAVSSH"
     gene            <239425..>240044
                     /locus_tag="THITE_2056626"
                     /db_xref="GeneID:11522658"
     mRNA            join(<239425..239751,239865..>240044)
                     /locus_tag="THITE_2056626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656154.1"
                     /db_xref="GeneID:11522658"
     CDS             join(239425..239751,239865..240044)
                     /locus_tag="THITE_2056626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656202.1"
                     /db_xref="GeneID:11522658"
                     /db_xref="JGIDB:Thite2_2056626"
                     /translation="MIPQAVLLALGALVGTATAAAVPKVAVSPRDFLNPGQLRCLWTE
                     QDHADLGCLTSLGEWTTNEAECGTFVGSWNSNTTFFLSSPDSGSCGLDGSFFKCGRDG
                     VKPFNFGTWGREGPVPGRDILRAGEYATFASDSANAPPASGDPPLDIHIYMGIEPGKW
                     VFLGWKDL"
     gene            249499..251286
                     /locus_tag="THITE_2120621"
                     /db_xref="GeneID:11522659"
     mRNA            join(249499..249826,249890..249927,250005..250259,
                     250310..250935,251007..251118,251173..251286)
                     /locus_tag="THITE_2120621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656155.1"
                     /db_xref="GeneID:11522659"
     CDS             join(249552..249826,249890..249927,250005..250259,
                     250310..250935,251007..251118,251173..251246)
                     /locus_tag="THITE_2120621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656203.1"
                     /db_xref="GeneID:11522659"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2120621"
                     /translation="MQSLSLSRIEWLASQWSMTPLALSLSLLLVILTSYVAYQRLLSP
                     FAGIPGPFWASLSRLWLTWHARKGDLHTVMMRLHEKHGKLVRIAPSEVSISDLNAIKT
                     IYGAGSKFRKSSWYSVWQGRRDYDLFGEQDERVHAAQRRLVSRPYAMSSLKQLEPYVD
                     NAVLVFLNKLGDMAGQVIDLGNWFQLFAFDVIGEITFSKPFGFMDAGTDDGSFKPIQD
                     ALFSGAWVGQVPWLFWLSDFLSPVIGQRLAIAGRNTNWVAKVVREVTARLQSGSDCPD
                     ILGQLLKVHHEKPQQFSVSNLMSVAGSNVFAGSDTTAISTRAIVYNVLKNPECKQRLL
                     DEIDDFRRRGELSDPVTIAEAEKMPYLQAVMYEALRCHPAVGMTLPRVVPPEGLEVDG
                     HYLPAGSIVGVNPWVVHRNKDVYGHDADTFRPERWLKADTADMHRFFFAFGSGARTCI
                     GKSESLPVV"
     gene            252094..254249
                     /locus_tag="THITE_2120623"
                     /db_xref="GeneID:11522660"
     mRNA            252094..254249
                     /locus_tag="THITE_2120623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656156.1"
                     /db_xref="GeneID:11522660"
     CDS             252532..254085
                     /locus_tag="THITE_2120623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656204.1"
                     /db_xref="GeneID:11522660"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2120623"
                     /translation="MPYGLPTSTFLPGAFRHHHGHHGLPSVAGTNPTTPNSAVFQPLF
                     GQLSDLWGRRWVFLSTLAIFTLGSGLCGGASTGSMLIAARAVQGIGAGGINMMVDLII
                     CDLVPMRDRGKFLSLIFVAIGVFTAVGPLIGGALAQAGLWRWVFYLNLPIGAPCMVVT
                     FLFLRVKARADGGSFAARMRRVDWVGVAILTISTIAVMYAVTYGGSLRSWDDSRVVAP
                     LVAGLLCLVIFVLFEGSPFVSEPVTPYHLFANRTSAAAYAITFLHSIMSLWIMYVFAV
                     YFQAVLGKSQTISGVCLMPTVLGFPFAAAVGGALMSRWGRYKPLHLVGFALFTLGSGL
                     CSLLSQSSSPAAWVVLQLCLALGSGLVMACLLPAVQARLRESDTALSTGTWAFIRSIG
                     VIWGVTIPVAVFNNRFDELLPSLVRDEAARRLLGNGQAYAHATADVVNSFAGETRDQV
                     VEVYALSLQRVWQIAVVFGGVSFLLSALEREVALRKHLQTDFGIEEKKNTASRGSNPQ
                     PRDGGVLDA"
     gene            complement(264766..266954)
                     /locus_tag="THITE_2120626"
                     /db_xref="GeneID:11522661"
     mRNA            complement(join(264766..265393,265465..266954))
                     /locus_tag="THITE_2120626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656157.1"
                     /db_xref="GeneID:11522661"
     CDS             complement(join(265118..265393,265465..266796))
                     /locus_tag="THITE_2120626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656205.1"
                     /db_xref="GeneID:11522661"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Thite2_2120626"
                     /translation="MEEGQHKAAAGSEDAAALARLGVKQELERNFSTISMLGLAFAIL
                     NSWTALATSLSLALPSGGPSAIIWGLVVAGICNLCLAASLAEFLSAYPTAGGQYHWAA
                     IVSWRRFSPAISFVTGWINVAAWVCLTATGGLLGSQLIIGLMALFNPSYEAQPWQQFL
                     IYIAYTLAAFVINALANRLLALFTKAAFFWSVAGFVIISITVLACAAPEHRYQSGAFV
                     YGAFINETGWPDGLAWLLGLLQGAFALTGFDATAHMIEEIPRPQHEGPRIMLLCIGIG
                     IFTGFVFLSCLLFVLRDIDNTIGSTAGPLLQILYDATGNSRAGATCLYIFPIVCMLFT
                     TTSLMTTSSRMSYAFARDRGLPASRVFAAVNQTLGVPLNALIWTTAWVIIFGCVFLGS
                     TSAFNAIVSASVVALGVTYAIPPAINCLRGRRMLPASRPFKLSEPVGWTVNLIGIAWT
                     VLTTVLFVFPPEIPTTAANMNYCIVAFGVVLLIAGVQWIVDGRKNFTGPKVDIDGLVH
                     GAVEAITVGEGDVVEVEQSEKREESSS"
     gene            complement(<268713..>269938)
                     /locus_tag="THITE_123229"
                     /db_xref="GeneID:11522662"
     mRNA            complement(join(<268713..268839,269057..269754,
                     269831..>269938))
                     /locus_tag="THITE_123229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656158.1"
                     /db_xref="GeneID:11522662"
     CDS             complement(join(268713..268839,269057..269754,
                     269831..269938))
                     /locus_tag="THITE_123229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656206.1"
                     /db_xref="GeneID:11522662"
                     /db_xref="InterPro:IPR005581"
                     /db_xref="JGIDB:Thite2_123229"
                     /translation="MGQTHGALTLTLPIQWSTGLRIDVAVGDEEKSFFAKLIEREEFV
                     GMAEAEYEGQKAISAVIPEHAVEPIAWGYYEGDRTKAWFLTHFRNLVPRPPPLSSFLP
                     VVKKLHQESVSPTGKFGFHVTPFYGPPPMIVSWTDNWEKFWTREFRSGLEYVQRMRGE
                     DPELAEIAEEFIDKVVPRLLRPLQTGGRNIKPSLCHGDLWDGNIQIDWDTKKPMVFDP
                     CPFYGHCEMDLQCMRSPRYVVGLDFVKEYSKGVGKSEPIEDFDDRNALYAIAKEEMLR
                     LLDKHPNGLAGFKGDLTPTVTTKADHVAVIEAKL"
     gene            complement(<270919..>271948)
                     /locus_tag="THITE_44575"
                     /db_xref="GeneID:11522663"
     mRNA            complement(join(<270919..271621,271681..271800,
                     271872..>271948))
                     /locus_tag="THITE_44575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656159.1"
                     /db_xref="GeneID:11522663"
     CDS             complement(join(270919..271621,271681..271800,
                     271872..271948))
                     /locus_tag="THITE_44575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656207.1"
                     /db_xref="GeneID:11522663"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_44575"
                     /translation="MSESHVSKGGKFEPTPQKAQAQDLPGLEKKMEPPSEATKLEGAG
                     QAYEYAAAGKLKGCKALITGGDSGIGRAVAVLFAREGADVSIVYLPEEQPDAEDTKKM
                     VEKEGRRCLLIPGDLMDYDKCRAAVQEHVDAFGVIHVLVNNASKQIMCGDFAEIDLAA
                     VESTFRSNILQMFAVTKYALPHMRKGGSIINTTSTVAFRGTGSMVDYAATKGAIVSFT
                     RSLAKNLMPKGIRVNAVAPGPVHTPLQPASRPAEQMESFGEKSGIGRVGQPSDIAPSF
                     VFLASKDSELYYGQVLHAYPLGD"
     gene            complement(273786..274762)
                     /locus_tag="THITE_2120628"
                     /db_xref="GeneID:11522664"
     mRNA            complement(join(273786..274205,274266..274530,
                     274603..274762))
                     /locus_tag="THITE_2120628"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_003656160.1"
                     /db_xref="GeneID:11522664"
     CDS             complement(join(274299..274530,274603..274634))
                     /locus_tag="THITE_2120628"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_003656208.1"
                     /db_xref="GeneID:11522664"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="JGIDB:Thite2_2120628"
                     /translation="MENDRGEIVDLYVPRKCSATGRIIKAKDHGSCQITIAKVDENGR
                     AIQGENIIYALSGFVRAMGESDDALNRLAQRDGLLKNVWSAQR"
     gene            274861..278229
                     /locus_tag="THITE_2120630"
                     /db_xref="GeneID:11522665"
     mRNA            274861..278229
                     /locus_tag="THITE_2120630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656161.1"
                     /db_xref="GeneID:11522665"
     CDS             275130..277940
                     /locus_tag="THITE_2120630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656209.1"
                     /db_xref="GeneID:11522665"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Thite2_2120630"
                     /translation="MAAAGPRPCSSSLSRMQPRESLLVISSSPEFPSICDLLPTKKPA
                     LRSGSNGAPIPRDAPAGFTSAAQVWQSPRVSNEHINVSSDPNALRSAAPAKPMVDTAA
                     EVSFEPAVAAVDAGLRMEAGSKPAGAKRVTKKTEQSRCQNTRKGALTEVSAAETNLPK
                     KSGRKPRSKKDSAVLAQSTLPQGKVTKPRAECGQPKRKAETVSRHFAPQISAPEAVPK
                     LMADPIEDEVVILEPAMKRRLDWTPPRESLSTPRVVDTPAAKELPSSASPVRVNVFKN
                     LQDTYGRPSETAILTEEDDSTGATTDVLGKRKLIEMVTTGGNRPETPEVSPSKPKAAK
                     KKPRTITELATAAYRQPDEHTVLSDKPKQDTLLGYLDVTDGETAAAAKSEAKTAKMGR
                     RPAKPKPKPAKTREEKRRPLLLSPASAMRQVARQDFVFGTASQLAAEDDPELLRALHE
                     AMMVSNQADSDPFADSSPVKGRLALRRKPGSGLWAAGARGEDGDLIDLEVLDLTGSSP
                     LPRDYSLPQAPSPSHKAAAQGPSTKETCIEIGSSDTSLDLSASPPFLHVRSSSPSVAP
                     AGARISTASEGDKSSDHGQKHPPSAPREADFEPPPSNQEQHQFLLSQPKSLGQEELEP
                     QPKPNFELYTDARLAKEVASYGFKPVKKRTAMIALLEQCWSSQHTRGLASRSAQAPMS
                     TSSTKQTASPSRTRGRPRKNSAMSTSDVAEAPAPTKRGRKKSSSVTESEVEAPQAEKR
                     PRGRPKKATAAAAANQSKAKAPASPKRSKSPPKPAAPAPATPKRRKAPAKEVVEIADS
                     ESDSDSDDPFASSPITSPDKQDDVFSPPAVDLSVTEDTETSLVASPTDQQVSLFRYIT
                     QAVVTAPRAKDPANPSWHEKMLMYDPIILEDLTAWLNSGQLDRVGYDGEVAPGDVKKW
                     CESKSVCCLWRVSLNGKERKRF"
     gene            278243..279246
                     /locus_tag="THITE_2120631"
                     /db_xref="GeneID:11522666"
     mRNA            join(278243..278635,278702..279246)
                     /locus_tag="THITE_2120631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656162.1"
                     /db_xref="GeneID:11522666"
     CDS             join(278547..278635,278702..279122)
                     /locus_tag="THITE_2120631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656210.1"
                     /db_xref="GeneID:11522666"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Thite2_2120631"
                     /translation="MPAQGQGPTGGMAGEKKVKKPPAAPRPSSSVLLISPTNQVLLLH
                     RVHTSSAFASAHVFPGGNLSAYHDGPLPAPDSPLLHEDGPAYRLAAIRETFEESGILL
                     AKKAGSSRDQGLLHVPDDVREAGRKQVHGNKIRFTEWLEGLGGEPDVGMSPHTDWRWC
                     VPSRLGEPH"
     gene            280972..283468
                     /locus_tag="THITE_2120632"
                     /db_xref="GeneID:11522667"
     mRNA            join(280972..282644,282735..283468)
                     /locus_tag="THITE_2120632"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656163.1"
                     /db_xref="GeneID:11522667"
     CDS             join(281063..282644,282735..283312)
                     /locus_tag="THITE_2120632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656211.1"
                     /db_xref="GeneID:11522667"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Thite2_2120632"
                     /translation="MAPGILSEVSPAGETGQAFKILAVNDKPLKNGDEKPANGVSAKE
                     DNGPPAEVNGEARSDDKTEVESSSGSETSEDAPQDQTMKCEIKPLDRRYNDDDEIYFT
                     ERKAEVEKPKQKDWWRMFAFCLVRKYNSDNELQGHSLYVNPQPLRQLLADVIGNYPGD
                     PIDVDDVQIEAPYYSLFHYRAQLETEGFKRFADDPESLEHLKLLLNWIKTHFELEIAA
                     YERCTTQGQKVIAYDCAWTLFPPGTIVYCKLLTQNRAFRVHSKWYDTNELNPSLNLLA
                     EFVDFDGHRLGTRRIELSISKYPGTRELGELSVIPLDLLDDAEDVREELLARGRKFES
                     YVGQNLLAYNGIAIKKMPDGYARFSVTGRVMIDCKTYHRMEPNDSFVVTSGESSRMER
                     SRKKALAQLSFAGADGTPQFDRLSDEDAMLTNATVRGYSFTAKRFLEFFVEDLSEIEW
                     NSRCFEDLVLDPAIKKTVQALVSTHAQKRDTFNDIVKGKGMGLVCVLHGPPGVGKTLT
                     AECVAELVRRPLYMVSSGDLGITSAELDRSLSRIMDMAATWRAVLLIDEADVFLERRS
                     LHDLHRNAMVSVFLRVLEYYSGILFLTTNRVTTFDDAFKSRIHIPIRYTELSVDSRRQ
                     IWRNFCRKVPGGVDIDEKGLATLAEADLNGRQIKNAIKAAESLAAFDGVRLDLKQLLQ
                     ITKIQAMFESDLTSLSGVDYTAPGASKKDAESRNMFL"
     gene            complement(284862..>287407)
                     /locus_tag="THITE_2120635"
                     /db_xref="GeneID:11522668"
     mRNA            complement(join(284862..286952,287021..287053,
                     287257..>287407))
                     /locus_tag="THITE_2120635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656164.1"
                     /db_xref="GeneID:11522668"
     CDS             complement(join(284968..286952,287021..287053,
                     287257..287404))
                     /locus_tag="THITE_2120635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656212.1"
                     /db_xref="GeneID:11522668"
                     /db_xref="JGIDB:Thite2_2120635"
                     /translation="MYDGFNVRQGAINANHMDMVRFASSQDPGYKKTLGFLVELCNAR
                     PAAQQVVDERVHKRSDKILELLNFPSINERELAIEEAYNDTCTWIMDDRPSDKTSNRS
                     TTRFKSWLRSNSESIFWISGKAGCGKSTLMKFIYQHEDTAAALAEWAGSKKLIKAGYF
                     FLDRGNDLQKSREGLLRSLLCQILGERRDLVPVAFPTFFGSVPVPPTSATINTWESLS
                     RAFDAVLKGLTDSKVCLFIDGLDEYRMVERMHEYTPEQLDIIYDGTKEDESWGLSDWI
                     VAGHKDIAELVLRFKDRSNTKICLSSRELNVFEQRFAGLPRLEVHHYTAGPIEQYCEG
                     RLSKEAPGLVDRDRFVSTITAKSQGVFLWVRLVVDMLVDGTADGNTPSELWQTLESLP
                     GRLGGKNGLYMRMMQNVKAKYLPEAERLFQIVMHWHFISQSGRVFPLRGDMDIITLFL
                     AEEGHRETGGNGGLRAKREKFAPETWDGLRPRWTERERRLKSRCGGLLEGCEGVQFMH
                     QTAKEFMSREYIWNAIFPRSNGFVSTAAKNLAILSGLIRRLKCCREVTLEAQRIQREE
                     SRGGPKQHDSDAPNPHVADYRLLHNALLVAGHTALDHLEGEDYDDFEQLVDELDATGS
                     YHALPQGTEITYPPRRDWEKIFFGRSGWLGALLDKVRKERPARTETDHYIGDHGPTSS
                     PSIHCPQTQGERNSSAAAPNIASGRFRTVSPVLEGDRGR"
     gene            complement(289764..292162)
                     /locus_tag="THITE_2081050"
                     /db_xref="GeneID:11522669"
     mRNA            complement(join(289764..290033,290167..291407,
                     291481..292162))
                     /locus_tag="THITE_2081050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656165.1"
                     /db_xref="GeneID:11522669"
     CDS             complement(join(290921..291407,291481..292034))
                     /locus_tag="THITE_2081050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656213.1"
                     /db_xref="GeneID:11522669"
                     /db_xref="JGIDB:Thite2_2081050"
                     /translation="MSFIFTIRAGPARLAARAPQLAVRAFHQSAPKNSFFTPRTASLA
                     FRASTKNSSNGILSRLQGASRGYHAQYDSVYVDPAARRAELLRKLLIGGAIFGGTLVT
                     ANVVFNRETREDGGLPPYERSYLNRTFLHTGLGVGIIGLTAYQMVQSGFVYRIMVTNP
                     WIVGIGGLALSIGSMVATRAIEPENYIPKYACWAAFNATQAALIAPLMTIAPPALLAR
                     AGLYTVAMMGSISFVGATAKQDKYLYIGGPLLAGAAIVAVSGFAPLVLPATAVRTLAF
                     TENLWLYGGLALFGGFTLYDVQKVLYHARAAQRGVIKEDPINESISLELDFLNIFIRM
                     VQILMMQQNRRK"
     gene            293845..297314
                     /locus_tag="THITE_2120641"
                     /db_xref="GeneID:11522670"
     mRNA            293845..297314
                     /locus_tag="THITE_2120641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656166.1"
                     /db_xref="GeneID:11522670"
     CDS             294094..297153
                     /locus_tag="THITE_2120641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656214.1"
                     /db_xref="GeneID:11522670"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Thite2_2120641"
                     /translation="MRRSRTPPAAPSPYRALAHHHAHHGAASSQAGQQARDSVSSVLR
                     SFNVETNPSRPVRPSPLTASTIPDMPLDLVDRIRSFPLFMSAPEDFLAAIGAHLRPQI
                     HSPHDHILTEGDEAMAMYWLVRGIVAVTSRDGEAVYAELKPGAFFGEIGVLMDMPRTA
                     TIIARTKCLLLVLKKEDLKAELPKYPDMEKAIRQEAQERLAILRKKRQDGGQPSKLPD
                     TSGAKLAREAAPGEVRTGDVGVIEEGSVVKTKKRKSPSPGVVEDPAISGSALGSGYVS
                     VRRTLKELPLFSALPSDILHFLGLSAQPKSYPPFTDIICQGAPGNDIYFIVRGEAEVV
                     QEPPSQTLKRTIKSTYARPRLKQGQYFGEVASLGLSEWRTATVRSVTDVECLMIPGAT
                     LDELWRRCPPELKSQVEETARERFHPVEDVTMEEAESNGGKQAGADEQAAVPGVTLTP
                     PKTPAPTVDDEADTRRPSDPDPFLSVDMENLRNRRRNSLAPPTPQTDSSVIVGGIKVP
                     PVAPAPPLLSPVSPVSFDDSPLPAKRARTLAQAELEKGRKQRPAFPDDVWVAVFKQLE
                     LAELIRLRIVCRKWRELLTSSPELCTHVDLRPYNRKVTDWSLANVLAPFIGARPVEMD
                     ISNCFHITDEGFQALWKTCGRNVKVWRMRSVWEVSASQILEMSEFAKGLEEVDWSNCR
                     KVGDNLLARVVGWVVPEPPPSRDTDAATTKQPRRGSPQPPSQSQQATTASQPPGPAPG
                     TTIGCPSLRRFNLSYCKHITNRSMAHLAAHASARLEALDLTRCTSINDLGFQAWSAHR
                     FPALRRLCLADCTFLSDNAIVALVGAAKALTHLDLSFCCALSDTATEVVALGLPALRE
                     LRVAFCGSAVSDASLGCVALHLNELRGLSVRGCVRVTGNGVENVLEGCSRLEWLDVSQ
                     CKNLGGWLAGGGVSRWGYDERAENGGVGGAGGGGTATTRAASAPASAAAATATGRKNA
                     LAVQKSAQQPLGPGPVLRPVIPPRGAPAGRARKPVRFVVEKGPGGLR"
     gene            299626..299919
                     /locus_tag="THITE_2120643"
                     /db_xref="GeneID:11522671"
     mRNA            299626..299919
                     /locus_tag="THITE_2120643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656167.1"
                     /db_xref="GeneID:11522671"
     CDS             299679..299840
                     /locus_tag="THITE_2120643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656215.1"
                     /db_xref="GeneID:11522671"
                     /db_xref="JGIDB:Thite2_2120643"
                     /translation="MIWRVLIHYLISELLDVLFGHTWRVWCQSESRILVLFDQQDGES
                     FRSFTLLTQ"
     gene            complement(<300301..>303567)
                     /locus_tag="THITE_123221"
                     /db_xref="GeneID:11522672"
     mRNA            complement(join(<300301..302262,302317..302679,
                     302738..303280,303343..>303567))
                     /locus_tag="THITE_123221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656168.1"
                     /db_xref="GeneID:11522672"
     CDS             complement(join(300301..302262,302317..302679,
                     302738..303280,303343..303567))
                     /locus_tag="THITE_123221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656216.1"
                     /db_xref="GeneID:11522672"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_123221"
                     /translation="MTGEGSTNAPASGVDDSPNSNHDGASAPSPQDGYDPQQIMALAR
                     HPPPGASVYSPTAAPSAALNPRSCVTCRRRKVRCDKHMPCSNCRRAQIPCIFPAPGRA
                     PRRPRPKDPNAPAKQPSSERELELLKRLRKLEGIVEELSGQIEVESVRHPYSPGNSPD
                     AAGTGYGKDDHTVGARFDNLGSRLAGAAGSTSSRDSPGVAGGSRLPARPTSDSMSETD
                     SRGKASPDVHNQFGRLVLNEKGVTRYVSSSLWTSINDELDELRKASQDLSDEDSDESD
                     LDVTPESADHDRSVVDHHAFVLGYRSADIDLRPLHPLPSQIPFIWQVYQENVDPILKI
                     VHVPTMSKVIKEIRHNLDSLTPSLEALMFSIYYAAIASLDEEEVKLNFGTEKSSLMQK
                     YRFALEQGLAKAEFLTKPDTTVVQALIIFLVLVRRNDDTRFAWTLTGLLIRLSQALGL
                     HRDGTHFPNLTPFEIEMRRRLFWAVCVLDLRSAEDQGTDLTIVDRTFDTQIPLNINDS
                     DISPDSPCLPEPREGTTDMAFSLTRYEICALSRRLHMASSGIDPPCPADASRSLEERE
                     ALITEVYNRVEQRLLKDRDRSNPLFWVASNVTRIIVAKMTLVIYQPALFPGPGHDGLS
                     EDVRARLLNAALDVFEYSHVLNTDPRCKHWRWMFQTWSHWHALAYTLIEVSHRPWGPK
                     AERAWAALNLTFQAPRTVELQKLTNHHAVWLPLKKLYLKVKKHREVEIRRLQADPAAA
                     RELDAQDQCRLPPTRFGAIPSAMKAAIALERWRKLVNLPSAPPEAGPIEPQQQRASPQ
                     PKPTPEPEPQPQTQPLGPTTSLPLQSATTMSPVQPCSPADFAKPEILEYLDSAMANST
                     FVATDFAPLWSDGAPEEMVRAAFFPCPTAPTADVSSLAFDPASTVTPLAGLQQQQQQQ
                     PTPLNVACQVQQIQQQQPGGGSGSGGGGIVQTAPLGGGGGSMPDECLPPWLWPAANGG
                     GSPPDFLRLPGVGAGGAAEDLDINMDEGFDWQTWQESLGRYEVEANGGRAGSTWGPGL
                     "
     gene            complement(<304703..>308261)
                     /locus_tag="THITE_157561"
                     /db_xref="GeneID:11522673"
     mRNA            complement(join(<304703..304826,305587..307222,
                     307298..307453,307511..307948,308021..>308261))
                     /locus_tag="THITE_157561"
                     /product="glycoside hydrolase family 63 protein"
                     /transcript_id="XM_003656169.1"
                     /db_xref="GeneID:11522673"
     CDS             complement(join(304703..304826,305587..307222,
                     307298..307453,307511..307948,308021..308261))
                     /locus_tag="THITE_157561"
                     /note="CAZy_ID 269967"
                     /codon_start=1
                     /product="glycoside hydrolase family 63 protein"
                     /protein_id="XP_003656217.1"
                     /db_xref="GeneID:11522673"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="JGIDB:Thite2_157561"
                     /translation="MAAVLGCLTLLCALCFGGANAQGPGASNSTRSSSSTPERSWQTW
                     GPYRPNLYFGVRPQVPETLLMGLMWASGESRDRMLSTLRDTCEQNDGMQGYGWTFYDP
                     RVGGSQAVHDTQLQLDINTDFLKTEDGGSWAVRITGTPKLGATGVKTTAILHAAVEMA
                     DANEPKSLWCENHAKNKDGVDAACRGEIAGLGRFQFQVLGDATNNVVHETVVRSVQVP
                     EDKIWQAKSIFADQVKAAAGDQIAIQDAPGAGNMHFVQTTFQGAFQLTFTYHAAEAST
                     LDAQAVDTGISSLRRSFPSSVDKVFSRTPPFQGEEYARFSQEILSNLLGGLGFFHGDT
                     RVDETHAPEYEETDLDFWTKAASAMSRAHVTTTDAKTLLSFTPSRAYFPRGFLWDEGF
                     HLLPVIEWDLDLAVSVLRSWLSLMDDDGWIPREQILGPEARSRVPPEFQVQYPHYANP
                     PTMLALVLPAILSKLTGASPYTGHPSAYLSSPDQASALLKTLYRLLARHYHWFRRTQA
                     GNFSSAYPRPASAIPGTGFRWRGRTPTHNLPSGLDDYPRADPPHPGELHVDALAWVGG
                     AAAALQQAALYLGKQRADGNDDNDADDAATYAAHVAAAKHNLDALHWDAARQSYCDAT
                     VRREEEENGEQQQQYALVCHEGYVSLTPLLLGLVGADHPHLPALLDLVADPDRLWSPH
                     GLRSLSKGDEHYGRDEDYWRGAVWVNLNVLAVLRLRDVGLSGKGPAAVRTRALSLAAE
                     LRERLVRTVYESWNRTGYFWEQYSDETGEGRRTRAFTGWTAAVILLMGLRFAQGAEGV
                     DESENTTSWREASTGLSVMVLFGVVGLDAHAAHPAHLAHPHWRTKAGQFRRIASTMET
                     KPLQPELK"
     gene            308560..310316
                     /locus_tag="THITE_2120646"
                     /db_xref="GeneID:11522674"
     mRNA            join(308560..309402,309480..310316)
                     /locus_tag="THITE_2120646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656170.1"
                     /db_xref="GeneID:11522674"
     CDS             join(308728..309402,309480..309923)
                     /locus_tag="THITE_2120646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656218.1"
                     /db_xref="GeneID:11522674"
                     /db_xref="JGIDB:Thite2_2120646"
                     /translation="MAAYHGESQLGYSNLEPVPLDNNHWNIQMGNGLEAVQRYGNHDK
                     HVVSTGTDKILIQAHPTAPEVVAAGGSLPHVPRRTICGMGQRTFWVVAGVVGFILLAA
                     AIGGGVGGSLSRHSQPSSSLAAASTASTGTSTGSPAPTPTRVPFQNLSIAAARWVDGD
                     SITHYRVYTLSGNSSQTRILESARDQDDGDWTVSAITDVNVDTVQAGTPLSVSVGYPH
                     TNTSKVPVRSVYYLQPGGTIIERQTPYKEAVGVWGDDNFSGLYAASNGSSLFSYWYQD
                     LDQHLQVLATFFQELGVNELTIGRYVENGTNGQPWTSSRKSIPIQDGSSIAAVPAGDG
                     QDIRLYVGGSDGTIKQFAYNLEDDVLGNVVGRSRPALS"
     gene            complement(<310811..>311739)
                     /locus_tag="THITE_2131440"
                     /db_xref="GeneID:11522675"
     mRNA            complement(join(<310811..311208,311283..311352,
                     311413..>311739))
                     /locus_tag="THITE_2131440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656171.1"
                     /db_xref="GeneID:11522675"
     CDS             complement(join(310811..311208,311283..311352,
                     311413..311739))
                     /locus_tag="THITE_2131440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656219.1"
                     /db_xref="GeneID:11522675"
                     /db_xref="JGIDB:Thite2_2131440"
                     /translation="MANEDDISSVEQKTLSIVRNLLVAPDGTEHATADALEALHAYYR
                     ETFCHPDDPSWKRNPARGTIIVAGSAVSHVFDVAAYVPFNDFKHRRLADLVIGLKRNA
                     AQEFNPDDPRLGWDQKVVNEEARETWNCYHHDSMDRCNEAVNMYTLLARLTGAETLGA
                     NAVPWATDDVVEGLEEPASRNSTPLVLKAAAVIATQHILYAGEALVKEVDGEKWKTWA
                     AKLRDLADSTPEDAEWDLKHNAREAYGKMVQLRPELFRESSRNTSQ"
     gene            complement(<326708..>326947)
                     /locus_tag="THITE_2056120"
                     /db_xref="GeneID:11522728"
     mRNA            complement(join(<326708..326866,326906..>326947))
                     /locus_tag="THITE_2056120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656172.1"
                     /db_xref="GeneID:11522728"
     CDS             complement(join(326708..326866,326906..326947))
                     /locus_tag="THITE_2056120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656220.1"
                     /db_xref="GeneID:11522728"
                     /db_xref="JGIDB:Thite2_2056120"
                     /translation="MLGDYITIYLNNVLVYKVLRRLRDIGFNLDLKKYIFIVKEVKYL
                     EYIVKVEVYICPNPKKINAIYK"
     gene            complement(350943..351633)
                     /locus_tag="THITE_2120648"
                     /db_xref="GeneID:11522729"
     mRNA            complement(join(350943..351221,351279..351633))
                     /locus_tag="THITE_2120648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656173.1"
                     /db_xref="GeneID:11522729"
     CDS             complement(join(351048..351221,351279..351452))
                     /locus_tag="THITE_2120648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656221.1"
                     /db_xref="GeneID:11522729"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Thite2_2120648"
                     /translation="MGESFFACAERETLEETGLVVRAQRLLAVTNDVFDPRSKHYITI
                     FVLCQRVDETQEPQVLEPEKCECWTWQSWSDIKAVIAGRDGESKVFLPIVNLLRDYPG
                     VVSEMETSRLNPN"
     gene            <352617..>353308
                     /locus_tag="THITE_26900"
                     /db_xref="GeneID:11522730"
     mRNA            join(<352617..352831,353038..>353308)
                     /locus_tag="THITE_26900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656174.1"
                     /db_xref="GeneID:11522730"
     CDS             join(352617..352831,353038..>353308)
                     /locus_tag="THITE_26900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656222.1"
                     /db_xref="GeneID:11522730"
                     /db_xref="JGIDB:Thite2_26900"
                     /translation="MPNLVAIDVSVTDNRIRLRFSDRAVAAAYAAYLRAQDRRPPQQQ
                     AIPGYQRLPHFHAATKEVSFTLPDFITWFITCRLPDDEDSVTFTAADADAARAARWAA
                     SAVLFEPMPDPTLPRLPFAARAFHDDNYDGGGGGHPVAFSRQLCVRRLWNRTVLLRRL
                     EE"
     gene            <354734..>355825
                     /locus_tag="THITE_157554"
                     /db_xref="GeneID:11522731"
     mRNA            <354734..>355825
                     /locus_tag="THITE_157554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656175.1"
                     /db_xref="GeneID:11522731"
     CDS             354734..355825
                     /locus_tag="THITE_157554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656223.1"
                     /db_xref="GeneID:11522731"
                     /db_xref="JGIDB:Thite2_157554"
                     /translation="MRTIPPSSGTNTSTFRPSIPLRPQARVRPPNPPFRMRPSLLPPL
                     VIPQRFSAAPILLASHDQQQVVDQRISQYRSSFPRSQAEAKPEPPLPPPPPPPVAALP
                     LDDLDNVDLFNFYHPCLLPPTPIQPRQASHAFVNRDPAELPADAVVPASRLPRGLSRY
                     KYTASRRGRGSFRRRNLDGLTRPQRPPLSPLASSPSPQPRRVSLPKWEGCESGDAMPT
                     PGAGEDDAAGEDNVLVGSVNRACDAPSLDYCDDSGSEYGDYSVGECGSPNWESEEERV
                     ALRELWDVIDDLLPGGNVLDHADIQELVNAGETGSDAGGWNDVARRSDDGSVDSGYGA
                     APQDTAWWRDFRQRLLLSQGDTLLSTLEA"
     gene            complement(355907..356980)
                     /locus_tag="THITE_2120651"
                     /db_xref="GeneID:11522732"
     mRNA            complement(join(355907..356497,356557..356594,
                     356665..356711,356770..356980))
                     /locus_tag="THITE_2120651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656176.1"
                     /db_xref="GeneID:11522732"
     CDS             complement(join(355939..356497,356557..356594,
                     356665..356711,356770..356848))
                     /locus_tag="THITE_2120651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656224.1"
                     /db_xref="GeneID:11522732"
                     /db_xref="JGIDB:Thite2_2120651"
                     /translation="MSSDQIVLLDIPTREPRTCWSLNPWKTRMLLNYKGLDYKTEWVE
                     YPDIKGRLEPHVPPNPEGTPYTLPAIRLSDGSYTMESRAIADQIEALHPSPPAHLDSP
                     ALAKLQTLVPRLQVALRPVYMPRVPRLLLADVSAAYFRATRAALVGMELDAFEAANPE
                     AGVWDTVEPLLREVTALLEEEGGPFFLGAQVSYADFVWGGLLLFYERLGALEELLRRS
                     GNAEVHRRLLEGLQPWTKRNAD"
     gene            <358330..>358818
                     /locus_tag="THITE_2131444"
                     /db_xref="GeneID:11522733"
     mRNA            <358330..>358818
                     /locus_tag="THITE_2131444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656177.1"
                     /db_xref="GeneID:11522733"
     CDS             358330..358818
                     /locus_tag="THITE_2131444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656225.1"
                     /db_xref="GeneID:11522733"
                     /db_xref="JGIDB:Thite2_2131444"
                     /translation="MAAWTQEEWEMMTEEERNEPIPMFRVRQNMTGPVYRGQWLYPST
                     IARLEIDPKDAEKARRRLRNNRFIARVQLLTVPDEIDGTDVFLAGDKAARPTLGQHPI
                     PLEDGQPALYLDFEFAHLMVNRTGTFKLRINLFRASSNHQSEKFVAWADGRTFTCWPL
                     VE"
     gene            <359831..>360394
                     /locus_tag="THITE_2131445"
                     /db_xref="GeneID:11522734"
     mRNA            <359831..>360394
                     /locus_tag="THITE_2131445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656178.1"
                     /db_xref="GeneID:11522734"
     CDS             359831..360394
                     /locus_tag="THITE_2131445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656226.1"
                     /db_xref="GeneID:11522734"
                     /db_xref="JGIDB:Thite2_2131445"
                     /translation="MPEIYGLLLKERPGRQMRPNQTLTPPLRVQLKLDKTNEIWRHYY
                     KDRVRARVKLQTYGKAPHFPKDKTEHLAGNRKVMGQNFQHHGETHQSVEFVFDDLAIK
                     EPGYYELVVQLEREHSDKTWSPVPHKTFSGGIYVKKPKDGNKHLRQLLFFGLPISRLM
                     DAGSAAGHRRGNFTPATEGPGAPKGTR"
     gene            complement(360735..362156)
                     /locus_tag="THITE_2120654"
                     /db_xref="GeneID:11522735"
     mRNA            complement(join(360735..361674,361769..362156))
                     /locus_tag="THITE_2120654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656179.1"
                     /db_xref="GeneID:11522735"
     CDS             complement(join(360793..361674,361769..361948))
                     /locus_tag="THITE_2120654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656227.1"
                     /db_xref="GeneID:11522735"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_2120654"
                     /translation="MSANSVVPTAYEPKGMKFRYLGNTGLQVSLFSLGGWLTYGATQK
                     GDIVKQILQTAWDHGIQTFDTAETYANGASEIEMGRALKELGWPRDEYVLTTKIFFGT
                     GRKEPNTRGLSRKHVVEGLKASLARLQTPYVDVVFAHRPDPATPMLEIVEGFTQVIRN
                     LNLAYYWGTSEWSAAQITEAIGLAEKHNLIAPVVEQPQYNALHRERFEVEYAPLFRQH
                     GYGTTIWSPLASGLLTGKYNNGIPEDSRFAHNKDFFANTIKELQSEQGKAKIEKVKKL
                     TAIAERLGHSVTHLALAWAAKNPNVSTVILGATKVEQVVDNLKALDLIDKLTPEIMEE
                     IEAVLDNKPKGVFTFGRDR"
     gene            complement(363590..365060)
                     /locus_tag="THITE_2120656"
                     /db_xref="GeneID:11522736"
     mRNA            complement(363590..365060)
                     /locus_tag="THITE_2120656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656180.1"
                     /db_xref="GeneID:11522736"
     CDS             complement(363741..364967)
                     /locus_tag="THITE_2120656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656228.1"
                     /db_xref="GeneID:11522736"
                     /db_xref="JGIDB:Thite2_2120656"
                     /translation="MDDEGTEPCWSWPYWKFGLKRDDLFNTLHDRYNTVPSPILDPEA
                     FHHDVYEISHQADSVDELHRLLQARKQQRLRELNETLESASFEIIANPTLIGTEQWQH
                     AVQLFRTRSLDSLVRLFASYLPSDHPWHKPAHSASTSEAGSSVGSLTDSHSTLFDEAE
                     SPVMTDEPLEYAPYRKQLLPPSPRSMTMCSDSSVASPIDEDDGPHHFDGFGPATPFRT
                     LSFSESEPDCCDMPESHAPGNCELASRCTDSQPAVATVPETVADGVDNETVAAKQPGS
                     RDGAAVLPPSSSVDVSDCETLTPTPQPEARPAALFEDTKDTKPATPNRRYRSLSPSRP
                     HPLSERDLDEVLSAHRDPRNAQRSRLARRERECSPAVQRRRRRRSPVEPATRIQKPAP
                     EVARSRPRSRRWAVDS"
     gene            366829..368923
                     /locus_tag="THITE_2120657"
                     /db_xref="GeneID:11522737"
     mRNA            366829..368923
                     /locus_tag="THITE_2120657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656181.1"
                     /db_xref="GeneID:11522737"
     CDS             367031..368815
                     /locus_tag="THITE_2120657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656229.1"
                     /db_xref="GeneID:11522737"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2120657"
                     /translation="MGDPRGYSEPSEDKTEPFSQSEIQARLQRSHLEEFNAMNSTVPL
                     DKLVVPLDEDIRILMRPLARDRTVREDQNLLPLELRAEEEDEAPHQVLAVRQTSRDIS
                     YTVSIPDYSNPNRRLICVLYYDPASDNQVLVNRSHMPFTLSRISQEPEGSRGEQYQVN
                     PQFSRALAPGTWRITMEGVDLLDFRLLERRPVRLRAVSSAASDLSGTSDSTVNSSGKR
                     SFLADEDDPVSPQKRRRPSKDARGKEEEDRVIMFLPAKATTKTEPGKELSAPTGHPLL
                     DLESDETVEVPRGGGVVGYTLTKKEPIASTALSSVFTAEYSDAPGRYVVAKVLRTTSP
                     ATAKNNEGAVAKTVIRQAQTWLRELENLERLNHKSIVRLYGGDARFLSLYMEPVDGRD
                     LSARDTWRHTSTDRFLGDSSDALRILEDISSALHYMHGKDLVHNDIKPGNILYSRERG
                     AVLCDLGLSSEKPSPSFGGTPWYVPPEFIGLGKRGAPSDVWALGVVMLYVLDKIPWPE
                     VRGHRNHPRHLFWRIADVHERDRNLQAAAVSSMQRWLSELNAVRNQLDLKNKVERLVH
                     GMLAPNPKERLTTGDIISHLFAAQSPRR"
     gene            368926..369780
                     /locus_tag="THITE_127508"
                     /db_xref="GeneID:11522738"
     mRNA            368926..369780
                     /locus_tag="THITE_127508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656182.1"
                     /db_xref="GeneID:11522738"
     CDS             369054..369485
                     /locus_tag="THITE_127508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656230.1"
                     /db_xref="GeneID:11522738"
                     /db_xref="JGIDB:Thite2_127508"
                     /translation="MSSPSASPWPPPTPTQSGSPRLPTPHSPCVSDPDPDPDPDPDPP
                     RTPTTSVNKPVVLHTTPPAQQYRVRAKHNDVGRSCTLLYSALSFSARTQLDQPAGLAQ
                     SAVALPAGQAGGQGQPPPAQPSCPPVPVLLLKGAGAGAVGV"
     gene            complement(<371409..>372159)
                     /locus_tag="THITE_2056878"
                     /db_xref="GeneID:11522739"
     mRNA            complement(join(<371409..371713,371805..>372159))
                     /locus_tag="THITE_2056878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656183.1"
                     /db_xref="GeneID:11522739"
     CDS             complement(join(371409..371713,371805..372159))
                     /locus_tag="THITE_2056878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656231.1"
                     /db_xref="GeneID:11522739"
                     /db_xref="JGIDB:Thite2_2056878"
                     /translation="MAKRGGRSGTTASVLPARAEGYDRLGRMMGMLPEMTAFRRFGAL
                     SAEDLLYRQAELVELERSLREYQQDDKGSGHPDREHYARNWDKLQRSGDSDVDEGNDG
                     LQWETILEIRQKLKEYQEALIRHRQVLELRQPLPSQIKALDEWMRRPSMGNVYLEGPD
                     RKIWSEPNLEDMVTLIPQPPDENFTTEFTVKLVHQYNKLLGRHIHVRTDPILRDRPAT
                     C"
     gene            <374417..374846
                     /locus_tag="THITE_164158"
                     /db_xref="GeneID:11522740"
     mRNA            join(<374417..374602,374667..374846)
                     /locus_tag="THITE_164158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656184.1"
                     /db_xref="GeneID:11522740"
     CDS             <374417..374602
                     /locus_tag="THITE_164158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656232.1"
                     /db_xref="GeneID:11522740"
                     /db_xref="JGIDB:Thite2_164158"
                     /translation="TNSGRWRNGSARPRLPPRGPRRSGRCARPPRRQPRRRRSGTRRR
                     RRRAARVSERGSKSNTR"
     gene            <376436..>377857
                     /locus_tag="THITE_2055725"
                     /db_xref="GeneID:11522741"
     mRNA            <376436..>377857
                     /locus_tag="THITE_2055725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656185.1"
                     /db_xref="GeneID:11522741"
     CDS             376436..377857
                     /locus_tag="THITE_2055725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656233.1"
                     /db_xref="GeneID:11522741"
                     /db_xref="JGIDB:Thite2_2055725"
                     /translation="MAPIETFAAMLALASSARAAPFVPQWTASQWTTTVYSEPTPTPS
                     PYAISHHNVTSHGPYTGPPATTTGALSTSVIASSIPPAPPAPQIVNYPADGKLHGDQP
                     LPFTPSGGIGTNGSVPMYKVASDFDYQSLALALYHEWIELDLFHWGLATFSDEEFDAY
                     GINAEDRFLLQHMADQEIGHASVIANMLGPNAPKQCTYNYPVSNVAEYIDFNQKLTRW
                     AEAGVYGFLGHLNSGPAATMLLQSITVEARQQLIFRQFGGQFPMPEWHTPGIPQSWAW
                     TLLAPYISSCPYNQTRLVWQNFPALYILNQPNPARINGSAAWNETTGGYANSLSTAGI
                     PADQLCANASTPGMDCPAAVSNNRSLPLSYPGRQVFLKWDAPGRLVGPNNSYVTSTNV
                     AQPRFAAWLSQLNVTYTPLLNVSAQDRTAYTIQPDVSTWKGDPAVNGTMFMALTDVDL
                     FVTPYNVSLINPHVAALAVYQAG"
     gene            complement(378212..379186)
                     /locus_tag="THITE_2120659"
                     /db_xref="GeneID:11522742"
     mRNA            complement(join(378212..378304,378375..379186))
                     /locus_tag="THITE_2120659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656186.1"
                     /db_xref="GeneID:11522742"
     CDS             complement(378393..379052)
                     /locus_tag="THITE_2120659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656234.1"
                     /db_xref="GeneID:11522742"
                     /db_xref="JGIDB:Thite2_2120659"
                     /translation="MIDFIRHHWYDLGVIPFFLSLWYLRLNRAKLTTTEKFLLANFMA
                     VLAHQFEEYRFPGGFPAAMNMGVHSSARPERFPLSSHSAALTNIVATYGYYLAPVFFP
                     DQVWAALGPVLLGFGQFFIHGININTKLGSFYNPGLATVIFMHIPLGYYYIRHVARSG
                     QLTRRQWALGLAYAAAFWYLVLIKSTFGWLVDYDSPYPFYPAEMERGGVAAWIKRVRN
                     L"
     gene            381322..382357
                     /locus_tag="THITE_2120662"
                     /db_xref="GeneID:11522743"
     mRNA            join(381322..381801,381864..381995,382055..382357)
                     /locus_tag="THITE_2120662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656187.1"
                     /db_xref="GeneID:11522743"
     CDS             join(381331..381801,381864..381995,382055..382126)
                     /locus_tag="THITE_2120662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656235.1"
                     /db_xref="GeneID:11522743"
                     /db_xref="JGIDB:Thite2_2120662"
                     /translation="MVSLAVWTSAPPSTETTVDTRNLKDSAVWYPEIPGPALCLHEES
                     FLPRSFFTSGFKPLFWCCFGGPAGRYLAHLTRIQALWYAGGICRVDFFFDTEVPSEHR
                     VLGRYKHGKVCSHLNFTIDGPGGERIESIEIGHRYPDPGDSVPWAVKEGILLWCELRT
                     NRGRSCRFPDADETDKTPTPSVQKLITPAPGSMITGLYATQRPDYGYGFTAMGVISEK
                     VEKNDP"
     gene            complement(382487..383856)
                     /locus_tag="THITE_2120664"
                     /db_xref="GeneID:11522744"
     mRNA            complement(join(382487..382796,382869..383023,
                     383083..383289,383372..383856))
                     /locus_tag="THITE_2120664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656188.1"
                     /db_xref="GeneID:11522744"
     CDS             complement(join(382594..382796,382869..383023,
                     383083..383289,383372..383598))
                     /locus_tag="THITE_2120664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656236.1"
                     /db_xref="GeneID:11522744"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2120664"
                     /translation="MATGGFPYKHVLLIGATSGIGRALAERLLEENIQVTAVGRRQER
                     LDELVRKHGADKAHAVAFDINQLDAIPKFAEDVTKQYPDIDSVFINAGVQRPADFSSP
                     ASVDLKEFHEQMHTNYAAAVSLAHAFLPFLLEKGETTPTSLIFTSSNLAIVPAVPIPA
                     YSASKAALHVFAMCLRCQLAKKKNVKVIEVFPPAVQTELHDYLGPERGRNLGMPLDEF
                     TAQAWQGLANGDDEVHVGFIGSKERFFALARGRREACEEFAVGPL"
     gene            383968..385213
                     /locus_tag="THITE_2120667"
                     /db_xref="GeneID:11522745"
     mRNA            383968..385213
                     /locus_tag="THITE_2120667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656189.1"
                     /db_xref="GeneID:11522745"
     CDS             384092..385018
                     /locus_tag="THITE_2120667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656237.1"
                     /db_xref="GeneID:11522745"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Thite2_2120667"
                     /translation="MAVDFENDIILLTCASGKQCSRLIPLLYGKWKKLRLAAHSAASE
                     ERLKAQYPEATVVRADMSRPDDARRILSGVTAVLHIGPSLHAHETELGYTMIDAAREE
                     AKHGVFKHFVYSSVLHPQLRKLMNHDAKRYVEEYLIESGLNYTIIQPSHILDPFPVQQ
                     LLQQQSPVFTARFDPNTTFSFTVLQDLAEAIAKIFEEREKHYLAQYTACSTGPTSYVQ
                     VVDALSKEIGKPIQIVRKEYFDATEELLKAVVGTAEGLPQSTRDAVHRLVLYYNFYGI
                     KGNTNVLEWLIGRKTTSVEDWVHQKVLECQRS"
     gene            complement(<385888..>386158)
                     /locus_tag="THITE_2022599"
                     /db_xref="GeneID:11522746"
     mRNA            complement(join(<385888..385953,386009..>386158))
                     /locus_tag="THITE_2022599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656190.1"
                     /db_xref="GeneID:11522746"
     CDS             complement(join(<385888..385953,386009..>386158))
                     /locus_tag="THITE_2022599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656238.1"
                     /db_xref="GeneID:11522746"
                     /db_xref="JGIDB:Thite2_2022599"
                     /translation="QNFPECTQDLMQTDDCAAVIDPVACYNEFRWSTRTLQCIDGTDD
                     ADRKRKACKCCSCVGQVMCNWVKQSRYC"
     gene            <386935..>388147
                     /locus_tag="THITE_45518"
                     /db_xref="GeneID:11522747"
     mRNA            join(<386935..387090,387140..387331,387402..388038,
                     388110..>388147)
                     /locus_tag="THITE_45518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656191.1"
                     /db_xref="GeneID:11522747"
     CDS             join(386935..387090,387140..387331,387402..388038,
                     388110..388147)
                     /locus_tag="THITE_45518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656239.1"
                     /db_xref="GeneID:11522747"
                     /db_xref="JGIDB:Thite2_45518"
                     /translation="MKWDAVAVTLGLGSPAWALLRFGCAQLTIQRLDPLVTPGQNPSP
                     HLHQIIGGNSFNVSMPYPEHDLVNLSTCTSCQFTEDLSNYWTAVLFFRARNGTFKRVP
                     QIAQQGMEGTKGGMVVYYMSDALFDTAQRSTVTAFKPGFRMLIGDASFKTRDEARKFR
                     QLTYTCMENQASRAPETVGFPQTPCKLGIMANHQFPTCWDGVNLDSPNHRDHVAYPET
                     GTFESGGKCPASHPVKIPQILLETVWDTSAFNNKDDWPEDGSQPFVWSNGDSTGFSNH
                     ADYVFGWKGDALQRAMDAHTYVSAPMLKTQSIADQNKCASTVKDMVKENFDGWLKELP
                     GGNPVF"
     gene            <389385..>390633
                     /locus_tag="THITE_115327"
                     /db_xref="GeneID:11522748"
     mRNA            join(<389385..389511,389573..389611,389673..389770,
                     389800..390332,390480..>390633)
                     /locus_tag="THITE_115327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656192.1"
                     /db_xref="GeneID:11522748"
     CDS             join(389385..389511,389573..389611,389673..389770,
                     389800..390332,390480..390633)
                     /locus_tag="THITE_115327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656240.1"
                     /db_xref="GeneID:11522748"
                     /db_xref="JGIDB:Thite2_115327"
                     /translation="MSFSSSSVPATTAAASATIASSAAAPASAASASLLPAASGSSFS
                     SAGTAAAAGQNIPATIVIPANYPAYVDPALLIVHPAHWVFENLEPIDPNTGAFVSPAP
                     ALVHAAAPVAAPSVTAHPVAAPPVAAHPIPAALVAAPIAAPVPPAIPAGPVVAPPAPI
                     AAPPAPVAAPPLSDEQQLGQAPRSAAQHSLPYPPGVDPRYWQKVYNRADSLARDRAAA
                     QQDRLSRATYRRALELLVSDVVRSLDRRGGLARATLAKRAALRAASMSWQPNEPIIQF
                     LQQHGIMLAMSTWPNAGMLLNSWRHSDPTFGFHWRTNINI"
     gene            complement(<392962..>393951)
                     /locus_tag="THITE_2057389"
                     /db_xref="GeneID:11522749"
     mRNA            complement(<392962..>393951)
                     /locus_tag="THITE_2057389"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656193.1"
                     /db_xref="GeneID:11522749"
     CDS             complement(392962..393951)
                     /locus_tag="THITE_2057389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656241.1"
                     /db_xref="GeneID:11522749"
                     /db_xref="JGIDB:Thite2_2057389"
                     /translation="MTTTGEFFYLDPASISPTTKPWAKVDGGSTSSFRLTARQRSVTN
                     LRDALPAATLPSGPLPGVFGGDIDVGGFAAFHAPLNSDTADLFTTDAAVRERYYPQVE
                     ALLRANLSGSSGAGKVARVVIFDHTIRRHDPAAPRQPVRQVHVDQTPAAAAARVRRHV
                     KPAADAEALLQPGRRFQIINVWRPIGHAAADFPLAVVDWRSAKGEGDGGDLVPVDLLY
                     PVRNRAEGDPDDDRGKEVPPDGGDGTEGYEVKGETYGVLPNEAHRFYYVKDMAPDEAL
                     FIKCFDSWSQGQPGGKKGVSGFTPHTAFVDPATPAGAKPRESIEVRCLVFYDE"
     gene            complement(394582..>396111)
                     /locus_tag="THITE_2096959"
                     /db_xref="GeneID:11522750"
     mRNA            complement(394582..>396111)
                     /locus_tag="THITE_2096959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656194.1"
                     /db_xref="GeneID:11522750"
     CDS             complement(394597..396111)
                     /locus_tag="THITE_2096959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656242.1"
                     /db_xref="GeneID:11522750"
                     /db_xref="JGIDB:Thite2_2096959"
                     /translation="MEQTTTAPWQEEAIPAPASAHTQTHTRSESSASSETACSTNEKR
                     HSSTSTSSIVKEKGHRHTCSTASSTDLEAQLSEVDDFSQKRFGFIRYTALNVYRRLFS
                     LAFIGNAIGFIVLMARGAAPLDLVNASAINLAVCGLCRHPLVVNMLFLTFGAVPRSAP
                     MRLRRLACKIFHLGGVHSGTGVASCVWYIGFAGVYTYNFTPSPLATAALVLIWIVLAF
                     LLAIIIVAHPAFRAKCHDYFELTHRFSNWLILALFWALLFLLGSQQPSLAGFLLHLPA
                     FWILILLTLATIHPWLLLRRVPVVAEPLSPHAVRLHFAHTSVRFGQGISVARHPLADW
                     HSFASFTDQFDAPATRFSCLVSRAGDWTRAAIASPPAHLWTRGVPTYGFGYVFRMFER
                     IVVVTTGSGIGPCLSFIEDARRPAMRVVWQARSPLETYGQRTLDLVRRMDAEPVIIDS
                     KVSGRVDMLPVVLRLYKDFGADAVCVISNAKMTKSLVYSLETRGIAAYGPIFDS"
     gene            complement(<398191..>399357)
                     /locus_tag="THITE_2131460"
                     /db_xref="GeneID:11522751"
     mRNA            complement(join(<398191..398218,398381..>399357))
                     /locus_tag="THITE_2131460"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003656195.1"
                     /db_xref="GeneID:11522751"
     CDS             complement(join(398191..398218,398381..399357))
                     /locus_tag="THITE_2131460"
                     /note="CAZy_ID 269779"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003656243.1"
                     /db_xref="GeneID:11522751"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Thite2_2131460"
                     /translation="MHLLLLSLVSLLPLSQAAPQATLGNLDFPDPSITYDPQTRAWYA
                     FATQGNGHHVQAAKAASPSGPWTYLSNTDLLPTPPSWASTPDPAIWAPDVHYLRATDS
                     FVLYFAALQPAAAGGRHCVGAATARNITGPFAPLATPLACPVAEGGAIDPAGFEDDAD
                     GSRWVLYKVDGNAAGPGGPCGNGDAPGRPTPIRLQRVDSRDGVTVVGEPVTLLDRDAA
                     EDGPLVEAPSLVKLGPGRFALCYSSHCFNTADYDVRYATAESIQGPYTRRGQLIGKQA
                     GAFGLVAPGGATGIAGGGGLVFHANCPAGRCMYETEYAVGGDGAISIPAGLRAIDLCG
                     "
     gene            <400873..>401178
                     /locus_tag="THITE_157532"
                     /db_xref="GeneID:11522752"
     mRNA            join(<400873..400929,400984..>401178)
                     /locus_tag="THITE_157532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656196.1"
                     /db_xref="GeneID:11522752"
     CDS             join(400873..400929,400984..401178)
                     /locus_tag="THITE_157532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656244.1"
                     /db_xref="GeneID:11522752"
                     /db_xref="JGIDB:Thite2_157532"
                     /translation="MMKVFDSEGAASALAATTLRFGLGWGNSVSGFITAAFTPVPVLF
                     YKYDQSLRKKFPLKLQALNSCKMDIVALTCGGNPRGWAG"
     gene            <402231..>404039
                     /locus_tag="THITE_2057681"
                     /db_xref="GeneID:11522753"
     mRNA            join(<402231..402453,402512..402658,402720..403108,
                     403184..403782,403853..>404039)
                     /locus_tag="THITE_2057681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656197.1"
                     /db_xref="GeneID:11522753"
     CDS             join(402231..402453,402512..402658,402720..403108,
                     403184..403782,403853..404039)
                     /locus_tag="THITE_2057681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656245.1"
                     /db_xref="GeneID:11522753"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2057681"
                     /translation="MALLYVASGFSWSHVAGVVVLYYVLLACYRLWLHPLAGFPGPRL
                     AAISRWYEGYYDLVLGGKYTLKIRDLHKRYGPIIRISPHELHVSDPAFNDTIYRMNGR
                     WDKYAWTYDATGVPKSTVFTVDHDAHKARRAALAPLFSKAKIAARQDLIHKNVDRLCQ
                     RISDLGAKTFDLGAAISALARDTANEFVLGNEYGELNAEDFNVALSIAALGAGAIWRT
                     TKFIRWFGPALRSIPPAWAMKRGDEGTRSFFRTRQRYERDTREVLAAATSPNSESKLQ
                     NTLVHAIVNSDLPASEKTYQRVCDEVTTVAVAGFESTASALRLILYHVFSSDTILQRL
                     RRELASAAAAAGSSEPIPLKTLEQLPYLTSVLMEGLRLSPGIATRTARITDKDLVYGS
                     WRIPAGTPVGMTTLLMHTDEQNFPEPMRFDPDRWVDPRDRRAAEKAYAPFSRGTRICL
                     GMHLAWAEMYLVVAALVQRFNFTFEGVTAADFEFQADNFGISTRAGCHLIAKASPAEI
                     GVVDTA"
     gene            <405521..>406871
                     /locus_tag="THITE_123205"
                     /db_xref="GeneID:11522754"
     mRNA            join(<405521..406629,406730..>406871)
                     /locus_tag="THITE_123205"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_003656198.1"
                     /db_xref="GeneID:11522754"
     CDS             join(405521..406629,406730..406871)
                     /locus_tag="THITE_123205"
                     /EC_number="3.2.1.4"
                     /note="CAZy_ID 269649"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003656246.1"
                     /db_xref="GeneID:11522754"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Thite2_123205"
                     /translation="MPSVVLSLAFLAGSAIAQQSVWGQCGGIGYSGPTSCVSGSCCVT
                     LNAYYAQCTPGTGCGGGGSGTTLTTKTTTTTATATPTGGGGVGSGKTRFAGVNIAGFD
                     FGCGTDGTCNTAKVYPPVKNYPPDYNHPDGAGQMQHFYRDDNMNIFRLPVGWQYLVNN
                     NLGGSLDSTNFGYYDQLVQACLSTGAYCIIDIHNYARWNGAIIGQGGPTNEQFADLWR
                     QIATKYANQPRIWFGIMNEPHDVPNISTWAATVQAAVTAIRNAGATSQFISLPGNDWQ
                     SAAAFISDGSAAALSAVKNPDGSTTNLIFDVHKYLDSDNSGTHTECVTNNIDSAFAPL
                     ATWLRQNNRQAILTETGGGNTASCQTYVCQQLAYLNQNSDVYLGYVGWAAGSFDSTYE
                     LDLTPTQNGNSWTDTALAKACFAR"
     gene            <407673..>408406
                     /locus_tag="THITE_2057657"
                     /db_xref="GeneID:11522755"
     mRNA            join(<407673..407941,408052..>408406)
                     /locus_tag="THITE_2057657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656199.1"
                     /db_xref="GeneID:11522755"
     CDS             join(407673..407941,408052..408406)
                     /locus_tag="THITE_2057657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656247.1"
                     /db_xref="GeneID:11522755"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Thite2_2057657"
                     /translation="MSTTIPPTYPEPDYEAAHRATYERAPRHPIKPVLPPGVREADFT
                     KAIQEFIEVVGQDAVFVNEGLSDYIDPYDVHEADDSKRKVPSAAVCPQSTEQLQQVLR
                     IANAYKIPLWTFSRGKNLGYGGPAPRVSGSVALDLHRMDRILEVNDEFHYAVVEPGVT
                     FAQLYRYCVEHKKKVWPSTPSLGWGSVVGNVCMHPLQFAPPPPLLLG"
     gene            408397..409914
                     /locus_tag="THITE_2120675"
                     /db_xref="GeneID:11522756"
     mRNA            join(408397..409462,409525..409589,409654..409914)
                     /locus_tag="THITE_2120675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656200.1"
                     /db_xref="GeneID:11522756"
     CDS             join(408496..409462,409525..409589,409654..409752)
                     /locus_tag="THITE_2120675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656248.1"
                     /db_xref="GeneID:11522756"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="JGIDB:Thite2_2120675"
                     /translation="MGFGMNYAHHQCIGGLEVMLPDGDVVRTGQFGISNSPSAFLSKF
                     TYGPSVEGLFLQSNLGVVTKLSLWLTPQPQAYMACTFSVQEYDGLAVMVDAFGEMKRN
                     GTIQSCVWFTSLIETLCIMGRREDFWKGPGPIPDWRLEELRKETGFGHWYARWGLYGP
                     KRIVQAQFDEIKAVMAEKAPEGTITGVLFADDGGVDAASVPSPHGDMFVGVPSLWSLP
                     LINWPIPKDRAGKAAHGDYAPVIPSSGKMVLEWMKVSKPICEANGVELMADFFMHERH
                     IVLMNMFTWDQTDPEQKEKMQRLYYGLYEEAKKRGYGMYRGHVNHMDLIAEMNDFNNH
                     AYNRLVEKIKDAVDPNGILAPGKQGIWPNRFRHLRDTQKPTV"
     gene            complement(409892..411659)
                     /locus_tag="THITE_2120676"
                     /db_xref="GeneID:11522757"
     mRNA            complement(409892..411659)
                     /locus_tag="THITE_2120676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656201.1"
                     /db_xref="GeneID:11522757"
     CDS             complement(410058..411557)
                     /locus_tag="THITE_2120676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656249.1"
                     /db_xref="GeneID:11522757"
                     /db_xref="JGIDB:Thite2_2120676"
                     /translation="MEPEPETLDIVIVGAGLSGINSAYRVQTALPHRSFAVLEARRVI
                     GGTWAFWKYPGVRTDSAMGLFGFPWRPWPHTINMAPAEGIRAYIEDCAAAEGIDKKIR
                     FGHRVVASNWSSAEQRWTLHVDVTREDGSVAKKVIKAWWVINASGYYSYEKPLPTVIP
                     GIENFGGQVVHPQFWDERVSCAGKRVVIIGSGATAVTLLPAIAQTAQSVTMLQRSPSY
                     ILSLPSRDNVVAFLSKFLPLKWARLVNWWQRMILETLFVSFLLNFPRAGRRLLMSQAR
                     KQLPKGFDVDKHFNPWYNPFEQRLCLCPGGDFFKALHRPNARIVTDTIKTVTETGILL
                     KSGETLEADMIITATGLYFSLLSGVDARVDGESVIETLGSRYIWNGCMLEGVPNSGLI
                     TGYTAATWTPGADVRVRQLIRVIKHQEKSGAASATPHIEPAVRAKLPVLPAVGLNSTY
                     MVSAHDRMPKVAGRAPWVNGANWAQDVWRLITSDVRQGMKFTYADKKNV"
     gene            <413989..>414630
                     /locus_tag="THITE_2055331"
                     /db_xref="GeneID:11522758"
     mRNA            <413989..>414630
                     /locus_tag="THITE_2055331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656202.1"
                     /db_xref="GeneID:11522758"
     CDS             413989..414630
                     /locus_tag="THITE_2055331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656250.1"
                     /db_xref="GeneID:11522758"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Thite2_2055331"
                     /translation="MKFEPDTLERRLSRRFETPIPEARQFRWIKEIASAASWLESLDY
                     FHGDLRLENILLDETEHVKVCDFGRAMKRGCKIDVATYPFYCPAKNPVAGPAHEQFAI
                     GSCIYTIRTGEVPYGQWETPEDFKRMHEALLQGNYPPTEDDAVLGHIVSSCWHSSFES
                     MGDVEAAIERVVGQLCEEGSAICLSQEEHDICVQKCREFLAQQGQEHRENNAV"
     gene            415259..415909
                     /locus_tag="THITE_2120677"
                     /db_xref="GeneID:11522759"
     mRNA            415259..415909
                     /locus_tag="THITE_2120677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656203.1"
                     /db_xref="GeneID:11522759"
     CDS             415358..415852
                     /locus_tag="THITE_2120677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656251.1"
                     /db_xref="GeneID:11522759"
                     /db_xref="JGIDB:Thite2_2120677"
                     /translation="MKQSRPSNTEPGPWLGSSHTSQDPERQAAKRKRSREKPSKPSKL
                     SQPRKPSKTSQNTTAKPSPVSIPLSLPVLAWFPARPGPRFVVLRAAEGLELPTCATWQ
                     CHKIVSGGTRIRRHSSRALAKKLGLSLSRSLPADHADHVCSRLRPSLLSKSRHVPDFD
                     WLLA"
     gene            complement(<416145..417021)
                     /locus_tag="THITE_2171153"
                     /db_xref="GeneID:11522760"
     mRNA            complement(join(<416145..416389,416443..417021))
                     /locus_tag="THITE_2171153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656204.1"
                     /db_xref="GeneID:11522760"
     CDS             complement(join(<416180..416389,416443..416737))
                     /locus_tag="THITE_2171153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656252.1"
                     /db_xref="GeneID:11522760"
                     /db_xref="JGIDB:Thite2_2171153"
                     /translation="MAIPANAAVRESKRRATPRDWERINVLKALSAAEHSRRQFILNF
                     AASRDTTLLVPGQKADAVKAAEESVANWLSQSGYERVSSEFFKYTVDARLWSTHVGGE
                     LDFPFAFMRGKVEASAKSSEDAAHNDPEGEMVLLGNETDPGDGETTPVASPQTQSPRG
                     SLKGRSWM"
     gene            complement(<419328..>420492)
                     /locus_tag="THITE_115317"
                     /db_xref="GeneID:11522761"
     mRNA            complement(join(<419328..419467,419520..419557,
                     419631..419706,419748..419976,420037..420316,
                     420350..>420492))
                     /locus_tag="THITE_115317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656205.1"
                     /db_xref="GeneID:11522761"
     CDS             complement(join(419328..419467,419520..419557,
                     419631..419706,419748..419976,420037..420316,
                     420350..420492))
                     /locus_tag="THITE_115317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656253.1"
                     /db_xref="GeneID:11522761"
                     /db_xref="JGIDB:Thite2_115317"
                     /translation="MAPCARLQGECPFAARQNLRNLGYFPGRPFGSFQYRLLYKTLDC
                     AAPQLMREGRWGATKYTPWFYMQPGRRLVAHRGEGRGWGGQEKVPAPPAGAVDQLELG
                     EKAIEANLKKKKIKLAFREGAVCIARPRLVGFGARGRQVVAAVSPMSPGWIATGWGRV
                     NSASASDKGPVPVPENMDGRLNELSICEPAIVLEAEELRATIPTVLPERGVPRGLEPS
                     IPGCSIWDAWVVAAVQSISEPITAGAAWRSSPPGRAAGGRPLIGNRWLVETRGRAADA
                     APGQLGGRPGDQGRVQEAGVSLGNG"
     gene            <420632..>421510
                     /locus_tag="THITE_2091422"
                     /db_xref="GeneID:11522762"
     mRNA            <420632..>421510
                     /locus_tag="THITE_2091422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656206.1"
                     /db_xref="GeneID:11522762"
     CDS             420632..421510
                     /locus_tag="THITE_2091422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656254.1"
                     /db_xref="GeneID:11522762"
                     /db_xref="JGIDB:Thite2_2091422"
                     /translation="MRYHLLAVAAMAATGWAQTAPPNITTRPFEVDVVFPGNEVYKQT
                     EILPIVLAVQNLTEWTVGNLSMVWAWDIISYYGVYPATPGGLLASGQFQVPSDASSST
                     GPTYLVAITNASQWHPIHNPNHYGETYLLQWHATWYTSSDSCDTAANYRALGVFSDAV
                     QFDVQTAEELDLLQRANETNPAVDAVIPQAPACPRFDKAARITYNAATTACQLALQTV
                     SAAPGDPCAAKLDAAAASSISSRVASLSSSLVATRTTATPTAVRTSTSSAGAGAARPL
                     QTAFAAACVLCGVAFS"
     gene            421762..423303
                     /locus_tag="THITE_2120679"
                     /db_xref="GeneID:11522763"
     mRNA            join(421762..422056,422124..423303)
                     /locus_tag="THITE_2120679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656207.1"
                     /db_xref="GeneID:11522763"
     CDS             join(421950..422056,422124..423009)
                     /locus_tag="THITE_2120679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656255.1"
                     /db_xref="GeneID:11522763"
                     /db_xref="JGIDB:Thite2_2120679"
                     /translation="MDASSNANTPNPTITFYDIILDPAAYPMSPNPWKTRYALNFAGV
                     PYRTTWVPLNAIAATRSALGLPAIRKHADGSDFPTLPIIRDPLGKPPAKTDKGEAAAA
                     PGEEEEAVIGDSFDIALHLQRTHLSPNQQHTTKNQLFPSLSSTNHTPSGAAADADAGS
                     VALHRAFNALVDELFTRYGAPLAGTYMPFDPRTAAADKAAMLVRFPGGAAARWEDLEI
                     PPGSEARRGMLREFEDALEQKLGSCFGAGAGAGRGCGDGEERRAAGPFMGGRGSPMYA
                     DFIVGGWLQFMRGCLPEWEEMRDKWSGGKWGRLFDALEEWAQVDGRDGVVPARR"
     gene            <423559..426559
                     /locus_tag="THITE_2081075"
                     /db_xref="GeneID:11522764"
     mRNA            join(<423559..424541,424618..426082,426185..426559)
                     /locus_tag="THITE_2081075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656208.1"
                     /db_xref="GeneID:11522764"
     CDS             join(423559..424541,424618..426082,426185..426301)
                     /locus_tag="THITE_2081075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656256.1"
                     /db_xref="GeneID:11522764"
                     /db_xref="JGIDB:Thite2_2081075"
                     /translation="MESRNDFMFRPFGPGGQALPVPGDAPSLDDFDSDDPLRFFKYIN
                     AGAPGHLPMPKLMEADEVRRLCNERSSSVLAHYDRLQRILDRHESTIQKRWTKKTKQQ
                     RLRILLDGWPNMAPMHRPDFDAFRRETEAQRDAGTKFRDRFMWPYINQEDLLRPKSLL
                     LMLKSRGRHHPCEFAAADGDAMYLGRLTKALVPIFLNCYVVTLNGMTRPEEYGALVAW
                     EDHPDAFEWMHTRRQFLPGEALDILEAQDRLMKFLVHCCEQLLHDIPAAELIGDKYPV
                     QPEPPLKSGVEPDGLDSLAVMAEEAPYRPPGRLDFGRIESLLAARSSAAEDHLWALRE
                     DPSYFSNQLLIYKEHRQEMMKDTNGKPHPILQPLKIGVFWERVIGNVLLSAHVELEIF
                     AELRRQAEELKRLQLKYAGTLSPHKDLPDDYLFGILRFRYFLSQLAKEWLNDLKTTVV
                     ASPPMRSLFVRLPAEDLNKIIVTMKPGLKQTAAEKELVWLLRTLWEDGEALFFARMPM
                     IADELERLLRAEPRVKDMISGYVAGRIGDLSILCECLRQLDIYQPWANGYENHMVDRE
                     EDIKEEMARWRAGWFGIRSTMKSKPMLATFALADPSDKKFHYPAEKRRTKETVEALRQ
                     AEANLDAFWEKFDKCLKPGDVKRTALRELLSQNRTLQRTAEWTAPAPTKPSKPAVVSP
                     EDDVIYRPLSTLYFELGASSSTTKLDPIAQPKTKVKTRGTPSQQQQPQQQQQQQQQQQ
                     LADAVAALDLDTPQPPAPIPVDARALKVFRTLFFHPAVTSTPGEVAWPDFLHAMAAAG
                     FRAEKLYGSVWHLQPVAPFHEPHPAAKIPFHVARRMGRRLARAYGWFGGLFVLKEK"
     gene            <427302..>428022
                     /locus_tag="THITE_2146808"
                     /db_xref="GeneID:11522765"
     mRNA            join(<427302..427565,427663..>428022)
                     /locus_tag="THITE_2146808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656209.1"
                     /db_xref="GeneID:11522765"
     CDS             join(427302..427565,427663..428022)
                     /locus_tag="THITE_2146808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656257.1"
                     /db_xref="GeneID:11522765"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2146808"
                     /translation="MPPIRNKSVLVIGGSSGIGYAVADGALAEGARVRIASSNASRVQ
                     QSVAALKQKHPEGDVAGYVCDLTSPDLEQKLDELLAAVQPLDHVLLPRYITPGYQSSL
                     TLTTGAASDKPLPNWSLIGGFLTGLQGLTRNLALDLKPLRVNVVSPGPVATPYLGPPS
                     VADQFKEHTTLGKIGTPEEVAEAYLYLMKDTNVTGSMISTNSGALLV"
     gene            complement(429661..432021)
                     /locus_tag="THITE_2120681"
                     /db_xref="GeneID:11522766"
     mRNA            complement(429661..432021)
                     /locus_tag="THITE_2120681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656210.1"
                     /db_xref="GeneID:11522766"
     CDS             complement(429679..431940)
                     /locus_tag="THITE_2120681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656258.1"
                     /db_xref="GeneID:11522766"
                     /db_xref="JGIDB:Thite2_2120681"
                     /translation="MPENHVGVRQLNYTVPAELEEEYTQCLGRQRRAVAAAQEGNPAR
                     AVRLLRVNLNWCENHLSKDPIHPMTLWHLGEIGIRLISMKQFNEAIIYVGRAYDIWES
                     LDPLGNDTLKILEHYAYALAGDGHLGLAAGQYEELWNAYRKVFGDEAEATLQKGWQAA
                     RSWFDAATASGQVEDPQFLKKARGIYEQVVAAWESKRAAGSLKAIRARADLAINQAML
                     DQFAAAETMLERCLADLAALKEETGNQAEIENVEQLCQTWLDTVQPLIQEEQKRLEEE
                     AQKAAEAEKAGEGEINEPKWLEVGQEEEASRREQEQGEQRENERKGEDAREEDEANKE
                     EKARREENSKQEEGKQGQAAGQDEETWEEKEARTQEGTGNEEEARKEAEVLSQEEASF
                     LASSCFVPPYIQISRSFPEDSKREEDKPVEKAREAEEAGKEQEEAGKDEEAKKEEESR
                     KEKEDIKQEETRKQENATPNVGRQEEEASTQDQPRQATHQEETEAEDKQGTVTDEAGA
                     TEPSSACTTKPHANQEFPKEPQKTPQSLPERPIELQRPAANGNGQASVSPRSLGSSLF
                     ELAENRLWQSQRRKNAYSDSWLSNGNDLRAPRERSASAGPVREEETDSKIEAPAAPTK
                     PKPVADSKTASAKTAQQNGGESDGQSRPTASPSRLPLQEPSTESSQGNEPVPDVGKLK
                     EPSEQQSFGALSAVRGPSPIKQLNKKPGGPTQIPVTVRPHRLVVGSLFDATQQLGDDT
                     RYGLKPNILFHPL"
     gene            445035..>445651
                     /locus_tag="THITE_2096963"
                     /db_xref="GeneID:11522767"
     mRNA            join(445035..445434,445497..>445651)
                     /locus_tag="THITE_2096963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656211.1"
                     /db_xref="GeneID:11522767"
     CDS             join(445151..445434,445497..>445650)
                     /locus_tag="THITE_2096963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656259.1"
                     /db_xref="GeneID:11522767"
                     /db_xref="JGIDB:Thite2_2096963"
                     /translation="MPVNGRKLRGIILLDLALLSGALGRPAVLARADNGGEISPPPRQ
                     TTAKDIVAALITIFIAVTIVAVLIRWLIRTASAQVQDLFHGLSDEDSDEPEFYQYPIG
                     KPPDPGPPVVPRSGMSASVSATSLPSPKGNTPRPVGPRGPSSGQ"
     gene            <446324..447974
                     /locus_tag="THITE_2096964"
                     /db_xref="GeneID:11522768"
     mRNA            join(<446324..446406,446989..447974)
                     /locus_tag="THITE_2096964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656212.1"
                     /db_xref="GeneID:11522768"
     CDS             join(446324..446406,446989..447811)
                     /locus_tag="THITE_2096964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656260.1"
                     /db_xref="GeneID:11522768"
                     /db_xref="JGIDB:Thite2_2096964"
                     /translation="MAPQQILSIDRSSHLGDFFRQPVQHERKTYFLAPSRDQAPTGAI
                     ALGNLIKSPRSPEFPLNDPKSPTVTRLQSTATVISETNATRTLSAKFSVQRSVFASFL
                     QGILGGQDPVHLELLAALFAEPSVQAALRDSRFTANLYLVTAVQIAHGADYVVARARR
                     RGTHVHLAADLLGPSAGTVPAGAGVQADVGGAAHVRSAGTVEGPFVFAYSLREVLYRR
                     KTVTEQRRARVKGDLYGIGEKAVRPVETGDAEYVAELAGLKDEDPELPGQWDLDVESG
                     LDMDGSECQIVRVDIGDGDSGYEDV"
     gene            <448835..>449296
                     /locus_tag="THITE_2033124"
                     /db_xref="GeneID:11522769"
     mRNA            <448835..>449296
                     /locus_tag="THITE_2033124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656213.1"
                     /db_xref="GeneID:11522769"
     CDS             <448835..>449296
                     /locus_tag="THITE_2033124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656261.1"
                     /db_xref="GeneID:11522769"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Thite2_2033124"
                     /translation="YEALSYTWGDASSPLSIRLDKQDFKVTANLHAALTVLRLPTEPR
                     ILWIDAICINQHDNAEKAFQVPLMGMIYSRAATVNIWLGPEEAGGGPNSIFDILDKTK
                     LAGVDGKRLQLRTRGRKRVTIETWKPRLAELKAFSSRPYWTRIWIIQEATLA"
     gene            <452825..>454186
                     /locus_tag="THITE_2091431"
                     /db_xref="GeneID:11522938"
     mRNA            join(<452825..453025,453143..>454186)
                     /locus_tag="THITE_2091431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656214.1"
                     /db_xref="GeneID:11522938"
     CDS             join(452825..453025,453143..454186)
                     /locus_tag="THITE_2091431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656262.1"
                     /db_xref="GeneID:11522938"
                     /db_xref="JGIDB:Thite2_2091431"
                     /translation="MDVTTSDDPSSRGNTPGETPQDPAFACQTPALTDSSSDFDLLSI
                     SDLSVSASLDRRNPTVQELESAVTSRRTQKRREGQGSGNAGEEDGDEPPPGPHRRKRA
                     KRRDPNNPPEKILACPFWKADPVLHRDCFSKILTRIRDVKQHLARKQSPKFYCERCST
                     IFEDDEQRRQHVEDPAGLFCTPSPHLAGLTHRQQALLTRKSNPKLTEEGQWFAVWDIV
                     FPGRPRPRSAYLDARHAAELWAFCEYCRAQGPAVLDEQLRVMVNAGAWTGPEALAGEE
                     RREILEWALDQGLEFLFGEWSRSWVAETGKSSAPLADSGGADGGVGPGAQQPRGGSPP
                     GIGGSGSGESVEEGSAGLEEVMEHSEERIRGPSPGSMAGSAAVDSDAVPDLDFSGWLW
                     DNIPRTDTSQGEGELIDLRAGL"
     gene            complement(<455333..>455929)
                     /locus_tag="THITE_2057134"
                     /db_xref="GeneID:11522939"
     mRNA            complement(<455333..>455929)
                     /locus_tag="THITE_2057134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656215.1"
                     /db_xref="GeneID:11522939"
     CDS             complement(455333..455929)
                     /locus_tag="THITE_2057134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656263.1"
                     /db_xref="GeneID:11522939"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2057134"
                     /translation="MPSFGDFIRTQWIIKIPRPSASFAAKTVVITGGNAGLGKEAAKH
                     IVRLGAAKVILGCRSLDRGNSAKREIEALLKCSPDVVEVWELDLESPSSVKSFADRAN
                     ALPRLDVLINNAGMQTQQFQVVYGTERMVAVNVIGTFLLAVQLVPKLRETARNFKTTP
                     HMTFVGSALYDVAKWPENHGGDIFAWFQDESHVNKMNQ"
     gene            <456386..>459038
                     /locus_tag="THITE_2091433"
                     /db_xref="GeneID:11522940"
     mRNA            join(<456386..456501,456625..457000,457065..457290,
                     457359..457390,457448..458926,458976..>459038)
                     /locus_tag="THITE_2091433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656216.1"
                     /db_xref="GeneID:11522940"
     CDS             join(456386..456501,456625..457000,457065..457290,
                     457359..457390,457448..458926,458976..459038)
                     /locus_tag="THITE_2091433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656264.1"
                     /db_xref="GeneID:11522940"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2091433"
                     /translation="MGSDMQVPQPKRAAEQSQQPQRRTRNRIPLACEPCRARKLRCNR
                     EKPCHNCTARNEQASCRFRGRKNGPNGSAPGAAEPAAHALRQRIDHLESLVQKLIDRN
                     PHAPLPSGGMVCTPESSHSESGSALSADASDPLHVPGAGKTVTDGVHSVYLGGDDWHV
                     VLEEIRELKQAWSQEDDGLSDHSATAPALSHPVDGSSLLFNQVKPLERIEILATLPPK
                     AEVDRLISYFFDRQAFPIRVPPILHEPTFRREYEEHWRDPSRTNFIWLGLLFSILGIA
                     MLAYHQHGEPPEYEGISESLFQLYRVRTSQCLLSGDISKGLPYTVETLRFNATAELNR
                     RDDNRRGLWLMSAVVVRAAINMGYHRDPSRIPGLTPFQAEYRRRAWLSVVSMDDMASF
                     LGGFPRMTAALCSDTAEPRNLHDWELSPDAAAPLPPSRPLTEPTPATYLIVKGRLLRA
                     LGRVADFHHGPPPLDTVKSLREVDRAVHDAYASFPPHMKLDLDLSASSTTTTTNNSIP
                     NTPWSQTAFTLLAMYHRGMCTLHRRFLARARRDPRLRFSRARCLASALALLALQRRVL
                     LLPPTAAAPAAAAGGGGGGGVPAAYAHWQMRQTMVLAAMVVVLELEVRRRFGDDQGEE
                     RQGEGRVDTAGERDVGVEVGVDGGEGDIPGTGVLLEALEGACACWAEAWRVCDDARRV
                     HEVLQRMLAGLRAGAGNGERTAEPVVPASLGARPDMSSPGLDAFERVPSFDMDFSNMD
                     LDWATWDAFLDNPDPNFETAPVY"
     gene            complement(459070..460857)
                     /locus_tag="THITE_2081080"
                     /db_xref="GeneID:11522941"
     mRNA            complement(join(459070..460119,460198..460265,
                     460347..460383,460468..460857))
                     /locus_tag="THITE_2081080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656217.1"
                     /db_xref="GeneID:11522941"
     CDS             complement(join(459238..460119,460198..460265,
                     460347..460383,460468..460647))
                     /locus_tag="THITE_2081080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656265.1"
                     /db_xref="GeneID:11522941"
                     /db_xref="JGIDB:Thite2_2081080"
                     /translation="MSATAPAPELNPNDNNAYLVYIPSAVFVVICPVLMAFRIWARLR
                     NGGKLGADDWTAILALIFTLLTSGFLVASCQYGMGRHWATLNKHEKFETNKYFYMAQV
                     TYKAAINLVKCCILLLYLRLFHVVQWFRLSCWALLAAVAMYCTASITATIFQCRPIAR
                     AFDKDDTPGTCIDTAKFWFANAGFSIATDVIILLLPMPLVWRLEVPTAQKAALAAVFA
                     VGIFVVVTSCLRATTLDLFATSPDNTYNIANVMWTIVEPNVAVVCSCLPILRPFVMGI
                     IPALRSRRGAGSRGLPSYGNGSAGTGTGTGAQKSRATQGSRSRSDGMGGGRGGGDWVE
                     LGGVAAARGGLRRPNSLTGSEEDMLAGTKGAVEVGGRGIHKTVEYSVQYSEEQQ"
     gene            462564..465415
                     /locus_tag="THITE_2069428"
                     /db_xref="GeneID:11522942"
     mRNA            join(462564..462774,462882..464106,465303..465415)
                     /locus_tag="THITE_2069428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656218.1"
                     /db_xref="GeneID:11522942"
     CDS             join(462673..462774,462882..464093)
                     /locus_tag="THITE_2069428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656266.1"
                     /db_xref="GeneID:11522942"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2069428"
                     /translation="MAFLDRINISNASIQGMTAELHLDEGNRFNVALFAYYSSYILLE
                     IPSNMIIRKVRPSLYISGLMFIWGIINMCMGFVHSYAALVALRVLLGAFEAGVLPGIV
                     YVSSLYYKRHEYQKRMSFFFCSTVVAGAFGGLLAYAIANLGTPTMAPWRWIFIIEGAI
                     TSFLALVAAFIIADWPEQTRYLSADEKALLRRRLAADVGDACRMDTLNAFALARIVRD
                     YKIWLAAFLYMGVSVAGLSGTFFLPTILLEFDWKAQEAQVRTIPVYVLAAGMMVLGAW
                     ASDRLRHRSGFILGGAALATVGYAMLLAQEGKSRDYKFAAVFLVFGGAYMITPMCLAW
                     LQNNVSGHWKRAFAASAQVTIGNVAGIIGAFIFIKSEAPTYKTGYGVALGMMWLGGLC
                     TVVMAGLMWRENRKRERGERDYRLALPEEDRNNMGDWHPSFRFTL"
     gene            <467584..>469004
                     /locus_tag="THITE_2146815"
                     /db_xref="GeneID:11522943"
     mRNA            join(<467584..467739,467802..468026,468092..468127,
                     468286..468504,468585..>469004)
                     /locus_tag="THITE_2146815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656219.1"
                     /db_xref="GeneID:11522943"
     CDS             join(467584..467739,467802..468026,468092..468127,
                     468286..468504,468585..469004)
                     /locus_tag="THITE_2146815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656267.1"
                     /db_xref="GeneID:11522943"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Thite2_2146815"
                     /translation="MKTCNFAAALLAVAPAAVAGWSWAQGKSINFTSVPGYFVQDDEA
                     TDPTGFDYAAVNFGLINRTYPTDKRLTAAKNKTQWQRFEAFVKDLNSGCHRKANVQYK
                     VLFIGRHGEGWHNAAESFYGTPAWNCYWAELDGNGTAAYKANAYFKDRYETQKMPYFQ
                     SYYTSPLSRCTVTANLTFADIHLPAEHPFIPTVKEGFREGISIHTCDRRSNKTYISHM
                     FPTYKFEPGFSETDQLWRATEEETDAALAQRAKAVLDDVFRTDKNTWISITAHSGIAG
                     ALLAALNHRPFSLSTGQIIPVLVKAEAVDLRPTPTVQPYEPSATCRAPPVTSNASQGC
                     VCASTTAALPRATTGEP"
     gene            complement(<469842..>471292)
                     /locus_tag="THITE_2091437"
                     /db_xref="GeneID:11522944"
     mRNA            complement(join(<469842..470146,470217..470420,
                     470506..470634,470701..470823,470897..471037,
                     471142..>471292))
                     /locus_tag="THITE_2091437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656220.1"
                     /db_xref="GeneID:11522944"
     CDS             complement(join(469842..470146,470217..470420,
                     470506..470634,470701..470823,470897..471037,
                     471142..471292))
                     /locus_tag="THITE_2091437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656268.1"
                     /db_xref="GeneID:11522944"
                     /db_xref="JGIDB:Thite2_2091437"
                     /translation="MDFFAGLSSVGLHPADGDDAAASLSRLPSWVGRQPNGFPLCGRA
                     GSTPPVEIKLEPPCTPCRLPGASPCAHCASLDERRAPASTKLGSYPGTDELSPYIKKE
                     PLSSSPLPGRTSSPAGPRTPVSTGQGVVVKWSKPSPEVKNEPPSSSPLFGRHCMPSAP
                     HPPADAVRRANLRIKSRSPSPPIKTEPSDHSAAAKPGLTPPPPPPPPSSPPSPSTAPA
                     PSPAQAAPPARPPSPNWAQRLRPRRWHQTHPAVAVAVVVAAESGGRGRLHCWGGCGGG
                     GGVRAAGGAAGEFGCPGAPGGGGVLAERSAMDEVLPSTGVDEEEVEVYVEEELGKGQE
                     GGGGGDLEVWRWVEGD"
     gene            <472778..474345
                     /locus_tag="THITE_2155971"
                     /db_xref="GeneID:11522945"
     mRNA            join(<472778..472970,473039..474345)
                     /locus_tag="THITE_2155971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656221.1"
                     /db_xref="GeneID:11522945"
     CDS             join(472778..472970,473039..473925)
                     /locus_tag="THITE_2155971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656269.1"
                     /db_xref="GeneID:11522945"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Thite2_2155971"
                     /translation="MSAPIRVAVLDDYQGISEPKFKALDPSKYEVTFFKDTLLPYNHP
                     DTPQDVKDKLVARLEPFTVISTMRERTPFPRELIARLPNLKLLLTTGNRNLALDLGAF
                     AERGIPVAGAVDRAHAGSVGSVSTTEHCVALILAAARNLAQDDHVVKSGGWQTVPAVS
                     LAGKVFGAVGLGRLGVAVARIMRVAFGMRVVAWSENLTQEKADEKAREAGLPVEGEDG
                     EKTFKVVSKAELFRTADVVSVHLVLSDRSRGVIAGRDLEMMKPTAIFVNTSRGPLVVE
                     KDLLDVLEQGKIRAAALDVFDLEPLPLNSRWRTTKWGQDGRSQVLLTPHMGYVEEATL
                     DAWYDQQVENLLRWEKGEKLVQTLY"
     gene            <474521..>475800
                     /locus_tag="THITE_2131481"
                     /db_xref="GeneID:11522946"
     mRNA            join(<474521..474602,474667..474720,474773..>475800)
                     /locus_tag="THITE_2131481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656222.1"
                     /db_xref="GeneID:11522946"
     CDS             join(474521..474602,474667..474720,474773..475800)
                     /locus_tag="THITE_2131481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656270.1"
                     /db_xref="GeneID:11522946"
                     /db_xref="JGIDB:Thite2_2131481"
                     /translation="MELVPYNDKNEGSQAVPPFPVATRGPEGYPTWPYPPLNQHSAET
                     YRQPDEFVPSTPFPPAPYGPRPLNGPSTASFGSILPAGPVQLAPPMPWGPEPQQGTVQ
                     GHFSQAIVPVGQQGANTGEYPHGHGYGGASIMPRSGRRPRRRASTATAPNTLPLGRTA
                     GVLELLTKECQARGFNPEWKIDRLGDFKYTCRVMLWDQEVQGNGEYYDPVEAKRAVAA
                     KALDIVRFWPPGQLPPPQASRSWAPPPGNHPAIKDEEQSTMPALPWHQPAEHPSQPAG
                     RVHRVRRAMTTSRPARSNDDASLVQAFLDGMAAGARIRENDSRARRSRSASPRATSRT
                     LDGRRVRSSQRDRHRSNANPSSRRGEGRPRADKYRPNYRSGTEGQWVHDRYRP"
     gene            complement(476414..477550)
                     /locus_tag="THITE_2120692"
                     /db_xref="GeneID:11522947"
     mRNA            complement(join(476414..477246,477313..477550))
                     /locus_tag="THITE_2120692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656223.1"
                     /db_xref="GeneID:11522947"
     CDS             complement(join(476496..477246,477313..477350))
                     /locus_tag="THITE_2120692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656271.1"
                     /db_xref="GeneID:11522947"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2120692"
                     /translation="MKISGRTFVVSGGASGLGRACVREICAGGGNAAILDMNEELGST
                     LAGELGASAKFVPCDVSDTSSVAAAVQAAVAWAAETGKPLGGIIPAAGVGSAGLILDK
                     QRQPLALEAVDFVLAINVRGTLDVVRQALPHLAAAAPEGADGERGVVVMVASVAAFEG
                     QMGQVAYAASKGAVAAMTLPMARDLSRFGIRVVTVAPGPFDTAMTAVMSDKVREGLRK
                     AVEFPARSGRPEEFAALVRHAIENVMLNGVVIRLDGASRMPSKL"
     gene            477666..479533
                     /locus_tag="THITE_2120693"
                     /db_xref="GeneID:11522948"
     mRNA            join(477666..478115,478193..478322,478420..479533)
                     /locus_tag="THITE_2120693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656224.1"
                     /db_xref="GeneID:11522948"
     CDS             join(477988..478115,478193..478322,478420..479148)
                     /locus_tag="THITE_2120693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656272.1"
                     /db_xref="GeneID:11522948"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2120693"
                     /translation="MTRPRRSSATSEDSMGTAREQELGSMYDYLAKVILLGPSGTGKS
                     CLLHRFVKNEWRVLSSQTIGVEFASKIIKVGTGARRKRIKLQLWDTAGTERFRSVSRS
                     YYRGAAGAILIYDITSRASFNSLQPFLNDARALASPNLSLVLVGNKLDLAGDPLVDAG
                     LPPPTPSASSTVSSSASVAASHSSTSTIHPGLGAQLRATVAPDGREVSAVEASRWAST
                     VGIPVTVEVSAFSGEGVDEVFARLARMILAKIELGEIDPDDPMSGIQYGDAGAMWSAG
                     ASDGGSIKSTVTADEVGPGGRRRRRARRGGQGLREWEEVFTLTNRRRNRGCC"
     gene            480144..483164
                     /locus_tag="THITE_2120695"
                     /db_xref="GeneID:11522949"
     mRNA            join(480144..480939,481002..483164)
                     /locus_tag="THITE_2120695"
                     /product="glycoside hydrolase family 2 protein"
                     /transcript_id="XM_003656225.1"
                     /db_xref="GeneID:11522949"
     CDS             join(480436..480939,481002..483053)
                     /locus_tag="THITE_2120695"
                     /note="CAZy_ID 269769"
                     /codon_start=1
                     /product="glycoside hydrolase family 2 protein"
                     /protein_id="XP_003656273.1"
                     /db_xref="GeneID:11522949"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="JGIDB:Thite2_2120695"
                     /translation="MAPRLVIPVDKNWEFRQADKEGAQFLPVSQFPTNVHLDLQHHGL
                     IPDPFVGKNELAVQWVGEAQWTYRTTFASPAVPAGAKAVLAFDGLDTFATVLLNGTTV
                     LKTDNMFTPERVDVTSVLKEENELVITFDSAFLRGCKLVEEHPDHKWGCWNGDTSRLA
                     VRKAQYHWGWDWGPTLLTCGPWRPIHLEIYESRLTDLYAETIVDKSLVRANVTVTATV
                     EGRADKVRFDVSLDGQPVASETTDASSGTAAVSFLIDNPALWYPIRYGKQPLYTIRAT
                     LLSGEEEADTTSKRIGLRRAELIQRPLKEQPGTSFFFEINNVPVFCGGSDWIPADNFI
                     PRISREKYYDWVKLVADGNQFMIRVWGGGIYEEQAFYDACDELGILVWQDFMFGCGNY
                     PAWPELLQSIDREARENVKRLRHHPSIVIWAGNNEDYQYQESEGLTYDYANKDAESWL
                     KTDFPARYIYEKVLPEACAELTPNTFYHPGSPWGAGRNTRDATVGDIHQWNVWHGTQE
                     KWQNFDKLVGRFVSEFGMQAFPSVKTIDAYLPLGKDDPDRYPQSSTVDFHNKAEGHER
                     RIALYLAENLRYAPDPLEHFVYSTQLMQAECLASAYRLWKREWRGPGREYCGGALVWQ
                     INDCWPVTSWSIADYYLRPKLAYFTVKREMAPVSIGITRRTHLHPRDKYTRVNIDVKT
                     QIEVWGSNLTLEDLTVDCVLKAWDVETGEETFSQTLAAGKLLPENRSTEIAALDVPVR
                     KRNVGEESRIVVAAYLIREGKQIARYVNWPEPLKYVHLQKPKALKAQLTADHAAVEIS
                     AEVPVKGVALECEDDGVKFDDNLVDIVPGEVVTIGVSGASAETRIETRYLGML"
     gene            complement(483165..484541)
                     /locus_tag="THITE_2120696"
                     /db_xref="GeneID:11522950"
     mRNA            complement(join(483165..484343,484423..484541))
                     /locus_tag="THITE_2120696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656226.1"
                     /db_xref="GeneID:11522950"
     CDS             complement(join(483276..484343,484423..484431))
                     /locus_tag="THITE_2120696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656274.1"
                     /db_xref="GeneID:11522950"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2120696"
                     /translation="MASNLSFVLNKPNDVTFEERPVPKLQSPHDVLVAVNYTGICGSD
                     VHYWQHGAIGHFVVKDPMVLGHESAGTVVEVGAAVTTLRPGDRVALEPGYPCRRCANC
                     LAGRYNLCPDMVFAATPPIDGTLTGFWVAPADFCYRLPDGVSLQEGALIEPLAVAVHI
                     VRQARVQPGQSVVVMGAGPVGLLCAAVARAFGASKVVSVDIVQSKLDFARSFAATHTY
                     LSQRVPAEENARRIVAEAELGAGADAVIDASGAEPSIQASLHVVKVGGTYVQGGMGKA
                     DINFPIMALCLKEVTARGSFRYGSGDYKLAIELVATGKIDVKRLINGVVAFKDAEEAF
                     KKVKEGQVIKILIAGPNEKVDQSS"
     gene            486589..488349
                     /locus_tag="THITE_2120698"
                     /db_xref="GeneID:11522951"
     mRNA            join(486589..487110,487173..487511,487564..488349)
                     /locus_tag="THITE_2120698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656227.1"
                     /db_xref="GeneID:11522951"
     CDS             join(486850..487110,487173..487511,487564..487959)
                     /locus_tag="THITE_2120698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656275.1"
                     /db_xref="GeneID:11522951"
                     /db_xref="JGIDB:Thite2_2120698"
                     /translation="MSLLEHARALSRDVFIYDLRDFDTLLGGLSLNAGVTNANFYAMA
                     EIIIEISPPGPFFLQDENGETVAQDTQPLRPGRYFVVADGTVKQTTEVPLIRLRSFPT
                     GSRVQAFTNEVRERDGGCAVSKTENRAKQFDFWKGFEAAHIFPLAYEKQWNDQGWSRQ
                     ITILPTRRTHGTINSVQNGLLLRNDIHDLFDAYAFSINPDDGHKIVFFQPDNYHLSGT
                     FLDARFLDDPRRPPDSLLRWHFRQAVLTNMRGAGEPNFEHDFPPGSDIMGEIRRGPKA
                     AERMEFELFDRLAHHMDIYSEEQQADVDTDEDEHEVSTDEDEHDGNVSTSASSID"
     gene            complement(488119..488228)
                     /locus_tag="THITE_t141"
                     /db_xref="GeneID:11522952"
     tRNA            complement(488119..488228)
                     /locus_tag="THITE_t141"
                     /product="tRNA-Leu"
                     /note="Anticodon: CAG"
                     /anticodon=(pos:complement(488192..488194),aa:Leu,seq:cag)
                     /db_xref="GeneID:11522952"
     gene            <488600..>490231
                     /locus_tag="THITE_157502"
                     /db_xref="GeneID:11522936"
     mRNA            join(<488600..488629,488714..489929,489984..>490231)
                     /locus_tag="THITE_157502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656228.1"
                     /db_xref="GeneID:11522936"
     CDS             join(488600..488629,488714..489929,489984..490231)
                     /locus_tag="THITE_157502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656276.1"
                     /db_xref="GeneID:11522936"
                     /db_xref="JGIDB:Thite2_157502"
                     /translation="MATPAARSYNDAIDALNSLQTPYAVIEARRKAGIRPDAASLREM
                     RGYLARIGYSPRDLDRLNIVHVAGTKGKGSTCAFVDSILARYRARDGGRPPRSVGLFT
                     SPHLIAVRERIRINSAPISEELFAKYFFQVWDRLEANAHVAADEAAPGSKPIYARYLT
                     LMSFHVFLSEGVDVAVYETGIGGEYDATNVVERPVASGISTLGIDHVFVLGDTVDKIA
                     WHKAGIMKHGSPAFTVEQVPAAAEVLTRRALEKQVDLKVLDIDPRLTAAKIRPDAKFQ
                     KKNATLAVALAETALRKLDPSFAPDPARLPREFIDGLEQVVWRGRCEVKDGDCVIWHV
                     DGAHTVDSLKMAARWFVGECAGRAEGGGPKVLIFNQQGRAEAVDFLDGLCHTVKNGDP
                     SGKGFEHVIFCTNVTYATAGYKRDFVNHQHDPAEIEKMTMQRVFADKWRALDPSANVM
                     LIPSIEGAINTARSFAKEGGPKAQVLITGSLHLVGGALGILEGADAL"
     gene            complement(<490390..>492336)
                     /locus_tag="THITE_2096971"
                     /db_xref="GeneID:11519209"
     mRNA            complement(<490390..>492336)
                     /locus_tag="THITE_2096971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656229.1"
                     /db_xref="GeneID:11519209"
     CDS             complement(490390..492336)
                     /locus_tag="THITE_2096971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656277.1"
                     /db_xref="GeneID:11519209"
                     /db_xref="JGIDB:Thite2_2096971"
                     /translation="MRPLPCRITTQLSPRNPAALLKPTAAFLTSRSHSPIRNFGSHHY
                     NRPKMASTDDDQAAADYAAALARLAQLQSNRAVTSLFDKAPAPPAGTGTGSGTGTGTG
                     SDTDKPAAPAAADLNALAIPEMLAWLRRAGYSGSSLADAGVRCVHVAGTKGKGSVSAL
                     IAAILAQYGTARTGAGTGAGAGTEAGDVQARGVSVGPVGLYTSPHVLSPRERIVLDGE
                     PLAPARFARYVEELWARFTRAARDEAAAAAARRGGPLGAGSSNGDDAGGGGGEAAGGL
                     GSLSEAELAELDGPATKPFYFRFLTILALHVFLAEGARSAVVECGIGGEYDATSALLL
                     PPSDGGDGAVSAAVVTQLGLDHVGMLGDTVEKIAWHKSGVFKPGVKAFTRRLPAAQAG
                     VMEVLRARAREKGATLVEVRDEDVEAWGGVEGARLQGPFQKHNMALAVHAAREHLLRI
                     GVRFEGRFGTDEWSLSDIPPEFVRGLKEASLRGRCEVFEDADGVMWHLDGAHTDDSLA
                     GVGRWFAGRTRGDSVRVLLFNQQERDPGPLLGALFAGAQAQQDTDGQPVFTHAIFTRN
                     EEQKPADGEERDLSAQTKAAAAVRDLGTTTQVTVRDAVQTAVNEVRAIAAQARKDGKS
                     CQVLVTGSFHLVGPVLKTISNVEC"
     gene            complement(492798..495235)
                     /locus_tag="THITE_2120700"
                     /db_xref="GeneID:11519210"
     mRNA            complement(join(492798..492915,493018..494952,
                     495035..495235))
                     /locus_tag="THITE_2120700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656230.1"
                     /db_xref="GeneID:11519210"
     CDS             complement(join(492871..492915,493018..494952,
                     495035..495148))
                     /locus_tag="THITE_2120700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656278.1"
                     /db_xref="GeneID:11519210"
                     /db_xref="JGIDB:Thite2_2120700"
                     /translation="MLRTSLRSVRALGNRPAAAAAGRQWQVSAARRAVVSGQRSYADN
                     KKPADQAKLPASETLTAPSTAPPPPRQTETVASSTIPPENAPLTPPAPGPAVTSETAA
                     KTTPPAPPPTPRKKKGFFRRLRNYILTLTLLSALAFGGGVWYSRINDNFHDFFTEYVP
                     YGEQAVLYLEELDFKKRFPNVASRVTGRRPDGEQVKIPAQSGASWRVADGSESAGRQS
                     SAIQKEAVTKAAKTKGEPAVVTEAKKETATLPRAEATTNEAELQKPVPAPVEKKPKPE
                     PAPTPTPTPAPVPVVPAAEPAPAPAPASAPAKQPFKAPEVDEPSRWPPASPIDPLAVP
                     DAAEPVVQDLVHMLNDIITVINHDGASEKYAATIGKAKDELSKVGGKIRDLKTAVEQD
                     AAKQVRQRVDDFDRAANELVSRLEAVMTAQEQQFRREFEAEAARLRQSYDSKVRLIQE
                     RERQLAEAKLGNQLLEQAIQLQRQFARDVQQQVEEERDGRLGKLQELSAAVASLEQLA
                     AGWNNVIDANLRTQQLHVAVEAVRASLEDARHPRPFVRELVALKEIAAQDPVVDAAIA
                     SIPPAAYQRGVSTPAELVDRFRRVAAEVRKAALLPDDAGVASHASSYVLSKVLFRKQG
                     LAAGDDVESVLTRAQTFLEEGDLDNAAREMNGLSGWAKTLSRDWLAEVRKVLEVRQAL
                     EVIQTEARLQSLKVE"
     gene            complement(495501..496987)
                     /locus_tag="THITE_2069455"
                     /db_xref="GeneID:11519211"
     mRNA            complement(join(495501..496270,496330..496521,
                     496572..496618,496669..496987))
                     /locus_tag="THITE_2069455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656231.1"
                     /db_xref="GeneID:11519211"
     CDS             complement(join(495923..496270,496330..496521,
                     496572..496618,496669..496741))
                     /locus_tag="THITE_2069455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656279.1"
                     /db_xref="GeneID:11519211"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2069455"
                     /translation="MATRGPPGARAMNTRFAQFKLVLLGESAVGKSSIVLRFVKDQFD
                     SYRESTIGAAFLTQTISLDENTTVKFEIWDTAGQERYKSLAPMYYRNANCAVVVYDIT
                     QATSLDKAKSWVKELQRQANENIIIALAGNKLDLVAEQPDKRAVQTADAEAYAREAGL
                     LFFETSAKTAENVQELFTAIAKKLPLDQVGPRHTRPGQRPGVSLAPEGSNTQVAGPCA
                     C"
     gene            497282..500049
                     /locus_tag="THITE_2120707"
                     /db_xref="GeneID:11519212"
     mRNA            join(497282..497714,497774..499512,499574..500049)
                     /locus_tag="THITE_2120707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656232.1"
                     /db_xref="GeneID:11519212"
     CDS             join(497507..497714,497774..499512,499574..499744)
                     /locus_tag="THITE_2120707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656280.1"
                     /db_xref="GeneID:11519212"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="JGIDB:Thite2_2120707"
                     /translation="MAFPFRDINVQTASDSYIFSSPSSPNAPVLSIDRPTGDIRLSDA
                     SLLTGKRVSRVTSIAGILGMIRLRLDKYIIIITKVKPVGRLRGHMVYKVAATELLPLR
                     ERQVHDPDEDNFLALLRSFIKSGPMYFSYSIDLTNSFQRQAQQDNASPLWKRADDRFF
                     WNRFIQSDLIDFRTLGGRGQPPPQPGIDPYILPVIFGMLEIHPTTFKGTPLTIALITR
                     RSRHRAGTRYFTRGLDDEGHVANYNETEQILVINDTAAGLGGSVGSAGPAWQRNTSAE
                     SKDMQILSYVQTRGSVPAYWAEVNTLKYTPKLQIRAVEAAFPAARAHFDEQIRIYGDN
                     YLVNLVNQKGREMRVKQAYEQIVEMLVSSPKEHTQADQRTDEKFHTIETGGPQRSHFD
                     RLHYIYFDFHAETKGLQMHRAQLLIDRMHEALLAQQYFRAADMPGSRIDGRLEVRSLQ
                     TSVVRTNCMDCLDRTNVVQSMLARWTLDRMLIDLGLLARGARFADEDPAFELLFRNLW
                     ADNADVVSRSYSGTGAMKTDLTRLGRRTKAGALQDANVAVTRYCRNNFLDGPRQDAFD
                     LFLGAYQPPAGGIGTSFIFADRRPVWIQSVPYIAAFGFFFVLVALYTPRLPDAAVWPL
                     RLVTIFWAVVTAWCLHFILSNGMLYVNWPKLNPRPWATEGYHETISRVRKDRILGPLV
                     ARHERGLSTARYINAEEGKKRIE"
     gene            complement(<500304..503612)
                     /locus_tag="THITE_2155981"
                     /db_xref="GeneID:11519213"
     mRNA            complement(join(<500304..500328,500466..503612))
                     /locus_tag="THITE_2155981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656233.1"
                     /db_xref="GeneID:11519213"
     CDS             complement(join(500304..500328,500466..503485))
                     /locus_tag="THITE_2155981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656281.1"
                     /db_xref="GeneID:11519213"
                     /db_xref="JGIDB:Thite2_2155981"
                     /translation="MESARIVNMALNLSQSRRLASRGNLSQPTPPRLAPLPDNAPGGS
                     LRYHLQQQRKMSRTVSPKPDRSPRIGGGRSFTPLQPAFEPGAAYRYHFSQSTLARAQK
                     AKEYLELMAQYRRVLDLVAPLEPERTTRPWSTPPSTPSGSAPVSRVPTGEPETRIGRP
                     YNPLQYIRNRKVRARERKAIDGAAQGFSDVLKVSEWIDEVAKWVATGQARLPGNPALP
                     PFPSAQAAALQASPPTNARTSTVMKPRRPRVDWVIDPADMLADVYWLELDDNKKLVED
                     RHWRRVFPQAPDVPQPLSRDEMPRLATSGSALDSSEALAPDEKATPDPPLSRHEHEHV
                     FSAARDRAQQKLRALKGSHHRQTSSVTNRDILRLRRGSLSESSDTDSDRRRRAKGGPG
                     GSSTVRSVLEKQMEEMIAQEQREAASHPLYDHETQRIHFTPMTPEREARQPSQELDNR
                     LRADSRAELSEAEAQGLGLKPLPPARSTPPQPRGGTSLEVPGSRRLSVEGDASQLNSP
                     NLRPTNDVGPVPAIGMDLSPVSSRPSSPHRNPLSKVKSMFRDRSKERPSDTQPAGEDA
                     VLSLGPPDDAWIGTPATAGSNVSSPQRRRSRSPAGERVMGHRSHKSIGSARVRGEDGG
                     LSLRSLLRGPRIDTVLRSGVSKVSDMLWRRDAGDDQSSTTSTDDSDSESRGRSRGPRH
                     GRHLSAEDATALREAGSQLTPDYAKSGHLQHPPAKPISRRSSRFDLLKPPRIDVQSAS
                     PSQSPPPPLVVVQPHEPVGSDAESQAGRDDVRAAAARLDAALTLPHAPRGSTSSSSRH
                     WSMSDRDASTGPAVSKREIARLHALLLSAGIHAAEMDRRAKQRKLLPSPLPATAKITT
                     TTTTTHDPPPPTWQDIARLAPDAATRHHLLTTPLSQTDMYPLAARALASSVSSSAAHL
                     DAQAARFAADAAPALLRRAEALRAKVAGELTSLAQNAADAADDAGHDLTVAQRLKVKR
                     VADAMDKMLRRRRRRFRWVRRAGWLLVEWLLVGAIVSLELDC"
     gene            complement(<504728..>505823)
                     /locus_tag="THITE_157496"
                     /db_xref="GeneID:11519214"
     mRNA            complement(join(<504728..505567,505647..>505823))
                     /locus_tag="THITE_157496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656234.1"
                     /db_xref="GeneID:11519214"
     CDS             complement(join(504728..505567,505647..505823))
                     /locus_tag="THITE_157496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656282.1"
                     /db_xref="GeneID:11519214"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Thite2_157496"
                     /translation="MSISGSIPEPNIPDYYADLGVSQHASSKEIKDAWRNGAMRYHPD
                     KMAPGKTIDAKEFRKIREAYDHLRDETKRARYDAHYPEIRAQWAQYRKQQAAVQQQQE
                     QRAAPTQEEIRQRRDAEREKAEEAARRRKEREERERQAEERSREAARKAREEQERAWE
                     RLRKLKKEEEEEEKEKRRVQEELRRKEAEAAAAAAAAAARERAQREAAAREQQQARRE
                     RLREAERRSEEAARKARAEQEQAARERVRTAQIEERQEDLRRRWAGLRESRHAGGARQ
                     QQPEQPRTAGQCVRPGIGWARRNGRTTCVFCGVVRRKFANVCLGCLVVACPDCMAKHC
                     GGKH"
     gene            complement(506079..508099)
                     /locus_tag="THITE_2120709"
                     /db_xref="GeneID:11519215"
     mRNA            complement(506079..508099)
                     /locus_tag="THITE_2120709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656235.1"
                     /db_xref="GeneID:11519215"
     CDS             complement(506423..507985)
                     /locus_tag="THITE_2120709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656283.1"
                     /db_xref="GeneID:11519215"
                     /db_xref="InterPro:IPR005373"
                     /db_xref="JGIDB:Thite2_2120709"
                     /translation="MSSLFSAQLHPGRALGFLVLGASLHDVLTRLKAEPQRFPKLDLV
                     YSPTEPVKEPVVLGLPANGIRLRFDGPEQRLRLIEILDFTKNHIFLKPANDKERDLVR
                     PTSTASEATAPADAAPGPTFRHIYQRFLGPTYDGEYVPDAETYVLSYPGVAFTFPMRR
                     KDYSPAKDVVSLLSSTAIPSSMAVFSGDSWAQARETMWTEILPSLKTFAPLAKGKDVF
                     PDEVSLVKIHGGGKLQLFRKWTNASFWIMLGETTPQQLVAELGPPDAIYRKNDQRMYI
                     HKLRAASNTMARPSGNDLKRQDDLTDTDQSSHPASDEYDSNDEAVEDSTVANVSGECF
                     YNYFYLGFDVLVSTPTTPCRPPPSQVGNPSIPEPPFRSTHADRLVATKVILHGNVPGS
                     YPFNRHRRCRWEISYLQEPSDAAAATTTTANSEMPFPEIEARLREEWKSIYPSEAEAR
                     QKQRGMVLNRGWGDSPGSSCELLGGWEESGGTNPGVGKGRGEESTTTLYGFPGLVFEV
                     LKNGYVSAVTVF"
     gene            508491..512831
                     /locus_tag="THITE_2120711"
                     /db_xref="GeneID:11519216"
     mRNA            join(508491..509176,509225..511381,511435..512831)
                     /locus_tag="THITE_2120711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656236.1"
                     /db_xref="GeneID:11519216"
     CDS             join(508724..509176,509225..511381,511435..512439)
                     /locus_tag="THITE_2120711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656284.1"
                     /db_xref="GeneID:11519216"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Thite2_2120711"
                     /translation="MAPPPARAAAGGRASIRPGVRNTAAASRAGATRQPLGASRLARA
                     PSPAESLVSVATATTAGAKRKERDFDPDDGEATNINVVVRCRGRNEREVKENSAVVVR
                     TEATKGKLVDLSMGPNAVSNKTYTFDHVFSQAADQSMIFEDVVRPVLDEMLAGYNCTI
                     FAYGQTGTGKTYTMSGDLTETMGMLSDNAGIIPRVLQALFNKLELDEKENSVRCSFIE
                     LYNEELRDLLAADENTKLKIFDDTSRKGHATTVVQGMEERYIQNASEGLRWLREGSVK
                     RQVAATKCNDLSSRSHTVFTITVYTKHKTENGEDFLMLGKLNLVDLAGSENIQRSGAE
                     NKRAAEAGLINKSLLTLGRVINALVDRSAHIPYRESKLTRLLQDSLGGRTKTCIIATI
                     SPAKSNLEETISTLDYAFRAKNIRNKPQLNALTSKKMLLRDFTIEIERLKAELIATRQ
                     RNGVYLSNDMYEELTVQNESRRILTEEQAAKIETLETNLRNKVQELLSLTSNFMGLKK
                     EHEGTLAQFEETKELLDQTEIVLAATKKSLAEETHLRKAHQATEEALAAVGGDLLSTL
                     ERTVCDIDGLHSKNRRRSELHNLNRSTWNMSQAHVADITELVEDRIAEFRQDQEERIS
                     SIAQRMQTFVKEELEKMSSTQIFLDENLAQFAESRTQLLGQQERSKEEMDGVLEEIRV
                     VRDNVKQRVGESLQAIAAAAERIAGDVLGELNTFHSQLHLSYNSLGKDFKSLFEELLR
                     HIRAQKAESDRLRAELEEAAKAMVESNQSVSARIQEVLDEERAQAATERQALLSQITR
                     LINSQAELQESRLADKAALLQETMADSSKMFEGSVAEYSAGMDAWGERDEKLLEEVAS
                     SKDTLKTKLKDDWTAANKHSTAIQTATKSVHAETVRVVEEQIQDLDVQMQDLDEFVAR
                     AKSHNAGHHERHAESVQKLSTTVKRSFANISDHFKETFGRVQALGAEMDADADALRDA
                     LAPLDEKVCQPLAELREDVQNTQLREYVPTGQTPEKVHYQYPTELPRTAAHADLLASM
                     QDSEPDHDPAPAPALSPTPCRPAGPVVLPDIDMTPVRSPSRPASTDSQHHQQQQSGGD
                     GSVGSGSSKSRLSMSLREVNPNLTAGSLVFDAAAAAAAAAAGAGTARGSLPGGGPLPS
                     SAAAAAATGETTVPLAKNTRTRGASRLSKKVVGAIADGPENVPPPLRSSTRRKSPRLH
                     "
     gene            513449..514551
                     /locus_tag="THITE_2120713"
                     /db_xref="GeneID:11519217"
     mRNA            513449..514551
                     /locus_tag="THITE_2120713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656237.1"
                     /db_xref="GeneID:11519217"
     CDS             513637..514533
                     /locus_tag="THITE_2120713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656285.1"
                     /db_xref="GeneID:11519217"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2120713"
                     /translation="MSSSSSSPAKPAHPDLTGFRALSFDCYGTLIDWEAGLQADLSPL
                     LAALPPTHPWRATPLLALQHFNALSEHLEQAQPALAYDDILAESLRLLAAEQGVRLDE
                     LDDEEAAAALRGERIRDGPGRWPAFADTVAGLRTLGRHYRLVVLSNVDEANIGRAAGP
                     GGPLAGARFDAVYTAQAIGSYKPSAANFRFLFERVRREFGVDKEKGELLHVARSLTAD
                     HVPAKELGLRSVWIARGGDRPENYGTGGDYAKLKAEGKLGFEWTFQTIGEFAEEVERQ
                     FAAKKKKEETQAEEGVGQQAGR"
     gene            complement(514552..516794)
                     /locus_tag="THITE_2120715"
                     /db_xref="GeneID:11519218"
     mRNA            complement(join(514552..516354,516432..516794))
                     /locus_tag="THITE_2120715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656238.1"
                     /db_xref="GeneID:11519218"
     CDS             complement(join(514570..516354,516432..516683))
                     /locus_tag="THITE_2120715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656286.1"
                     /db_xref="GeneID:11519218"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2120715"
                     /translation="MIPIKPEPDLDSASATSDLHSLDSETLHETRPNRWRGHPSTWQG
                     WTERDRETWTALENARRGDLAVHLYNACGLKRGWRAGPVQDGDGNGDDDGAGKGWKPD
                     KGWTAWPMKADEVPDDGLLPRAADVNEPFTLRREDRARSFAGCNLEEEISAAMLRCAK
                     ERFRRRGLQRGAAGGSAPGVVVQSVEKDDANATATEGETDASGTAATSAKDEDDTDAD
                     ALARVLRRKRRRAVSPTFTPVLSADDERSSALLRPLARRIMAQLDDTLMILHNQRVAG
                     LGCMSESSASDDDETGVESVPQRAAKSPPPRRYRGGRPKKVHVPREGETEREMLVRLA
                     REGKRKIPTFSSDESEPGRGERSRGRTRSVSSKRRAASASSQAASRSEKSRSRSSSVS
                     SELNREKRLSRWGLRDWRDVLGAAALAGFSPATISRAAQRCATLFREEITMHTLHEQS
                     AASERPAVETVRYVPGAPLPPSSDEETESEEELLQLRTVSRQSSLRPAGASSPEPERE
                     VRRRSRSGTPGILVCPHPGCPRAAEGFRKRSNLERHIRTVHKDQTADYTDYTDAELTE
                     AGRTPRRRSRSATPGGTVHLCHYPHCPRAVEGFRKRSNLARHLRSVHGKRAADFAEDE
                     EDTMDEMDGGVHVDGFLRPIKVRKGWRGDDVQPRPPRSRKRARQGSEELDSFLS"
     gene            complement(<525144..>525416)
                     /locus_tag="THITE_2057533"
                     /db_xref="GeneID:11519219"
     mRNA            complement(<525144..>525416)
                     /locus_tag="THITE_2057533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656239.1"
                     /db_xref="GeneID:11519219"
     CDS             complement(525144..>525416)
                     /locus_tag="THITE_2057533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656287.1"
                     /db_xref="GeneID:11519219"
                     /db_xref="JGIDB:Thite2_2057533"
                     /translation="IYVYIDDIIIASKNIEEYLKYIKTVLNIFNKVYIYILVEKSFIA
                     YLLVRLLGYIVNGEGVAKTDDRIAIFKKLKFPNTLETLEQYLGIVR"
     gene            544147..545423
                     /locus_tag="THITE_2171159"
                     /db_xref="GeneID:11519220"
     mRNA            join(544147..544745,544821..545423)
                     /locus_tag="THITE_2171159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656240.1"
                     /db_xref="GeneID:11519220"
     CDS             join(544207..544745,544821..545247)
                     /locus_tag="THITE_2171159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656288.1"
                     /db_xref="GeneID:11519220"
                     /db_xref="JGIDB:Thite2_2171159"
                     /translation="MATVYDLLTQHSTNVVHNTHYVTQSNKEWARNYHPIRNLVVHSY
                     HGGDGLVHADFDSAFLGSYEDDGMRMDEPAMAPNKRIWRLECEADCELWFHTEVSNVV
                     LAGWNRYPQVTQTSHTKPPRVENIPEEVDAMYTIKYRNERTVIAIGEMKRNLIQAAAW
                     QAGNVLQVAGQKMLSRELRGYAVKYQSPQVYCFDGKTLLLLQFRADTPAKMMDADCPV
                     DCWVLPREGSFYSLRYALYRLMAQGFRRFQGMCALPISVGGLTPRSRRFFNGVPVWHP
                     NGVDQDEHPGGYVRSVNGTSGAVKWTHSESGDLVWETAAFWGEHA"
     gene            complement(<545415..>545957)
                     /locus_tag="THITE_2012866"
                     /db_xref="GeneID:11519221"
     mRNA            complement(<545415..>545957)
                     /locus_tag="THITE_2012866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656241.1"
                     /db_xref="GeneID:11519221"
     CDS             complement(<545415..>545957)
                     /locus_tag="THITE_2012866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656289.1"
                     /db_xref="GeneID:11519221"
                     /db_xref="JGIDB:Thite2_2012866"
                     /translation="FRFRTRVIHATATPADGVHRHVLRLRVQPSVVQQIIQALVNSLL
                     PRPAQIWFQSCFPEWALPGQLVLKKQKDGWDAEFETEKATYAKLAPLQDVVIPRCFGQ
                     LRYKGTRALLLSDIGGVCLATPEGGLLDLGDFQRMMRQALDAFLPFGILQDDSKLDNY
                     HLVGDKIMVVDLERVSDGLTD"
     gene            complement(571431..574120)
                     /locus_tag="THITE_2120720"
                     /db_xref="GeneID:11519222"
     mRNA            complement(571431..574120)
                     /locus_tag="THITE_2120720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656242.1"
                     /db_xref="GeneID:11519222"
     CDS             complement(571924..573963)
                     /locus_tag="THITE_2120720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656290.1"
                     /db_xref="GeneID:11519222"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="JGIDB:Thite2_2120720"
                     /translation="MAGKIKKKGQAGQARNYMTRTQAVKKLQLSLPDFRKLCIWKGIY
                     PREPRSRKKVSKSATPSTTFYYTKDIQYLLHEPLLQKFREQKVLEKKISRALGRGDVS
                     DAARLERNAARPDKTGRPRYTLNHVVRERYPTFTDALRDLDDCLSMLFLFANLPSTTA
                     VPAKMIARCERLCLEFQHYLIVSHSLRKSFLSIKGIYYQANIQGEDILWLVPYKFNQR
                     IVGDIDFRIMGTFVEFYMTVLGFVNYRLYTSIGLKYPPRFDQLKDDQGAELGAFSLEV
                     VNPEAKGETKAITNGEAEQGPDPNVQAEVNKVVQQLRLESNEAAAAEDSLAQREVQGE
                     EAPSDALDKFEPVAPGGDVLPQPSYSNTDPSQLFSNFTFYLSRETPRQPLEFILRAFG
                     CKRIGWDSVLGEGAYTHDESDPSITHQIVDRPVIRAAMSEGGDGEDNQTTQKLGPNQR
                     YPGRIYVQPQWVWDSINDEELKSPELYAPGASLPPHLSPFVKPTNGQYDPTRPLEEQQ
                     TEGEALDAELEDANGEDQDGEESEVENDMDVASEDEDEGEDEFGGFSGAEEDEAEEEE
                     EEEEEEEEEEDGSEDVEESAARQRQRELEAEISGKPVPRKADAKAQAKLQAKKALLRK
                     QRQEAEELERAKGMLSKKKRKLFEQMQYSNNKRSAEDMKLRAKRRKLEKELAKKA"
     gene            <574358..575862
                     /locus_tag="THITE_2081127"
                     /db_xref="GeneID:11519223"
     mRNA            join(<574358..574511,574593..574854,574926..575862)
                     /locus_tag="THITE_2081127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656243.1"
                     /db_xref="GeneID:11519223"
     CDS             join(574358..574511,574593..574854,574926..575781)
                     /locus_tag="THITE_2081127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656291.1"
                     /db_xref="GeneID:11519223"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="JGIDB:Thite2_2081127"
                     /translation="MDGTKVAPGRTAGLYAGAAVLRLAIFTLLPGLANLLTGRVEVST
                     PVTSFKRQGLFLYNRNVSPYDGGVYHQAPLFLPLFSLLPSFSSFPIFTYLLYIVVDLL
                     SASALWRIADSGEAGSSALFTSPRREKRWSGFGIAALFLFNPFTVATCIGRSTSVFTT
                     CAILHAIAKAVSGAPFGAMVALSFASYLSMYPLLLLPPLILLCYDRQCPERAINSGFR
                     FAATCVATVAGVLAVLFQLSYFITGSWEFLPSTYGVQLTLSDLTPNVGLWWYFFIEMF
                     DSFRSFFLAVFWLHLSSYVGGLTLRIRRQPLVVLTLLLGIFAIFKPYPSISDTSLFLA
                     MVPLYRHVFPLMRYTFVIAAVILYAAFLGPAFYHLWIYAGSGNANFFYAITLVWGLGQ
                     SLLVCDLMFAVLRDEWEVERPEMVGKEIRQI"
     gene            576265..578021
                     /locus_tag="THITE_2120724"
                     /db_xref="GeneID:11519224"
     mRNA            join(576265..576603,576817..578021)
                     /locus_tag="THITE_2120724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656244.1"
                     /db_xref="GeneID:11519224"
     CDS             join(576366..576603,576817..577655)
                     /locus_tag="THITE_2120724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656292.1"
                     /db_xref="GeneID:11519224"
                     /db_xref="JGIDB:Thite2_2120724"
                     /translation="MAPIRRYLRITKYSVLECRIYLDNPALAQSWLLNPRDPVLPRVI
                     ESVRPLVLPKLREEKERERSRKKGKKRSIKDVVVEDDFEVSIFLTETDTRHSLLHKQK
                     LFRDKVQTRLTSNSSRLLGAAGTGASRDEPIDVDRQFPQGGGGGSGASVAAAAAAAED
                     ERDDGEGAPVLLREEEDDAINLADLPAVGEMAGGGELADGKRPKRRRRRGQGPEDASE
                     ESGANVIETDSSGDDGLFVDEDEDEDDDGVRSDKEGDDAASGRRPAKRRRRGDAAAGG
                     DTAGRGDGDDKKKMAMDISYEGFAIYGRVLCLVVKRRGGGPAGPSGSNKPQPGRPGGQ
                     AMMENWIASTQLPAEAAAGEAEGP"
     gene            complement(<589965..>590237)
                     /locus_tag="THITE_2055852"
                     /db_xref="GeneID:11519225"
     mRNA            complement(<589965..>590237)
                     /locus_tag="THITE_2055852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656245.1"
                     /db_xref="GeneID:11519225"
     CDS             complement(589965..>590237)
                     /locus_tag="THITE_2055852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656293.1"
                     /db_xref="GeneID:11519225"
                     /db_xref="JGIDB:Thite2_2055852"
                     /translation="IYAYIDDIIIASKNIEEYLKYIKTVLDILDKVYIYILVEKSFVA
                     YPSVRLLSYIVNGEGVAKIDDRIAIFKKLKFPNTLETLEQYFGIAR"
     gene            <596124..>596375
                     /locus_tag="THITE_2057218"
                     /db_xref="GeneID:11519226"
     mRNA            <596124..>596375
                     /locus_tag="THITE_2057218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656246.1"
                     /db_xref="GeneID:11519226"
     CDS             <596124..596375
                     /locus_tag="THITE_2057218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656294.1"
                     /db_xref="GeneID:11519226"
                     /db_xref="JGIDB:Thite2_2057218"
                     /translation="IYVYINNIIIANKNIEEHFKYIKTVLDIFDKVYIYISIEKSFIA
                     YPLVRLLSYIVNGEGVAKTDDRIAIFKKFKFPDTFETLE"
     gene            609036..609844
                     /locus_tag="THITE_2120729"
                     /db_xref="GeneID:11519227"
     mRNA            609036..609844
                     /locus_tag="THITE_2120729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656247.1"
                     /db_xref="GeneID:11519227"
     CDS             609220..609816
                     /locus_tag="THITE_2120729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656295.1"
                     /db_xref="GeneID:11519227"
                     /db_xref="JGIDB:Thite2_2120729"
                     /translation="MQNTAEYATLQRYPRSTQPGQHAGYPGPRREINEGLKAVIPRAP
                     NIGGDLSVPTWVKQYSARPSDRRLHCRAARNVLSNSDGSPTYHRVVFVLIQHQAPSLA
                     RQPARQMQAASSHHPTLTSRIAPVRARSKHCQPQRQGLQGTVAPSGIPTGVPFGASRH
                     LLPPETPRYVTGVASSLSSSAPSGLALGDVKRLVVNSG"
     gene            <610324..>611629
                     /locus_tag="THITE_23605"
                     /db_xref="GeneID:11519228"
     mRNA            join(<610324..610471,610575..>611629)
                     /locus_tag="THITE_23605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656248.1"
                     /db_xref="GeneID:11519228"
     CDS             join(610324..610471,610575..>611629)
                     /locus_tag="THITE_23605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656296.1"
                     /db_xref="GeneID:11519228"
                     /db_xref="JGIDB:Thite2_23605"
                     /translation="MVLQLHVWGPAFGLPSLDAECLAAIAYLAQTADPADYQLIQSSP
                     SAVPTQHLPALHDPSTSTWTSGYTPILTYLQTHPPPTFRDPSASTAAAAAADSTAYTA
                     FLTAHAAPLLALSLYVSSANYAAATRPAYSAVLPLPLPWTEPPAARAAMARRAAHLGV
                     SDALDADAHADAHGVRRVAEDGGWVTVPAALGGGSRKKRVGGVQGMLRAEQKARIRLE
                     GLAEEVLDVLGEVEWEGKGCGIRCLVFGYLALMVMPEVPRPWLREVTQARYQGLWEFV
                     VGFKREVFPEGRTLPWAQEKAACSAVAVGMRFVRGVLGEVPLVGELWSRWWTARKMSQ
                     VLGGQGTQTRSGGDLLLLLGAGLGLAAVSAGAFFYRSLPPFGEAVQVWRKPVVTLSSL
                     GAAGALFSG"
     gene            611943..615433
                     /locus_tag="THITE_2120730"
                     /db_xref="GeneID:11519229"
     mRNA            join(611943..612342,612441..615433)
                     /locus_tag="THITE_2120730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656249.1"
                     /db_xref="GeneID:11519229"
     CDS             join(612315..612342,612441..615106)
                     /locus_tag="THITE_2120730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656297.1"
                     /db_xref="GeneID:11519229"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR010663"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="JGIDB:Thite2_2120730"
                     /translation="MILRVKVQQGRRVSYVPGWDCHGLPIELKAVGAAEGKRMSPGAI
                     RKAARELAAKTVLEQMQSFRTYAVMADWDARWTTMDTAYEIRQLRLFQRMARRGLVYR
                     RYKPVYWSPSSGTALAEAELEYNEAHVSRAAYVRFRVVDGYGALPGMEGFEGRLFAVV
                     WTTTPWTLPANRAIAVHEDLAYHIVRVGADAFLVAENCLERVAKVLGGETAAPEVVGT
                     VKGSQLTQLRYVNLLRGKSAELQPFIHGSFVTEGSGSGLVHCAPGHGFDDYLACLSLG
                     IPVSAPVDNDGLFTEEAYPDQPDRLKGISVLDGGSAAVLELLGDDVLDVHEYRHKYPY
                     DWRTKQPIIIRATAQWFADVDTIKQEALAAIDEVRFVPEHGKNRLEAFVRGRSEWCIS
                     RQRAWGVPIPALYEPNGDAVMTDEVIDHIISVIQERGTDAWWTDPADDPAWIPEPLRG
                     KTEYSRGLDTMDVWFDSGTSWTMMNRQADLYLEGSDQHRGWFQSSLLTRVAAMGDHSA
                     KSTTNTLGLSPFKTLITHGFTLDQDGKKMSKSLGNIISADQVMDGSLLPPLKAKKKGG
                     NNTPPVKDALGPDALRLWVASSDYTGDIVLGEPVLKTIHQALLKYRTTIKMLTGSMHA
                     SARTAPLTAVDQIALLQLRDVMAEVGAHYDAYEFNKAFGCLNRWLTNDLSAFYLEALK
                     DRLYCADGGGALEPIFVGLLRMLAPLTPVLVEEAWEHRPAWMKEEEEKGENGGAAQQQ
                     QQHPLRQLYDAPLVDPARLTIDEAELRGAVPVLMRVHAAIKAALETARADKLLGSSLQ
                     CAVVLQVPEGGRVLRTLRRFSDELEAMFVVSSVELNGAVPEGEGAQWKRCEEFELDGE
                     ACKAWVLPPKQAKCPRCWRFVAPQEDQLCARCEEVVGEAVQ"
     gene            <616953..>617759
                     /locus_tag="THITE_2010477"
                     /db_xref="GeneID:11519230"
     mRNA            <616953..>617759
                     /locus_tag="THITE_2010477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656250.1"
                     /db_xref="GeneID:11519230"
     CDS             <616953..>617759
                     /locus_tag="THITE_2010477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656298.1"
                     /db_xref="GeneID:11519230"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_2010477"
                     /translation="PLLRTPTLVLGDFLARALTRASGGGRFRILEVGAGTGGTTRHIV
                     GRLRSLGIPFEYTFSDLSASLVGAARRQFRDRGADNGTMVFRVLDVEQPPAPEDTAAY
                     HVVLATNCIHATRNLAVSLRNLRRMLRDDGALALIEITQNMFWLDVVVGLLEGWWLFE
                     DGREHALVDERHWARVMKAAGFAAVEWSDGESPESKTVRVIGAFPTAAEATSNSSDAV
                     TTSTHGGGMVVGSTSRTEKPTSSDKAVVETVVYTTVGGQDIHADVYWPVGP"
     gene            <618171..>618725
                     /locus_tag="THITE_2024531"
                     /db_xref="GeneID:11519231"
     mRNA            <618171..>618725
                     /locus_tag="THITE_2024531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656251.1"
                     /db_xref="GeneID:11519231"
     CDS             <618171..>618725
                     /locus_tag="THITE_2024531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656299.1"
                     /db_xref="GeneID:11519231"
                     /db_xref="JGIDB:Thite2_2024531"
                     /translation="PTDYEDLWWRAPIQPDGARDTGQEYDVLEAVQDAPLTNYGVVGA
                     WEPLSDPRILTDPRCRIVLHINWKAQTLPVIVNGLPSRAKADADADAHPGTDWNAAPQ
                     PPLERVRAVSPRAHITRGTYAPVPTFLVHGTADDLIPWQQSRGTYDALVARGVPAGLA
                     LVEGAPHICDLSSNPESEGWKAALR"
     gene            <619927..>622212
                     /locus_tag="THITE_2146851"
                     /db_xref="GeneID:11519232"
     mRNA            <619927..>622212
                     /locus_tag="THITE_2146851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656252.1"
                     /db_xref="GeneID:11519232"
     CDS             619927..622212
                     /locus_tag="THITE_2146851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656300.1"
                     /db_xref="GeneID:11519232"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2146851"
                     /translation="MDILKVLSRGIKSNPKSRAQGAAATAQLPSAGALPHPQLFHDPV
                     STSSRGKKRKRRGDAQGDETEHQDDDEDLSDVDYFAPKKPAAESAPAAAEEDPAPKKR
                     KIKLLDEDECRQILRSHRMKFTVLSGLRQTEAAEGPDSKKDKKQQQQQKKKDKDKKSK
                     EEDTKKDDQHKKQIFPQPLTSFAELRTTYDIAPQLAANIAAQGFRVPTEVQMGSLPLL
                     LRPATALKKASSAAVDVVGSSGADFLAVAPTGSGKTISFLIPAIDGALRRRADEGRSR
                     DEHVLQAVVVAPTRELASQIVNEGRKLAFGTGVRVVLMKRSLRLVAEELKGGEESKGE
                     KEEESSGGEEGSEDEEESGEESEEEKTGKDKEGALKPPARVDILVTTPKTLLNFLSGG
                     KSGARKVLPTVRSLILDEADVLLDPIFRKQTMGIWRACTHPDVALTCWSATMASNIEA
                     LVTKQLEKRSKRPDSSPRPLIRLVVGLKDTAVPNVTHKLIYTATEAGKLLALRQLLHP
                     VSSADSGPPLRPPFLVFTQTIERAQALHDELKYDIPLEAGGPARVAVLHSSLPDAARA
                     RIVARFRAGDVWVLVTTDVLARGVDFAGVNGVVNYDVPTSAAAYVHRAGRTGRAGRHG
                     GVAVTFYTKDDIPFVKSVANVIAASERQAGKAAGQGQGQEGTAAVPKWLLDALPKVAK
                     EDKRRLKVRGVESRRTGGKASITTKSSWERRREHNRLQAIEASKRRKRQRREEAGKGD
                     KGGGGKAAAEEEEGEWGGLDD"
     gene            complement(622208..624184)
                     /locus_tag="THITE_2120732"
                     /db_xref="GeneID:11519233"
     mRNA            complement(join(622208..622939,623040..623327,
                     623391..623836,623903..624184))
                     /locus_tag="THITE_2120732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656253.1"
                     /db_xref="GeneID:11519233"
     CDS             complement(join(622378..622939,623040..623327,
                     623391..623806))
                     /locus_tag="THITE_2120732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656301.1"
                     /db_xref="GeneID:11519233"
                     /db_xref="JGIDB:Thite2_2120732"
                     /translation="MCFGSKNDARGGDAPRPAPSPQPLASEQKPSVPGRHPRPASNEY
                     APPPGPPPSHRPPVTTGADDFAPPPGPPPSRRPAAGPSGDDFAPPPGPPPGHAADDFA
                     PPPGPPPSHRPHDDLSYIAPPPGPPPAQSQPKPQHDWEAAVPDTSLFPPPPSFFSGFD
                     RSPANNATEAEAEAGERWCAQHPLTAPLTLDGPAIAALAAHNPRLMQPDGFRGTLVCT
                     APGVWAGTTTSRATDSTIIAYPPLYTVTQHSPLSPARPPTKTIYYEVQLTHAHNGRRP
                     GDICLALGFAALPYPSFRMPGWHRGSLAVHGDDGHRFVNDRWGGKAFTAPFARGERLG
                     LGMTFTAASGSGNGARGRIETEVFFTRQGREVGRWNLHEETDAEQDLPVTGLEGYHDL
                     SCAVGTCGETGFEVLFDPARWLFKPQGYY"
     gene            complement(<624610..>626394)
                     /locus_tag="THITE_2091470"
                     /db_xref="GeneID:11519234"
     mRNA            complement(<624610..>626394)
                     /locus_tag="THITE_2091470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656254.1"
                     /db_xref="GeneID:11519234"
     CDS             complement(624610..626394)
                     /locus_tag="THITE_2091470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656302.1"
                     /db_xref="GeneID:11519234"
                     /db_xref="InterPro:IPR000383"
                     /db_xref="InterPro:IPR013736"
                     /db_xref="JGIDB:Thite2_2091470"
                     /translation="MASMTSSIPRAPVVPIKPPEPGVGGYQPLNPRSEILPAGWNGFN
                     SRPLPSAILVEHDVAFTMRDGAKLYADIYRPPSSGSDGDDAKVPALLCWSPFGKKFNG
                     LAALRLMTPWNLGIPDGTLSGLEKFEAPDPADWVPAGYAVVNIDSRGAGDSDGTMVIM
                     GTQEAQDGYDTLEALARLPWCNGRVGLAGNSHLAIVQWFIAALRPPSLKAIAPWEGCG
                     DLFREQFVRGGIYGGDLFDKLIVKHMLRGRHGMECFREMYKQHPLANAWWNDKRPDMR
                     QITVPTYITGTWTNTMHGMGAIRGWLEVGTADKWLRWHPWQEWYDLWGNPQAKAELLQ
                     FFGRYLKGEDNGWEQTPRVRMAVLRFGTADPIENMVVDDFPLPQTQHKPLYLQPNGLL
                     GADAPREASIASYNSESADSVAFKHTFGRRTQIIGIPKAVLYMSCPDHDDMDVYVLIE
                     KLDAGGRPMLNLNIPWRGIPAKSFDEFTPEQSTEVVLYKGPVGILRASHRAADPARAM
                     HPNWPFHPHETEDKVRPPGTVVRLEIGIWAMGVEYAAGEGLQVRISGRNLAINNFGTT
                     EHADNKGQHRVHLGGEHASHVILPFVLV"
     gene            626930..628478
                     /locus_tag="THITE_2120734"
                     /db_xref="GeneID:11519235"
     mRNA            join(626930..627502,627567..628478)
                     /locus_tag="THITE_2120734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656255.1"
                     /db_xref="GeneID:11519235"
     CDS             join(627165..627502,627567..628311)
                     /locus_tag="THITE_2120734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656303.1"
                     /db_xref="GeneID:11519235"
                     /db_xref="JGIDB:Thite2_2120734"
                     /translation="MAMTTTTTTVAKEALVEGKLSTTPAGLTPKPSGPNKLFNNPDAK
                     FGDFRDDLLRDGFCVVKGAVPRERAEKYAEEMFRYLETFKGGLGFKRDDPSTYVEEKM
                     PVINEKGMCLGYGIAHESFTWAVRQEPGVIDAFAKVYDTDDLIVSFDGVNLAFPRTDL
                     KPNTPWPHQDQDPEKPGFRCLQGLVNLLPNGDRDGGLIVCKGAHLLSEEFHAEFKDEP
                     DKIWAWTKEWYGFTDRGMQWLADRGCPWIKVNAEPGDLLLWDSRTPHYNLSPALGAGP
                     RFCVYTCYMPAADATQEELARKKAALENTQSTTHWPNAMHVGGVPVRRRDGRDCPYND
                     WKPRQPVQLTERGLRLTGIPYIKASV"
     gene            complement(<628729..>631354)
                     /locus_tag="THITE_115282"
                     /db_xref="GeneID:11519236"
     mRNA            complement(join(<628729..629190,629261..629543,
                     629640..631209,631291..>631354))
                     /locus_tag="THITE_115282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656256.1"
                     /db_xref="GeneID:11519236"
     CDS             complement(join(628729..629190,629261..629543,
                     629640..631209,631291..631354))
                     /locus_tag="THITE_115282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656304.1"
                     /db_xref="GeneID:11519236"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_115282"
                     /translation="MDASGSDRPAKRKRLNFACNHCRAKKVRCDQLEPSCQGCLAAGV
                     ECVTIDKRRPGLEVRRRPAGSQDPTGSPRPRSLHRRVELLPALAPARSGTAEPAAVPP
                     PGVVPITPASEPATATTTTTTTNRSPSMAPPPDNPGGSTAAGDPPSGEEPGRRRFAGR
                     LPMMAPGARVSDGDTVEIMTGWLELAFHRLGIPSRFDACLRRKASPAAAPAPGIVPVA
                     LPAIPPAAQCREALAAYYATVHVLFPIVEPAVLDGICEDVVRSCAAGMIHAGRLPELL
                     LFCLALVLGTAGGKPAAESSLSSSSLTTTNLATAYVGFCESMLGHVLGWGTVDSVRIV
                     FLLALVLRWREKITAAWPLAGVCVSIAQVLGLDRRKPHGRRSSPEAVVSTDAERADQE
                     RRRVWWCVYSFEKLFAFELGRPSAIADADHHDHDQLEPARVPRPAPLRGGGRDNHDGS
                     SEEDIDFFHIVISLARTLSEVSRRSIAARAKEERAGREGLESAIRFKVATTGECVLLL
                     MRWAEGLPKHLRPTSDLLCEPAEFPAAAFVCVQYHSALIMLLRNTLLIHDEALRGAVE
                     EHAAGQPWSQVTRNGQAIAASSARSIVRLLMDGHDRGSRPALPTVTAPLHVLSVLSVH
                     LIRHPTSRVASSDISLIRTAGDFAVEKCELIAQDQRVRGIVQLLDSEVLRIVAAAQPP
                     AARRASSITDGRLSSHSSLDNNNSPAGGGRSASRCESYNDSSGVVLNQSASSQGFSAD
                     GGGGLSSTGLMELSAEMPMSMAIPDVAWSPSLADEIGWDWGDFSQLFSEPVM"
     gene            631630..633822
                     /locus_tag="THITE_2120735"
                     /db_xref="GeneID:11519237"
     mRNA            join(631630..632673,632748..633157,633252..633822)
                     /locus_tag="THITE_2120735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656257.1"
                     /db_xref="GeneID:11519237"
     CDS             join(631959..632673,632748..633157,633252..633674)
                     /locus_tag="THITE_2120735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656305.1"
                     /db_xref="GeneID:11519237"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2120735"
                     /translation="MSSSCRLPAETPRVSEQQRITTFQCATYWLTTTVSRSLDPLNLP
                     LWRKNITVLIVGLYSAFAVLATSGMGAIVTQVREMYPPEDQDRVSDLLTHPTLFMGIG
                     NLLAMPLCVAVGRRPVFLLSLVILVASGIGCACSTSLTSHIAARDILSVAAGQSEALV
                     AFMVQEVHFLHQRGRAATWNAAIQGVVTGAMFVATTYLVPAWGVRWWYGVITIVNGVL
                     LIASFFLVPETMYDRVLEDDGNETGSPKAARVTTTTNHTLDPERYGARTWRHDLKVFH
                     FKPRWHETWTFYKTAALSFCIPAIVWLLLLNGAFLGVYVFHSSTFATVLLGPPYLFEF
                     GFLGFVQLAIVLANCIGLVVIGYGSDWIIKLMSRLHKGIYQPEYRLLSAILPSIIAVV
                     SCVIYGQTAQHPDQWSWAGIVVPYAAGYLAFLGANTVSITYVVDSWPAEAGPMLLVVA
                     AGRGFISFGLSYALVPWIARNGYDGSMRELAIICGVFALLGIPCYVFGRNIRVWSKKR
                     LYPSPAC"
     gene            complement(634539..637843)
                     /locus_tag="THITE_2171161"
                     /db_xref="GeneID:11519238"
     mRNA            complement(join(634539..636473,636530..636607,
                     636663..636734,636794..636917,637109..637843))
                     /locus_tag="THITE_2171161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656258.1"
                     /db_xref="GeneID:11519238"
     CDS             complement(join(635070..636473,636530..636607,
                     636663..636734,636794..636917,637109..637743))
                     /locus_tag="THITE_2171161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656306.1"
                     /db_xref="GeneID:11519238"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="JGIDB:Thite2_2171161"
                     /translation="MKGPSPSPQTKTHGGSHRSSRRPDSNSVPIPVISGNPPPLDTSK
                     SNNNNNKHASPASPSLPGAHGSPGGAGGGVASAQPAPATDGDSSSSSRPVNTPQAAQS
                     GAVVGPEGEKQDAEAKEPKPPVVRRVWHIFKAVILHSKINVLLAFVPVGIAVAQVDGL
                     SPGLVFAMNALAIVPLAGLLSFATESVARRLGDSLGALLNVTFGNAVELIIFIALVKN
                     EIRVVQASLLGSILANLLLILGMSFFLGGLRFREQIYNSTVTQMSACLLSLSVVSLVL
                     PTAFHASFSDSDLADAQSLKISRGTSVVLLLVYIVYLLFQLISHAYMYESTPQHIIDE
                     EATPGPVANWLDSSSSDGSCSSDSDSSDSDHSRETMSRRMKRVMHRRRRSSVVSAEAA
                     GSVSPGFSRTASAGTSDILPVKGEPNSEESSSRPALNHRKSSNGVHDEGEDEKAHRHG
                     KHHRHRLPRRKHRKHKHRANVTASPETVSETIDENAVVEPSARDLRRVEFAPDVASTR
                     GNLAGEPRSRSPFQGLRAMSLRPVVSSLAPTVFTQPPTAATTHVPSGPVPRVRYGIRR
                     TNSLPDRLDQYYRAPGAMMPSQIPLARPPTKAIIAEEAHTVELSRTAAVILLLLSTAL
                     VAVCAEFMVDSIDGLVETSTLSEIFIGLIILPIVGNAAEHVTAITVAMKNKMDLAIGV
                     AVGSSIQIALFITPLIVIIGWIMNREMTLYFTLFETVCLFVSAFITNFLVLDGRSNYL
                     EGALLMATYVIIGVVAFFYPNANDASARVF"
     gene            640393..641486
                     /locus_tag="THITE_2120742"
                     /db_xref="GeneID:11519239"
     mRNA            640393..641486
                     /locus_tag="THITE_2120742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656259.1"
                     /db_xref="GeneID:11519239"
     CDS             640661..641287
                     /locus_tag="THITE_2120742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656307.1"
                     /db_xref="GeneID:11519239"
                     /db_xref="JGIDB:Thite2_2120742"
                     /translation="MAANGSTTRVLKDLALRRLVHPPGLSHFASNGLPPPSHDTTSAA
                     YHVTQASFLLQLDLAVQASWAARHRSKYVDVKVLLMTWQSDDLGVEREAQALLSVFRD
                     LYRFDCEYWQIPDRDSAREATKKVIAHMERASSSPDNLFIFYYAGHASPNPHFPGGLP
                     TWVAKYCSQLHRGLAAERGLMRSRTLQPHAEFPQIRLQLHPAAPLPRR"
     gene            642309..643979
                     /locus_tag="THITE_2120743"
                     /db_xref="GeneID:11519240"
     mRNA            join(642309..642686,642754..643223,643324..643475,
                     643565..643979)
                     /locus_tag="THITE_2120743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656260.1"
                     /db_xref="GeneID:11519240"
     CDS             join(642470..642686,642754..643223,643324..643475,
                     643565..643874)
                     /locus_tag="THITE_2120743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656308.1"
                     /db_xref="GeneID:11519240"
                     /db_xref="JGIDB:Thite2_2120743"
                     /translation="MPFIRRYISARDLLEVENPVLDLPNRLSRLTVRHNFDIGAHYTG
                     STASTSHPSGSSLRRGLNTLATASASGKDAMGLDAFDPLQREFEALRRAMSDSKVPTP
                     PQKQTEAESEIPKSAVTPISSSGYEDLVANSSSGYRSYLPRPLSGTGDSISTDERSYP
                     CSFDTSKPPELPLGSDAPRPDTPVPGPSFLSEDRCFPALKPPSLQDEDPRNPIEYRFK
                     FHQSHEFRPGRVLKMVSFEPRKGSPPAETLSEGFSLPREVALSVRYRRFVVIANDEGY
                     CTCVPISTYSGQACKKHGVKPAKHGIVFETGRRPRLLPGEPELGFPPVQVRLTEPGER
                     FAKESRVNYAKLTTIEHNMLVYFIGEVVEDDLDIILSAVDLCWAKRRR"
     gene            complement(646245..650196)
                     /locus_tag="THITE_2120744"
                     /db_xref="GeneID:11519241"
     mRNA            complement(join(646245..647728,648106..650196))
                     /locus_tag="THITE_2120744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656261.1"
                     /db_xref="GeneID:11519241"
     CDS             complement(join(646299..647728,648106..650050))
                     /locus_tag="THITE_2120744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656309.1"
                     /db_xref="GeneID:11519241"
                     /db_xref="JGIDB:Thite2_2120744"
                     /translation="MSTPYWGQLPPPKASQTRARRLSDDQALPPEHRQSLDAAAQGPA
                     RSNRGSVQTTKSDAPTDSTLSPFASPTASSFQGQGLTPRPPSFPYGANQYPPEFLENR
                     RRRRSRNQEQDDDYAAVTGPPPPAAPDAPPSASASLKFPPVPPQAIGRPLRQMEVEER
                     NKAPAAGSQKDGWPRNALGESALPRPQRVNTDPTFGASFSLANGGPRRASAAEQSLQK
                     SIRRSSTQSSADRPRVIANDRSPLQRLELALDSISKEDKRARVEAAERAARERAAAAA
                     ANGSAQQGQKSPQQVRFRERRPSVAAGDAPRTPITPTKPAQGSQPTQAGQAGPDGPHS
                     QNPPDEGRRRNTAGGPSPRAPPESRIPVPVQSSGIPQRNLSFRERAARSDMKPPSGLG
                     SPAAQESFPTTGPNGHTPTRSGSNKLKKPPPSDPWPNRTSEAGGMYDSGEPSARVGPR
                     AANPPVQPNLWERVLEALDEGDDSDGGLMAYPPGAAKLTKTPSQRKADQILGRVPTQA
                     QVPSEVRQAAPPSAANNGGPTSHGPAPMAAAQHPGVHRDREHHADTGGERHHVSDLVY
                     HARDKLQPGQGVFKPTAYLDEWKQATVGALTGALLDLEDAPPPAVDKSTPWWEAPQSR
                     RRSNSLSSRPKKAEAFEGEYDESNAPTRFKPPLYLKCGPLLRFCGIRHEKVPGRSTRT
                     GAVADREIWRGSIMIVTTDADSSYDIAPTLRLFVQPIELLPPPPREIHGDEPLAPEYV
                     DPIAGHPKLGRKGETLYVRPVDHLEEAKDISRDETDEGLYEKTKSPPDVPLPEGVVDP
                     PGSFAARRKRAEIDGEKVGKYKDVRGFRLHAERGYTFWKFNIEIELREKQQRIAYRIN
                     RGPSTGFWVPAKGQSMNIMFYSCNGFSLSVQPDDFSGPDPMWRDVLNTHQSQPFHVMI
                     GGGDQIYNDRCMQDTVLFKDWLMIKNPLHKHNAPFTPAMQDELERFYLERYAMWFSQG
                     LFAMANSQIPMVNMYDDHDIIDGFGSYPHHFMNSPVFSGLGNVAFKYYMLFQHQSTVD
                     ETEKTEPSWILGDKPGPYITERSRSLFMFLGAKVALLAVDARTERTRDEVVREDTWKK
                     IMDRCYDEIDKGKVEHLLVVLGVPIAYPRLVWLENM"
     gene            652011..655156
                     /locus_tag="THITE_2120746"
                     /db_xref="GeneID:11519242"
     mRNA            join(652011..653874,653932..655156)
                     /locus_tag="THITE_2120746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656262.1"
                     /db_xref="GeneID:11519242"
     CDS             join(652145..653874,653932..654931)
                     /locus_tag="THITE_2120746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656310.1"
                     /db_xref="GeneID:11519242"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="JGIDB:Thite2_2120746"
                     /translation="MKIPTAAALLGLAASAAASGVLPRRWDVNDYYVLRLDANTSPHE
                     VARSLGLSHEGPLGELKGHHVFVAKKSEHDVVKRALAERRRRRSLGERHVLDGVLFSE
                     KQVLRRPWAKRVIPQRRGPVPLSDAARAQGRPVQSAVQAQAEVARALQITDPIFHEQW
                     HLFNTIQLGHDVNVTGVWLQGITGKNATVAIVDDGLDMYSDDLKPNYYAAGSYDFNDK
                     TAEPRPRLSDDKHGTRCAGEVSAAKNNVCGVGVAYDSKIAGLRILSKLISDADEAVAM
                     NYDFQHNQIYSCSWGPPDDGRSMDAPGILIRAAMLNGVQNGRQGLGSIYVFASGNGAQ
                     AEDNCNFDGYTNSIYSITVGAIDRTGQHPYYSEKCSAGLVVTYSSGSGDAIHTTDVGQ
                     NACYNGHGGTSAAAPLAAGIFALVLQVRPDLSWRDMQYLAMDTAIPINLESGDWQDTA
                     IGKKFSHTFGYGKLDSYAIVEAAKTWKNVKPQAWFYSPWIHVNQDIPQGDKGVAVPFE
                     VTEEMLKEANLERLEHITVTMNVEHGRRGDLSVDLISPSGVVSHLSVTRKYDDSPDGY
                     NDWTFMSVAHWGETGIGTWTIIVKDTNVNAFSGKFIDWHLKLWGESRDASKAKLLPMP
                     TEHDDDDHALIATTTIPATFTTIGPNPAPATDSETPVKPTDHPDRPVNAKPTPTSSTA
                     TVPPPTEEEENLPSESSAPGSSNSNNSTWLPSFLPTFGVSAATQAWIYGSLVLIVLFC
                     AGLGLYLYLARRRRLRNNPRNDYEFELLDDNDDEEAAAGGEKGGAAAGGGAAAAAAGR
                     RGRSRRTTTTRGGELYDAFAGESDEDDDDDDDFGGAEHYRDRVDRAAGAEGAAGSPAP
                     VNEKVPPGRDSLESEEEEGHHVIGDDDDDEDEDESGDDEQRHEARPLQGGAHR"
     gene            complement(655727..657939)
                     /locus_tag="THITE_2120748"
                     /db_xref="GeneID:11519243"
     mRNA            complement(655727..657939)
                     /locus_tag="THITE_2120748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656263.1"
                     /db_xref="GeneID:11519243"
     CDS             complement(655911..657008)
                     /locus_tag="THITE_2120748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656311.1"
                     /db_xref="GeneID:11519243"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Thite2_2120748"
                     /translation="MEYVRGDRFGPDFTSRRAYSLQRFLSRLALHPILRRASILHTFL
                     ESPDWNATMRSRAGRVGPAGAGGDGLGQGSPSAVGSGGGGVFDSFADSFMNAFTKVHK
                     PDPRFIQVKEKSDKLDEDLNNVEKVVARVARREADLETDLRDLAEQFQKLITLEPGVE
                     SAVHAFAASVEDTAAGLKKLKDHTDQDYLGSLRDMTAYSAALKTLLKAREQKQLDYEQ
                     LTEYLNKSTAERDSLTGGPGAGHGHPHGFSAGPFGSGALGGASGFLRSKLEDVRGVDH
                     EQARRDRLRKLELRIDELTHAVEAARADADSFADQVVREVDTFEWIKRLEFKRQLGGL
                     VDAHLGFYSGVVDTWERYVREMEAQGVVLPA"
     gene            complement(657961..660512)
                     /locus_tag="THITE_2120749"
                     /db_xref="GeneID:11519244"
     mRNA            complement(join(657961..659949,660013..660512))
                     /locus_tag="THITE_2120749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656264.1"
                     /db_xref="GeneID:11519244"
     CDS             complement(join(658328..659949,660013..660073))
                     /locus_tag="THITE_2120749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656312.1"
                     /db_xref="GeneID:11519244"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="JGIDB:Thite2_2120749"
                     /translation="MSASTRVARRALVVNPFQGTGRALPRSALLATSIHLARNAQRLG
                     PASALLIPIRTLTTPGTTTHGPPGGPPPGFNPEEAKKPLPKEPASVAKPATKSAEPPK
                     AKETEVKEAAKEATEVSADAGASLTELAAQKESGVEKAEDKKEEKKLTLGQKIKKELQ
                     HYWDGTKLLAAEVRISSRLALKMAAGYELTRRENRQLQRTVQDLARLVPFSVFVIVPF
                     AELLLPVALKLFPNMLPSTYEGQKSKEQKASTLRATRKEVSDFLRQTLKETGLPLTQA
                     TTQKEEFTNFFRKLRSTGEKPTAEDVIKVCKIFRDDLTLDNLSRPQLVSMCRYLNLNT
                     FGTDMMLRYQIRHRMRQIKRDDRAISYEGVDSLSVSELQTACASRGIKSYGVSPARLR
                     EDLQTWLDLRLRDGVPSTLLVLSNAYMYGQTQVEEGVSSQIEALTGVLSSIPEELFHE
                     MELEVHNAEGAATNKQRLEVLKEQQELIDEELEQDQENQATGFATPRDTENIDEKEER
                     QAQAESDGTIEKAQVGEAVDAEKDMLDAARSEEQQQQQQREAEPAQSKSSDK"
     gene            <661656..662809
                     /locus_tag="THITE_2069499"
                     /db_xref="GeneID:11519245"
     mRNA            join(<661656..661812,661883..662024,662187..662809)
                     /locus_tag="THITE_2069499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656265.1"
                     /db_xref="GeneID:11519245"
     CDS             join(661656..661812,661883..662024,662187..662595)
                     /locus_tag="THITE_2069499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656313.1"
                     /db_xref="GeneID:11519245"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="JGIDB:Thite2_2069499"
                     /translation="MRLRKAARVILIGAPGVGKGTQSERLLQRFPQLSSISSGDLLRH
                     HVKQRTPLGIKVESTMKAGGLVPDDLMLRLISNELTRRGWIYSGHPSGNVMTLASSSA
                     SFLLDGFPRTAAQAERLDAIVPINLAVSLRTPLEVIVQRIGGRWVHEPSGRVYNTTFN
                     PPRVPGRDDVTGEPLVRRPDDSEEVYRARWERFRETSEPLLEHYARKGVLWEVHGLSS
                     DEITPKLFREFERRFVE"
     gene            <673264..>673500
                     /locus_tag="THITE_2056929"
                     /db_xref="GeneID:11519246"
     mRNA            join(<673264..673302,673342..>673500)
                     /locus_tag="THITE_2056929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656266.1"
                     /db_xref="GeneID:11519246"
     CDS             join(<673264..673302,673342..673500)
                     /locus_tag="THITE_2056929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656314.1"
                     /db_xref="GeneID:11519246"
                     /db_xref="JGIDB:Thite2_2056929"
                     /translation="LGDYITIYLNNVLVYKVLQRLRDVGFNLDLKKYIFVVKEVKYLG
                     YIIEARVYIRPNPKKIKAIYE"
     gene            complement(<681241..>681465)
                     /locus_tag="THITE_2056835"
                     /db_xref="GeneID:11519247"
     mRNA            complement(join(<681241..681360,681382..>681465))
                     /locus_tag="THITE_2056835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656267.1"
                     /db_xref="GeneID:11519247"
     CDS             complement(join(681241..681360,681382..>681465))
                     /locus_tag="THITE_2056835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656315.1"
                     /db_xref="GeneID:11519247"
                     /db_xref="JGIDB:Thite2_2056835"
                     /translation="TIILENRYPIYRHRDTRQIVTYKVNSYKVMLYNPYLSYKYTAYI
                     NIEICTSMKSIKYIYKYIYKRTN"
     gene            <705906..>706202
                     /locus_tag="THITE_2013508"
                     /db_xref="GeneID:11519248"
     mRNA            <705906..>706202
                     /locus_tag="THITE_2013508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656268.1"
                     /db_xref="GeneID:11519248"
     CDS             <705906..>706202
                     /locus_tag="THITE_2013508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656316.1"
                     /db_xref="GeneID:11519248"
                     /db_xref="JGIDB:Thite2_2013508"
                     /translation="RFIDCLFYKYKHFIYTYINNIIIASKNIEEYLKYIKTVLNIFNK
                     IYIYISVEKSFIAYLSVRLLSYIVNSEGVAKIDDRIAIFKKLKFPNTLETLEQYL"
     gene            713180..715821
                     /locus_tag="THITE_2120753"
                     /db_xref="GeneID:11519249"
     mRNA            join(713180..713287,713373..715821)
                     /locus_tag="THITE_2120753"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003656269.1"
                     /db_xref="GeneID:11519249"
     CDS             713448..715697
                     /locus_tag="THITE_2120753"
                     /note="CAZy_ID 270199"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003656317.1"
                     /db_xref="GeneID:11519249"
                     /db_xref="JGIDB:Thite2_2120753"
                     /translation="MLVEWAVVAAAATAVSAVSPWSSLPFKPKDGARGNDNRPPLSDD
                     RVFHDMLTALSDLQDAYFQRWVGTWPEGIDWTRAVTSTHVAATLRVISDALELSLPDP
                     PGECAVRKAEVISGYFADVIAYYFAEDAFAIRNQAYDDMLWVVLGWLESIQFVDEHGR
                     LASRMASVGLQRTLPGACETWYGSGWTPAFAHRARVFWELAAKGWDTTLCGGGMLWNP
                     GLMPYKNAVTNQLFISASVGMYLHFPGDSNPSPFGFGTPLEPHDPAFLRAARDAHAWL
                     AASNMTNAQGLYADGFHISGRNGSTRCDLRDEMVYTYNQGIILSGLLGLFRATGEPRF
                     LREGHALVENVVRATGWDLERDAPMDALEFDFTTDPGSRVTSGSGSGPRPGFGFRQQT
                     TKTKTKKDQKKTTSTKPPRPPRLPPWRGLGRAGVLEEACDASGTCSQDAQTFKGIWMH
                     HFAAFCAPDALRPRAGPSAATTTTTSSSSSSATTNTTNTAPAAATATTAATAAAQPAP
                     DFHATACRRYLPWLRHNARAALQTRDARGLFGMWWTAGLLLPQNHGQDHGQDHDHYDH
                     DHDYDGLDGLDDGDAGRGEALALALDLYLEELAREREWEREGGREEGGQVVDYRNWGV
                     PRDAVWMKLADADQHSDDHDDGGGSGSGSGSGGRSSGGGDAGAGAGGQGQKPLGGTGG
                     RHGQVAAGRAAAGNDDNNLGKRGEQEVLGAAAGASDPNLRGRGRTVETQGGGLALLRA
                     LWVVSRHEL"
     gene            complement(715978..718027)
                     /locus_tag="THITE_2069500"
                     /db_xref="GeneID:11519250"
     mRNA            complement(join(715978..716164,716224..716304,
                     716378..716472,716533..717807,717904..718027))
                     /locus_tag="THITE_2069500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656270.1"
                     /db_xref="GeneID:11519250"
     CDS             complement(join(716072..716164,716224..716304,
                     716378..716472,716533..717807,717904..717997))
                     /locus_tag="THITE_2069500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656318.1"
                     /db_xref="GeneID:11519250"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Thite2_2069500"
                     /translation="MQRLERERADLQRLARAQAQARTGRNFSFTFMLFFVGSACWFLG
                     YQYPRDVDPSSTLPLNATRPPTYKLNPAHLEAAWADFVEIVGQENVSTVDDDIKQHTV
                     SEWSSHQPTDPAQKPFCVVYPSTTEQVSAIMKICHVRRIPVVGYSGGTSLEGHYTPTR
                     GGICIDFSRMNKVLALHKEDLDVVVQPGVGWEELNEQLAQHNLFFPPDPGPGAQIGGM
                     VGTGCSGTNAYRYGTMREWVLSLTVVLADGTVIKTRQRPRKSSAGYDLTRLFIGSEGT
                     LGLVTEATLKLCVKPAAASVAVASFPSIRSAADCVARVVADGIPVAAVEILDDDQMRF
                     INAHGTTSRRWREAPTIFFKFTGTAGGVKEQIDIVRQLARRAGSQSFDFAKDDAEQAE
                     LWQARKVALWSTMAQRRPGDRVWTGDVAVPMSRLPDIIEQTKKDFKTSGLTSSIVGHV
                     GDGNFHVILLYSDAERKLAEDCVHRMVKRAVELEGTVTGEHGVGLVKRDYLPHELGET
                     TVDAMRKIKAAFDPLCLLNCDKVVRVQKPARGEVAEW"
     gene            complement(718509..721184)
                     /locus_tag="THITE_2120758"
                     /db_xref="GeneID:11519251"
     mRNA            complement(join(718509..720751,720971..721184))
                     /locus_tag="THITE_2120758"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656271.1"
                     /db_xref="GeneID:11519251"
     CDS             complement(join(718729..720751,720971..721086))
                     /locus_tag="THITE_2120758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656319.1"
                     /db_xref="GeneID:11519251"
                     /db_xref="JGIDB:Thite2_2120758"
                     /translation="MVYRWRLYRDICYRLYVEENKSLDEVIQYMREEHNFTPSRRAFQ
                     TAFSGWKFPNKQNPLYKNEQFVARVRELWERNVSQKDMVAILVSEGYEVGEREVARVR
                     ARHGWKLRSSVSTYGMVNPARQQTQAPDDDGAEGDAAQHDRDNGVNGLDNGHDQGNEP
                     QGGYYDYGASGSGSGGGLSPADAQVQDETLDAMREARREYRKRLYEIESHERWLAKKR
                     RRHTRPYGGLPADPPGPPRFPSETTLTEAKDILQLDDKAYKMVREKFHSICENAGVYK
                     KTLAGPERWEALKDQLVRESMHLRAVLWDPADMEKKKLAIEIIACDVTKRMRVVANGI
                     NTTDAKVILGLNPDQARTIRAQLYNILAQEKFTSKFEEGVEYFETLKQRWIASSPELS
                     SVVAAGPADPDHARKMRAINALCRETTRRYRDAARRMGGPPPVLQPPKPKPRKRKPKA
                     PKPDRKQSAETAGNQAAQAAPTPGAESVLETPGPTEPAEPAPSAETAPPAETAPLTET
                     APSAETAPPAPPAPPAPPAPPAQPRRRGRPKGSRNKPKPLPHLSSRLVLAEPGEPQTD
                     QEMVDAQLGANAPAHAPAAAQTPQANGQPGQGHGAATREQTTTTAAPSNGPIAVFFRL
                     NSSSMVFFRSAPRQWICPLESRTIAALRSAAVQKTPGALCYKIEGIVKDGKGGELPLP
                     VSDQVELDTYLQHVEGQGAPTFEIHVVPGE"
     gene            complement(721371..>723666)
                     /locus_tag="THITE_2096993"
                     /db_xref="GeneID:11519252"
     mRNA            complement(join(721371..722474,722533..722653,
                     722710..722726,722783..723287,723368..723470,
                     723533..>723666))
                     /locus_tag="THITE_2096993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656272.1"
                     /db_xref="GeneID:11519252"
     CDS             complement(join(721504..722474,722533..722653,
                     722710..722726,722783..723287,723368..723470,
                     723533..723666))
                     /locus_tag="THITE_2096993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656320.1"
                     /db_xref="GeneID:11519252"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Thite2_2096993"
                     /translation="MAPQNRRFANHPGAKEAPASALEYRQEKDKNPALRGLPLVVASI
                     IAESSEWIRKLLWANANFGQPRLISDLEGVPWRIHPNVIPLADDSAPAAGMLELGPEL
                     QQPQPADLAGRFYSAADYHALYKSGQATPLQVAEALLPLIRRDVQEQSKYAVAWTQSN
                     VDEVLAAARASTERWAAGTPLGILDGVPFGVKDDVDVKGFVSTMGMKVDKTQEYFNKP
                     AKETAWPARRLEEAGAIMMGKMNQHEVGMDTTGCNPATGTATNWYNKSYYTGGSSAGA
                     GSALSGGLVPITVGTDAGGSVRIPTAFCGVYGLKPTHNRTCGMSSSVCVVGPMTATAA
                     DLTIAYRFMAQPIPDDPAQNLFAVSTPPDPSAPKYLGICREWVATASPDVQRIYDAAV
                     AHLTSRCGYTAVDIRLPFLREGQIAHAATCLTEAAADARGRTRNPAHYLRLLNRPNRI
                     NVGIGAQTPAADYLRYGQLRQVLMQHLAFLFAAHPGLLVLTPTTPMAGWPRHAGDDAY
                     GSSDGNQTIRSMRFVWVANMSGCPAVTCPAGYVEPAQGEGMLPVGLMAMAEWGMEEQL
                     LGFAREVEGYLNEAYPGGRRRPEEWVDVIGLAKEKAAKDNAAKRGSEYLR"
     gene            complement(725556..727231)
                     /locus_tag="THITE_2120763"
                     /db_xref="GeneID:11519253"
     mRNA            complement(725556..727231)
                     /locus_tag="THITE_2120763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656273.1"
                     /db_xref="GeneID:11519253"
     CDS             complement(725586..727064)
                     /locus_tag="THITE_2120763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656321.1"
                     /db_xref="GeneID:11519253"
                     /db_xref="JGIDB:Thite2_2120763"
                     /translation="MAFLGGQPGGVANKITKSKGKVVKPILKKLSHSEKNSLDLDRGW
                     DEQQVEQLVGDDWEAKDVSFGFAGGLGANDSIVAAGAGSGFRPNPKFQHGRSGSQTSA
                     GSGPRGGAFVHPFAQTPRTSTPPLSYANSLASFDNGRDCSPTITENEDNSDFQATATP
                     NLHSHAHSHTFSQPQLPAASQSTLRRPSLNSQRTSSFPDIPASNPPSLRIITGRSVSG
                     TTATSSRFVPGSLPTGSHSDLHVNAHSLSVSAVDTLDSPTGSLRCGGSVSASHQQQSH
                     LPPLRASLDMGQFPRLRSRSELDTATRQENIRIARRKFEERERAKEEKYDREMIRKRE
                     RRENKEATRIEKGEAPSRPSFHRKRTPTALSTVSAPTGAGVGANSSPVGGLFAHSTSR
                     LASSAPAKSGGVGLGIGRRRHTDNEATDMYAQTEKPVGFASRRYDSVPVEAPPSFGVT
                     VHDVQFEQTRPRRGSSAKRKTQSYWHGFLLWLRTKLLRLSRH"
     gene            complement(<727770..>728368)
                     /locus_tag="THITE_2091489"
                     /db_xref="GeneID:11519254"
     mRNA            complement(join(<727770..728044,728135..728259,
                     728331..>728368))
                     /locus_tag="THITE_2091489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656274.1"
                     /db_xref="GeneID:11519254"
     CDS             complement(join(727770..728044,728135..728259,
                     728331..728368))
                     /locus_tag="THITE_2091489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656322.1"
                     /db_xref="GeneID:11519254"
                     /db_xref="JGIDB:Thite2_2091489"
                     /translation="MAKIAKTGPPGAVASLTAGKDAHSASLVADRRHNNTAKTSGEKH
                     AQPATSTTLPSNRSGARHPVFRFPRWLPISPTRDGQSVWLTNKGAVTGAGTAEGCRPL
                     TGRLGVQGPRARWCPPRAQAPGKTPLPTPPLPHSRSSPVGQRE"
     gene            <734433..>735485
                     /locus_tag="THITE_115271"
                     /db_xref="GeneID:11519255"
     mRNA            join(<734433..734510,734765..734913,735114..735307,
                     735337..>735485)
                     /locus_tag="THITE_115271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656275.1"
                     /db_xref="GeneID:11519255"
     CDS             join(734433..734510,734765..734913,735114..735307,
                     735337..735485)
                     /locus_tag="THITE_115271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656323.1"
                     /db_xref="GeneID:11519255"
                     /db_xref="JGIDB:Thite2_115271"
                     /translation="MSADLRGPTLLAAHTWIPATLTVYTQLMFDAGIRFQSLLSAANV
                     PICGQECRTTPRALKTSECVLRTYQHFDGTVLSNPVGDFQQRPNSPRGGTRTYATVHW
                     DPDPDLVKTSPTAGYAISFHTEVLTKIPYRGCIREPVLLIQGNCTWDGRGLSSIPATV
                     FSFANHTIATAGHAAVDDSEGHALYSGGT"
     gene            737817..740087
                     /locus_tag="THITE_2120767"
                     /db_xref="GeneID:11519256"
     mRNA            join(737817..738131,738270..739151,739222..739516,
                     739603..740087)
                     /locus_tag="THITE_2120767"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003656276.1"
                     /db_xref="GeneID:11519256"
     CDS             join(738046..738131,738270..739151,739222..739516,
                     739603..739875)
                     /locus_tag="THITE_2120767"
                     /note="CAZy_ID 269897"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003656324.1"
                     /db_xref="GeneID:11519256"
                     /db_xref="JGIDB:Thite2_2120767"
                     /translation="MSALMDIVIPRPEFLYSTKFWAVFHTILWLHRYVRLLVHCVSHW
                     TYKSKMPNWEKPKYTSKDVTVIIPTIHNRPEELRPSLESILACQPAKLILVTTWNKHE
                     ALRRVTATLQMPDPACPVEIEVLHVDKANKRLQVCKALEDDHVRTAITVMADDDVEWP
                     PTLMPWLLAPFEDDRMGGVGTCQRVKRVFDGDVVTRIFNWLGAAYIERRNFEISATHN
                     IDGGTSCMSGRTGAYRTEMLKSYDFLGSFKNEKWGRYILNADDDNFVTRWLVAHQWKT
                     WIQYEPECEIETTLENSTKFLYQCSRWARSNWRSNWTSLVRERYVLTQQPWCTYALHI
                     ATFTSLAFVVDPLLLFSCWWGTENWEPRNRRILLWAEIAFMFGFTKVVKLVGLFRRNP
                     SDIVFLPVSILFGYFHGLIKLYALFTLKETSWGSREDGDEHNTFRLQEKPVRSQSMAT
                     PHGPGLPKSMRHARFSQAKRVAISSSGKQGFMSYALAAATDVAYPKATGSPMYDDIDS
                     ADD"
     gene            <744475..>745985
                     /locus_tag="THITE_115269"
                     /db_xref="GeneID:11519257"
     mRNA            join(<744475..744534,744614..744667,744839..745119,
                     745217..745246,745501..745619,745661..745827,
                     745935..>745985)
                     /locus_tag="THITE_115269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656277.1"
                     /db_xref="GeneID:11519257"
     CDS             join(744475..744534,744614..744667,744839..745119,
                     745217..745246,745501..745619,745661..745827,
                     745935..745985)
                     /locus_tag="THITE_115269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656325.1"
                     /db_xref="GeneID:11519257"
                     /db_xref="JGIDB:Thite2_115269"
                     /translation="MPPMSARCCRRRVSLGALLAYFRTYLLDYVDSVTWPHTSCTKVC
                     WWNDRLGAGSGPDEFWVPRQLSRAGPGLNGREGNYTEGPEYMAEQASVWCYHAAAHSS
                     LICGRLRFLVTGLFRLFFEPFRQHRITPLLIPYSVFPTVAVAAVGTPSWESGLSQFCG
                     FLRFPLPASPRKMRKWHACSLVITPLPDLDSNAKEVELSGAKPRPLRIKRSGRQYRTG
                     RLCLVLEDRYYSPESFGIHVWTECASLTNASDTRA"
     gene            complement(<747380..>748927)
                     /locus_tag="THITE_46464"
                     /db_xref="GeneID:11519258"
     mRNA            complement(join(<747380..747697,748043..748232,
                     748488..748663,748730..>748927))
                     /locus_tag="THITE_46464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656278.1"
                     /db_xref="GeneID:11519258"
     CDS             complement(join(747380..747697,748043..748232,
                     748488..748663,748730..748927))
                     /locus_tag="THITE_46464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656326.1"
                     /db_xref="GeneID:11519258"
                     /db_xref="JGIDB:Thite2_46464"
                     /translation="MSGLAGRRPGLASSASSPDIFCRPMEPSPAPLVYINGWHGTGKK
                     TVAECLTLLLGRDKSLLIDVRGHGHYHDRNHNPLLTPEHPRYFSFDLDCGPDLTPSTS
                     SRSAFISPASTTTTNDPSASAPTAENLALLLTHPRNRARLAVLPACAPDTPAGRATLR
                     TFEAAAARAGRLFAPVALTCAPGEHARRESGEQETASFPSLPGMQTGPAMGVGMGVGW
                     AKGQGLAAPMNAGLTVDVTRVAAFEAALQIVEYVKGLEAEREAELCSAGGSPASTPGN
                     SPESARAWTSLRLGGQQ"
     gene            complement(749532..751355)
                     /locus_tag="THITE_2081166"
                     /db_xref="GeneID:11519259"
     mRNA            complement(join(749532..749919,749986..751355))
                     /locus_tag="THITE_2081166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656279.1"
                     /db_xref="GeneID:11519259"
     CDS             complement(join(749720..749919,749986..750973))
                     /locus_tag="THITE_2081166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656327.1"
                     /db_xref="GeneID:11519259"
                     /db_xref="JGIDB:Thite2_2081166"
                     /translation="METQTRSRPELRPVWTGRELHPTHPRPSPLSATSPLYSASLHLP
                     SPMYPASPSYDQAMRAHERALVDRLDRLDQRGKRESQPSPTTARSLSSVSERTLSARR
                     PSAASLPIPRAPEPSPRSPGFPQYPRRQTLVAEARSILLSGLPDGLPDGLPRTPTDTA
                     STLADRRQSLPPSFHSQRRRSQQLLQELRDWGRVYFCNADARVADCFVAAVALRRPSD
                     SSSPDDEALAVKDELTTKRRHRVTIRARVRPCALHQKPFLIRRTFDMDELRATIPEPL
                     RLSSAPRRPSAELPSRGTLPTNQRGTSAATSAEQDLDLEAAKSPVRSINTLPIHLKYA
                     RAFFPVLAALLYSGHIQKGDIIDLPLPYPEAWFQTVAHVYTGQGELTEAMKQNILYLG
                     GKV"
     gene            751782..753737
                     /locus_tag="THITE_2120772"
                     /db_xref="GeneID:11519260"
     mRNA            join(751782..752229,752298..753737)
                     /locus_tag="THITE_2120772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656280.1"
                     /db_xref="GeneID:11519260"
     CDS             join(752095..752229,752298..753683)
                     /locus_tag="THITE_2120772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656328.1"
                     /db_xref="GeneID:11519260"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="JGIDB:Thite2_2120772"
                     /translation="MANAGTSTNVTAAAARTYKQLKEDFVSNLSGGSVTEIAQVCAVA
                     PVVALLWSVLQARQSFFKPYTALAFVVDFLLNVGALLLSVTLYSSAPLLLNILLLTAA
                     AFVCAVPTALPSGRKKKPQLPPNAQSKTPPGPPGVLSTKPFLTNYRGNMLVVTCICIL
                     AVDFRLFPRRFAKVETWGTSLMDMGVGSFVFSAGIVASRPVLKERAEGTTTPLATRLA
                     RSLRHSLPLLALGFVRLLSVKGLDYAEHVTEYGVHWNFFFTLGLLPPFVVLFQSALKL
                     VPSYAGLALLLGVLYQVVLESTALKAYILAAPRTDLLSMNREGVFSFWGYLAIFLAGQ
                     DTGMLVLPRNPTIRGFAGRSKRFALLLSLTAWSLVWTALYFFCTDYAYGAGLTVSRRL
                     ANLPYMLWVVASNSTLVLAFCLVDVLCFPAFYRAPDAKAEKEAHDAATSRVLRAYNRN
                     GLAVFLLANLLTGLVNMTVRTLDVSSVTTMAVLVAYMTVLTAAAVGLDMYDITIKL"
     gene            756622..760808
                     /locus_tag="THITE_2120775"
                     /db_xref="GeneID:11519261"
     mRNA            join(756622..757946,758013..758606,758666..760808)
                     /locus_tag="THITE_2120775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656281.1"
                     /db_xref="GeneID:11519261"
     CDS             join(757242..757946,758013..758606,758666..760612)
                     /locus_tag="THITE_2120775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656329.1"
                     /db_xref="GeneID:11519261"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2120775"
                     /translation="MSSRAAVASPVPVPVALPAGSPSPHNANADHRRTMPAAVPPRTS
                     SSRRAQTTERTTDASRRTHTDSSRDANGRIDAAEQSSRSRRANQPPQDQHGPSGARDG
                     RGNPSTTSATTAAPLLSPPPNSNPADGPSREASEILNSVLISPPEVDIEREKERSALA
                     QPRQVSSLPDDDAAPPPIVAMADPAEETRRGGRSRHDHSRREKQTKFGEYILGNTIGE
                     GEFGKVKLGWKQEGGVQVAIKLIKKDQLGNNPTRMAKIMREVAILQQLTHPNIVKLHK
                     MEESERHYGIVLEYASGGELFDYILNHRYLKDNTARRLFAQLVSGVGYLHKKGIVHRD
                     LKLENLLLDRNRNIIITDFGFANTFDPNEELTEEEEMNLTDREFVKRMGLDKVKPNGS
                     RKGDLMQTSCGSPCYAAPELVVSDSLYTGRKVDVWSCGVILYAMLAGYLPFDDDPANP
                     EGDNINLLYKYIVNTPLTFPEYVTPHARDLLRRILVPNPRKRADLFEVARHSWLSEYA
                     HVVEFITSSTTSPKDIQNTTVPPEDEDIPILARSASVRESTKKTTAAPAIGGLVSKQG
                     TIDADADAAYAKQQRDNKRRTVQVEYVAPSTATQRGEPSGTQGSSSRTRARSGSQGAV
                     DVSESAPLSAPTEKPLPREPIATGDAYGKTPVASRRPPSAHRNAGSSAAAARGGREAA
                     FMTAVPSPGARPATGGSIQSTSSRGPGAGQRPSYSQPVPPEVADTNAHGRIQQPPRGG
                     SSYGNPASASQGQNEFGRPSMSLPPKFARLSGFADQTPGGTSSGEVKGHKRSSTMGEI
                     SSKLFGRSGSLFGGRSRKRSEQQPAGEKGKRYPPVSMNNSILGADEGRQSMDSKRSRK
                     SFSIGLGKKASGSISGSQKSQEKHARRFSFIPGSFSLKSIGIGKDENRPQLDSQQDLP
                     IQEPPAVDQYGRYVEQDIGREQPVEASTLDGMWAQLHEPRASPDPYGHRQQYPSNGYG
                     HPSASQGHMPPALLSGGSEASVDRVHPAHGSAPQLPQTPQQDGGYDGRRVASGAAKPG
                     RGVLQKNKRFVDAWDTDSYSRGRDHSGSSGPARRVMDFFRRRGKARGGEIS"
     gene            complement(762103..763316)
                     /locus_tag="THITE_2120778"
                     /db_xref="GeneID:11519262"
     mRNA            complement(join(762103..762250,762308..762739,
                     762846..763316))
                     /locus_tag="THITE_2120778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656282.1"
                     /db_xref="GeneID:11519262"
     CDS             complement(join(762485..762739,762846..763121))
                     /locus_tag="THITE_2120778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656330.1"
                     /db_xref="GeneID:11519262"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2120778"
                     /translation="MAPDEMEIDEAVPPQAPGNNSSSSNNDISAAKLAAMQTRTKATA
                     VRSIEGWIVMVTNVHEETDEEAIHDKFGEFGEIRNVHLNLDRRTGYVKGYALIEYTTL
                     EEARAAIDGANGTQLLDQTVQVDFAFVRPPPGKAIARPGGGGGGGGGPVRGSNRGARS
                     GRSRSRSPGAPKEDVL"
     gene            complement(<771448..>772361)
                     /locus_tag="THITE_2091498"
                     /db_xref="GeneID:11519263"
     mRNA            complement(join(<771448..771777,771832..771898,
                     771955..772176,772243..>772361))
                     /locus_tag="THITE_2091498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656283.1"
                     /db_xref="GeneID:11519263"
     CDS             complement(join(771448..771777,771832..771898,
                     771955..772176,772243..772361))
                     /locus_tag="THITE_2091498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656331.1"
                     /db_xref="GeneID:11519263"
                     /db_xref="JGIDB:Thite2_2091498"
                     /translation="MPSSARLAALEKARAAKAAKNKPPPLPATPTKAGAGASKKTPAT
                     PKTPSKRAAPPSSSSSSSEDEEEEGALREQPCLGCLKSAMRGKSSGECREAPGKAARC
                     ARCARGKKCRSIVLPAAKHFLALMQGRQEPKANLDQKTLRATLRALLAMEGEDADAED
                     DDDDDDERAPAPAKGKGKGKAKAAAPTKKSKKAKKAKKEESEEEDEDEDESEEEAAPG
                     FDPEALARGVAAAVLAAMTPKKKKGGK"
     gene            complement(780463..781761)
                     /locus_tag="THITE_2120786"
                     /db_xref="GeneID:11519264"
     mRNA            complement(join(780463..781021,781136..781324,
                     781411..781431,781493..781600,781673..781761))
                     /locus_tag="THITE_2120786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656284.1"
                     /db_xref="GeneID:11519264"
     CDS             complement(join(780645..781021,781136..781324,
                     781411..781431,781493..781556))
                     /locus_tag="THITE_2120786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656332.1"
                     /db_xref="GeneID:11519264"
                     /db_xref="JGIDB:Thite2_2120786"
                     /translation="MDKLLGKAVEKVFGDDDERPEGHQGGGNMAHGGAYPAGGGYPHP
                     GDDDLHGAASAAASHAPEDEDFFSNVIGKLLQNKSMSQVAEEDIDEEDAVQSHRKFFG
                     SSSSSHHEEQASSSSLGSAAAMQALKLFTSSSASPSGHNQSQNALVGLAMAEASKLFD
                     AQASQGRVAAGADKQSAVMKAGEMALKMYLKSRGLGGQEGGAGGLGGLVALAGKFV"
     gene            complement(782240..784570)
                     /locus_tag="THITE_2120791"
                     /db_xref="GeneID:11519265"
     mRNA            complement(join(782240..782414,782468..783605,
                     783674..784570))
                     /locus_tag="THITE_2120791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656285.1"
                     /db_xref="GeneID:11519265"
     CDS             complement(join(782251..782414,782468..783605,
                     783674..783754))
                     /locus_tag="THITE_2120791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656333.1"
                     /db_xref="GeneID:11519265"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Thite2_2120791"
                     /translation="MDPLCPAVSSLTFGVPMGLGPDITALQVNIDPAQSHVLLDNSLF
                     LALDEAMAMSLDPSGPLPKSFATASAQPSSTSYSPPDSTAANPENTANPAREGVGAGS
                     ASNPGTLTDFTKRRNWPAKVVEELQDVLHILDANGRIKHVSPSAERLTGYRPAELRGI
                     FMQKLLHPDDVGVFTAELNESIASGTPLRIFYRLRKKDGTYAVFEAVGHGHIAAAKFA
                     PNPENPTPFCQAVFMMARPYPTKNAALLDSFLEHKMENERLKRKIAELRREEQEEAEE
                     SERAWFQSQEATPSDGGGMPLGAMPLQPGMEFSGLPQERRMSVDSGTAERTTVPGTRR
                     PSATASRADTIEMLTGLRYQEGERSRGISTGNPNPSLITGEAGIATSEEGDQRAGEKK
                     KKLKLAEEYVCTDCGTLESPEWRKGPSGPKTLCNACGLRWAKKEKKKSGHTGTAGATE
                     HHAHETETAG"
     gene            785977..786053
                     /locus_tag="THITE_t128"
                     /db_xref="GeneID:11519266"
     tRNA            785977..786053
                     /locus_tag="THITE_t128"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:786009..786011,aa:Thr,seq:agt)
                     /db_xref="GeneID:11519266"
     gene            786083..786159
                     /locus_tag="THITE_t129"
                     /db_xref="GeneID:11522628"
     tRNA            786083..786159
                     /locus_tag="THITE_t129"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:786115..786117,aa:Thr,seq:agt)
                     /db_xref="GeneID:11522628"
     gene            complement(786200..786855)
                     /locus_tag="THITE_2120797"
                     /db_xref="GeneID:11522629"
     mRNA            complement(join(786200..786690,786746..786855))
                     /locus_tag="THITE_2120797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656286.1"
                     /db_xref="GeneID:11522629"
     CDS             complement(join(786227..786690,786746..786761))
                     /locus_tag="THITE_2120797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656334.1"
                     /db_xref="GeneID:11522629"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="JGIDB:Thite2_2120797"
                     /translation="MGKRSQFAVSLPEGCWFNNTSDTWVRGPLPSARAELFVAGRELA
                     NMYEEENDSFEQRRKFVEQLRAKEGRDGDVSSSEAAAGGVVDESYVYALASGLPPTGR
                     WGCGVERLVVLFGGTKRISNCLMSRWPRIQAIGTVLIIPAPHPACQPDWRPVRLARG"
     gene            787408..791523
                     /locus_tag="THITE_2120798"
                     /db_xref="GeneID:11519267"
     mRNA            join(787408..787619,787674..791523)
                     /locus_tag="THITE_2120798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656287.1"
                     /db_xref="GeneID:11519267"
     CDS             join(787497..787619,787674..791486)
                     /locus_tag="THITE_2120798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656335.1"
                     /db_xref="GeneID:11519267"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="JGIDB:Thite2_2120798"
                     /translation="MSRIEKLSILGVRSFGPQHPETIAFNSPLTLIVGYNGSGKTTII
                     ECLKYATTGELPPNSKGGAFIHDPNLAGEKDVRAQVRVSFRSTVGESYVITRNVQLTV
                     KKNTRSQKTLEGSLLLRNNGERHLISTRVMELDKLVPEKLGVSPAVLDAVIFCHQDES
                     LWPMSEPAALKKRFDEIFEAMQYTKLIDNMKVLRKKKGEELSRLKLQETHDKQNKEKA
                     DEVDRLMSRLTREIQEARDRCNELLQKMDEESARIKDKYEQANSFLAVMNNLQTKKEK
                     LEYKNEAIEVLRGRIEELPQTDQVLETILNEYEETYQHTVSARDSKAAQFHQLQAELK
                     LAREQHTAKAAEQGKHQSDKDKYERQLETRDRMIHDAATRHEIRGYDGDLDDRRIAAF
                     NERIQKILSDKKRELERLQRDNADEFDKKTAIITDRESRKASLIRDRSSAKQRIVTVG
                     KESATLQAELSSLDIDEGTEAVLRTEMKELEARIEMTKTEEQRADLDAQIKKANDDIY
                     RLEAQSSKLARELVECTRLASERAQLDLRKKQLTERRRELDILKSTWEAQLSALLGSD
                     WQPDTIETEFQNALKRQNTEVAECRKQKDATQQELKQVEYKLSNARERHNRLSTEKED
                     CKRAVTKALKDVRNPDSPPIEDYTKEVESIEAELGQTETDLKLYDEMKKHYVSIRDRA
                     VRFNKCYYCERDFKDQPAAKSKLLDKIAKKLNDEDKQELMDDQVHFTDQLKTLRAVRS
                     QYDTFLRLEAELPSLNKEISLASSQREGLIRRLEDQDLAFREAEDKRQEIDALSKHVL
                     KISQTHKDIMDAERQVERSQQSSSITMRSPDEINEEQTACAEQTRLAQAKVSKLTTER
                     QRLKDLAAQLEVERLELKHKISTAVQRLERKKSLQESIRRCKEEQSQLRDAVQEADKE
                     IERLEPEIASARAALEEARQQGRAKEQKVAEERDGLATTVSELKMINSEIQDYLDRGG
                     PSNLASNQRAIASLETTIENLESEARDLTVQINKLTKDIDNSNAKKRNIADNLTYRKN
                     LREREVLQAEIEELQSRNAHEDYDRLTQEARYLESSRAKLAAERERLMGSMASKDAEF
                     ARLNDQYEIELKGALDKYLETHVLVETTRAAIEDLGVGVTALDKAIMHFHSMKMEEIN
                     NTIGELWQSTYQGTDIDTIQIRSDVEAGAGSGPGRRNYNYRVSMIKGDTEMDMRGRCS
                     AGQKVLASIIIRLALAESFGINCGLIALDEPTTNLDSDNIRSLAESLHAIIKARRSQS
                     NLQLIVITHDEEFLKHMQCSDFCDDFYRVKRDEKQNSVIVRESITRIMG"
     gene            complement(791818..794156)
                     /locus_tag="THITE_2120800"
                     /db_xref="GeneID:11519268"
     mRNA            complement(join(791818..793743,793808..793856,
                     793926..794156))
                     /locus_tag="THITE_2120800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656288.1"
                     /db_xref="GeneID:11519268"
     CDS             complement(join(791902..793743,793808..793856,
                     793926..793996))
                     /locus_tag="THITE_2120800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656336.1"
                     /db_xref="GeneID:11519268"
                     /db_xref="JGIDB:Thite2_2120800"
                     /translation="MAEVETTSCDDVLRRAAQDGSMDYAVWPDLLPVLLARIENIART
                     EFPIPNIPSPHPPARPPSPRFLAPLPSSDPFDTSDQAEPSPSSQGTDKENAHPSSPSA
                     SRHAAPSTSASAGGPSSQPSAPAPLPKPIADMLDEILAVLRSNFSQYPPHTIQRLAEL
                     VLQPRQHYRNVVPYLHALDRVVHVTSGANTYPLPPALPDIGAMSLLANGAGGGAAGNL
                     SVDTLAANSLGSDEALGGALLTPIPWLARSANGGSSDDGSDVDSSSPLSAGGNPAQQF
                     HLQQQARGAHLEGRVQTESTETIEGPNGIGSIETVSVSVNGIPSTGAGAALLGQRSVT
                     QGELLRQEQRAGLVPRNQINRQQQQQQQQRHAAESGTSGDADDDAVMSENVPQEEDEI
                     PHARGPEVIGLADTGPLSAAAASYIASGGSGGGGGPKNLQGMDVEVAVGQRLQSPPAQ
                     QQPQQETNKRTSSSPDIVPRSPKREATGNLEQESPRKRLKEEEPASSASNGGGQDQNQ
                     GLAQLATSPPSSDTRSTTTITATPATHGAQAGAPAKPDAEGDVTLPDAQQQPEPPAPD
                     PSTGEATTQGGDGGNDGDETTSTTTTTAPVKGAEAADKADGEGESTAEQDTAGATTTT
                     KTSSAPSTATVTTTAAAADGGAGPERTGG"
     gene            <796445..797885
                     /locus_tag="THITE_73567"
                     /db_xref="GeneID:11519269"
     mRNA            join(<796445..796585,796824..797117,797185..797885)
                     /locus_tag="THITE_73567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656289.1"
                     /db_xref="GeneID:11519269"
     CDS             join(796445..796585,796824..797117,797185..797679)
                     /locus_tag="THITE_73567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656337.1"
                     /db_xref="GeneID:11519269"
                     /db_xref="JGIDB:Thite2_73567"
                     /translation="MASGIAAGSSRSRTSLFSTEFLVPKWAKLFFLVVGLQALICVAF
                     ESYIIGLCVANLAIFIYAVLQIDQIDNSISRLLQAGALKPDADDSDVWAFARPFLIAV
                     PAIVGVVTVLMGGIAYKLYREFAWDILKLIGADYRMKKRFLHYQIYIALLKFDFFFFL
                     GFTVQFLVIVNGISDAEMGLHIAAIPVTIAILLCAAFFTQRENRIGMCLVILLYFGGL
                     AYFFFKLVRIYQPGHSQDYVAVRRSLTAFAVLTIILIILTIINAFICMSNFGAGLKAH
                     LVRPRGPDPEKEDANSYQMNDHKPQLPSRMTID"
     gene            complement(799037..801088)
                     /locus_tag="THITE_2120805"
                     /db_xref="GeneID:11519270"
     mRNA            complement(join(799037..800379,800458..800591,
                     800679..801088))
                     /locus_tag="THITE_2120805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656290.1"
                     /db_xref="GeneID:11519270"
     CDS             complement(join(799354..800379,800458..800591,
                     800679..800820))
                     /locus_tag="THITE_2120805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656338.1"
                     /db_xref="GeneID:11519270"
                     /db_xref="JGIDB:Thite2_2120805"
                     /translation="MDSAKEKLTSLLDELSKASKLPRLSAAAQDVDKIIELLSEAREQ
                     IANGMDPHMASLTMTKLQNPIRTAFDKVNDSLKAASSTHKKIGRSLDKHFPLKPLPSD
                     TDTMAKHIPLINRAIAMHLLREGQFGVAATFLDETQAKHPSSASSRPDDRMVQDGDEA
                     VADGEDGMDGSGDADFSMLHSHELQDRFTEMYSILQELKTHNLLPAIEWARANSAELE
                     ARGSNLEFELTKLQYIWLFKGPAVNGLPDDENNGQIGALTYGRLHFGRFQGRHMREIQ
                     RLASAMVFAPNLPASPYHDIFSIDSAFADVASSFTREFCSLLGLSAESPLYLAATAGA
                     LALPQLLKYTLATRARGTEWTTAQELPYETPLPQSMLFHNIFVCPVSKEQTTAANPPM
                     VIPCGHMLAQDTLQKLCKGNRFKCPYCPSEGLLKDARPVVL"
     gene            802248..805310
                     /locus_tag="THITE_2120806"
                     /db_xref="GeneID:11519271"
     mRNA            join(802248..802653,802735..805310)
                     /locus_tag="THITE_2120806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656291.1"
                     /db_xref="GeneID:11519271"
     CDS             join(802436..802653,802735..805219)
                     /locus_tag="THITE_2120806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656339.1"
                     /db_xref="GeneID:11519271"
                     /db_xref="JGIDB:Thite2_2120806"
                     /translation="MSLRFGLPTAALDNRVHREEELTLARRASQLRNAKAASPEAPGG
                     ASAATSSALAAPPPRGRRRVVLPDPVAFRFLEGDPTVTVVERRRVLPGYELYLVEQWA
                     CSRQSPTVVIATYTGDTKHSVVVGVLEVPADEKDWLPRLRVYFKAIHQYHARPKETEI
                     GELMVTNLSSFPSALTVIAVPEGDIRKHRQVFIVNENLKRLGCSGRSGLTLTEPTPAT
                     QAKFMQTYKTSDRIPFDQAVLELVKLCQLALFIFGMLEEEYMDGLLCDVTEKAINDWW
                     TEIGSEYFNIEPTDGILGPTTVAALLGTLLGARNRLSYYGAPVSKDVFDIESTKKGIG
                     TFQKSLRLERTRRLDRQTLLKLHSVTAKAAAGEGGWGVQKAVKSTVAEIGGKRGEFVI
                     GMVGGRDKANIGDIETLDLAKFISLVYGERPKWLWYGKPRRTLQEHSPEHPVSAFGKE
                     LRDEVGPPLGNRRTQSASVEEELEARKKEDPPAVYQPPPPTGSLPIAAETPGGDRDAL
                     RKAVFKSVAGKVSDARSGLGRIRDAVGGGLRGHVSRPSKDESPDTAMSGYSSPSIATL
                     AQSSAAVTSPVAVGRAFTWKVKPEEYLAALRDGERGEPAPAIPLPGGNKTDEPLAAPQ
                     GGAHLPPNLLATHDEKERLDLGLAEMAKEVRSTNVSAPGSVVADGDLQGPVLALERSS
                     GGPRLSLQRRHSAGGTLCSSRFNEARYPRRLSFSAAEDAVLCWDEPIKFTDAPAAGDL
                     AGLQPQAELACYLYGRLQLIHTDIAPWVSNKVSDVSALDQTFDAQQAELQRLHSAAEE
                     AYERVRLGGSEFVAEERGRLGEAVKEVEMLAAKLEYEIGALVSRVDEVEDGIAQFEAQ
                     VEDVERRAEELKRVLETESWLHWFVRTLTGIGTGPNITRGSASS"
     gene            complement(805311..806444)
                     /locus_tag="THITE_2120808"
                     /db_xref="GeneID:11519272"
     mRNA            complement(join(805311..806067,806171..806444))
                     /locus_tag="THITE_2120808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656292.1"
                     /db_xref="GeneID:11519272"
     CDS             complement(join(805887..806067,806171..806268))
                     /locus_tag="THITE_2120808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656340.1"
                     /db_xref="GeneID:11519272"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Thite2_2120808"
                     /translation="MSFLGFGRPQPTSAEKIAAVENELKVVAEMHSRMIKVCTAKCID
                     RTYREGELSKGEAVCLDRCSAKFFEAHQTISEQLQKEGAARGFGGPGA"
     gene            806521..808880
                     /locus_tag="THITE_2120809"
                     /db_xref="GeneID:11519273"
     mRNA            806521..808880
                     /locus_tag="THITE_2120809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656293.1"
                     /db_xref="GeneID:11519273"
     CDS             806917..808701
                     /locus_tag="THITE_2120809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656341.1"
                     /db_xref="GeneID:11519273"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Thite2_2120809"
                     /translation="MRPAPRLQFLRPYTWQPVGPPNPAYLRFFHLARQQELEEANALK
                     YPRLRHNGPPMRIPDFRQKYAHIQQGVVADEVVTLHGRVESVRRAGAKLVFLDLKGEF
                     ERVQGICNFGKLVDGTTVGGLKEFARLLSRGDIISVTGKATRTPAGELTIQATHLPEL
                     LTPSLVPLPTKLIDEESRTQHRHLDMLVNRKTTDTLRLRSYLIKYLRDFFHDRGFLEF
                     QTPILAADAGGANARPFTVSAKTVSRDLSLRIAPELWLKRLVVGGVDRVFELGPAFRN
                     EGIDQTHNPEFTICEFYHAYANLADLISLTEDLIRGAAAHCQSLISTKLTALPPVDLA
                     PFEGPFQQAEFIPALESALHFTLPDLASPTALSDLRALLKQHAIPLDAEAFTTDSLPQ
                     LLDRLAAAYIEPLSAAAPLFVTHHPACMSPLAKGFVCPRTGQAVAARAELFVGARELA
                     NMYEEENDPFEQRRKFVEQLRAKEGRGGGGGEASSSEADGGAAGGGGGVVDESYVHAL
                     ASGLPPTGGWGCGVERLVMLFAGTKRISDCLSFGNLRNVVGVAAAGRAAPEQEQGLEQ
                     QLESEQRLNKEEKVQEERAATSSASEAR"
     gene            complement(809717..811787)
                     /locus_tag="THITE_2120811"
                     /db_xref="GeneID:11519274"
     mRNA            complement(809717..811787)
                     /locus_tag="THITE_2120811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656294.1"
                     /db_xref="GeneID:11519274"
     CDS             complement(809943..811532)
                     /locus_tag="THITE_2120811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656342.1"
                     /db_xref="GeneID:11519274"
                     /db_xref="JGIDB:Thite2_2120811"
                     /translation="MTKIPWSFRSIILDQIPYLDVSMFEMMINSMPNLETVVVSRCLL
                     LDITKLKPLLDVIMRHPRSLKDGSKATNPSCQGTRSSTAAYIRFDFFPFFFKGPNSAK
                     RLGSYGVTWNEPTFNTPKAVFALILRCWELAKEVGMDLVSDSSLFWSFVRQLPGPDVL
                     WAVKAREALLTREYDLAEGKKSKKDIWNSFADDITAALTGDNQKHPKAPERMARYLPS
                     DHGGPYYWRNKARCSVCNFHYPLSLFPIRPGVCWGCKAESFLKEMEDSHLRQWLRSVI
                     SIWLYNLDPRNTTLNQLLSSNRKPIQDAAEAEAENADHVWRYFVNLPSANNGWMDAKP
                     LYYPPPPPGLAKEVAALIRWLWKCSPATEPFDYREGGPQRKDPCKEPLSVADFQDPDC
                     GGEIMENFNLRWMWSPQTDRVYAEYWVEKNNLPPFTDMRDPRVQEELRSARQDPKKCR
                     IARDLERRAQNKLDKEVYRFHHPLVEDCLYSMGTPGFRPFNLDQPVLDPVVNKKEYDE
                     LIRYQQFQSSPYGYTSMRSNF"
     gene            complement(811789..813020)
                     /locus_tag="THITE_2120812"
                     /db_xref="GeneID:11519633"
     mRNA            complement(join(811789..811995,812109..812369,
                     812454..812507,812577..813020))
                     /locus_tag="THITE_2120812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656295.1"
                     /db_xref="GeneID:11519633"
     CDS             complement(join(811963..811995,812109..812369,
                     812454..812507,812577..813008))
                     /locus_tag="THITE_2120812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656343.1"
                     /db_xref="GeneID:11519633"
                     /db_xref="JGIDB:Thite2_2120812"
                     /translation="MARRKSKGAEARNADNADSTSAAQTRISRTSQPQPRRSKPERVA
                     AGKSAGKVQQCHQVRPKITPVPASAVSCPKTAVKTEQLSVRIRSQAQTSQKKRPTAMA
                     GHKQGANPASNGVRAQLEVPEGYVFKTKKTTKRRNRTKKTTETPIPEPEPVRPWEIDR
                     EYPKPQDDTKSFNYERNKWRSFGNKDAKKEIEKALARGSRARLPQIFPDSTPEQLERA
                     QRIYWSKNERKLYHIRLTKRAEPILSRLFIVRTTTIGWSSF"
     gene            820259..823241
                     /locus_tag="THITE_127481"
                     /db_xref="GeneID:11519634"
     mRNA            join(820259..820751,820805..821000,821054..821757,
                     821816..822173,822240..823241)
                     /locus_tag="THITE_127481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656296.1"
                     /db_xref="GeneID:11519634"
     CDS             join(820456..820751,820805..821000,821054..821757,
                     821816..822173,822240..822476)
                     /locus_tag="THITE_127481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656344.1"
                     /db_xref="GeneID:11519634"
                     /db_xref="JGIDB:Thite2_127481"
                     /translation="MADTQKPAEVPQETPAAEPVAETKPAETAPAETTEAAAAEAAAP
                     AAEATEAPATETAAAEPAAEQAAAAAPAEEAKKEEAKPIEEGHLEHKGQGANFPKNLI
                     YSKQLFWFGSEPVDLKAISSFKADKVTEVAHHITSWAAETGKGLLFYSEKGDKTAPHG
                     VIHLADASEPTVEGSNKFHFTAKGHKHSFKASSAAERDNWVAQLKAKIAEAKELAATV
                     TESETYKKTLASLKPAPVKKEEKAPAATEAPATEEAAAAETPAAEAPKEEPKKEEPKK
                     EEEKPEKEEPKRRSASRKRASIFGNFLGKKEEKKAAEPAEAKATEAKPAEPEAAAAET
                     STAAAAAEAPAAETAAEPAAESAPAATEAAAEPETKPEEKAEEAKKEEDKKEAAEARP
                     AHTKRASIFGGLSFGKKKAPAAAEAAPAKEAPATTEAVAETAPVIPAVETTEPLSTEV
                     ASPAPAPAETAEAAPATNGETKKEVKTEKRKSNLPFAFGKKKEGSTSDEESEKPKSPS
                     AFSKLRATIKGKSKPEKTEKAEEKGEEKAEETPAVPAVPATETEAKPAEPAAEEAAKP
                     AEAEASAAAPAAEETPAKPVETTPAVTAAA"
     gene            complement(823769..828093)
                     /locus_tag="THITE_2120822"
                     /db_xref="GeneID:11519635"
     mRNA            complement(823769..828093)
                     /locus_tag="THITE_2120822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656297.1"
                     /db_xref="GeneID:11519635"
     CDS             complement(824018..828058)
                     /locus_tag="THITE_2120822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656345.1"
                     /db_xref="GeneID:11519635"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Thite2_2120822"
                     /translation="MPGHKRLEGVTTLRLPKGLVSTTSPARSLGTPGSRSSAELSSLS
                     CSRDIWSQPSTIQLLQGIGVVELLEQDERPTFVVDLNDRANFAAASLQLVYVNPALRS
                     APALLKLLQVDAAEPGHNSDFSKFKAWVVRLLHDGPSSNQEASSITYAGFPWACSTLR
                     RRFRVVRGYQTVAPGAASPAPLPSPATDLGSSEPWTGRRLEALRERSDYFGAASQSHI
                     RAQSEPRSRAGSIVDTVVQPFDDLVLAPPQLRTTFDWTQIPIDDPNLDAHHRFARSID
                     WASTALGPVEGWPLELRIMSSMVMGSPHPAALYWGKDYVAIYNEAYISLAGQKHPRLM
                     GSRYQDIWPEIWDEMHPVFEAARECGYATMKNDDALFISRHCPAEETFFSWSIIPLVG
                     RDGTVVALYNPAFENTRRKIAERRMLTLREIGIRTAQARDVKGFWRQLQKALEYNELD
                     VPFALLYSVREDSESEVSSLSSGNLAHLPQVVLEGSIGVPDGHLCAVPSIDLRSSDEG
                     FAPHMRNSMAHSAGPIVLSEEDGTLPTELVQGISWRGFGDPCRTVVVFPVHPTTAGDA
                     VVGFIVLGVNPRRPYDEDYQLFLNLLSLQLTTSLASVVLFEEEIRRGQNAARLAALDR
                     QELSLQLHLRTQEAVESEYRFTRMAEFGPVGLFIADGHGHIDYCNEMWYRISGLPRDA
                     STLNAWMQSICDEDRPGAELAWRRVVEEKTAVTHEFRFKGSRELMDGQLVDVWALMSA
                     YPERDESGGLKSIFGCITDISQQKWAEDFQKQRRDEAVELKRQQENFIDITSHEMRNP
                     LSAILQCADEISSGLTRYKREDPSANAPGSLNLLIDNCVEAASIISLCANHQKRIVDD
                     ILTLSKLDSNLLLVTPVDVQPVQVVQDVLKMFETELLTNGIDSQLIIEQSYRDLAVDW
                     VKLDPSRLRQVLINLMTNAIKFTQGRPTRSIAISLGASKDVVEDEEGLSYVPAQQPDQ
                     GDIRDDADWADGEKINLHVAITDTGSGMDDHEKQLLFQRFSQTSPRTHVQYGGSGLGL
                     FICRILTELQGGQIAVQSEKGQGSTFAFYVKGRKSVPPRVHSPVRTPSPPDNYATFPC
                     PLHTTPMEPLPPPTQPAITPINEPTQPQPAAAAAPSPPRQPPPPRIDVLIVEDNLVNQ
                     KVLQRQLQLSGSNTHVANHGGEALAQLRRSRFWDEHAAAPEDRHYGDGCGGNANISVI
                     LMDLEMPVMDGISCTREIRRLEAQGVIAQHIPIIAVTAYARPEQVANAKAAGVVSHLF
                     SPPSLLFSGRVLQSSIADRDRRTTSSRNRSASRNSYPRSRSWWSSTPRRRRNRVPDAV
                     SWPRSPREKRREQPAVLERENCFETS"
     gene            830335..832785
                     /locus_tag="THITE_73555"
                     /db_xref="GeneID:11519636"
     mRNA            join(830335..830508,830581..831731,831814..832110,
                     832211..832785)
                     /locus_tag="THITE_73555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656298.1"
                     /db_xref="GeneID:11519636"
     CDS             join(831484..831731,831814..832110,832211..832442)
                     /locus_tag="THITE_73555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656346.1"
                     /db_xref="GeneID:11519636"
                     /db_xref="JGIDB:Thite2_73555"
                     /translation="MGSYVILRRPWRAKKPLYFGMIPELGGTIALLVLFGLQNPDAFR
                     TLFWRIGFEHGLNSNPNMILYAYANFRPLPSIPFVWSQTLTSFNVAISILSLFVLLAK
                     MIATIMKVFYPVFGVFVGLSLTALYATSVGGQAGPDYADPRYPSPVPWYIRMGCDIAA
                     PYNAVGDCKIAKGAFAATVFMMTLYLCQTAFAIWSMLPNKELDRVESDDEEDGSVRKD
                     KASSSVEMKSSSAPNPQATPFTPRTQAFHTLDRKLPLRDS"
     gene            complement(833033..834970)
                     /locus_tag="THITE_2120825"
                     /db_xref="GeneID:11519637"
     mRNA            complement(join(833033..833194,833260..833833,
                     833890..834520,834579..834970))
                     /locus_tag="THITE_2120825"
                     /product="glycoside hydrolase family 79 protein"
                     /transcript_id="XM_003656299.1"
                     /db_xref="GeneID:11519637"
     CDS             complement(join(833380..833833,833890..834520,
                     834579..834726))
                     /locus_tag="THITE_2120825"
                     /note="CAZy_ID 270200"
                     /codon_start=1
                     /product="glycoside hydrolase family 79 protein"
                     /protein_id="XP_003656347.1"
                     /db_xref="GeneID:11519637"
                     /db_xref="JGIDB:Thite2_2120825"
                     /translation="MKQVTLLYTLTNTRLVSAELPVASSVPHNDVFDGFVSYSIEFSS
                     FPDFAGNKSHPNTYSATLLENIGRISGTKPYIRVGGNTQDYALYDASLPFALNGTVDP
                     ARSPDYPTTITIGPSFFESYNTWEHVKFSHGFNLGLGANRSSGWQTLLDTVPLACKAL
                     GDGKLYAWSYGNEPDLYSTSAQGPVRPPDWNESLYVFQWLNGTRTIKRLIEEHCPELA
                     TDDVYGYMAPDFGGTGNHLKAPATWAAGLDDDKDIKLFSTHNYISGATSPGVTLQGTL
                     MNHAVTKRSVDAHIKEYNAILAQSASRDGVPPLIFGEANSLYNQGRPGLSNTFGAALW
                     GVDFNLYAASVGFKRVHMHMGTNYRVCRLALVLLSVSLPAVRSRCIYVLLGYSTPHGS
                     RSQHPSPQSAPRRPTTAP"
     gene            835848..838066
                     /locus_tag="THITE_2120827"
                     /db_xref="GeneID:11519638"
     mRNA            join(835848..836289,836368..836458,836518..838066)
                     /locus_tag="THITE_2120827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656300.1"
                     /db_xref="GeneID:11519638"
     CDS             join(836161..836289,836368..836458,836518..837902)
                     /locus_tag="THITE_2120827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656348.1"
                     /db_xref="GeneID:11519638"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Thite2_2120827"
                     /translation="MAFLQRALFPASRAVAARSQFRRSALPAIANPFVRLSSTMRPKL
                     RDPSLFKENVCYVNGEWVAAGSGKTFEVHDPATGELIGTCPEFDAQDTEKAIKAAEVA
                     FEEFRHRTGRERSKLLRKWYDLMVENAGDLATLITWENGKPTADAKGEVTYAANFLEW
                     FSEEAPRIYGDTIPSSVPGNRVFTIKEPVGVCGLITPWNFPAAMITRKIGPALAVGCT
                     VVCKAPGETPYTPLALAELAHRAGIPRGVVNVITALNNTAEVGQVLTTNPTVRKVSFT
                     GSTPVGKLLMKQCAGTLKKLSLELGGNAPFIVFDDADIDLAVAGAIASKFRSSGQTCV
                     CANRIFVQRGVYDEFAAKFADKVRAFRVGNGFQQGVTHGPLIHQRAVDKVEQHVRDAQ
                     QKGATVVLGGHKLPDLGPHFFQPTVLTGMTAEMAMAAEETFGPVAGLFPFDTEEEVVR
                     LANATPVGLAGYFFSRDLHRVHRVAEHLEVGMVGVNTGLISDPAAPFGGVKESGFGRE
                     GSLYGVAEYQVTKMVTYGGMGRPLQR"
     gene            complement(838523..839719)
                     /locus_tag="THITE_2069549"
                     /db_xref="GeneID:11519639"
     mRNA            complement(join(838523..838873,838922..839719))
                     /locus_tag="THITE_2069549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656301.1"
                     /db_xref="GeneID:11519639"
     CDS             complement(join(838754..838873,838922..839710))
                     /locus_tag="THITE_2069549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656349.1"
                     /db_xref="GeneID:11519639"
                     /db_xref="JGIDB:Thite2_2069549"
                     /translation="MLEVLAQRRDVLGDKHPDTIASMESLALTYHAQKRYEEAERMML
                     EVLAQRRDLLGDKHPSTIKSMESLALIYQDQKRYEEAEKIIVEVLALRRDVLGNKHPD
                     TIASMAWIAIIYHAQGRYIEAERIKLEVLALRRDVLGDKHRDTIKSMAMLARTYRAQG
                     RHEEAEKIELEVQALRRDVLGDKHPDTITSMASMENSANDRNPQEKATEADKVSLSSF
                     SDRKLYVRSSDGHANDEPDAQSVGTGGEKVSTSGRNDHKESKGRWEIKRTSFDDLDEP
                     SRKPWLPNLQKVAEAEPKPRRRAKSR"
     gene            complement(<840279..>841417)
                     /locus_tag="THITE_131090"
                     /db_xref="GeneID:11519640"
     mRNA            complement(join(<840279..840470,840547..841234,
                     841306..>841417))
                     /locus_tag="THITE_131090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656302.1"
                     /db_xref="GeneID:11519640"
     CDS             complement(join(<840281..840470,840547..841234,
                     841306..841417))
                     /locus_tag="THITE_131090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656350.1"
                     /db_xref="GeneID:11519640"
                     /db_xref="JGIDB:Thite2_131090"
                     /translation="MRAPVSRLSLDRRLAEAPEVKELICQHLADLQEALDDLMHIVNG
                     EVPNRDMTGEEDGQAPSDEASMLLEIITESVKSLFRIGVLVRKTGTDDRFRRAIRSSN
                     AVFPANFDINHAMEKYSKLRLRSAGLLATRVGSAISKRRQFIKYCRDHRLRLGYDEAA
                     VIGDDEAAVIPEPEKVERARTELLSSKASTFHPERIPQGALMSEAFEEEKEEEDDDDA
                     ISLMTASTVSDPTQRLELPKLSDLSADGEQFECPICFTLQSFSQERAWRKHAFRDLKA
                     YVCTVGGKECDSELFGDRNAWFEHELRQHRAQYACNLCSNQQLCSSEQELTSHA"
     gene            841843..844073
                     /locus_tag="THITE_2120830"
                     /db_xref="GeneID:11519641"
     mRNA            join(841843..842357,842426..843006,843061..844073)
                     /locus_tag="THITE_2120830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656303.1"
                     /db_xref="GeneID:11519641"
     CDS             join(841947..842357,842426..843006,843061..843871)
                     /locus_tag="THITE_2120830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656351.1"
                     /db_xref="GeneID:11519641"
                     /db_xref="JGIDB:Thite2_2120830"
                     /translation="MSGFEVAGIVLGVFPLIISGIEKYSELSKRLGLWHQIRLEHFKC
                     LRDLRFHRTVLTSHLRQLLLPLVVDDARVKQLLADPGGAGWKDASLDKALRERLGESY
                     ELYFEYISGVLGVLEDLKEELALDSEVVQDKLSSPKAAMSATRLKNAVTKDGREFQLY
                     RAKFSNREAARKELFAQLQSYNDRLEKLLSTSDRDAQLKQQAAALRQGTKVDPALCNF
                     WKLSAKLFRALASTWGCGCREQHLARLLLQHRTAKKAEFHVAFATPVASQWQIHWTRI
                     TEQLDDGGNGTAAPTSSVASSVPAPAHMPNHRQGRPAKSSMRSRNQATCTELQQSTRS
                     TLTITLTPPPALLHRISILCVSLGQTQNGCCGYLGGDGEDDSRFYVHSVSRRTGDALP
                     SVTLDQIIRGEASQRPTRRQRYTLALILASSFLQLTDTQWLPAASWRKADIVFYSNGD
                     TGDDVSGNTRHAIRLDRPHLSRSIGSDPEDDDNTTSSSAAAVGAIAQSLNQLGIVLLE
                     LCFGKPLEEQACRREWPAGGSEAERRGFDLLAARRWQYEVDEEAGADFSDAVGWCLGS
                     QYRADRWRQEMLRQVVQPLQRCHDYLMGGGGRPS"
     gene            complement(845808..848831)
                     /locus_tag="THITE_2120833"
                     /db_xref="GeneID:11519642"
     mRNA            complement(845808..848831)
                     /locus_tag="THITE_2120833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656304.1"
                     /db_xref="GeneID:11519642"
     CDS             complement(845966..848701)
                     /locus_tag="THITE_2120833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656352.1"
                     /db_xref="GeneID:11519642"
                     /db_xref="JGIDB:Thite2_2120833"
                     /translation="MLSRPTFSIRKLIPSPQKKQHDGPEDYEGSYFYHDDDDEMDTLS
                     KIKTWRPPMGLIKRSKPSIEINRSEELHRIVGIPPLPDTPQSSTTSLCSIDNGSASVA
                     NASPRASPPRRPGRSPLASPLASPQRSPQRSPQRSPLLLPQQLDDPHQKHQHHYQHQH
                     QHHPTHSLQHPQLTPPSSPPQQGDMFPQTPASTQAPSSSPEAITTTPPPETNAPGDDA
                     GFSRDIQQLIHETEEAFKLRQSLIDAKLPDHELAKFPKPKAPSPMSPPMRRKSQRRSQ
                     GSVKSVKSPTKASMKAPLLPAQARLPSSSRPKRAKSKKSRRRPRVAARQSSMWQLTES
                     AKDLFNIRIFHRIEADEMLPESTLREIRGSRAAHWTRSPELGVTHVDNKSAAAAAPIE
                     PLSLDGSRDGAAEEDAVTPRASVVNQGREINREDCKTPMPQQPPQAPPTNGANKQESN
                     GQLSVLECTAEEVDHEPSLPLQQPDSPTTRSFDGDDEDGSLPIMTMAEDEPPATAKLA
                     GSPMPPPAPTTMKAPLHRRLPSRQLPPLPTIPEIIATGPEEATLSPTSVPQPPGSACR
                     VNKDDYIFLDSNPWTLTMPAFRHGQIRLAKADLPIGKLAAAVDDTLDWTAFQMAILGG
                     AGDFFSEPTDYSRPSEAELDELEELASWFASFGFQGPGALVGPSEPRTPPQPWTPVMP
                     RTPAGPTPCTSSPSPMSMSTTGPGSPGIMRRIDPPAASHADINGGSGMVPFTDSIAGR
                     FFPPAALSSSLASPPPPPPATSTHRHSDSSTTFDQPQPSPNQASQAPAPASELPPPSW
                     SYTTTSSSWSQTPPPGALTFSTRNRAGLAIDAGAGGRRPSVDSVQSLPQSPMMDLVVS
                     RDVEGNEYMVPMGFNLSHDLGDFLTWHAAHVVPGAAAGFAFGGGAGAGEGGGAGS"
     gene            complement(855496..856939)
                     /locus_tag="THITE_2120838"
                     /db_xref="GeneID:11519643"
     mRNA            complement(join(855496..856583,856639..856939))
                     /locus_tag="THITE_2120838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656305.1"
                     /db_xref="GeneID:11519643"
     CDS             complement(join(855718..856583,856639..856807))
                     /locus_tag="THITE_2120838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656353.1"
                     /db_xref="GeneID:11519643"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="JGIDB:Thite2_2120838"
                     /translation="METQGSAPAPPLFRAVASSTRPLYQLLKAINFTNKVHVDITENG
                     LRFAADHARVMQGVAHWSKGLFTTYTVNLPAGPAPASASADDAEEDDEPLPPTFQISL
                     PALLETLQIFGAADAAARQAKADVDPYRSNLRNYRSDAFSNQTLGMSGTCSLSYAREG
                     EPFSIVLDEAGVSTTCNLTTYVPEAPDDIPFDIEDLSFKIITSARWLLDALAELAPAA
                     PDKLTIAASRREPYLRLTTAGGPLGSSSVDFAKGRDLLETFSVRQRWVQTFKFDIIKS
                     ASEAMRIASKVSLRGDGQGVLSMQFMVEVEGSGPSFLDFRFVPYAVCEDDDGEDEDEE
                     GEDGGGQTEE"
     gene            complement(856940..857502)
                     /locus_tag="THITE_2120840"
                     /db_xref="GeneID:11519644"
     mRNA            complement(join(856940..857002,857063..857502))
                     /locus_tag="THITE_2120840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656306.1"
                     /db_xref="GeneID:11519644"
     CDS             complement(join(856957..857002,857063..857319))
                     /locus_tag="THITE_2120840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656354.1"
                     /db_xref="GeneID:11519644"
                     /db_xref="JGIDB:Thite2_2120840"
                     /translation="MDSSLHEVWQAAAGSPFVPTVGKGSQFLVAFVLLLIGFSLSGAF
                     ALSMPYLCHSNVIQLVLLTMRFPDRSLVNLPILAVPASLALAVGVVYMFCAVGVYV"
     gene            <857697..>859032
                     /locus_tag="THITE_115243"
                     /db_xref="GeneID:11519645"
     mRNA            join(<857697..857709,857782..857906,857983..>859032)
                     /locus_tag="THITE_115243"
                     /product="histone acetyltransferase GCN5-like protein"
                     /transcript_id="XM_003656307.1"
                     /db_xref="GeneID:11519645"
     CDS             join(857697..857709,857782..857906,857983..859032)
                     /locus_tag="THITE_115243"
                     /note="Contains conserved domains: COG5076, COG5076,
                     Transcription factor involved in chromatin remodeling,
                     contains bromodomain; pfam00439, Bromodomain, Bromodomain
                     and pfam00583, Acetyltransf_1, Acetyltransferase (GNAT)
                     family. Contains conserved domains: COG5076, COG5076,
                     Transcription factor involved in chromatin remodeling,
                     contains bromodomain"
                     /codon_start=1
                     /product="histone acetyltransferase GCN5-like protein"
                     /protein_id="XP_003656355.1"
                     /db_xref="GeneID:11519645"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Thite2_115243"
                     /translation="MKDENGKRKASDEPASPVASKRVKHDDSAEPEKPPAKIPAIPYP
                     EKPAVIEERNGEIEFRVVNNDGERESTIILTGLKCIFQKQLPKMPKDYIARLVYDRTH
                     LSIAIVKKPLEVVGGITFRPFKGRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKAT
                     SDVMHFLTYADNYAIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTIMQCTMLPRIRYL
                     EMGRMLLKQKECVQAKIRAFSKSHIVHQPPKQWKNGVTPIDPLSIEAIRASGWSPDMD
                     ELARQPRHGPNYNQLLHLLNDLQNHPSSWPFLVPVNKDEVLDYYDVIKEPMDLSTMES
                     KLEADQYTTPEDFIRDAKLIFDNCRKYNNENTPYAKSANKLEKFMWQQIRAIPEWSHL
                     ENS"
     gene            complement(859157..862091)
                     /locus_tag="THITE_127477"
                     /db_xref="GeneID:11519646"
     mRNA            complement(join(859157..860944,861019..861676,
                     861744..862091))
                     /locus_tag="THITE_127477"
                     /product="glycoside hydrolase family 37 protein"
                     /transcript_id="XM_003656308.1"
                     /db_xref="GeneID:11519646"
     CDS             complement(join(859697..860944,861019..861676,
                     861744..861925))
                     /locus_tag="THITE_127477"
                     /note="CAZy_ID 269728"
                     /codon_start=1
                     /product="glycoside hydrolase family 37 protein"
                     /protein_id="XP_003656356.1"
                     /db_xref="GeneID:11519646"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="JGIDB:Thite2_127477"
                     /translation="MAPRSFVAAAALAGLISSASALYINGSVTAPCDSPLYCHGEILK
                     AIELAHPFTDSKTFVDMPTIRPLDEVIAAFNRLSQPLSNNSELNAFLAANFAPAGGEL
                     EAVPRDQLHTEPSFLNKLDDTVIKEFVAKVIDIWPDLTRRYGGPGNCTACANSFIPVN
                     RTFVVAGGRFREPYYWDSYWILEGLLRTGGAFTEISKNIIENFLDFVETIGFIPNGAR
                     IYYLDRSQPPLLARMVRSYVDYTNDTSILDRALPLLIKEHEFWSTNRSVSIKAPNGKT
                     YTLNRYYVNNNQPRPESFREDYITANNGSYYAASGIIYPVNTPLNDTEKAELYANLAS
                     GAETGWDYSTRWLKNPNDAAKDIYFPLRSLNVRGTVPVDLNSILYENEVIISQYLKRA
                     GNNSEAERWAYAASQRSEAMFELMWNATHWSYFDYNLTSNSQRIFVPVDDDATAAERA
                     GAPRGQQVLFNIGQFYPFWTGAAPAQLKNNPLAVQQAYARVARMLDENAGGIPATNFV
                     TGQQWDQPNVWPPLQHVLMEGLLNTPPTFGDADPAYQSVRALALRLAQRYLDSTFCTW
                     YATGGSTSQTPQLQGVAPGAEGIMFEKYADNSTNVAGSGGEYEVVEGFGWSNGVLIWA
                     ADVFGAQLKRPDCGNITAAHTSGSGAQKRSGGSLARRAVELDPWDAAWTKMFGRSALK
                     KREDVRKRWLLAA"
     gene            complement(863333..865130)
                     /locus_tag="THITE_2120844"
                     /db_xref="GeneID:11519647"
     mRNA            complement(join(863333..864283,864342..864600,
                     864658..865130))
                     /locus_tag="THITE_2120844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656309.1"
                     /db_xref="GeneID:11519647"
     CDS             complement(join(863455..864283,864342..864600,
                     864658..864754))
                     /locus_tag="THITE_2120844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656357.1"
                     /db_xref="GeneID:11519647"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="JGIDB:Thite2_2120844"
                     /translation="MSLSNEDSASKMAAPRHNAWIGSDGAGGCDLRSDTMTTPTASML
                     AAIQSCTLLDDVFNEDPTTMDLESHCAALTGKEAGLFVLSGTMGNQLALRSLLTQPPH
                     GVLCDYRSHIVKYEAGGVATLTGALVKTVVPKNGVYLTLEDIKANVYLDDDVHTCPTR
                     VISLENTLNGMIMPLQEVRRISAFARQHGLKMHCDGARLWEVAASGAGSLVDFASCFD
                     TVSLCFSKGLGAPIGSILVGSKDVIKHARWVRKSIGGGLRQSGVVTAAARVAVDETFG
                     KGPNGEGGLLRNTHVLAQEVSKMWTDLGGKLVHPVHTNMVWLDLDDANCTGARFEALG
                     REAGLKLLGGRLVIHYQIYQNRDFVIPRLANIFKAVLGGRGQSGGSHASQDGETSMYR
                     SQ"
     gene            complement(865666..867872)
                     /locus_tag="THITE_2120847"
                     /db_xref="GeneID:11519648"
     mRNA            complement(join(865666..867322,867374..867872))
                     /locus_tag="THITE_2120847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656310.1"
                     /db_xref="GeneID:11519648"
     CDS             complement(join(865774..867322,867374..867414))
                     /locus_tag="THITE_2120847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656358.1"
                     /db_xref="GeneID:11519648"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2120847"
                     /translation="MRRRMWVILYLWDFALSSMLSRPLLINHADCTVEMPTLTLENNP
                     QRPNQPSPFRHMNLHCQLCIDMAAQLGRASDSSADKAQVAWRMKEVVDKWLANLPAEY
                     ALDAPDTRWDDEYEWVTFQRRYLHLIGYMGSFSQLRPFLTRNSSKPMSRLELSLRAAG
                     VQACLGLMDVSWTLFENLVSIGAKFHYAIFCIFDSATVMCSAILQDEARNLPQRETVL
                     EGIRKALRMLAEASSESKTTTALYRILKGLLVKLPLSPEEQGAIRMPKRSKDGSITPL
                     SEDSPATAFSMNPLASRALSETSHAPRSEQHRSVSADSERVSTLDSSNLPPRSDTSMS
                     SPDHSRSINAQASAGAQPWQGSILQPSTVGTVGDCLPSTNPLAPIVPIRPQNIGTAES
                     FVPAVSAISTAGIMTSESFEPAPGFGQMAGLGPVHAIPLSQADWQPAHVPINGLGSGM
                     LMHQSANLEAFGNNAPSILENWDWQGLGLGHPMSWGESYTDVNDPGRTRDHHAGIFGV
                     FTGPGMSNNGRESLDADDRNR"
     gene            complement(<870394..>873756)
                     /locus_tag="THITE_157422"
                     /db_xref="GeneID:11519649"
     mRNA            complement(<870394..>873756)
                     /locus_tag="THITE_157422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656311.1"
                     /db_xref="GeneID:11519649"
     CDS             complement(870394..873756)
                     /locus_tag="THITE_157422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656359.1"
                     /db_xref="GeneID:11519649"
                     /db_xref="JGIDB:Thite2_157422"
                     /translation="MLQHRMHHNPFSSPPSSTGSHDTVSTTTEELSQNLSNFSFSPDG
                     EGTRVFGEDLQQPSNRRAARSGRFGSKQMHETILNTSAIARTFPEWSGLVARDNATVT
                     QTIDMAAPFKPVSASPGGKENMPPTQERAEENTFEIMADAKRKRSRADLQARVENESD
                     CSTVLSLSPARPVSGARRSRFAVAQPDATPSPDVPKRSLQDVASKIRTEKKTAEGGTT
                     PSRPSALQPSHETPAHNPAPDSSMVTPTSRSFFLPSFRHLPDWTSGTLKFSTMKNGVP
                     VFVRSGKSGVRLDQYGKEHADVHAVGIPKEDEEIFVSMDKLQEEVRELHDHDAMLQRE
                     AERLQREVYQLQAELKRLKSQKLSDSAIGSESEASFRRSGGHDQNLEHEIAELRERLD
                     QASRQVGVHDIHSAALAAERDEALHQASVARERATKLQAELEATQKDLESSLNLLRER
                     ETLQLENDKLRRELSGVQKDLRATREELDSVRKQFEAAQEEKRQLAQDHASMERNNES
                     YFKENKKLQAQVAARDQHIADLKKGISSRDKMLENIQGLTTDTAALELNAELQAEIER
                     LQKRVEQQRAELHQKDGDISAKEGRIRSLKEQNLDLSIDNERLREENQRLRTEHEEIR
                     SQWVEERHKVVRLNQLLGRNTVAETADDCVRLDDDFKQREAALRQKLERREAAVKKVK
                     QLSSKISKIAEQEFIGKTVKVTRIVEPTGMQNVTEETTGKSSAVNVDEDPTRELHLSD
                     DSEFASVMEGEIAKLRQTYEALRSRALQGNDMTDNSLPSLPPTLQRSKSDSGVPAAKA
                     TQSKAQLPGILKKPSQPAFEDDTGRFSVKSALSIVSHHSDDEVLDTVHSRKSSMSTAQ
                     PELPRPRSRMRRDSEADRDATEPNMTSAFFMPDITLEGNKQGTAKDLPQQALPTLSKD
                     ARRVLDGICQHNSINCNVCVRIATHGERIAANSTVTSTKKILITEEDVRRGKKTVSAE
                     KPIPVSDRAPEQPAASAHQQQHANSDEPTVRPSMPPGEALAVLIKETQDEIDHLQMEL
                     KRLNEVYCGLDKSQGMRERRRVMADIKRLLGELEAKSGHLYRLHDVLEGQKQAGQLMQ
                     DGQVDVTVLSGLVRAEVAGESRAVAEEWNGFD"
     gene            complement(881147..882792)
                     /locus_tag="THITE_2120852"
                     /db_xref="GeneID:11519650"
     mRNA            complement(join(881147..881712,881792..882079,
                     882139..882337,882417..882792))
                     /locus_tag="THITE_2120852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656312.1"
                     /db_xref="GeneID:11519650"
     CDS             complement(join(881473..881712,881792..882079,
                     882139..882337,882417..882553))
                     /locus_tag="THITE_2120852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656360.1"
                     /db_xref="GeneID:11519650"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="JGIDB:Thite2_2120852"
                     /translation="MRFAQSFTPALLLLAAGVAQAASAWGFDEGSVSVVGRKSGEAVK
                     EKLNARAPLSKPVSLGSTDTLKLSLTAKDNGKAKRPHQAFLLLQEQESGLEAPFPLTV
                     KENGKAVAQISHKDLPVQLLAATKPLKASVVLASFGSAQGLDAPVFELKIETDPNVPP
                     PAYEKPLRYGKKPEIHHIFRPDPKSPPKVVSLFFTLAVVGTLPALLIGWFTLGGNLNH
                     LSKAIGAAPLSHATFFGSILAMEFVFIMYYTSWTLFQTLPVIAAVAVATVLSGTKALG
                     EVQSRRLAGER"
     gene            <884977..>885648
                     /locus_tag="THITE_27104"
                     /db_xref="GeneID:11519651"
     mRNA            join(<884977..885076,885130..885218,885295..>885648)
                     /locus_tag="THITE_27104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656313.1"
                     /db_xref="GeneID:11519651"
     CDS             join(884977..885076,885130..885218,885295..>885648)
                     /locus_tag="THITE_27104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656361.1"
                     /db_xref="GeneID:11519651"
                     /db_xref="JGIDB:Thite2_27104"
                     /translation="MVSFRTTLLALAAAVAVSADYWVDPNSVPSSDRHAWCDDELSSC
                     PAICLQTSTGPPQVNTCDPDTLTYGCVCSDGKQPNLTEYTLTLPYYVCVEWGNQCVKA
                     CGSDNQCASNCREDHPCGAQNPPRVNATTTSTTATTASATASNQVFTGLADGSGSNTA
                     GGNNAAGTLRLSDSFGLAVVA"
     gene            886427..888954
                     /locus_tag="THITE_2069563"
                     /db_xref="GeneID:11519652"
     mRNA            join(886427..886792,886914..887023,887092..887217,
                     887276..888954)
                     /locus_tag="THITE_2069563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656314.1"
                     /db_xref="GeneID:11519652"
     CDS             join(886777..886792,886914..887023,887092..887217,
                     887276..888337)
                     /locus_tag="THITE_2069563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656362.1"
                     /db_xref="GeneID:11519652"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Thite2_2069563"
                     /translation="MAPNSKEAVAECISDDALIHLKSYKYSAVDKSPISYYVLRPYWN
                     AFVELLPLWLAPNMVTLLGFMCILFNVGLLVVMIPDLEGPAPPWVYYSFGFGLFMYQT
                     FDNVDGKQARRTGTSSGLGELFDHGIDSLNCTLASLLETAAMGLGTSKSGVFTALCPC
                     LPMFFSTWETYHTHTLYLGVVNGPTEGLLLACLVMIISGYCGPAIWTQPLASLLTPHL
                     PLLGTLGLTEAHLTDLSIRDIWVTFIIVSLLFTHIPFCIHHVVQARRAKHLPVAPVFL
                     EWTPMAVYTLSIGAWLYSPHSTLRRDNHLVLFCIVMSFVFGRMTTKMILAHLTRQPFP
                     YWTVMLWPLVGGAVLANLPRLGLPAVDARTEYLYLCGYLVFAAVAYFRWAYLVTTSIC
                     RFLGINCLTIPAQKQRENERMTAAAAAVLGKQPAANGDVSGRKVD"
     gene            complement(889592..891040)
                     /locus_tag="THITE_2120861"
                     /db_xref="GeneID:11519653"
     mRNA            complement(join(889592..889756,889821..889999,
                     890074..891040))
                     /locus_tag="THITE_2120861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656315.1"
                     /db_xref="GeneID:11519653"
     CDS             complement(join(889693..889756,889821..889999,
                     890074..890685))
                     /locus_tag="THITE_2120861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656363.1"
                     /db_xref="GeneID:11519653"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Thite2_2120861"
                     /translation="MASETEQAHPSQQPVQQEDQVDDDNSSAVPVAEGAAGPATTNGA
                     AQPPEQSFGHDPEPEPERAALFSDEDNDDNASEASIPSDVLSDQVTSPSVSVPPYWSH
                     SRAQQENQLLPHPRGHARAVSSASVESVLPPGAITLQDNERDDDEDDQHPGRRSNSSE
                     IYGRDRNRACWARSVQVTDYVLVNGSATNIGAFVVWHIRVETLNGSRMNIRKRYSEFD
                     EFRQRLVQTFPNFEAAVPALPPKSVLKRFQPRFLEKRRAGLQYFLNCILLNPEFSGSP
                     VLKEFLFS"
     gene            complement(891048..892690)
                     /locus_tag="THITE_2120863"
                     /db_xref="GeneID:11519654"
     mRNA            complement(join(891048..891720,891804..892690))
                     /locus_tag="THITE_2120863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656316.1"
                     /db_xref="GeneID:11519654"
     CDS             complement(join(891204..891720,891804..892525))
                     /locus_tag="THITE_2120863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656364.1"
                     /db_xref="GeneID:11519654"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="JGIDB:Thite2_2120863"
                     /translation="MRSPSTFDLLVILVPFVLLAIHVSPTLSYTLLSNHSLQHHIPPA
                     NKASSPSSPDPDFDPLHGTLLAPLLTPRVPGTPGHARVQHHFASFVRAHLHPSWTLEW
                     HNTTAATPATGDRQVPFQNLILRRDPPWTRPGGGGGGDGGNGAGQGEGDVARLTLAAH
                     YDSLYRPEGFVGATDSAVPCAVLLFVARAVDEALTRRWQDLESRGEAGDGLEEEKGVQ
                     ILLLDGEEAWVQWSDEDSLYGSRALAEAWESTRYAAGSSFATPLEAISLFVLLDLLGA
                     PEPHIPSYFPSTHWAYQHLATIEGRLRELGALQTTPRQPFLAEGKKEGAPVFRGYVQD
                     DHVPFMRRGVDILHIIPSPFPAVWHTMDDDGAHLDVPTIRDWARIMTAFVAEWMDLEG
                     YLPQATASNVDNGSSTKDEL"
     gene            895090..896063
                     /locus_tag="THITE_2120866"
                     /db_xref="GeneID:11519655"
     mRNA            895090..896063
                     /locus_tag="THITE_2120866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656317.1"
                     /db_xref="GeneID:11519655"
     CDS             895242..895811
                     /locus_tag="THITE_2120866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656365.1"
                     /db_xref="GeneID:11519655"
                     /db_xref="JGIDB:Thite2_2120866"
                     /translation="MSLSPLSGHYRPPTSNFRAFVRSLKEAGVDMSHMSVSKSYAVLV
                     GLETYVKVRKKAKDIVDKVKHHGKAEPQEDILAVPRSRKTTSTSMSTLADEAELAHTQ
                     MTPSRPAGASPCPRTGLETAENDDGPQPALSPVPEHESPEQNDEQQHKREKESEEEKM
                     REENRLAVEVVQKLGLGTGLPEPKGQKGG"
     gene            complement(896064..897284)
                     /locus_tag="THITE_2120867"
                     /db_xref="GeneID:11519656"
     mRNA            complement(896064..897284)
                     /locus_tag="THITE_2120867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656318.1"
                     /db_xref="GeneID:11519656"
     CDS             complement(896656..897198)
                     /locus_tag="THITE_2120867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656366.1"
                     /db_xref="GeneID:11519656"
                     /db_xref="JGIDB:Thite2_2120867"
                     /translation="MDGFFDNYRRLASPLLPVPAAPPPTPHHVFYAASPVFMMPAHYA
                     TSLFQPAPSPVPLPLSQAGFPVRPSCGRQFRMADSSTEDQQEREGEEERGEDTGDDCG
                     STRTRTTRSAVRAGARETSSTMEDERELPDGLGLSTDSCSAEGSDEGARYPRYSRRVQ
                     SKSEPAALAVRSLSGSGSGS"
     gene            complement(897285..900776)
                     /locus_tag="THITE_2120869"
                     /db_xref="GeneID:11519657"
     mRNA            complement(join(897285..897874,897928..898129,
                     898185..898345,898413..899632,899718..900776))
                     /locus_tag="THITE_2120869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656319.1"
                     /db_xref="GeneID:11519657"
     CDS             complement(join(897481..897874,897928..898129,
                     898185..898345,898413..899632,899718..900566))
                     /locus_tag="THITE_2120869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656367.1"
                     /db_xref="GeneID:11519657"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_2120869"
                     /translation="MAIAGLSDAGATAERAVGMPLRQVLSSLHYAYPTAVFAYYVLTS
                     TIAVCTLQTKSADRAHPRRRAITWLLTLVIVTYFAQLLVLGIQGLVRHIFPLAEQDTV
                     IGLMSSALVFGVVLAGLSDTANPVWYPYMGCFGVALVLEPVVASLSFMVRPNEPLDVV
                     GFFDISLVATRYLAVILALACYFEGNRSSRLEKGTDSERQSLLKANGNGHSHASHDSD
                     SDDQSAATQQDGYGGTSDASTDSNQSSDTDDDENPYERRQRQASEKMEKRLKEKGNWL
                     TYAKSFLVFFPYIWPVNNRSLQLRVVLVGFCLLAMNFLNVLIPRQMGIIMDSLSGTNH
                     RNPWTEVLIFAGLKLVASEAGLSLLRQWLWIPVEFYSFDAISTAAYSHVLNLSSDFHD
                     SKSSSDIMMAISCGQSISNILESICFRAVPMLIDMVVAFLYLSATLGPYEGFITIATA
                     AVFMYIATRMIAALKTARRNEVGSWYREHYVRQAGIQGWSTVASFNQIGHEEARYSVA
                     VKDRVDKTQKVYFGYVLAYAFQFLVLLCGLIAGAFLVVYQVTHGQATAGDFIMLLTYW
                     GQLVAPLTFFASLGKSISRDLLQAEQLLEIMQTKPSVLNKEGAPPLRFKGGEVRFDHV
                     YFSYDKKKEILKDIQFTAKPGMTVAFVGATGAGKSTILKLLDRFYDVTQGSIEIDGQD
                     IRDVDLYSLRAQIGVVPQAPVLFDDTIMNNVRYAKLTATDEEVYEACKAASIHDQILT
                     FSDGYQTRVGERGVKLSGGELQRVAIARAILKRPSIVLLDEATSAVDTETEQKIQEAL
                     RRLCEGRTTFIVAHRLSTIMNADRIIVVTGGEIVEQGSHEDLIRADGKYAELWSKQIF
                     VKPKDKEPREDNNKHAGKGRKALSIVNDLTAEATSSELAKVKSPPTLNGQANAQANGQ
                     AKDSNSTAEANGKPNAQPNTPAHKKEV"
     gene            917977..919390
                     /locus_tag="THITE_2120871"
                     /db_xref="GeneID:11519658"
     mRNA            join(917977..918220,918312..918655,918736..919390)
                     /locus_tag="THITE_2120871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656320.1"
                     /db_xref="GeneID:11519658"
     gene            917992..918084
                     /locus_tag="THITE_t130"
                     /db_xref="GeneID:11519659"
     tRNA            917992..918084
                     /locus_tag="THITE_t130"
                     /product="tRNA-Ala"
                     /note="Anticodon: TGC"
                     /anticodon=(pos:918024..918026,aa:Ala,seq:tgc)
                     /db_xref="GeneID:11519659"
     CDS             join(918519..918655,918736..919231)
                     /locus_tag="THITE_2120871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656368.1"
                     /db_xref="GeneID:11519658"
                     /db_xref="InterPro:IPR012816"
                     /db_xref="JGIDB:Thite2_2120871"
                     /translation="MSAASSSSPVYFWRDTEPSTGYLSQWYPCAFTDDADPSIIYRSA
                     EHYMMYHKAQLFADHAVAAEILAAPHPRTVKALGRKVAGFSDAVWKAHREAIVRRGNL
                     LKFTRPADVRDGRWLVKLHGTEEEVSIRELLLRTGERELVEASPMDRIWGIGFGAAKA
                     GVVGREKWGLNLLGKALMDVREQLRRDGESGGKGAKEAENAKQEDGADQK"
     gene            complement(919632..921653)
                     /locus_tag="THITE_2120874"
                     /db_xref="GeneID:11522630"
     mRNA            complement(join(919632..920411,920474..921653))
                     /locus_tag="THITE_2120874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656321.1"
                     /db_xref="GeneID:11522630"
     CDS             complement(join(919736..920411,920474..921426))
                     /locus_tag="THITE_2120874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656369.1"
                     /db_xref="GeneID:11522630"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="JGIDB:Thite2_2120874"
                     /translation="MMNSVRHMQRFSPGAPLRAPGLRSVRCTPPLQHRLLSSRTAQVD
                     IFESTTYSTSVPFRQQPFLRSSLPAVAIRLDRLPPSSARPFHLSARTQQKEAADKETK
                     AQPETQESEAKTGSDPQQEAKQEAKEGEGKADGEGEGGGKGKEKKEDLPPPPPHGDKT
                     PWQVFLETMQTELKQSKEWNESTKALASSANQFVESESVRKARQAYEATSGAVSSTAA
                     NVVKSTAGAIGKGAAWTWETPVMKGVRKGANITGEVLDKATKPIRETEAYKNVKDVID
                     DGSSSRYGGWVEKEERRRRRELREQMNKKNGVHNQVFEADPNAGTSITVHKDAAWKEA
                     WRAFRDQNKFVQGLFGMKTVYQESENPLISTARSITDRVAGFFAENETAMVIKKLRSM
                     DPAFKLEPFLQELREYILPEVLDAYVKGDVETLKLWLSEAQYSVYEALTKQYLQAGLK
                     SDGKILDIRGVDILRARMLDPGEIPVFIVTCRTQEVHVYRNAKTNQLAAGMEDKVQLV
                     TYAIGITRIAEDVNNPETRGWRLIEMQKSGRDYI"
     gene            921679..922712
                     /locus_tag="THITE_2120876"
                     /db_xref="GeneID:11519660"
     mRNA            921679..922712
                     /locus_tag="THITE_2120876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656322.1"
                     /db_xref="GeneID:11519660"
     CDS             921861..922520
                     /locus_tag="THITE_2120876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656370.1"
                     /db_xref="GeneID:11519660"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="JGIDB:Thite2_2120876"
                     /translation="MSRLTIGRLLAPALLRPLSKPTGAANAVPQWARLFSQSRATASS
                     IFTSPPQQPAAQQDSNPMNRLATAVLGQVVQPTNPNAPLSEELGIEEEKQSKEPYHFH
                     IYSHKHNTHVTLTKPNRDALISLSCGNLGFKKSARKNYDAAYQLGAYVIDKMHQKGLT
                     KQIHKLEVVLRGFGPGREAVVKVLMGNEGKYLRPKIVRVSDATRLKFGGTRSKRKRRL
                     G"
     gene            922825..924593
                     /locus_tag="THITE_2120877"
                     /db_xref="GeneID:11519661"
     mRNA            922825..924593
                     /locus_tag="THITE_2120877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656323.1"
                     /db_xref="GeneID:11519661"
     CDS             923147..924535
                     /locus_tag="THITE_2120877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656371.1"
                     /db_xref="GeneID:11519661"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="JGIDB:Thite2_2120877"
                     /translation="MHGLDALFNNPVFAGGIGLAGLGAAAAFGRRALISAAGLLRRQL
                     LVNIEISKRDPSYNWVLAWLAQPRDNRGFLAQRLTRLRNLSISTSTKSLSPAAEDGAG
                     KIHADFRVQPGFGRHIVRHAPGVYIAVNREKAGTATTATGEPHETLTLTLLWRHRHVL
                     AEVFTQAHALAQSFQQGKTVVYTARKMEWAVLGKPRLKRPLGSVILDEGVKERLVADV
                     KEFLKAQQWYTDRGVPYRRGYLLYGPPGTGKTSFIQALAGELDYSVAMINLSEMGMTD
                     DLLAHLLTQLPEKSVLVLEDVDAALVNRRQRDPDGYSGRTVTASGLLNALDGLAAGED
                     RITFLTTNHIDRLDPALIRPGRVDMMVRIGEATRYQAAQMWDRYYGDIDEDHSGRERF
                     LARLDELGLFGGSNQDPSVPKRHTSTAAIQGLFQFNKGDMEGAIRMAEGLIPRTFEPE
                     QPSAEGTIKAPA"
     gene            complement(925081..926237)
                     /locus_tag="THITE_2120878"
                     /db_xref="GeneID:11519662"
     mRNA            complement(925081..926237)
                     /locus_tag="THITE_2120878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656324.1"
                     /db_xref="GeneID:11519662"
     CDS             complement(925265..925870)
                     /locus_tag="THITE_2120878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656372.1"
                     /db_xref="GeneID:11519662"
                     /db_xref="InterPro:IPR015362"
                     /db_xref="JGIDB:Thite2_2120878"
                     /translation="MPSEPTASGIVTDEVSGERHIPESKRADGSTRKAIKIRPGYRPP
                     EDVEVYKNRIAENFRNRGKGPVPGAEGLKDDKPAQPSSATANKNAKRREARKKAKAAG
                     QTQSERQNEAAPVEEAVKENVDPELEKEKKVRALKKKLRQAKELREKKEGGEALLPEQ
                     IAKVIKINELIRELDALGFNAEGEPKSGTGGSKLRGSETSS"
     gene            926239..927524
                     /locus_tag="THITE_2120879"
                     /db_xref="GeneID:11519663"
     mRNA            join(926239..926450,926520..926536,926592..926657,
                     926720..926768,926828..926853,927048..927524)
                     /locus_tag="THITE_2120879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656325.1"
                     /db_xref="GeneID:11519663"
     CDS             join(926448..926450,926520..926536,926592..926657,
                     926720..926768,926828..926853,927048..927159)
                     /locus_tag="THITE_2120879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656373.1"
                     /db_xref="GeneID:11519663"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="JGIDB:Thite2_2120879"
                     /translation="MASALYNALFRRNYTMLGVVFAAAFVFEVGFNDVMNKIWDNHNR
                     GRQWKDIRHNLARSAFESVLFQCSWASLLLPQSRTSLTSIQCLPTR"
     gene            928175..935075
                     /locus_tag="THITE_2120880"
                     /db_xref="GeneID:11519664"
     mRNA            928175..935075
                     /locus_tag="THITE_2120880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656326.1"
                     /db_xref="GeneID:11519664"
     CDS             928374..935045
                     /locus_tag="THITE_2120880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656374.1"
                     /db_xref="GeneID:11519664"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="JGIDB:Thite2_2120880"
                     /translation="METPMSTQEQQLCQLLLELPARHGFRYTDDAARELLTALFWCMA
                     GGRADYLNLFFPVGGPARNGTLKLREAQGAVEGAEYTEAARGKACGHIFKQGEASYAC
                     RTCSADDTCCLCSKCFDATDHTGHMVRISISPGNSGCCDCGDPEAWNRPMFCTIHSMW
                     EGEGKGKGREAAALPEDLVASMRMTIGRVFDYLCDVISCSPEQLRQTKTVESIEQDER
                     MSRLSPTYCGGDTESPGEYAVLLWNDEKHTVVDVRDQVARACSTTLSNGLAKAYETDG
                     IGRSILMYDKSIEKLIEVATTLERIRVTVTIRSARDTFREQMCGTMIEWLRDISGCSV
                     GEDHHILRQVVCEEMLKPWRKGSPATHAIVGKDGIDDEELIDQEDMETNDFYLQQSRI
                     LLQARMAARAARREAAAADAASEDGDEDEDEGDNNTPGSDMDDEGDDDEDVVMLEARD
                     DADVPMQDWRQDTALEEDEATVAGYPPPPPPPPVPRRAARERELTPSDSDTAEPLIAP
                     TVYAKAHLEVPKTPGLKQGETAPPPKPGHYWLITPSGYVEQESIPVAEDLFERVRLDW
                     MILFDLRMWKKVRNDLRSLYISTVVTIPEFKRVLGLRFAGLYTTLSQLYLIGDREPDH
                     SIINISLQMLTTPSITAEIVERGNFLTSLMAILYTFLTTRQVGHPWDVASNAVLSFDT
                     GSVTNRRMYHFYLDLKYLFSSPHVQERLRTEERYMMQFLDLVKLHQGICPNVRAVGEH
                     VEYETDTWISASLVTREINRLCRQFAESFRGVKEQDSLYVSRAIRLAAKTVIINSIGA
                     ERGRFSQSEIKDEVRFKTLDDFEFEAPGRDFQVVRFVVEEEPISFHHALHYTLSWLIE
                     CGKAMPVEQLRALLSFSTQELVMKPRSMGKKTMPRHGDYGPEDYLMAAFDFPLRVCAW
                     LAQMKAGMWVRNGLSLRHQAGTYRGVGQRDVSHHRDIFLLQTALVVCDPSRVLASIVD
                     RFGMEKWVKGFFEQKSKAQDDIQHLDVVEDMIHLLIVLLSDRTALTPAEDDRAPHLAS
                     MRRDITHVLCFKPLSFSDICLKLPDRFQEQEDFHKILDEMTTFRPPEGLTDVGTFELK
                     PEYIEDVDPYIAHYNKNQREEAEMAWRKCVAKKTGKPLEDVVYEPKLRPIPSGAFAGL
                     GRFTSTGMFAQIIYYSLLYTLVYPGMTPQVPSTRVETFLQVVLHLILIAIAEDKSDEN
                     EAQQSSFIATALTQQARSNFMPDAPQAKTIVALLNLITSKEEFKTCHPKVSTILRRMR
                     QKRPRAFESSFERLGLSVDRMDTASPAASNADEERERKKRAALDRQARVMAQFQAQQK
                     SFMENQGDINWGEMEDLEDDDDLPPMEEHRKFWKYPSGTCILCQEDTDDRRLYGTFAY
                     FTESNILRQTDFQDPDFVREAFNTPDNLDRSAEAIRPFGVAHENRQIVRKVDQRGQTF
                     ETERQVIGKGFPAKLSRRGPVSIGCGHMMHYSCFETYFDATTRRHNQQIARHAPENIA
                     MLEFVCPLCKALGNAFLPIIWKGQEESYPGPLVPSSSFPTFLDSQLHSAYYTLGAARP
                     LDQVQSTFASYTTNQMINSLAEKSSQLLDDAWVDVGAQSFSTGTPFSETFSLVSAPEA
                     GPRGPTPDTNSAMRELVNVYRRLRDTLSKNGIVSRHEIGPAELEANELYGSDALARSV
                     GFSISAVEIQQRGVEAEYGMTFLEKIPDQVLTQLRILAETVTSYIAVGGLRESGENKI
                     DTEYRRDSERQHCQLFITQYLGEATENSRSPASSYPPLLSQDPFIFLCECVFGVIPAQ
                     GFEIAHMVRLCYLAEITKVAYHLARNVRMAQYFQYVGADRRQDMDPATSKFLAFCDGL
                     CEIDIECAAQGMVEIDRPRWENRAFEQPGLGSWDSWYILLRKYALAFLRKCVVLLHVK
                     YGVDFNSRVSPNPEQRELERLTEALRVPSLDEMLTALTPAQGVQHGWPASTRRLVAGW
                     VKHQALWPYNGDCDTLPQSAVISHPGIFELVGLPKNYDTLIEESTRRRCPTKGRDVTD
                     PVICLFCGDIFCSQAVCCAKEIREGRNKVFKVGGAQQHMIKYVSVPKFTHSSAAFCAN
                     PECVYQMPGKHWPLHQHSQVLRLLPLAAVGLVQPGAVHRQIRRGGHGPALRAAAVPAS
                     EAVRLDAAEPVAQPRGAELHRAEARGGYQHGRVGDHLARFVRVGIGCGRRQPTRQSVL
                     GHCVLRHLNSGSSSLLTSQSLESWGRVRGVSCF"
     gene            complement(<935670..939367)
                     /locus_tag="THITE_2097024"
                     /db_xref="GeneID:11519665"
     mRNA            complement(join(<935670..937476,937531..937836,
                     937934..938963,939021..939367))
                     /locus_tag="THITE_2097024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656327.1"
                     /db_xref="GeneID:11519665"
     CDS             complement(join(935670..937476,937531..937836,
                     937934..938963,939021..939207))
                     /locus_tag="THITE_2097024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656375.1"
                     /db_xref="GeneID:11519665"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2097024"
                     /translation="MNSHPVRHRSQTGVSSSGPERTVDGVSGNRTIPPSKSSSVLSAK
                     LRRHGVKVVSALKSLTNSSYEQPVVTEQLSPVSGGYRTKSAFALGMHKMSNAIFRSPP
                     QPTVVRRASPKGRPSLKETFQVAGVLLPSPPASRLAHSTSSNISCNKASSSQGSCAKA
                     TLDTTTISPRESTFKDGDLNAIGGRGRGVEPKLSAQRARRGPGSQPTVIPPRPPGNFD
                     NGNGNDNNQLVTIQEMPLNHCRPSIATVERAAAAKICLETRFNELLSPGPSPRQMRQQ
                     MLETDLFNRARRRGTPLSADEVLAARARFAQRESQHLRRLRVMKARGLRALGGASAAA
                     APQDGSRVMDYETVKVLGKGSFGVVRLVRHRRRPGRVYAMKVIKKSKMLRSSQEGHLR
                     AERDILVASEGSRWIVPLVASFQDLSNLYLVMEYMPGGDFLSLLIRENTLHESVARFY
                     IAEIVLCVEAAHSLKCIHRDIKPDNFLISASGHLKISDFGLAFDGHWSHDTTYYSSHR
                     LETESRCAEATKKRPSGITIGIERHGKKDMHDGEPLLNWRNRCGNRKSARSIVGTSQY
                     MAPEVIEGRRYDARCDWWSVGVILFECIYGHTPFLAEEGRHKTKENILRHHETFGFPS
                     RPSVSRRCQHLILSLITDMEYRLCSERYRMKDRVTSSSPSFCRSSRGVGASTRCCGPR
                     DFAGRYVFPYDAEDIKAHKWFRNVPWERLHEVTPPFVPKLRSVDDTQYFDDGESVSDA
                     SESQQEIEEPCGNGHDGAAERPQGPQLPSFSPLCSIQEGIDWPPALYPSSPAAGQNRN
                     TQTHPHRNLIHDLRDPASSTKDHQYSIPPPLPSLESPVAAAAPPFAVAFNNNNNNSPN
                     PFPSPLPPPTKEQLTFLRPLRRTLQEFALAAIATPAPPPPPHDGAAASTCRQHTIEQY
                     LARLPGATDAERARLREFVRRFRPTAAAAAAAATTPAGAGAAGAARADQQRRNKRPRD
                     RLLRDAATRGVAMEVRKRTAFLGYEWQRMGLGEEDEDEYEVVDEQQQQEEEEEHRDQD
                     WEEVGGRGPGLDGEGGGGGGGEKENGNGYAGGGGAGWGTAGRAVPPYEAGNGQPGPVL
                     HQPRETAYQGWSHDVAPMRAM"
     gene            complement(939554..941798)
                     /locus_tag="THITE_164085"
                     /db_xref="GeneID:11519666"
     mRNA            complement(join(939554..940201,940268..941003,
                     941070..941519,941582..941798))
                     /locus_tag="THITE_164085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656328.1"
                     /db_xref="GeneID:11519666"
     CDS             complement(join(939996..940201,940268..941003,
                     941070..941519,941582..941671))
                     /locus_tag="THITE_164085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656376.1"
                     /db_xref="GeneID:11519666"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Thite2_164085"
                     /translation="MSPLLPVAVYGLEVPPGEVMVPAEIEFPATIRITMAAIDPTAEP
                     ETDGQGNVPSVPRSTLKIYKANIDDDEEDEDNLESLLGGGEDEDESDEDDEEVNGGPS
                     DPSKSKKARREAAIKKLLEATKEDPDEKMEDASPKPNGAKNKGKAKASDEDEESDEED
                     ENADELNMEEFVVCTLDTERTYQQPIDITVGEGEKIFFSVKGTHAVYLTGNYVVPADE
                     AEDEDEDEDEDSDDEYDLAPGIEDEDSDEMSDELDHIDGTPRIKEIDTDEEEEAPKLV
                     DAKKGKNKRPAEEEAEGLDEMMDKDEKAKDDKAKDEKKLSKKQLKKLKNNQGEAVAVE
                     AKAKDSPAAKGDKKVQFAKNLEQGPTGPAKDQGSTGPAAKDQGDKKASLGVKVVQGVT
                     IDDRKLGTGRTAKPGDRVGMRYIGKLQNGKVFDANKKGAPFTFKLGKGEVIKGWDIGV
                     VGMSVGGERRLTIPAHLAYGSRSMPGIPANSTLIFDIKLLEIK"
     gene            complement(<942707..943952)
                     /locus_tag="THITE_2156026"
                     /db_xref="GeneID:11519667"
     mRNA            complement(join(<942707..943098,943165..943952))
                     /locus_tag="THITE_2156026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656329.1"
                     /db_xref="GeneID:11519667"
     CDS             complement(join(942707..943098,943165..943345))
                     /locus_tag="THITE_2156026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656377.1"
                     /db_xref="GeneID:11519667"
                     /db_xref="JGIDB:Thite2_2156026"
                     /translation="MAATDSRKTVRIGVFIPADCQLLDMACIDIFGTMSYEYFSLVKG
                     LVPAPMLNLAPSVQISYISTIQPGELIPLTASARVSCTHHLSHPAVQPGQLDIVLVPG
                     PDPTIDWTDGDKKAALEWLAAHAARPETDILCVCTGIYLCGAAGLLKGKKACGPRALQ
                     GDLAKKFEGVEWVGEELRWVRDGNFWSSGE"
     gene            <948179..>948454
                     /locus_tag="THITE_2057014"
                     /db_xref="GeneID:11519668"
     mRNA            join(<948179..948315,948352..>948454)
                     /locus_tag="THITE_2057014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656330.1"
                     /db_xref="GeneID:11519668"
     CDS             join(<948179..948315,948352..948454)
                     /locus_tag="THITE_2057014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656378.1"
                     /db_xref="GeneID:11519668"
                     /db_xref="JGIDB:Thite2_2057014"
                     /translation="RLRDIGLNLDFKKYIFIVKEVKYLGYIVEIGVYIRPNPKKIKAI
                     YNFLGFANFYYNFIPNFSKKVALLIYFTYKNVLFY"
     gene            956623..957502
                     /locus_tag="THITE_2120889"
                     /db_xref="GeneID:11519669"
     mRNA            join(956623..956951,956999..957074,957129..957502)
                     /locus_tag="THITE_2120889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656331.1"
                     /db_xref="GeneID:11519669"
     CDS             join(956860..956951,956999..957074,957129..957458)
                     /locus_tag="THITE_2120889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656379.1"
                     /db_xref="GeneID:11519669"
                     /db_xref="JGIDB:Thite2_2120889"
                     /translation="MRGKSSGECREAPGKAARCARCARGKKCRSIPASVLPAAKHFLA
                     LMQGRQEPKANLDQKTLRATLRALLAMEGEDADAEDDDDDDDERAPAPAKGKGKGKAK
                     AAAPTKKSKKAKKAKKEESEEEDEDEDESEEEAAPGFDPEALARGVAAAVLAAMTPKK
                     KKGGK"
     gene            <967794..>969715
                     /locus_tag="THITE_115222"
                     /db_xref="GeneID:11519670"
     mRNA            join(<967794..967895,968307..968330,968449..968470,
                     968793..968913,968980..969131,969444..969649,
                     969698..>969715)
                     /locus_tag="THITE_115222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656332.1"
                     /db_xref="GeneID:11519670"
     CDS             join(967794..967895,968307..968330,968449..968470,
                     968793..968913,968980..969131,969444..969649,
                     969698..969715)
                     /locus_tag="THITE_115222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656380.1"
                     /db_xref="GeneID:11519670"
                     /db_xref="JGIDB:Thite2_115222"
                     /translation="MCPLSAGSLASGVTCAPACDIPPRQARKRLSVEHLPTLANCVSI
                     PIPYLAIPSTICLTAFKKAYTTKVVKNKLALLLATPSKSSASASKKTPAMPKTPITSK
                     TPSKCIAPSSSFSSSEEEEEEGALREVLYLSYLKSTIYKGKDVDANNNDNDNDEERIP
                     TPAKGKGKGKAKVATPTKKAKKAKKEESKEENKDKDKEEATLGFDLDTLKKGGK"
     gene            complement(984168..985047)
                     /locus_tag="THITE_2120895"
                     /db_xref="GeneID:11519671"
     mRNA            complement(join(984168..984541,984596..984671,
                     984719..985047))
                     /locus_tag="THITE_2120895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656333.1"
                     /db_xref="GeneID:11519671"
     CDS             complement(join(984212..984541,984596..984671,
                     984719..984810))
                     /locus_tag="THITE_2120895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656381.1"
                     /db_xref="GeneID:11519671"
                     /db_xref="JGIDB:Thite2_2120895"
                     /translation="MRGKSSGECREAPGKAARCARCARGKKCRSIPASVLPAAKHFLA
                     LMQGRQEPKANLDQKTLRATLRALLAMEGEDADAEDDDDDDDERAPAPAKGKGKGKAK
                     AAAPTKKSKKAKKAKKEESEEEDEDEDESEEEAAPGFDPEALARGVAAAVLAAMTPKK
                     KKGGK"
     gene            complement(<991831..>994127)
                     /locus_tag="THITE_45171"
                     /db_xref="GeneID:11519672"
     mRNA            complement(join(<991831..992422,992490..993048,
                     993146..993371,993561..>994127))
                     /locus_tag="THITE_45171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656334.1"
                     /db_xref="GeneID:11519672"
     CDS             complement(join(991831..992422,992490..993048,
                     993146..993371,993561..994127))
                     /locus_tag="THITE_45171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656382.1"
                     /db_xref="GeneID:11519672"
                     /db_xref="JGIDB:Thite2_45171"
                     /translation="MSIFAWCSRRAGGLAMLATIGLSYWVISSELQAQRHGYKYASDD
                     SLSAPHYDPSRWGSWVTIFSYYCLLIHFLVFIFPLRSCWAVFTITRNLRKAARTRALK
                     DLKFNHRRRGSSTSLSSSETLTSSRDISSTSSSEAGDLDPEAYTDGDIAPDRVIHAIV
                     IPNYKEENDTLRETLEVLASHPQARNTYDVYLAMEQRERNAETKAARLTNEFSKKFRS
                     IDFTVHPSDIPGELAGKGSNMAWAARKLSEKYSLAQRKDVIVTGIDADSHLSSNYFAL
                     VTTMHMAYPDSASTTLYSAPIIFDRNAHNVPAIVRVADVLWSAAGMSGLYKGSWIAPP
                     TSVYSVPLELVDRVGGWDCDSEAIGEDLHMYLKCFFALNGNLTVRTVLSPVSQTNVTG
                     GGRGKGIRGMVADVRARYKQALRHMWGALDTGYALRKVVEVWRERKHTARAFRPLHMS
                     TNDVSETYVPQSQIDSVDAEATPESGIFSDVVTDTLKEPDWQRIFILFHRLFEAHFLP
                     VQMTILVVASTLYVWITEGNSDPHGVSWIFSLCNVLRTAGFMEVALYLFLYEDFHKIC
                     VESREIEMGDAGLLKGMHFSRRQVKTNLIDYIMVPLVAPIFGSIPCAQAQICHFWTLD
                     LVYTVSKKVTRERAKSVTADALV"
     gene            complement(998104..999380)
                     /locus_tag="THITE_2120901"
                     /db_xref="GeneID:11519832"
     mRNA            complement(join(998104..998363,998427..998670,
                     998754..999380))
                     /locus_tag="THITE_2120901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656335.1"
                     /db_xref="GeneID:11519832"
     CDS             complement(join(998322..998363,998427..998670,
                     998754..999112))
                     /locus_tag="THITE_2120901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656383.1"
                     /db_xref="GeneID:11519832"
                     /db_xref="JGIDB:Thite2_2120901"
                     /translation="MNANAHITDPALASVLETSRTAREQAQALVDLIAHATTANAGGP
                     LAADALIEISKQQKLLNTNLAHLRGLHRAAHFRARETKSLTAEARHEVDVLHLQLQNL
                     YYEQRHLEGEIAACEGFDHTYQLLPLIPVEEFLEKHPELADADENALMVARINHERAE
                     REALEQQRLELQKRKQKLIAENKKRRDDLANLDKDLEKFIDAAKPIQKMFEKVV"
     gene            999596..1001868
                     /locus_tag="THITE_2120904"
                     /db_xref="GeneID:11521705"
     mRNA            999596..1001868
                     /locus_tag="THITE_2120904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656336.1"
                     /db_xref="GeneID:11521705"
     CDS             1000064..1001551
                     /locus_tag="THITE_2120904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656384.1"
                     /db_xref="GeneID:11521705"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="JGIDB:Thite2_2120904"
                     /translation="MDVSPSMGCPAPFTFSSCDDAPEAQSSGALVPDRFAARQRRHSQ
                     LAPRRKSIVNQIMDGEEALLFKLDMCLTQLERRIEYWESYGELSLDSSLSAAFATLQA
                     VRTRCSQASEEVMGAGRRRLQVMVETLESGYHEAMAAAGSLNEKAKVGIELLDGMLED
                     LETQAAKFREKGLASAAESFMDEAHRVVDGGIERAIRVAGTLEDHVQRAIARAKEIGL
                     LRYEDLPVPWRINPHIISGYRFSETKLACVRSAFGFSNELVNIWSHALGLILVLAVAF
                     YFYPASATFSLSSKADVFVAAVFFFAACQCLVCSIVWHTMNSVADVNLISIFACVDYT
                     GISLLIAASIMTTEYTAFYCEPVGRWIYMVTTAILGVAGVILPWHPRFNGADMAWARV
                     SFFVALAATGLLPILQLSLTRSPWAVFEFYTPIAKSLLVYLLGACIYASQVPERWFPG
                     MFDYFGGSHNLWHIAVLGGILFHYTAMQDFFSHAFRLASDGCIAY"
     gene            complement(1005275..1007377)
                     /locus_tag="THITE_2120912"
                     /db_xref="GeneID:11521706"
     mRNA            complement(join(1005275..1005617,1005686..1006491,
                     1006567..1007377))
                     /locus_tag="THITE_2120912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656337.1"
                     /db_xref="GeneID:11521706"
     CDS             complement(join(1005494..1005617,1005686..1006491,
                     1006567..1007178))
                     /locus_tag="THITE_2120912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656385.1"
                     /db_xref="GeneID:11521706"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Thite2_2120912"
                     /translation="MTLRDLNQLLDRMPSSTKDTPGLSSLGPLPAMQLHPPPSPGTHR
                     TLRRLQSAHTLGAKAATQPSLISQQRLQLQHQQQFQNLNQHLQKGPPPPAPAHAPPSH
                     QQQQQQPPPPRRHASINRSPQRARANSDTPQPANVPQLSAATMTAATAARRSALSKRS
                     LAADTMSLERLLREGPPNGDVEGALESTRLKILDQGIKSDSDGMSSLRIYVWLIFLNA
                     PVLDTDSYLALIHRGASPAYSKIRNDTFRTLSTDPLFRRRVSEASLIRLLNAFAWTLH
                     DAREERARDPSVASSSRLSLDQSSSRPETGHGSDYGSPSSSPAAKRARALTLTTEGSV
                     TSMAAEPGAYVQGMNVLAAPFLYAARSETEAFAAFHQLLTNECPGYIRGAMDGVHKGL
                     ALVDKVLAIVDPKLSLYLLSKNLSAEIYAFPSVLTLCACTPPLPEVLRLWDFLFAYGP
                     HLNILCIVAQLVMIRTKIMESPSPNKLLRSFPALQADQIKRTTLAIIKMIPDDIYSEI
                     VSHAR"
     gene            1009853..1012779
                     /locus_tag="THITE_2120915"
                     /db_xref="GeneID:11521707"
     mRNA            join(1009853..1010284,1010359..1010504,1010567..1011110,
                     1011175..1012779)
                     /locus_tag="THITE_2120915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656338.1"
                     /db_xref="GeneID:11521707"
     CDS             join(1010011..1010284,1010359..1010504,1010567..1011110,
                     1011175..1012754)
                     /locus_tag="THITE_2120915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656386.1"
                     /db_xref="GeneID:11521707"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Thite2_2120915"
                     /translation="MSLKARHVVAKALGIKLQEQDPYKELDTPGASVLSGRTEHSFVE
                     EPPLVLDYLNSLIPSGKDLYRYLLSLFPFLSWIGRYNLQWFIGDLVAGITIGAVVVPQ
                     GMAYAKLANLDVQFGLYSSFMGVLIYWFFATSKDITIGPVAVMSQLTGGIVADLATTL
                     PDVPGHVIASALAILAGSIVLFIGLIRCGWIVDLISLTALSAFMTGSALNIISGQIPT
                     MMGISGFSTRDAPYLVFIHTLQGLPRTTLDAAMGLTALTLLYLLRAACSYSAKRWPKH
                     QRLFFFLSTLRTVFVILLYTMISWLVNRGLPEKKVKFKILLDVPRGFQNAAVPVLNQR
                     IASNLVGYLPATVIVLLIEHIAISKSFGRVNNYTINPSQEMVAIGVTNMLGPFLGGYA
                     ATGSFSRTAIKSKAGVRTPFAGVITAVVVLLAIYALPAVFYYIPNASLAAVIIHAVGD
                     LITPPNTVYHFWLVSPLEVVIFFVGVIVTVFSTIENGIYCTICLSAAMLLFRILRARG
                     RFLGRVRVASMLDDHVIGDEFRQVAYGTFTRSPDAPFRNVFLPITHADGSNPEVELGN
                     PYPGIFIYRFTEGFNYTNASHSLDFMTRYIFAHTRRTNPAHFERPGDRPWNDPGPSRR
                     KLKAAVAAGSDGAAAEGDSSLPTLKAVILDFSSVNHVDITSVQHLIDVRNQLDRYASP
                     DTVDWHIACISNRWTKRALAAAGFGYPTMRPDVPHLRWKSIFSVAEIGGSQSAAAAAE
                     FEDNEKELESIHRRQSLHHTTPDLEAGISPHTKGGAANDRGSSHSSEPAAGGDAKAGA
                     AKLSGGRTVAVHGINRPLFHVDLTSALQSAIANVEARGEFRGGVSEQAK"
     gene            complement(1013380..1015934)
                     /locus_tag="THITE_2120918"
                     /db_xref="GeneID:11521708"
     mRNA            complement(join(1013380..1013603,1013660..1014612,
                     1014687..1015522,1015665..1015934))
                     /locus_tag="THITE_2120918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656339.1"
                     /db_xref="GeneID:11521708"
     CDS             complement(join(1013765..1014612,1014687..1015515))
                     /locus_tag="THITE_2120918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656387.1"
                     /db_xref="GeneID:11521708"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Thite2_2120918"
                     /translation="MEDLPEEINLVTLNCWGLKYISKLRRERLSEIGRQLAIADPKPH
                     IVALQECWTQEDYKSIRRQTRFILPYAKFYHSAALGGGLAILSRWPIEESTMYRYPLN
                     GRPTAFWRGDWYVGKGVACATIRYGPAAKQVIEVFNTHTHAPYEGGKPNDSYLCHRTA
                     QSWEIAKLLRGAAERGHLVIAMGDFNMIPMSLEHQLVTALAPVRDTWRVIHPDSSVGP
                     ADHPAEMARRRPVPTAEFNIQENGAASDGPYNTWRWTKAQQKLLGPGKPPVPIAPDTP
                     DRRGKRLDYIFAGSGDIHALGGGWVVKRVRVGMMMRHPEFGCSLSDHFAIESTLAFHP
                     LRETQPSPPPPPLAAKSASDATASNRDSSPTAATATVLPSDEPRPPTPAEPKTESALH
                     NGAYLQLQSPTPSSDHDPDNPATGPIPAASQIRSFLNPSPDALPPTAYDEILSLIRSY
                     TAREQAQLRWRAAHFFLAVLVTVACLVGVWFSPHNYVSFVLVLVSSLGLTAGTVDGLL
                     ALLFFRSELKALKEFEWEVRNAKGALVRGGAAGWDGRAVGEDGEEEWGED"
     gene            1016039..1018065
                     /locus_tag="THITE_2120922"
                     /db_xref="GeneID:11521709"
     mRNA            join(1016039..1017341,1017420..1018065)
                     /locus_tag="THITE_2120922"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656340.1"
                     /db_xref="GeneID:11521709"
     CDS             join(1016170..1017341,1017420..1018050)
                     /locus_tag="THITE_2120922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656388.1"
                     /db_xref="GeneID:11521709"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2120922"
                     /translation="MSEFESAAGTPITEPPSKRRRVHDGSLDTTPRSQSPSSPRHRSP
                     PTGGHMHEQSLSIRRGRPASRSHSRSRNGNLDADDGNRGRYRSSPSASRSRSRSGRSR
                     SRSRLRSRSRSQSASYSRSRSISSSRSRTRSRSRSRSRSRSRSRIRTRSGSRTRSLSS
                     SQPTPTTPHAAHHHRHARPPILPNYQPHLLLQGHTRAVSQVRISPDGRWIASASADGT
                     AKIWDAATGAHLDTLVGHMAGVSCLAWAPDSNTLATGSDDKAIWLWDRVTGSPAHAVG
                     RRDPAGVGIGAAAKGPATGRAGARRGRVGASDEGTRGGRPGRGPLLGHHNYVYCLAFS
                     PKGNILASGSYDEAVFLWDVRAGRLMRSLPAHSDPVSGVDFCRDGTLVVSCSTDGLIR
                     IWDTSTGQCLRTLVHEDNPAVTNVCFSPNGRFVLAFSLDDSIRLWDYVSGSVKKTYQG
                     HTNKGFSIGGGFGVLTDADDGYPGDDEDYGSARRQAFVTSASEDGDIVMWDVVSKAVV
                     QRIRGAHKGICFWVDVHGGTMVSAGQDGLVKVFRHRPDGRPLKQENGGTNGHVNGLPE
                     EPAMQDAAAADEELQRHVEAEAGSPGFHVKEEQL"
     gene            complement(1018194..1018855)
                     /locus_tag="THITE_2120923"
                     /db_xref="GeneID:11521710"
     mRNA            complement(join(1018194..1018626,1018707..1018855))
                     /locus_tag="THITE_2120923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656341.1"
                     /db_xref="GeneID:11521710"
     CDS             complement(join(1018338..1018626,1018707..1018744))
                     /locus_tag="THITE_2120923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656389.1"
                     /db_xref="GeneID:11521710"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="JGIDB:Thite2_2120923"
                     /translation="MPTDVPVEFPCALTLNVPFPDARLASVALQALRVDKELSSLVVR
                     DLSTIAEEGLSEQTVLRVEYKAATNRMLRVAVNSFLESLALVMEVMEVLDHDVVEAWQ
                     GQEERG"
     gene            1019189..1021826
                     /locus_tag="THITE_2120924"
                     /db_xref="GeneID:11521711"
     mRNA            join(1019189..1019537,1019706..1020020,1020086..1021826)
                     /locus_tag="THITE_2120924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656342.1"
                     /db_xref="GeneID:11521711"
     CDS             join(1019480..1019537,1019706..1020020,1020086..1021695)
                     /locus_tag="THITE_2120924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656390.1"
                     /db_xref="GeneID:11521711"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Thite2_2120924"
                     /translation="MAPSTRYSSNLGQIIEYIPDRLYLASYVEAPDANTLFPYPDPPP
                     RSPSKWSQRSPEGPTPAQSSQKQPFYFTVDDTLLYNAFHHDFGPLHIGHLYRFALQFH
                     EILGAKENKDRPIVFWSRADPRSRANASCLLACYMVLIQSWPPHLALAPIAQVDPPLM
                     PFRDAGYSQADYGITVQDVVYGVWKAKEEGCCVLETFDLDEYERFERVEQGDFNWITP
                     NFLAFASPQSTPSARTPEGTDAWNALPTTLAAVDAHPTLAQPFKNVLRHFSERNIGLV
                     VRLNSALYDASYFEALGIQHVDMIFEDGTCPPLSMVRKFIRMAHEMITVKKKGVAVHC
                     KAGLGRTGCLIGAYLIYRHGFTANEIISYMRFMRPGMVVGPQQHWLHLNQGTFREWWV
                     EERVERKLRKEAALAAAAAAGSQTNGAHQPITPIRATQKSGLGRSSSKNGTSTPPNRG
                     SARTPLGEIDHDRTRDNSIGVQEDYLPAPTPGQPRKTQRNAVDRHHPYHRSTSAVPTV
                     EEEAGAEHEVQTEVISIHRSQGNESDEEWNLRVRQHREASGSLSPDRRDRSVSHQTTT
                     TSTTTIYQLVDDDASHDIENMGMATAKTKSYDQIQRASSASGVLVKVRGASSSPKRAV
                     AGGGVRESGVRKTSGRVGSVGQGSPIGAAVSSARKS"
     gene            1025767..1028420
                     /locus_tag="THITE_2120926"
                     /db_xref="GeneID:11521712"
     mRNA            1025767..1028420
                     /locus_tag="THITE_2120926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656343.1"
                     /db_xref="GeneID:11521712"
     CDS             1026365..1028005
                     /locus_tag="THITE_2120926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656391.1"
                     /db_xref="GeneID:11521712"
                     /db_xref="JGIDB:Thite2_2120926"
                     /translation="MSLSPTTGMSRLSLDRNSPLPRDPSRSQLRHPSSSMPESEPSSD
                     QSDWELEEDDDEGEGEPDTVSSPTGFKYNISRLSPRTRRVVKGLFNQSSSKDPPQISL
                     ELCGIRGDDPEGSGLFYAFQMHEVVPCSVRIGSRNSGRFSAPKCECPDARYRHLRPCK
                     HLIWLFDKISKLALVDHDPDSVLTMTELGYAEELGDPFAQISQVRLDVLADDLRCDMS
                     EPDTDVVSPNPARVREAREMVAAMEGVEPRELDSYRPDLDASYNRIPPIRRGDLGATL
                     FSLLLASHHLAEWVRSELSPSDPAVDPFRRLQQRASRIIGELDVYSAAERDPAAVDAY
                     RRRGKMAEGPRDVDWAAAQIRHCVDKIERLVSRGSSPLPAWARSSAARSLVCILKAVV
                     HHRDLYPRLIREQDADFVYSALDMLADQSQFIEELEEIMDLVGIRGAPPSYVDKMRSL
                     ISRMRSHGTEDVVSPSGIPRSETPPLYESSSAAVQHPGPSRGSSVQFLTPEVPASAMG
                     RGGQGARGGRGRGNGRGSKRLVSPHDSPRGSRKRVRGA"
     gene            complement(1028522..1031379)
                     /locus_tag="THITE_2120928"
                     /db_xref="GeneID:11521713"
     mRNA            complement(1028522..1031379)
                     /locus_tag="THITE_2120928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656344.1"
                     /db_xref="GeneID:11521713"
     CDS             complement(1029152..1030996)
                     /locus_tag="THITE_2120928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656392.1"
                     /db_xref="GeneID:11521713"
                     /db_xref="JGIDB:Thite2_2120928"
                     /translation="MELNSASIHDVIHPTAGYTTTASLQNPPPTENQAADQSEASSWA
                     CSQLNPKNRIDSLEYPLNPLWRIDGCTGLGTQYYATPLFLPDVTPMRFDVFIPEEAVD
                     SPVLRELLDLSVAFHTKDATRLRRLGISRHIVRTLRAWVTRKGYGMYSALCQSLPFGS
                     RIILENLHVDIDRIRISVVPTYYVERQLLGLARIGQSLGLPPELVPPAVDISRLSVVQ
                     QLHDSVCLVRMKGTGGGAEADKLWILKALASGTKYLFVELRNLLLMEPHPNVVSRPKY
                     LVTKQCRFGGKTAVVGFILPFHQHGSLRDTLPLLRLHGRLSLDLQLRWAVQLASAVCH
                     IRDRGGMFYPDLRLDNILLSASHDVVMVDFEQRGVWCEFSAPEVNAIEYVRILASDEV
                     SEGGRGPNRAIPEETRRLFAAILDRLLPDWNILQACEDYASPRPHDYPNYNIPWLSLD
                     ETEQEAAMVYMLGRVLWCIFEGQSAPQTAAVWQSYRHEPDIEFPAFRLTPPKLRVLIN
                     HCTRGRRGALSSLIVRRGSRLVLRDQPNSSPEAVLDVARKWWRDEVEFAQRFLKMREE
                     RKAIGAWSGNYFQRPKLVDVLAELERLSQVFDTAGNLKPLLTVVATSS"
     gene            1035314..1038774
                     /locus_tag="THITE_2120935"
                     /db_xref="GeneID:11521714"
     mRNA            join(1035314..1035792,1036073..1036556,1036653..1037314,
                     1037377..1038255,1038324..1038366,1038419..1038574,
                     1038640..1038774)
                     /locus_tag="THITE_2120935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656345.1"
                     /db_xref="GeneID:11521714"
     CDS             join(1035790..1035792,1036073..1036556,1036653..1037314,
                     1037377..1038255,1038324..1038366,1038419..1038574,
                     1038640..1038743)
                     /locus_tag="THITE_2120935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656393.1"
                     /db_xref="GeneID:11521714"
                     /db_xref="JGIDB:Thite2_2120935"
                     /translation="MNPNIRKRRAYGHPEAPAEPVLSGLPLLASHDTVPPLAADHRYI
                     LEPAPLPYALPPGTWDASSPDHHPYFQEQAALVLNEPLGSFINFDSPPYPYSSNNPHH
                     FLKKPRLDQTIHMRAPCSGDLCAQDGQEKSPPALSSGWTGKRLADCLASFSVCSTFEP
                     QPSYQPLLTPPLYDYDDSRPPALNTAIVSVQPQAQAALLPTPVSPGTTALFACDDPAL
                     MAQYVSDHPPLQPIRPTGLQPAITREEMVYPGLSASAQFDGSAESLHGASGLERGLQR
                     QPYNGDVPLGTGAIAGVYGAGQASTSYAGHGIVTALPSHSVPMHPLDVKPAAERGDVQ
                     DGGTRLDFFQVPRTTPVKRGPFKDQDSREKTALTRKMGSCIRCRMQRIRCNLDPENER
                     GPCLSCKKIASSTKVYRLNCLRLKITDVKLFKPGQVKGQEWTNRWKDGVMDDIGNWES
                     SEVRTIHVTEGYTGKSVRLQVRQFKPQPGDSLERKWVSKNGTRQTVQIPAFAIVNLDD
                     AKAAFDQYIKLGLLGCCDYLLGPRDELLSRTYSLAISTAKDIATPLSERSLLMTTLDL
                     WMSVRLTTKSFEIVGDDTLGMPRDIIKDQDNPLHGKIPLPPVMGAQIDSVIIHQIQPR
                     LRRKTLEELQKMTQEKKPKTWLTTYLVTFILLHNIALITKHDADYARKHGLNRRFARE
                     ANVKEYNLGANTLLAYFHYCNKATYPFSSECKDQDLRALAELDDDAISFVHYTRQFVA
                     DHRKEWEDLWIRDDYENEFYYVSQLFEQNWQPRTMA"
     gene            1041745..1042273
                     /locus_tag="THITE_2120936"
                     /db_xref="GeneID:11521715"
     mRNA            1041745..1042273
                     /locus_tag="THITE_2120936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656346.1"
                     /db_xref="GeneID:11521715"
     CDS             1041753..1041998
                     /locus_tag="THITE_2120936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656394.1"
                     /db_xref="GeneID:11521715"
                     /db_xref="JGIDB:Thite2_2120936"
                     /translation="MSSQFFRGPSQVLLAGCLPQLVFCVTGRFVLTRSLFLPAAVECV
                     QGPYPPSEPAGCALFPVGHKQERDAGRQLPVQRRVLS"
     gene            <1042398..>1043780
                     /locus_tag="THITE_2055598"
                     /db_xref="GeneID:11521716"
     mRNA            join(<1042398..1042626,1042683..1042913,1042971..1043038,
                     1043106..1043275,1043336..>1043780)
                     /locus_tag="THITE_2055598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656347.1"
                     /db_xref="GeneID:11521716"
     CDS             join(1042398..1042626,1042683..1042913,1042971..1043038,
                     1043106..1043275,1043336..1043780)
                     /locus_tag="THITE_2055598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656395.1"
                     /db_xref="GeneID:11521716"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Thite2_2055598"
                     /translation="MSAAATATILGSPSLALPAKASIDISALLPPGFPAHLESGLSWT
                     GSDFSESSDHILVLTDTHHAEIKSALENFKRKCLDQDGDLVEPANFPLPTLGPKLKEL
                     SRDVHDGRGFCLVRGIDPSSYCVEDLTLVYLGIQSYIAEQRGRQDKRGNMLVHIVADN
                     STRQAAEHHRHSTKAITFHNEESGDVISWLTRSTAAAGGKCIIASAYTVYNVLASTRP
                     DVIRTLARSDWPFAMPRFQCRPIIFYQEERLIMNFGRAALLGSEAHPRAPYLPSLTAR
                     QVEALDAIEAIAQATQLEIQTQAGDMHFINNLAILHRREGFVNGEAPTEKRHLVRMRL
                     RSAEQGWSIPPELKADWDDAFKGTAAKHWHVEPMPLYFFPMRLQPN"
     gene            complement(<1052042..>1052369)
                     /locus_tag="THITE_157384"
                     /db_xref="GeneID:11521717"
     mRNA            complement(join(<1052042..1052285,1052347..>1052369))
                     /locus_tag="THITE_157384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656348.1"
                     /db_xref="GeneID:11521717"
     CDS             complement(join(1052042..1052285,1052347..1052369))
                     /locus_tag="THITE_157384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656396.1"
                     /db_xref="GeneID:11521717"
                     /db_xref="JGIDB:Thite2_157384"
                     /translation="MPDDGDGCIPATQGDSVKHPGFSDTLRPPTPIAHNIGSCASLDA
                     NRALASATTNPDQPPVGPQRFSKTQRTYTTYASASLFNVPLPHQ"
     gene            1055831..1057784
                     /locus_tag="THITE_2120943"
                     /db_xref="GeneID:11521718"
     mRNA            join(1055831..1056054,1056117..1056358,1056432..1057202,
                     1057281..1057784)
                     /locus_tag="THITE_2120943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656349.1"
                     /db_xref="GeneID:11521718"
     CDS             join(1056215..1056358,1056432..1057202,1057281..1057760)
                     /locus_tag="THITE_2120943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656397.1"
                     /db_xref="GeneID:11521718"
                     /db_xref="JGIDB:Thite2_2120943"
                     /translation="MSAAANWVAVASTVCCVFLLLSWAVLPVDKTYRHYLSICLTMGV
                     VFMNLGFVIPLAGNPEQCYDAITPNSMSTSPMCAASGFFLILGGWSGVLWVFLRALSL
                     HLQICWQLVVGRNFMFFSQVVGWGVPVIGVILAFVLSGVSFRFGQTCHINHKNSLADL
                     WIPLLVFAGLTIIIQFATFGYCIKVYLASLSDNSATTEGSNMPSYTNSIRTMTPKQAY
                     RRVRRVIALQWRGIVIVLIIVTDVILFSIVFVFEDNTVQAVKDDVTLAAPWIFCLIEN
                     GGNKVPCLDLASSLVVGMPTIGAVLFLLGMNGIWLLFLLGRWSMVTGWWDLFVELPNR
                     NKREFVSVDARLDDLKKDTRSYEMLSRDTGKTMDESVTPSVETPISPTLARSTAGSPM
                     APDRYPANNDGRRTPDYFGNTARYHAPARSFSSPRPPQTTVTWDARETYARPTSPPYR
                     QQDRYVNPLGMNRI"
     gene            1059580..1061217
                     /locus_tag="THITE_2120948"
                     /db_xref="GeneID:11521719"
     mRNA            1059580..1061217
                     /locus_tag="THITE_2120948"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_003656350.1"
                     /db_xref="GeneID:11521719"
     CDS             1059886..1061136
                     /locus_tag="THITE_2120948"
                     /note="CAZy_ID 269813"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003656398.1"
                     /db_xref="GeneID:11521719"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Thite2_2120948"
                     /translation="MIVILVLLLAAALLTYFFISEATLSAPWKPDPSARLFAQRPLPP
                     PLDDTFLSSPKYTLPLRTRGRDVVDANGRRFKLASVNWYGASDELFVPGGLDVRHRDD
                     IAALIRSMGFNSVRLPYADETVMANPVVAPHLLSANPDLVGKRALDVFEAVVQALTDQ
                     GIAVIVNNHITSATWCCGADPCDSGWANDHLPAVLCRVRQTEEQWVQHWEEVMGRFVK
                     NRLVIGADLRNEVRGFWGTMPWEKWAAAAEKAGNRLLKMNPDWLIIVGGTESCNDLSG
                     VARRPVVLDVPDRVVYSAHVYSWSGWGSLGGRYSKRTYASFVQSMRKNWAYLVEGNIA
                     PVWVGEFGAPDKPKRGDANYWNNLMRYLKTIDADFGYWAINPRKPKDDERETYSILKD
                     DWLTPLLDYRMKDMTEMMRAGRRK"
     gene            1061882..1064552
                     /locus_tag="THITE_2120949"
                     /db_xref="GeneID:11521720"
     mRNA            join(1061882..1062064,1062235..1062498,1062584..1063335,
                     1063395..1064552)
                     /locus_tag="THITE_2120949"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656351.1"
                     /db_xref="GeneID:11521720"
     CDS             join(1061978..1062064,1062235..1062498,1062584..1063335,
                     1063395..1064538)
                     /locus_tag="THITE_2120949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656399.1"
                     /db_xref="GeneID:11521720"
                     /db_xref="JGIDB:Thite2_2120949"
                     /translation="MDSAAAGVAEGEDELYVSHTCYAQSAESRFGERVLDDLKTFVFQ
                     PPHDAWIPVLDPGDVDEEDDDAEMDLDVGFVDLYDSDPSTAHVLETDPSHAEQGFPRI
                     ATLRNNLTALSQRYNLYFAAYQDRIYVYQPRRSAPRILPSQSLILQPRPSKYADFAGG
                     AIDPRFPHQVNHIIVGNLGLLEIVLLAYDDGDVIAYYTHAIVRCIRANADDVRRGGAR
                     TRQPAHPKPFFHENVGKSAWGMAIHERSRLIAVGSNLHEVTVFAFALSNPTTVYNFPD
                     ADLSPRTRCGQTALALEKHLRSRTRTWRIVLPLSHVGDNIPNLAFMDDEAGEADKVVA
                     IDVAGNVWLLDIWKLGTPPLLWPMAAPRDNVTGRAMGWGVLVLPGSSFRSAKTVYDSL
                     GVPGGEVIPGTRAEDSSRVWLDTTCSLYYVDGLSPSAKHVFRRGSRAEYARKHATNLE
                     YPGDDFDDLEPATESESEVEGESSGASAAVDDATGDGAASSPAAGGRGDRQWTALSAY
                     RGPSGTDLDDMADDIQMGRCIIPLFGETPALDGTVSQHTALTRRSFQRQGRTNHVEVR
                     AAQFPAHTARNLCLLRTSQTGIELLPLDRDAPCISCKYVLPCHQDGRASAPWDLHPVY
                     SQRVSMLIHVPELNLVAAGSPTGRVALITLTRTAKKFYMTKLRRGFRVECVLPRKSDK
                     KLRPNCTLIGIAMSPAPHRQAKGLELRPGGKRTHPTVYRLILHYKDHSILMYDVAKRG
                     SGWDLTVF"
     gene            1069314..1071325
                     /locus_tag="THITE_2120957"
                     /db_xref="GeneID:11521721"
     mRNA            join(1069314..1069458,1069610..1069938,1070015..1070953,
                     1071030..1071325)
                     /locus_tag="THITE_2120957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656352.1"
                     /db_xref="GeneID:11521721"
     CDS             join(1069410..1069458,1069610..1069938,1070015..1070953,
                     1071030..1071275)
                     /locus_tag="THITE_2120957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656400.1"
                     /db_xref="GeneID:11521721"
                     /db_xref="InterPro:IPR010256"
                     /db_xref="JGIDB:Thite2_2120957"
                     /translation="MSTTDGSSSGNAGTSSDDNPNLPFRAGDQAYIIVSSAMVLLMVP
                     GIAFLYSGLARRKSALSLIWVTMMSFSVIVFQWYFWGYSLALSSSATNGFIGNLDKFG
                     LRNTLGEPSPGSPLIPELLYSFYQLQFCAVTAALVIGATAERGRVVPAMVFTFFWATL
                     VYCPVAYWAWGANGWAFKYGVLDYAGGGPVEIGSGASALAYSWVLGRRNEKMMLNFRP
                     HNISLITLGTILLWFGWLGFNGGSAFGANLRATMACWNSCLTAMFAAMTWCLLDFRLA
                     RKWSLVGWCSGTISGLVAATPASGIITPWASIILGVVAGVACNFGTKIKFIIGIDDAL
                     DVFAEHAIGGMVGLVFNGFFAADYIISLDGVNTSITGGFLNHNYRQLYVQIAYLVAAT
                     AYTFVMSAIIAKAVDLVPGLHLRASSEAELLGMDDDQHGEFAYDYVEVRRDYLAWTPA
                     EKDPKEDGVVVIPQHGIAGHQDLVDNVRLRGPSSSKAESSAPATPPPEREPEPPKATL
                     PVVEEKAAGSAQ"
     gene            1072750..1074324
                     /locus_tag="THITE_2120959"
                     /db_xref="GeneID:11521722"
     mRNA            join(1072750..1073137,1073210..1074324)
                     /locus_tag="THITE_2120959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656353.1"
                     /db_xref="GeneID:11521722"
     CDS             join(1072889..1073137,1073210..1074175)
                     /locus_tag="THITE_2120959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656401.1"
                     /db_xref="GeneID:11521722"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Thite2_2120959"
                     /translation="MSFISRLGLWPQTGTNSTGLIVASTAIATAAVLSLLRSYLWPTP
                     PKIDRSPLRTVLPTLSPDELNRLEYKPDSFPGARDVETPYGSIRVYEWGPLTGEKVVF
                     VHGISTSCMTLSKLAHALVNEKGCRVMLFDLFGRGFSDNPSDLPHDARLYTTQILIAL
                     ASSTEISWTGPNAFKLVGYSLGGGIAVHFATAFPHLVSSLVLLAPAGLIRPESFGALS
                     RAVFTSGLVPPRLLAWITRQRLKKPIRESGKRSNGGGSRTPASRPDPVAASLSETAPL
                     LGGPGGGGSRPEPRNALEQRVLRDVHWQLAHHAGFVPAFMSCIRHAPLVGQHAAWAKL
                     ADRAPGTTVIILGEGDEIIDPVEYVHDARPLVGGPEKVAWAVVPGGHDFPMTSAEDTL
                     AEMYKAWGWPLF"
     gene            complement(1074877..1077024)
                     /locus_tag="THITE_2120965"
                     /db_xref="GeneID:11521723"
     mRNA            complement(join(1074877..1075388,1075446..1075695,
                     1075771..1076049,1076104..1076214,1076267..1076372,
                     1076435..1076509,1076662..1077024))
                     /locus_tag="THITE_2120965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656354.1"
                     /db_xref="GeneID:11521723"
     CDS             complement(join(1075029..1075388,1075446..1075695,
                     1075771..1076049,1076104..1076214,1076267..1076372,
                     1076435..1076509,1076662..1076707))
                     /locus_tag="THITE_2120965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656402.1"
                     /db_xref="GeneID:11521723"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="JGIDB:Thite2_2120965"
                     /translation="MMGLVSGRRRATSNASSRSSGEATEPLEDDTLVVEPDQGNVLSH
                     IISQLRPGADLSKVVLPTFILEPRSMLERITNFMCHPEMLLPIPTIDDPVQRFVAVVK
                     FYLSGWHIRPPGVKKPLNPILGEIFTCSWEFPDNTRAYYIAEQTSHHPPKSSYFYMVP
                     GHNIRVDGTLKPRSKFLGNSAASMMEGTAILSILNRGKDPVKGERYTLTQPNMYARGI
                     LFGKMKYELGDHSYVRCPETGLSADIEFKTKGWVSGTYNAIGGTIKNDRTGEVLYELS
                     GLWSEEMFIKNVKTGHKEMFFNALKSKPSPPICRPLEEQDERESQRLWAKTARAVKKR
                     NHELATEEKTKVEELQREEAAKRANDGVEWRPRLFRRVKGGPGGPEEGEEELEWIINA
                     QMSDGSIPCYRLDVTC"
     gene            <1079485..1084283
                     /locus_tag="THITE_61985"
                     /db_xref="GeneID:11521724"
     mRNA            join(<1079485..1082833,1082907..1084283)
                     /locus_tag="THITE_61985"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656355.1"
                     /db_xref="GeneID:11521724"
     CDS             join(1079485..1082833,1082907..1082983)
                     /locus_tag="THITE_61985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656403.1"
                     /db_xref="GeneID:11521724"
                     /db_xref="JGIDB:Thite2_61985"
                     /translation="MTENEPPALAVPDDGRTTRRGRLMGKLFGRDRDRKAAHDDGDLD
                     DFLHGAPDKLQVVHASPPVLTKIDTKTATRYPNALNFNGPSEPPTREYAVRPRDPTTK
                     PKKGLVVRFADTYPEIIGEGGDECEVPTLEVSRSKKQRSQHAAGGSARPRPADVGDTI
                     QDPFGDEHAAEPPFNLGPPRRTQNALTAGLEPPASVLPSANNTGRFLGVPNAPQDERR
                     RSFIEIQQAQMREAEGRAFASAVRAASGDQSKRERGSASPTSSDGGSDSPITASPDSM
                     QLPQSQSSAPPAQPPQIPAKALPQRPPLPQIPVPPESRDIPSSHNPFSATSQQANSPE
                     RLKRTQKLENSPTTLPSANSAFQPRFDSLRQGTKISEKDYASPVQHQNTMSFQDVVAA
                     ASDDAMSAFVTRTRHLFELFRLHAESVRPLVSCSPHDLARAAVWWFLTGRTALEVAIR
                     ERPSTPESQRKNEMAKQQAYADLAKGYWLLEEAMPEVVSSGRSPPDLQAENVRGTLNS
                     SLKKLAVSMKRNGFLPPAEAFLPQMVDRTIWLDYPPLSQDIKLLLWGSSSAFSQGQEN
                     AGMTILESMPLGDSATTFCFARFQVDAFLTELGRESQRLYLPCFLSTVRPQTQPDIAF
                     VLASQNGAVQLRVSGDKNVGPVMEDVRWRAENCSLELRLPRGFILIVQCTQQAFTTLR
                     SMYESSAKVHSTLYPRQDETCIFRSTLRAFQYFDNDPQARQFPKESIPNCEVALFERL
                     FREGAATGPRTYHRGYRIAVVTGPRTKTLSGVNQIYSPQTPIHFGFLRSEANHPALSL
                     KFDNGRFKGNMVLSFADEKERLRMHSLLIGTALDRGESVSGEVPLQAVWFSERYGDSR
                     DKGLQLLSTLSWNKVRVINSDNDGDKPSCVLADRLRVVYECKDGTLTDRINVAPGELK
                     LRLDVQNPSCLMVFRQPQSDITVAVTKAKASRDLSAGGLSQALDTLKQSATIRTFMFP
                     KLEDLHVFQTAITGFKVLFDGIASAFAISRRRMVVPIHKKWEAGATRIQVVQQDGVAQ
                     LLAFFEDFSHGECMGFHLKGTDVFEVFSRGGKAGLKIDDAKFPLPKVLAPEVDEAQKA
                     ADAAFLCLDLPELPGEHDDISILFDSEAERDRLVACLPAPVKGSRLPKIKGMT"
     gene            complement(<1083567..>1086583)
                     /locus_tag="THITE_2091571"
                     /db_xref="GeneID:11521725"
     mRNA            complement(join(<1083567..1084254,1086576..>1086583))
                     /locus_tag="THITE_2091571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656356.1"
                     /db_xref="GeneID:11521725"
     CDS             complement(join(1083567..1084254,1086576..1086583))
                     /locus_tag="THITE_2091571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656404.1"
                     /db_xref="GeneID:11521725"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2091571"
                     /translation="MDFPPTKVSLDRSKHRIRKSKSNMANFLASIFGTEQDKVNCSFY
                     YKIGACRHGDRCSRKHVKPSYSQTILMPNLYQNPAFDPKNRMNASQLQNHFDAFYEDI
                     WCEMCKYGELEELVVCDNNNDHLIGNVYARFKYEDSAQKACDALNSRWYAARPIYCEL
                     SPVTDFREACCRLNSGEGCVRGGFCNFIHRKDPSPELERELQLATKKWLKMKPRSRSP
                     TRSPSPEPVRRRY"
     gene            1096384..1101452
                     /locus_tag="THITE_2120977"
                     /db_xref="GeneID:11521726"
     mRNA            join(1096384..1096685,1096756..1097059,1097124..1099840,
                     1099895..1101452)
                     /locus_tag="THITE_2120977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656357.1"
                     /db_xref="GeneID:11521726"
     CDS             join(1096494..1096685,1096756..1097059,1097124..1099840,
                     1099895..1101190)
                     /locus_tag="THITE_2120977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656405.1"
                     /db_xref="GeneID:11521726"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Thite2_2120977"
                     /translation="MATAVAANELKQQGAIEASRNPNNSVTAEDAERKIVEDSREAGV
                     TAFTFDPNASAEQKKAQARAAIPEGLHHRPKGVAIVTDLDDGTKADVELPSPSKAGAL
                     AVARTEDGKTLVDGKVDEEEEEDWGKTGWAPRFGWPTESAHEGESMLDHTTWVESQLS
                     EKYFGDWYHNAAVIVFACLASWLVAVLGGGLAWVFIVMAICATYYRTSVRRVRRNFRD
                     DITRELALKKLETDSESVEWINSFLVKFWPIYQPVLAQTVINAVDQVLSSATPAFLDS
                     LKLKTFTLGSKPPRMEHVKTYPKAEDDVVIMDWMFSFTPNDTADMTARQIKNKINPKV
                     ILEIRLGKAMVSKGLDVIVEDMAFSGLMRLKIKLQIPFPHVEKVEMCFLERPTIDYVC
                     KPLGGETFGFDINFIPGLESFIMEQIHGALAPMMYAPNVFPIEVAKMLAGTPVDQAIG
                     VIAITLHGAQGLKNTDKFSGTPDPYAMVSLNGRQPLARTKVVKENSNPQWNETHYVIV
                     TSFNDSLDIDVYDYNEIRKDKKLGSASFALENVEEVYEHEGERLELNLDGKARGVLLC
                     DVRFFPVLEPQKLPDGTTEPPPESNQGILRFTVEQAKELDGTKSMVGLLNPYAMLLLN
                     GKEVHVTKKLKRTNNPIWDNGSKEILITDRKNAKLGVAIKDDRDIAGDQLIGTYHIKL
                     DDMLELTAKGQEWYNLAGVKTGRVKMMAQWRPVTIAGIATGTGGYVTPVGVMRLHFKY
                     ARQLRNVEALGKSDPYVRVVMSGVEKGRTVTFKNNLDPNWDEVLYVPIHSPRERLQLE
                     VMDAENVGKDRSLGLTEIYAGDYMAQDETGEWLVHDQKEERHDGLRMHGKGVPKGVLT
                     YTVAFYPTLNVADPEEEEEEKEKEREREREREREREKDPDKLNGVDGDKDKSSLSRPS
                     LDARSSARQSLDVRTNEEKEPDAPLTPKTPTSPAFAPSPRRSRDDREPPKVYLTPQEL
                     LGYESGLVIFRLMEAELPKASSQIEVFVDDMAFPSYVSSAARTRHHKFDEIGDCFIRE
                     LEFSRLTIKVTEKSEKQEEGDKQHVLARLSGNTLDTLKQCLNNPTTLKMRDEDGDVYS
                     IKVSLKYVPVKMKLDPSESINNMGNLRVDVLDAQDLPSADSNGKSDPYAKFELNGQEV
                     FKTKVQKKTLSPAWNETFNVLVPSRMAAKFKATVWDWDFADKPDFLGGTDIKLDQLEP
                     FRAQEFKYPLDGKSGVLHLRMLFTPDYVTRTRQGTSTLVGTFAVPGRIVTGVAGVPLK
                     GGAAIGHGVGKGASFLMRGLRGKKDDDSVSISSRSSADIPRITTESPPESKPAAANGG
                     LSVQHSRKVSVGASSIHSAIIPGASSGTASFTVISASGFAPSADVYVTVTQVKDGKTK
                     QVGKTKHHKPSSGMVKFDETFRIQCTPDAQFKVEAKEHHTFGSDHPLGEALYFVDDSN
                     TGAEKSLSVGTGTVVIKSSFAPAATDGADKLVPDSPKSAKSTTSGMRRSFLSKRELRV
                     PSRDGTPS"
     gene            1102761..1105595
                     /locus_tag="THITE_2120978"
                     /db_xref="GeneID:11521727"
     mRNA            1102761..1105595
                     /locus_tag="THITE_2120978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656358.1"
                     /db_xref="GeneID:11521727"
     CDS             1103060..1105465
                     /locus_tag="THITE_2120978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656406.1"
                     /db_xref="GeneID:11521727"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="JGIDB:Thite2_2120978"
                     /translation="MDQADIPALLSRLASDEDAVRKMAVFKLQSSINDPAFADVFISS
                     GGLVILRRLIMTTGGNTLAYSLQSLTRLLDVDMGWDIFEGPAAGDLVERIVELIVTNP
                     LVNILRGAMSILVALVGRLQSPSGGAGGPPGSPGSPSAGGNGVGGSGDGSAAAAGNAG
                     PSSRAPTAVRAPGTFGFRAIKPAVAVYPQFFELVIQQLQSADHALCANALMLINALIR
                     DAVTTDGSGTAGLQAKGSAVGAGEEWSKFIKRLQDLGLIRAVYNLLQSSALQDLAHPL
                     LEFQSLTKVLLRKWREVRVDLERPEHRRALKGLHLASAPDRRHANGVPGTGATVASEE
                     ADGLKKGSRRHNPEKWRRLGFETESPALEFETAGFLGMMDLTDYVRKNEDEFQKLLLE
                     QSTRPLSERCPVARASLAVTMILYDHFDVDKSDLEDPRGFLALNDAKTHDKLFRPLLL
                     QWSRLHTAGLHAFFRLWKSTGAQRDDFDKVAELVRVLVEHVVGQAGRTKDVLEVEDEL
                     QEYDAARLRELQMELLELSFEDQWGAHLSQVREELKRESLQFVKEQRIRCLLQGSWFT
                     KPMPHRRQESYPKRQLYQPWRFAKLSHNRRYLHYADFPDKLPYEPGLDALPEKIDLGT
                     ISSVVSNVSTAPDADAAAGDGEADQSPDSSTPTLRHNGAAISKPTTKITIYSFKDDLT
                     NPSTTPISPDTNKTSTTAAAAVTPNGTSSSAEPKEEPVLTLYPLNHSLASEWLDGLLM
                     LLNQAPITAETNKLVTLISDYGLKVRLLNVRLEQMYAGPGVQGAGVVPSREGLDEDYF
                     YAI"
     gene            1106433..1108283
                     /locus_tag="THITE_2120979"
                     /db_xref="GeneID:11521728"
     mRNA            join(1106433..1106796,1106858..1108283)
                     /locus_tag="THITE_2120979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656359.1"
                     /db_xref="GeneID:11521728"
     CDS             join(1106712..1106796,1106858..1108029)
                     /locus_tag="THITE_2120979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656407.1"
                     /db_xref="GeneID:11521728"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="JGIDB:Thite2_2120979"
                     /translation="MSASTPASSKQPHRRQTTKGTFEGQWWYCDCNPPLQAAFLQVKK
                     PGRNKGRWFYTCAKPQDSQCSFFLFEDEANAIKKKALQEKSGFNSGAFGPRSPKPAGR
                     GAETPFSQDVSMTAEGPIFSQSSSVFPTPAPGERRLGRLPPVPDSGWSSDEDSEGTAA
                     GRREHSSGPCLGVASPASKRKRPLAEGEDAERPAADKGESGTAAGPSDLGPNNVDMTV
                     ETANQSDRVHQSQQPQLSQSQQSQRSKSASDSPATPSGRSTRLGFGVPQTPTSGNSSN
                     AASASEPGTKRFKTNQGLPASTPSSARKWGGGSGGQPQGANDFSEDDAEITTAVLGLL
                     KAESVSAPVRRAVRETLNLHALRCRGVERGRDVLREGLKKKDQLIAELQARVAKLEGE
                     RQTRRELLRRAASNLEEALSQESRDD"
     gene            <1108913..>1111061
                     /locus_tag="THITE_2131584"
                     /db_xref="GeneID:11521729"
     mRNA            join(<1108913..1109163,1109236..1109347,1109491..1109915,
                     1109969..>1111061)
                     /locus_tag="THITE_2131584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656360.1"
                     /db_xref="GeneID:11521729"
     CDS             join(1108913..1109163,1109236..1109347,1109491..1109915,
                     1109969..1111061)
                     /locus_tag="THITE_2131584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656408.1"
                     /db_xref="GeneID:11521729"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="JGIDB:Thite2_2131584"
                     /translation="MDPQAPSSPSSPSSSSPPPPPAPASSDLGGQAHGHAASPTSSDA
                     PQGPSSQSMQSTPPPVPQPAVEGAPAGGGRHPRAKRKRTTARDKDILEEEFRKNSKPD
                     KEARAEIVKRVSLTEKEVQIWFQNRRQNARRKARPLSPEDLAAIAYGPVKLLPGSSVE
                     PANYASAPVPCLPPPEQTGAFGSHSDPASSLSSSEAEKADERPQWGRPWELPAPAGQR
                     AGESQQPISRSFAGEVGYLANRRNRTSPSPASSTPSHLGRDDSFRSEPFPSCSPPSAA
                     SPALPTPPSSLRLSTSLEGKAEVVPSTFSSPPHPTGASRPSDALYRPEPLPRLDLQPS
                     RGTITLPPISTLTDSLPPPPATSEPLPPRLTRGRSRDPQAWEYCCLSKNREDTLTMQA
                     KHESSGSAVAEIHLIRSTSLTAGTSARQSTDVKRKTAAAHHGLSRRDVAKKPRLSRSA
                     SSQARIETTLGPSSRHNIMRETPAVSRLDKTKTDTEAALAGNDSDKENWSPDENGNSR
                     PFRRVPSGSGSLSRRSLPSGPTTVAKINRRRSLHEGRSSPFLSSRAHTAPTNGFQHRR
                     RERAQSPLQIYEDAEDCSPESDKVPDDEVERFMRGDVSPSKKGDADAVASLLSLSQGK
                     WR"
     gene            complement(1112644..1114996)
                     /locus_tag="THITE_2120984"
                     /db_xref="GeneID:11521730"
     mRNA            complement(join(1112644..1113312,1113381..1114996))
                     /locus_tag="THITE_2120984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656361.1"
                     /db_xref="GeneID:11521730"
     CDS             complement(join(1112810..1113312,1113381..1114818))
                     /locus_tag="THITE_2120984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656409.1"
                     /db_xref="GeneID:11521730"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="JGIDB:Thite2_2120984"
                     /translation="MPGSIHPALGHPADHPLLLRQERCVSDGVNKSSPVGPERPQDSQ
                     AALPLVLSPLDNGVKCPASPDVVVAAAPVTPTSAVPSNRNDEPAAHPQPSLPAVGRPA
                     PPDSDSLQPSTQPLPADSAAARGHRKNALSLESVPRQTIMKALASVARSNRPQALSLT
                     GMLSAHGAPQGGDTRPASSSSQQLCDALNGLAQAQNSRSNATATPTAAFPSLQSPCFY
                     HNRFDDAVDIEKVLEEIKNDEWMSHSRLVQTATGVREVSKQLQRRPIKRAVKNVMIVT
                     KARDNQLVLLTRELALWLLQTPRYGSDLGVNVYVDAKLRHSKRFNARGITDENPRFAE
                     MLRYWTPDLCWSQPEKFDLVLTLGGDGTVLFTSWLFQRIVPPVLSFSLGSLGFLTSFE
                     FEKYKDHLNRVMGDEGMRVNLRMRFTCTVYRDGPMGNEMEEGEQFEVLNELVIDRGPS
                     PYVSNLELYGDNELLTVVQADGCIFSTPTGSTAYSLSAGGSLVHPDIPAILLTPICPH
                     TLSFRPMVLSDTMLLRVSVPRNSRATAYCAFDGKGRIELRQGDHVTITASQYPFPTVV
                     RTDTEWFDSVSRTLRWNVRAATQKAFDAGAANGSGGGGGSASGSEDDESWDIDTDSAY
                     YTSEESSIAASPLRRQMSMLGL"
     gene            complement(1117782..1119125)
                     /locus_tag="THITE_2097043"
                     /db_xref="GeneID:11521731"
     mRNA            complement(join(1117782..1118637,1118700..1118857,
                     1118923..1119125))
                     /locus_tag="THITE_2097043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656362.1"
                     /db_xref="GeneID:11521731"
     CDS             complement(join(1118224..1118637,1118700..1118857,
                     1118923..1119112))
                     /locus_tag="THITE_2097043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656410.1"
                     /db_xref="GeneID:11521731"
                     /db_xref="JGIDB:Thite2_2097043"
                     /translation="MTATTAPEAALGILPRADGSAKYSHAGYTVTGSVNGPIEAQRRD
                     EHAYEAHVDVIVRPAAGVGGTRERHLESILQSSLSQLILVKDFPRSLIQIVLQVENSP
                     ENDYVDTKLVQASLNFSIMPALLQTAVLALLSAAVPMRATATATAIAVAQQGDHKKTI
                     IDPSPRDIETAHSVHVLAFTSHDELLLAESEGDFTVRDWDDVYETAKRICCRSARPKE
                     GMAMVLDEDDVGGPDMRHFLQSTMESKVAADLHWK"
     gene            1119307..1121059
                     /locus_tag="THITE_2120989"
                     /db_xref="GeneID:11521732"
     mRNA            1119307..1121059
                     /locus_tag="THITE_2120989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656363.1"
                     /db_xref="GeneID:11521732"
     CDS             1119489..1120823
                     /locus_tag="THITE_2120989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656411.1"
                     /db_xref="GeneID:11521732"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="JGIDB:Thite2_2120989"
                     /translation="MTSASTTVPDEAAQSSTAAKPSPAPGRGIPNLKDRIPKLEPRRR
                     KPEPSNPMPVPETPAAPPRPDPATLKFTVPSRRILSPKDHQLFLSSPTYKLILSFVFG
                     LSESVLDKPISSVKDADLSPTVKAILSILNETETLCQDTPPDDQGGSRFGNKAFRVFV
                     DKVKQRSPTWHTTLLNLPNPSAVAELGAYLTQSFGNRTRIDYGSGHELNFIMWLLCLY
                     QLSLLSRADFPALVLRVFARYLAVMRRVQTTYYLEPAGSHGVWGLDDYQFLPFLFGAS
                     QLVHHPFITPRAIHQELTVEEFGGEFLYLGQVAFVNSTKTVKGLRWHSPMLDDISSAK
                     NWAKIEGGMRRMFVSEVLGKLPVMQHFLFGSLIPAAEGMSEPREAGVKDEEEEEDGGE
                     VEVFDDKNGVRHVHQQSGWGDCCGIKVPSSIGAAEEMKKRGVGEQLRRIPFD"
     gene            complement(1121389..1122791)
                     /locus_tag="THITE_2120990"
                     /db_xref="GeneID:11521733"
     mRNA            complement(1121389..1122791)
                     /locus_tag="THITE_2120990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656364.1"
                     /db_xref="GeneID:11521733"
     CDS             complement(1121603..1122592)
                     /locus_tag="THITE_2120990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656412.1"
                     /db_xref="GeneID:11521733"
                     /db_xref="JGIDB:Thite2_2120990"
                     /translation="MEPVPETERMEEFRPSPLPSLRPPGTAALGTAESDVLRKPPTIR
                     RSTEPPLPSPISTSWMPPAALPYRPRASSPLSSNHARSRSAASLAPPMARTQSMPSTM
                     TTGHLLYSPQLRPQSPSGSPGRIRIPRKPVDEVFPSSPTRVSVLDPERRSTERSSSPN
                     LSLSMAPAATLQKVRRPSSPLCQVAHASTGSVPVAAPATPSSSSLAISPSYRQYDSFS
                     GSYGYSAAYPSSSVPSTPTSARSRSPSISSLETIPDSPDAEEAALEAERIAQLKAAVD
                     AAEGADVKGRSSLDVPTRGRTLSGFSSRDKRKRWSVCGAERRQDLDLETIWED"
     gene            1124083..1128505
                     /locus_tag="THITE_2120993"
                     /db_xref="GeneID:11521734"
     mRNA            join(1124083..1124788,1124841..1128505)
                     /locus_tag="THITE_2120993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656365.1"
                     /db_xref="GeneID:11521734"
     CDS             join(1124358..1124788,1124841..1127946)
                     /locus_tag="THITE_2120993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656413.1"
                     /db_xref="GeneID:11521734"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="JGIDB:Thite2_2120993"
                     /translation="MSDATRTASPDTAPHRGRRGRRGGFRRGRHTGPGQPDGSAEGSQ
                     QAPPHPIQNRPEPIVATASGTDAATSALDDLPRRGRDGRGTQRRGGRGRGAATQRSIV
                     VSHRGGRAPPPNRGEGGSSVLGAGLRATAPAFIPGRPIAASSSEQQALAPAQPRQVAA
                     ARELPKSTAADLPTRIHEDIDNRQYECVICTNEVLRNSKVWSCSICWTVTHLHCVKKW
                     HANAPNQPEGWRCPGCNSTLTEQPGPYSCWCGKETDPKPVAGLPPHSCGQTCSKSRAT
                     CPHPCTLMCHAGPCPPCTLMGPSQTCFCGKSTSTKRCSETDYGNGWSCLEPCGDLLAC
                     GEHNCTKPCHPGLCDACEIPLESTCYCGKEQQEIPCNRRGDVLASFNHGQLPVNQEFS
                     LGKWFLGSFQCGNVCGRTFDCGAHVCEKACHPQTEAAAHCPFSPDVVTHCPCGKTPLN
                     SIPAEPRRSCRDPIAHCDKPCNKVLACGHACLSKCHTGSCPPCTQHIEITCRCGRTTA
                     SSACHQGHVEHPLCFRVCRAQLNCGRHECGERCCSGDKKAAERRRQKRTANEDYEPEH
                     ICLQVCGRQLKCGKHKCQQLCHKGPCMSCPEAIFEEISCSCGRTVLQPPQPCGTRPPE
                     CRFPCTRSRPCGHPTVHHQCHPDDTPCPKCPFLVEKACICGKKMLKNQPCWFEEARCG
                     LPCGKKLRCGAHECRKPCHKPGECEDGDASGSHCSQPCGKVRKSCEHTCADQCHAPYP
                     CKEDKPCQSKTFITCPCQRRKQEVRCQATKANPWPTGESTLKCDDECLRLQRNQKLAE
                     ALNIDTETHTDDHIPYSDTTLKLFRENMTWAQAQEREFRVFAAAPEEKRLRFKPMPSH
                     QRAFLHALAEDFGLDSESQDPEPHRHVCIFKTPRFVSAPQKTLAQCLRIAKTASNLGT
                     GASLLTTRPPAAASRQESQAWNALLLNSPRFGLTIDELEAALAGDLATASRTGPALVF
                     TTNFLPSDQVLITATPSLAASAVAASPAPRPRAVESALESLKPAVAKTVSRLRLAGAV
                     SLCHVDASRNITRSEGDAHADAGGWSAVASRGSWRKAAKQAPGAQPPSQLRAPSAFVA
                     LRKSEVKRSVAAPQQEEDVEEDWFTAAEKEEKEEGVGDGGNENGGNQNGGVANEALDG
                     VDVDEGAGTGGIKQNSEQAGAEHASHAVSVDV"
     gene            complement(1128507..1130756)
                     /locus_tag="THITE_2120995"
                     /db_xref="GeneID:11521735"
     mRNA            complement(join(1128507..1129296,1129355..1129577,
                     1129651..1130063,1130144..1130187,1130342..1130756))
                     /locus_tag="THITE_2120995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656366.1"
                     /db_xref="GeneID:11521735"
     CDS             complement(join(1129134..1129296,1129355..1129577,
                     1129651..1130063,1130144..1130187,1130342..1130440))
                     /locus_tag="THITE_2120995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656414.1"
                     /db_xref="GeneID:11521735"
                     /db_xref="JGIDB:Thite2_2120995"
                     /translation="MPDPSSSNSLLEQTVSLMSSAASYMRLPAIASTGVAALLTALLY
                     FKQKALIYPSHIPANARTDVPRPSQFNFRDYEELIIPTNDGEKLSAFYIRGPRGGPNS
                     KVTVLMFHGNAGNIGHRLPIARMLIAASGCNVFMLEYRGYGISTGQPDESGLNIDAQT
                     ALDYLRDRAETRDHKIVVYGQSLGGAVGIRLVAKNQGGGDISGLILENTFLSMRKLIP
                     SIMPPAKYLAYLCHQVWPSDSLIPSIKVPTLFLSGLQDEIVPPIHMKRLYELSKAPIK
                     VWKPLPGGDHNSSVIEEGYFEAIADFVNKIVAEKEKE"
     gene            1132790..1135156
                     /locus_tag="THITE_2120997"
                     /db_xref="GeneID:11521736"
     mRNA            join(1132790..1133006,1133475..1133597,1133653..1135156)
                     /locus_tag="THITE_2120997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656367.1"
                     /db_xref="GeneID:11521736"
     CDS             join(1132986..1133006,1133475..1133597,1133653..1134825)
                     /locus_tag="THITE_2120997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656415.1"
                     /db_xref="GeneID:11521736"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="JGIDB:Thite2_2120997"
                     /translation="MVSFSCEACGDVLTKKKLDPHRNRCRGATFTCIDCMVHFPGTEY
                     RWHTSCMTEEQKYQGALYRDKKANAQSAAPSANKHAASNTMVQAAYVEDVAEDHDSWR
                     DYEQRSDDDEQSLADPLPEAPTPPSALEAQRAVNVFDFLVANPTPTASHVSLPASAPI
                     QLSKDTQLVRFDPDANGTAGPLNDDGAMVQYGTGPVPTNFETPAAKTARRKTKEGDKD
                     AKKDKKRKRLHIETDHIMTDAPPVLHSGLTGGMSRLMSRPSVFPPSPDYSGGDAAETP
                     ASPLKKSKSKHHKSSRTTETLGNSLMAMITAGSKSKSTSKKRTKTKSSSTPSKPKKKR
                     TAKALEAPKQQKLLEFTPGSKDGKEESGALVVFKPRAEHFLSFVNKGPESERGCSVNK
                     ALKRYHRERSASGSGLSKVMEEKELWRSLRMKKNERGEIVLFCLDD"
     gene            complement(1135662..1137118)
                     /locus_tag="THITE_2121000"
                     /db_xref="GeneID:11521737"
     mRNA            complement(1135662..1137118)
                     /locus_tag="THITE_2121000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656368.1"
                     /db_xref="GeneID:11521737"
     CDS             complement(1135675..1136967)
                     /locus_tag="THITE_2121000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656416.1"
                     /db_xref="GeneID:11521737"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Thite2_2121000"
                     /translation="MASPQPPPSRPPPSLTTTSPYPFAAAPDIIRAHQKDAYFQGVLN
                     NRLSDLHRRLRGARSAHAWANETRTFADALYLGLTTLLGNRTLGEEYCDLVQVEAPQI
                     AATTTSTSSPKDGTPGPVLPSLTRRAGMIIASTLLPYLAGLLLPRLRAALRARLQARL
                     ARLARQSQGQGRDEAREVDDKSGSRRPSRAGRGPSAEARVLRYLLAHLPALTSGAHIQ
                     AAALAVFYFTGAYYSLSKRLFGLRYVFTRRVEEGQGGRAGYEVLGVLLVVQMVVRGYL
                     HVRQQLAAGNSPEVDEGAEYRERADFGPGPNVDVSLDGNAYASNTELLGVPGGGGSNA
                     QRSLEAIGVTTHTPVLRGGKARYDLGASQKVMGWIKGAQQRKCTLCLEQLKDPAATQC
                     GHVFCWACIGDWVREKPECPLCRREAMVQHILPLRAAS"
     gene            1137320..1139005
                     /locus_tag="THITE_2121001"
                     /db_xref="GeneID:11521738"
     mRNA            join(1137320..1137582,1137634..1139005)
                     /locus_tag="THITE_2121001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656369.1"
                     /db_xref="GeneID:11521738"
     CDS             join(1137489..1137582,1137634..1138763)
                     /locus_tag="THITE_2121001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656417.1"
                     /db_xref="GeneID:11521738"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="JGIDB:Thite2_2121001"
                     /translation="MDGGDPAVEPQLDSFSLTFPLPYRVAFLITLAVWGWGCNLHFLH
                     LRRIDVPFLIRYPSRASSSQPTHHSSTYRLAAFLSLTSTLSIVIFWLLTRRDPRRVID
                     YDWLPMTNLLVLAVLFVLPLRRLSVSHTGRSRLLRTLRRVAVGGIAETKDGKFGDIIL
                     ADVLTSYAKTLADLFVCICMFLFTRDGSATARPDRGCGGAVLVPLIMALPSAIRLRQC
                     LIEFGRVRAAPYKESTGWGGQHLANAAKYATAFPVIVLGAMLRNQQDGSPGLYRAWVA
                     ACLLNSLYSFYWDVAKDWDLTLFSSERGSPDHPFGLRRTLLIHKPGVYYAVIALDLVL
                     RCTWMTKLSPEMDRISDFESSIFLIQFLEVFRRWVWVFFRIETEWIRNSVPGLGVDDM
                     VLLGDYQGNKYEDED"
     gene            1139006..1142170
                     /locus_tag="THITE_2121003"
                     /db_xref="GeneID:11521739"
     mRNA            1139006..1142170
                     /locus_tag="THITE_2121003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656370.1"
                     /db_xref="GeneID:11521739"
     CDS             1139424..1141853
                     /locus_tag="THITE_2121003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656418.1"
                     /db_xref="GeneID:11521739"
                     /db_xref="JGIDB:Thite2_2121003"
                     /translation="MALQESANVSSSSLGLSGAETPLPNSLSPPPPRDAERYEKRILP
                     QVPRKRESGVSNFSKEVDEALATPDSVITPDEGSICLIYRPSPSPRSAPGGGDAEFAA
                     ALDHEKDDNQKREDLKLDIANLPTSVPGGVLSPKVAKVLGVLGPRESTPSGHKSPAKV
                     RRLTGFELACEGSSQLNKRHRAKEHTQLHGEVSPVSNESSPYDHEEPKTAVSDLDAGP
                     EADGWTYSPEPSPGYYGSRDAHLHSAESSVVPQPLRVAKPARPSRSPERKVLETPPYV
                     EGSPRLRDIVDPGVSGHRTPSDKSSPDPYHEAAKQLAKGDAMATQQARQAERSQAEQL
                     AVQQFVEAGRASGAGSHRSYDSRKLPSLPHQNYRHLPSDLPSGGIPSGDDERRVPVWR
                     PSNYQQGSPRTVSASTFGRLTRRFHAQDPGQRSKSGDDTDNYPSTRTPDTGGSIPFSF
                     GPSDKGGKANTRHRHSSSVMAKVFFGRTSASPTIPRTPATPTPPVPNNTPIEPSFRHT
                     RAHHHANTHAHAHHANPYNLTPSPPSHSSSSAFPISTPELRVGTGEETAAAAAAKAKT
                     KASMSALAAKTNDLVGAAAGFLSKSTANIGHVSMSGDERRRQRLKSSIRVLGDGGRVL
                     AGGTAGSGVGSTPGSGVSAVSATSLGSGSGSGSPPAALWGAGGGGVAAGGYRGRLGSA
                     PAVTGATEFAFASPSAGDGSLLGTGTLPGQSLESNVGGTRGSPQPWHGRGVRSNVSPD
                     IGRQSPGQKARVSPVSTHRRSPAPRQGPSPRGSPRPRRKNGGPSPRRSGEGTREHGMG
                     APGPGIGLGVV"
     gene            1142685..1144169
                     /locus_tag="THITE_2121004"
                     /db_xref="GeneID:11521740"
     mRNA            join(1142685..1142924,1142998..1143048,1143125..1144169)
                     /locus_tag="THITE_2121004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656371.1"
                     /db_xref="GeneID:11521740"
     CDS             join(1142747..1142924,1142998..1143048,1143125..1143906)
                     /locus_tag="THITE_2121004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656419.1"
                     /db_xref="GeneID:11521740"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Thite2_2121004"
                     /translation="MRTKAAIARLRAYRPPPFPLWDRLPLSRRAAVLLLLYADRRGDL
                     RAVITMRAASLRSFSGHAALPGGKADTLDETPYQIARREAWEEIGLPMDDTKLPAPFR
                     IEHLCYLPMNLARTELVVRPCVALLHTAEAPIPLGSASPAPSPTAEESLIPRLDAKEV
                     AAVFSAPFHGFLKSTDEQPSPPPGAKQQQQQKQLPPGHWYEGHWTQWHDKPWRVHFFY
                     VPVTNQRVVKPKVREGGLAALSEDESEAGEDGAESRRYKVWGMTARILVDAATIAYGE
                     EPEFEHNTHFGDEALIEALAKQGRMGEKKRQESAPMSQGSKRATEAVKGFEGKKGEGS
                     KM"
     gene            complement(1144170..1144829)
                     /locus_tag="THITE_2121011"
                     /db_xref="GeneID:11521741"
     mRNA            complement(1144170..1144829)
                     /locus_tag="THITE_2121011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656372.1"
                     /db_xref="GeneID:11521741"
     CDS             complement(1144432..1144737)
                     /locus_tag="THITE_2121011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656420.1"
                     /db_xref="GeneID:11521741"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="JGIDB:Thite2_2121011"
                     /translation="MLFTWDTTNLCIVFRQWHITSNLGLVASLVAVVAICAGYEALRE
                     GIRRYEAALSRRVDTVPRKFVFSLSGLEWPFPSLTHPPSPNRVLCTLAWRMDRSKRV"
     gene            1145353..1146753
                     /locus_tag="THITE_2121012"
                     /db_xref="GeneID:11521742"
     mRNA            join(1145353..1145373,1145439..1145779,1145849..1145924,
                     1145998..1146753)
                     /locus_tag="THITE_2121012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656373.1"
                     /db_xref="GeneID:11521742"
     CDS             join(1145748..1145779,1145849..1145924,1145998..1146441)
                     /locus_tag="THITE_2121012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656421.1"
                     /db_xref="GeneID:11521742"
                     /db_xref="InterPro:IPR010329"
                     /db_xref="JGIDB:Thite2_2121012"
                     /translation="MLSPPVNLPKWLEENSHLLKPPINNYCVYNDDFTVMIVGGPNAR
                     TDYHINQTPEWFYQYKGAMLLKVVDDGAFRDIVIREGEMFLLPPNTPHNPVRFADTVG
                     IVLEQKRPADSIDRMRWYCQREGCGAVVHEAAFHCTDLGTQIKEAVERFKGDVAARTC
                     KACGEVADWCPRPGSIRDPNLAE"
     gene            complement(<1146605..1147614)
                     /locus_tag="THITE_61961"
                     /db_xref="GeneID:11521743"
     mRNA            complement(join(<1146605..1147032,1147101..1147312,
                     1147418..1147614))
                     /locus_tag="THITE_61961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003657273.2"
                     /db_xref="GeneID:11521743"
     CDS             complement(join(1146605..1147032,1147101..1147312,
                     1147418..1147503))
                     /locus_tag="THITE_61961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003657321.1"
                     /db_xref="GeneID:11521743"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="JGIDB:Thite2_61961"
                     /translation="MALLMRRGMATMASLKRAGKVICIGRNYADHITELNSARPKQPF
                     FFLKPPSSILLPGEGPVIRPKGVDLHYEVELALILGKRVRDLSAQDEQAALEAIESYA
                     LSIDMTARNIQNEAKKKGLPWDISKGFDTFLPVSKVINKAAIPDPHNIELYLTVNGKV
                     QQNDSTELMLFRIPRILSDISKVMTLEPGDIVLTGTPKGVGPVVPGDVMRAGIRVGGK
                     ELEEAKIEVAVEESTSSYEYAET"
     gene            1149176..1150486
                     /locus_tag="THITE_2121016"
                     /db_xref="GeneID:11522626"
     mRNA            join(1149176..1149342,1149526..1149692,1149799..1150095,
                     1150261..1150486)
                     /locus_tag="THITE_2121016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656374.1"
                     /db_xref="GeneID:11522626"
     CDS             join(1149627..1149692,1149799..1150095,1150261..1150455)
                     /locus_tag="THITE_2121016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656422.1"
                     /db_xref="GeneID:11522626"
                     /db_xref="JGIDB:Thite2_2121016"
                     /translation="MASMESLQLAQMLADLSDLNAAQESQAALAVVNANKTSSSTSAP
                     DDLSKSPEQPRPQRPGPRHHQRSGSGGSVASAGSSFISRTASPAKFDKYGRRILTPPN
                     TRANSAYGSIPGTPRRETETDEDVDRASTLMALYELRAKLRDQDSSRSLNKLREKVAA
                     LHAKQAQSEKKDGASGTKFTYPKSS"
     gene            <1152113..>1152621
                     /locus_tag="THITE_2057473"
                     /db_xref="GeneID:11521744"
     mRNA            join(<1152113..1152216,1152284..1152374,1152442..>1152621)
                     /locus_tag="THITE_2057473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656375.1"
                     /db_xref="GeneID:11521744"
     CDS             join(1152113..1152216,1152284..1152374,1152442..1152621)
                     /locus_tag="THITE_2057473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656423.1"
                     /db_xref="GeneID:11521744"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="JGIDB:Thite2_2057473"
                     /translation="MATGVDAKLLKSTKFPPEFNQKVDMQKVNVQVMKKWIANRVIEI
                     LGNEDDVVIELIFNLIEGGRYPDIKSLQIQLTGFLDKDTPTFCRDLWRLLLSAQASPQ
                     GVPKELLEAKKLELMQEKVGNG"
     gene            1154388..1155516
                     /locus_tag="THITE_2121023"
                     /db_xref="GeneID:11519792"
     mRNA            join(1154388..1154744,1154847..1155041,1155159..1155516)
                     /locus_tag="THITE_2121023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656376.1"
                     /db_xref="GeneID:11519792"
     CDS             join(1154586..1154744,1154847..1155041,1155159..1155410)
                     /locus_tag="THITE_2121023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656424.1"
                     /db_xref="GeneID:11519792"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="JGIDB:Thite2_2121023"
                     /translation="MSENAAPAGAGVKPAGPNGVGDGAATAGIPFYEKERQHLKSLIA
                     QRRALEKRLAATEEHILAKETEYLESTPSGNIITGFDNYTKGTTAAAAQRRKAGPADQ
                     HRVFSRSSISYNAAAADAQTPASTPASHAPTPVSSSFGNNRDGASSAATPASAAGGGG
                     RANTTKKTKKSGAAAVAAAAEDSETDGRETKKVRTSFGARK"
     gene            <1156032..1158819
                     /locus_tag="THITE_2097049"
                     /db_xref="GeneID:11519793"
     mRNA            join(<1156032..1156339,1156401..1157830,1157943..1158145,
                     1158222..1158338,1158434..1158819)
                     /locus_tag="THITE_2097049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656377.1"
                     /db_xref="GeneID:11519793"
     CDS             join(1156032..1156339,1156401..1157830,1157943..1158145,
                     1158222..1158338,1158434..1158556)
                     /locus_tag="THITE_2097049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656425.1"
                     /db_xref="GeneID:11519793"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="JGIDB:Thite2_2097049"
                     /translation="MTITATKFTPEVMLSAPRRTPALPSPSGKRAVYAVSTYSFQDHK
                     KTSQIRVLDIESGDSVSIVEDASASEPVWLGDDEVLYLKGGDAGITTLVVRHAWSAEA
                     EPYEAGSVKAPISNVIVKKLPNGSFAFACSALTTPDGQLFNPETEKKPHSSARVYTGL
                     FVRHWDAWNTRNKSSIFYGLLEQKDGKYALRNGTLTNALAGTGLSSPVPPFGGTGDFD
                     IGPSGLVFVAKDPELDPAIYTKTNLYYIPLETFTESSAPPPRIINTPGLEGYSNSPVF
                     SHCGRKVAFTRMRSNQYESDKPRLLLVPDITNPDKTEEFYATPDGVGGWDARPESIVW
                     SHDDSKLYVTAEHRARTLIFQLASTPSRATALPVPIKTPDGSVVSFHLLRPNRDHSSS
                     SSPADSDNDHLLVTSTSLVDNSCYSIADPAAQTATVISSASKEGKSFGLSRSAVDSIT
                     FRGAGGDYDVHALVVRPSTFDRGAANGNGNKKYPLCLLIHGGPQGAWLDAWSTRWNPA
                     VFAEQGYVVVCPNPTGSTGYGMAFEDGIRGEWGGRPYNDLVRCVEWVAENMPEVDVTR
                     AVALGASYGGFMINWIQGHPLGRKFKALVCHDGVFSTLNQWSSEELFFPIHDFEGTLY
                     DNREAYEKWDPARFVSEWETPQLIIHGELDYRLPITEGLAAFNVLQARKVPSKLLVFP
                     DENHWVLKHENSLVWHREVLGWINKYSGIENEQQLAEKVDGLKV"
     gene            complement(1159080..1161571)
                     /locus_tag="THITE_2121028"
                     /db_xref="GeneID:11519794"
     mRNA            complement(join(1159080..1161098,1161167..1161571))
                     /locus_tag="THITE_2121028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656378.1"
                     /db_xref="GeneID:11519794"
     CDS             complement(join(1159398..1161098,1161167..1161430))
                     /locus_tag="THITE_2121028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656426.1"
                     /db_xref="GeneID:11519794"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="JGIDB:Thite2_2121028"
                     /translation="MFWSGTLLSATGPLAKAWLSANQERKITKVQILQHNLQDSVDAI
                     IAPNDAPLALRLSGQLLLGVARIYSRKARYLLDDCNEALIKIKMAFRSAGNHDIPATM
                     HATTKESLMLPDTITPYDNLDLLPPPSSEFLASQLDEVNATPLSGRKAAVRPSNRDIN
                     LQEDFNNSQFLQDNNGDDEEMALANVDDLDLELDFGMDIDDRPSKLMDKSVEMGRDAP
                     AARPVEEDMLSEMDVAGPSKDRQAREPSLGLNLDFGDGVHIADGEGDIHMGDDDLQFN
                     VGDESAMPGAAGRDMSRARISESPLSDIDEEFAKEVELEYSRHMNTDMYEPGDEPTAS
                     TIRAPQRQKKKKLLQPDDQTVLTSAQIKEQQSKRDNILKPQSFVAHDPYIVGLMDLHR
                     NGGFVHNILFEGRSDAWAPELKGLLSLSSIRPNDLKRKRDSGVADMDSEDEQGASKSP
                     RLELPEDETTLGLGGAAAGNQSIAADGTVLEIPADDTAVFHGDDEHERPGSRAGAPSS
                     PLPAFDDTTMPIVHPADSGPVSVGTKHAVHILRDLFGPDAATNTEKRKKSAVVFQELL
                     PEQQTTKADATKMFFECLVLATKDAIKVEQPEGTLGGPIRIRGKRGLWGDWAERGAGG
                     EIAREQQQQQQQQIEPQPAVQSSTAVAVGA"
     gene            1162960..1166670
                     /locus_tag="THITE_2121031"
                     /db_xref="GeneID:11519795"
     mRNA            join(1162960..1163213,1163272..1164475,1164537..1165385,
                     1165434..1165877,1165969..1166670)
                     /locus_tag="THITE_2121031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656379.1"
                     /db_xref="GeneID:11519795"
     CDS             join(1163061..1163213,1163272..1164475,1164537..1165385,
                     1165434..1165877,1165969..1166513)
                     /locus_tag="THITE_2121031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656427.1"
                     /db_xref="GeneID:11519795"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Thite2_2121031"
                     /translation="MDRLMRKDDDDGLPLYHNSQEPGPPAALGDSSRSWSTSPRMSPR
                     TTSAQSRSVADEYASLTPIEVAARLNTSLTHGLTPAEALSRLRDYGPNEIPHDEPEPI
                     WLRFLKQFQEPLIVLLLVSAGASVVVGNMDDAVSITVAVTIVVSVGFIQEYRSEKSIE
                     ALNHLVPNHAHLVRKRASKASPGSRSPMWPRAGDKTPDTGESSGSITPEEEVLEATSS
                     KVMAAQLVPGDLVLFTTGDRIPADIRVTKAADLTIDASNLTGENEPVRVTASTRPRRG
                     LATPTHGGATLQLPQPSFPGAPDGSSATGAQGDQDGPQNIAYMGTLVKSGHGQGIVFA
                     TGGNTHFGTIATSVSGTESPRSPLQISMDELGSQLSKMSFVIIGLISLIGWFQGKKLL
                     EVFTISVSLAVAAIPEGLPIIVTVTLALGVHRMAKHNAIVRKMPKVETLGSVNVVCTD
                     KTGTLTMNHMTTAKMWYFGADDAFDVDSDDEMTEAKPDPAALRILRIGNIANDARLAR
                     KYSENGAAARAVLSSTEGRGHTSTYTRWVGQPTDVAMLDLLDRFREHDVRDSIGPRVS
                     ETPFSSERKWMGVTIGSEGGKSDKDFAYMKGAIDKVLDACDTYVTRDGKEVVLDSSRR
                     QEALQAAERMASQGLRVLAFASGPVAKSRSSRSAVGGARSSPAGADGAESPVHHGCEE
                     QYKGLTFAGLVGMSDPPRPGVGRSIRKLMRGRVKVIMITGDAETTALAIGKQLVKPVL
                     RGDELDAMSDEDLARAMDHTTIFARTNPDHKMKIIRALQSRGDIVAMTGDGVNDAPAL
                     KKADIGIAMGMHGTDVAKEAADMILTDDDFSTILHAIEEGKAIFNNIQNFITFQLSTS
                     VAGLSLVLICTALGFKSPLNAMQILWINIIMDGPPAQSLGVEAVDKDVMSRPPRRRGD
                     PVLTRRLLTRVLTQAAIIVAGTMLVYTHEMLDDGQVTRRDTTMTFTCFVLFDMFNALT
                     CRSESKSVLTGEVGLFKNVLFNWAVAGSLMGQLAVVYLPWLQEVFQTEALGWRDLGAL
                     VLLCSSVFWVDEGRKWWRYGKRSGLLGRGYSQAV"
     gene            complement(1166684..1169250)
                     /locus_tag="THITE_2121035"
                     /db_xref="GeneID:11519796"
     mRNA            complement(join(1166684..1168689,1168751..1169250))
                     /locus_tag="THITE_2121035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656380.1"
                     /db_xref="GeneID:11519796"
     CDS             complement(join(1166827..1168689,1168751..1169128))
                     /locus_tag="THITE_2121035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656428.1"
                     /db_xref="GeneID:11519796"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="JGIDB:Thite2_2121035"
                     /translation="MHSGPKTSASTYRFPRHVSPCIPGPWPLSPIIANHAAQLVVVGD
                     QSSGKSSLLESLTGIPFPRDVELCTRYATQITQRRDDVSRVEVSIIPGPNASEAHKRH
                     VEGYRSPALNPEDFRQQFPSILREVNERMGIRMRLSSNGSSDSSFLSAQFASDASSSE
                     DDGQPVTRPQGGSVFSEDVLKIEICGPSVDYLTVIDVPGIFRMPTPGVTTKADMVLVR
                     NMVRWYIQDSRTVILAVLPCNIDISNQEILTLAEEYDKNGERTLGILTKPDLVTEPSA
                     QAAVRNIILGKKKQLRLGYYLVRSRGADMNDADFLHREDEFKKAAWASLPPPRVGVGA
                     LKRRLAELLGHMARREFPKLRKEIGEMLHSVQRERDSLGPSRKDEQEQRRFLSGVAQE
                     FQELVRAGLEAQYAVSAAFEKSAELRLVTRVVNLADAFSDEFKRNSVLRRFDTIDEPV
                     KVEASPSRATPDSDRSDSILEFARDIDTEDYPELENIISHDYDIEEPEDGILDWITDL
                     YVRSRGMDLGTFSSAVWASAWTEQSSKWPAMSRAFMSKVIVAVHRFIMAALEVVCADP
                     RVREELWSAMQDEVLRRYEAGMAAAEYLASAERDTKPYTLDRHFNEHRQRCRGGRIAG
                     LLQHVTGHKDYQGLVSIRQVSNVTEQKPNIEDIVEKLHDDLSAYYDIACSRFVDNLLN
                     QAVNYHLLFGPSTPLGVFSQEWVIGLKPDQLEAIAGESPSIKEHRERLAQKINDLTAA
                     KEILRH"
     gene            1170047..1173044
                     /locus_tag="THITE_2121038"
                     /db_xref="GeneID:11519797"
     mRNA            join(1170047..1171507,1171562..1173044)
                     /locus_tag="THITE_2121038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656381.1"
                     /db_xref="GeneID:11519797"
     CDS             join(1170194..1171507,1171562..1172746)
                     /locus_tag="THITE_2121038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656429.1"
                     /db_xref="GeneID:11519797"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="JGIDB:Thite2_2121038"
                     /translation="MSTLPNGAATARSTTKMPAPSSTNSSSGNGLPSRPPPAVTPSPK
                     KDDDNSPSAPLHRATSPAEVRAALSALHAREASLTAHLSTLLTGHASLTRSLSRLDNL
                     RAGLGAQVISARSISSNMLASAADTAARLSGRVRALDLEKQRVEDTLRVVEQVAELKA
                     CVAGVVGSMGAPQDWEAAAGYISRAAKVPDDIVRGGFAAAVVPTVEVPDPPWVTLEQA
                     RESLCALFMREFKKAAAEGDAAKVTRFFKLFPLIGRGDVGLDVYGQYVCQGVAGEARA
                     SLKEGSAVAGGKGRKDGVFYANALTRLFDHIARIVEAHGGLVERHYGSGKMVKVIERL
                     QMEADVQGGIILDSWSDDRAVDRRLTDVRSYPFSFLMQSFLPQNRGFGGTPRVNSPAL
                     GGQTNDARDSEDEGVNMREVDALLVEIAVMLEKWSVYCRFLAGKCRDPESPDDAPLTL
                     PDVLIKSNLSRKVLGKLVEPCNSLTTFFFRRSVEKAFQLDESPSGLSLNMSKPIDSNP
                     PFIISAVDVVMYIVNTVIRRSISTSQRAVIDSVIASISSILGADFVGMIQRKMRDDSY
                     PRAAVQGNLPPEDKVVSFIVLINSLDMANEYLARIVSSFLNPSQEQHAKPLHDAFPFK
                     NEAAEVALRLNNLNASFSAKTTELINEGVRVLFSQVIKPRLRPVLTDTFRDADYTLSE
                     DELADLAAQNGQTEDEVLDQVPRVFEHGWDALMRPVARLLTPRTYTTLLDLTADYLAR
                     VLEKRVWSYAGGRTSAYGAIRMERDFSGIVGVISKGNYAVRELFGRTAQVLMVANMED
                     EEWEELAAEGDGGAGMQWVLTEEERRRARSIVRS"
     gene            complement(1173379..1174149)
                     /locus_tag="THITE_2121041"
                     /db_xref="GeneID:11519798"
     mRNA            complement(join(1173379..1173866,1174063..1174149))
                     /locus_tag="THITE_2121041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656382.1"
                     /db_xref="GeneID:11519798"
     CDS             complement(1173569..1173862)
                     /locus_tag="THITE_2121041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656430.1"
                     /db_xref="GeneID:11519798"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="JGIDB:Thite2_2121041"
                     /translation="MTTKPPKGHFNILYFASAGSYTSKNVEALPAPLPLRKLFATLEE
                     RYQGFRASVLDHSLVTINLTYVDVPGEDAAEEAEEIVIQEGDEVAIIPPVSSG"
     gene            complement(1174602..1176490)
                     /locus_tag="THITE_2171199"
                     /db_xref="GeneID:11519799"
     mRNA            complement(join(1174602..1175835,1175883..1175942,
                     1176011..1176293,1176415..1176490))
                     /locus_tag="THITE_2171199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656383.1"
                     /db_xref="GeneID:11519799"
     CDS             complement(join(1174642..1175835,1175883..1175942,
                     1176011..1176049))
                     /locus_tag="THITE_2171199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656431.1"
                     /db_xref="GeneID:11519799"
                     /db_xref="JGIDB:Thite2_2171199"
                     /translation="MSSNRKYAALPDLDSAPDIYETPDLTDDHSTVPPTTVQSPSDNE
                     YDEDEEHAAGISRSRLRVREARSKFMPAAVDANDVDFSDRLDGKRKSYKTSTRRHRVL
                     EDGTEELGDLSDEDDAVNLARKIARLRREIEVVKDEYGKQKAAAEKSKEERVTEDDIE
                     SLSKVLDEISRFDDSLTSRHLPATVPPPAAVGQNVEGDPTDGVSYTITYAPSYEQTHA
                     LAKAADFDRRLVVLEKALGVGSAAMPEFDSNGLPRAIIPLLEHLHKQISTLSEASVPS
                     LDSISRRVRALTQEAEALEKARRNAKAAHEALASAGAAPTAEATAIDDSEQTAKINAL
                     YGTLPTIENLAPLLPPLLDRLRSLRMIHAEAATASQTLERIEKKQADMAAEIQQWREG
                     LEKVEAAVREGDATMVRNMDVMSRWVKDLEDKMSKLSP"
     gene            1176712..1179009
                     /locus_tag="THITE_2121045"
                     /db_xref="GeneID:11519800"
     mRNA            1176712..1179009
                     /locus_tag="THITE_2121045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656384.1"
                     /db_xref="GeneID:11519800"
     CDS             1177137..1178645
                     /locus_tag="THITE_2121045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656432.1"
                     /db_xref="GeneID:11519800"
                     /db_xref="JGIDB:Thite2_2121045"
                     /translation="MKDVDVDAPPLSSSDQSDDDGLPVRGDIQPSRFLRGGRQQPSPR
                     QQTKATDSGKSHTDLATSRKRTRASTGPLPDRQLGSSTQELGRRSDSATAPNESSPAT
                     KQSKSNTPSDGELGSQFDIDPIFHTRKRPIVRRYGGTKALSSGVKEKALPTKRFKRPP
                     KAESPEPPSPERRKKFEIPSSPSMAGEDPASPARKLNLPDDDLDSPADVSPVRKKQFT
                     MPDDDTSTLLRDLDGPEGSQRLAFSIPEELPEPFVRTSEGNGSLTVSPPAGASSPMSP
                     LRNTTSPLTDLGSLDSTPVCPLCRKVVDQAHLDDFKERHPRLTVANMRKFCQDHKRRS
                     ARETWIQKGYPDIDWRRLDERISRHYGFLRKILEDGMDSHYVDVFQDTVRAGKNRTLF
                     RSDANLTPGYYGIRGLRAMSENLIQEFSSILRKRALQDRLVSARGYTVYLQSVLVPEL
                     AVRLIMEDMSVGEEEARRILEESSDVGELLNDEIADVVLEDDDVVDPLSQAH"
     gene            1180592..1181174
                     /locus_tag="THITE_2121046"
                     /db_xref="GeneID:11519801"
     mRNA            1180592..1181174
                     /locus_tag="THITE_2121046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656385.1"
                     /db_xref="GeneID:11519801"
     CDS             1180905..1181132
                     /locus_tag="THITE_2121046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656433.1"
                     /db_xref="GeneID:11519801"
                     /db_xref="JGIDB:Thite2_2121046"
                     /translation="MPRADDSSRFSSMTGSSTDSARSSITVKPLPLTPTTPSLPTAPC
                     PGNNGSRFAPHGSRRAAPSRLKTDDNGSFVR"
     gene            <1181311..>1187810
                     /locus_tag="THITE_2146951"
                     /db_xref="GeneID:11519802"
     mRNA            join(<1181311..1181592,1182098..1187389,1187460..>1187810)
                     /locus_tag="THITE_2146951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656386.1"
                     /db_xref="GeneID:11519802"
     CDS             join(1181311..1181592,1182098..1187389,1187460..1187810)
                     /locus_tag="THITE_2146951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656434.1"
                     /db_xref="GeneID:11519802"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR013716"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Thite2_2146951"
                     /translation="MREHAMSDLFDYRRDLAILDPAGGRASRAQQQTNPSTGSFGQGP
                     PWMANSSGAASAPTSTDQIPTTFYNDSTDNLSLASQLSPGVRTSISRPTPDIARYGVA
                     PVRDILSGPDRDRYVTDGSSQNPPKTSGSGRSGHSIVHLPGHHHKHNKSNEDPRSLRP
                     SVSREDSTLVPAKERSGSTGMYGARSRAQSPAPSANSTYWSSKNASGDGQTSPGRQPK
                     RRFLGRLRGRREKDDAGDLGKLSSSTQSLLPRPSRHELPFGDRSTPQGSEWPGSPDHR
                     DAYGPRPPFSRAATFNNKFPFSSKKSRAIRQHDDADENIGPTDRQDAGGTVFHLDTNL
                     NDMEGILSKRTPLTPMDTAFLSDLDFDKLPIKPTDPSGAWNAPDSWAVRRGDEASAQV
                     PEADDIGSPPRPEEKLTNYCIRVFRADGTFATLQMALDATVSDLISQIVKKSYVIDGV
                     ENYNIILKKHDLVRILSPAERPLLMQKRLLQQVGYEDRDRIEDIGREDNSYICRFMFL
                     SARESGFHAVAHNVGFGRMQKLSHVDLSGRNLTAIPVALYSKAADIISLNLSRNLSLD
                     VPRDFIQACENLRDIKYTNNEARKLPPSLGWANKLTLLDVSNNRLEQLEHVDLGGLTG
                     LLKFNLANNRLSHLPAYFGAYSVLRTLNISSNFLEKLPAFVCDLESLVDLDLSFNLIS
                     ELPDAIGKLRNLEKFVITNNRLSGSFPSSFRNLSSLRELDIKYNAIANIDVIAQLPKL
                     EILTADHNSVSQFVGTFERLRSLKLNWNPVTKFDIRASVPTLKLLNLSSAQLASIDDS
                     FNNMPSLERLVLDRNYFVSLPSQIGSLKKLEHFSIAHNLIRQLPPEIGCLTELRVLDV
                     RGNNIRKLPMELWYANKLETLNASSNLLDSFPKPASRPPVPPEETASAASSLGSKLSG
                     TTRAVSPMPSVEELNGDASRRPSQASSTLLSVGPSPVPPSGDRKGSMVSLYGKGGRKT
                     SVVSRSTQSSAPPVSGGIRKDSSHSALLTTTFAGSLRHLYLAENSLDDDDWETLMKLH
                     ELRVLNLSYNGLNDMPQRALRSWPQLTELYLSGNELTSLPADALEDYSLLQTLHINNN
                     KFINLPADISRARRLAVLDCGSNSLKYNIANVPYDWNWNLNPNLRYLNLSGNRRLEIK
                     QSYPGMVGQTREQYSDFNRLANLRVLGLIDVTLTQPSIPDQSEDRRVRTSSSLAGYMP
                     YGMADTLGKNEHLSTIDLVVPRFNSSDSETLLGLFDGQTLPSSGSKVAKYLHENFGNI
                     FAHELNERKAAQGETPQDAFRRAFLALNKDLITAASQHAEDRSLMTHRGSQASLVLSK
                     EDLNSGAVATVVYITEQELYVANVGDVQAMLIRNDGQYEMLTKKHDPADPQERSRIRD
                     AGGWVSRQGRLNELLPVSRAFGYADFMPAVQAAPHVTHHTIKDQDETILIATREVWEY
                     LSPEHVCDIARTERGDLMRAAQKIRDLAMAYGSKDKIMVMLLGVANLKQRRERSRMHR
                     GQSMSWFNFPQDDNGLPVSSRRGRKTKAEGPLDSTLLRLDAEVPAPTGNIAIVFTDIK
                     NSTQLWENYPDAMRSALKLHNEVMRRQLRLIGGFEVKSEGDAFMVTFATATAALLWCF
                     AVQMQLLTVNWPNEMLNSVTCQPTFDRENRLIFRGLSVRMGIHWGEPLAEQDPVTRRM
                     DYLGPVVNKASRVSACADGGQITVSSDFILEIQRCLETYQETSAEDTFDDDPYARAIR
                     SELRSLSSQGFEVKEMGEKKLKGLENPEYIYSLYPHALAGRIDQHNLHERAQSESEKP
                     ATLRDAGLEIRPEDVWELWHVSLRLERLCSALQEAPGRLQPPETELMERIKRRGGEVT
                     ERFLLNFMEHQVSRIEACVSTLAVRHLVLANDPTRDPNDLRAPMSEVLDTLAERLALL
                     QRYEARFGPLPHDDGASLGSLSSGLSASAPALLPDRRKRAVDGPDPDTPQPSSASGSD
                     SAGTRVDTPESALGEP"
     gene            complement(1189075..1192472)
                     /locus_tag="THITE_2121047"
                     /db_xref="GeneID:11519803"
     mRNA            complement(join(1189075..1189853,1189921..1192472))
                     /locus_tag="THITE_2121047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656387.1"
                     /db_xref="GeneID:11519803"
     CDS             complement(join(1189399..1189853,1189921..1192063))
                     /locus_tag="THITE_2121047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656435.1"
                     /db_xref="GeneID:11519803"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="JGIDB:Thite2_2121047"
                     /translation="MAAQSTLRQSAAEEAIAAFIDKYTELIRSKLRKTSKTTRLLSAL
                     ALVASIILAGEGARRRWKRKRAEREEGRKLVRTNSWLHNKDGSRTIFVPYRDRTAKVV
                     IHSTKRLTFEAHRRLFLSPPKKSGLADGTVPSPETKPGVNLAFLHQLSSLLSIMVPRW
                     TSKEAALLMGLSASLMMRTYLSLVVARLDGEIVRDLMAGNGKLFLWGLVKWCGLGGVA
                     TYTNSMIKFLEGKVSIAFRTRLTRYIHDLYLNDNLNYYKVHNLDGGVGLSTDQFITHD
                     LTRFCAAAANLYSSLGKPFVDICIFNYQLYRSLGPFALTGLFSAYLASSSILRRLAPE
                     FAQQRATEAQTEGEFRSLHGRLMANAEEIAFYGGGEREKGFLDGVFELLKDRKALMYR
                     ARARYIMFEDLIVKYGWSAYGYALASLPVFLPAWSGAHGKLEPAAQAEKGGRERGRMK
                     NFIFNKRLMLSLADAGTRMIYELKDLSELAGYTSRVYTLISTLHRVHACAYPVKGMGN
                     ELYSLSDVQGTMQRGFDGVRFENVPIVAPSLWPNGGDELIESLSMIVRSGDHLLISGP
                     NGVGKSAIARVLAGLWPVYRGLVSRPKNNGEDGIMFLPQRPYLSIGTLRDQVIYPDGA
                     ADMREKHRTERDLQNVLDLVHLDYLPNRFEDRWNARKEWKDVLSGGEKQRLAIARLLY
                     HQPKYAFIDEGTSAVSSDVEGLLYETCKQKGITLITISTRASLKKYHRYSLTLGLGPY
                     GNEWDFQRIGTPSEKMQAERELSELRARLEQVEAWKARHAEIVRELAQVWVEGGEDGD
                     TAPLPYGETEPSQKTDTEAEETQDEADFHEAQEMMGDETDAERRHGTSDGAEMRNSTG
                     RESGSTVIV"
     gene            1194999..1197330
                     /locus_tag="THITE_2121050"
                     /db_xref="GeneID:11519804"
     mRNA            join(1194999..1195170,1195405..1195698,1195747..1196546,
                     1196603..1196752,1196808..1197330)
                     /locus_tag="THITE_2121050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656388.1"
                     /db_xref="GeneID:11519804"
     CDS             join(1195467..1195698,1195747..1196546,1196603..1196752,
                     1196808..1197119)
                     /locus_tag="THITE_2121050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656436.1"
                     /db_xref="GeneID:11519804"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Thite2_2121050"
                     /translation="MARGTDEKPQAVAESSKEKEMLTPEDGASKKSRALLPVPSRSSS
                     QRVQPSPTATGMSGATASDPRDSIGGRSKESRGSAGTGPTATPGNSELHSPAAMSQTK
                     KKGGFFAFLGCCGVPDNANGLDTEPPVPNHKLEKIPARPATASRRTATPSEQPSSSRT
                     HLSEKEPSQLVPVSQGPPKNGKRVSGASTQDQSTVGGERDNESKQTTLVGPGSSNPVI
                     SVEPPHAASAEDDKVDEVPSEKDAEGDVPMPDAESARQQAHQQEHEQAHQGPVAAVEE
                     ALPRVPPPPPGPVPAVPNAPTSALIESPPVFAPDQPQRFLLPPQAPEHKGRKCLVLDL
                     DETLVHSSFKILHQADFTIPVEIEGNYHNVYVIKRPGVDQFMKRVGELYEVVVFTASV
                     AKYGDPLLDQLDIHKVVHHRLFRESCYNHQGNYVKDLSQVGRDLKDTIIIDNSPTSYI
                     FHPQHAVPISSWFSDAHDNELLDLIPVLEDLAGPNVRDVSLVLDVSL"
     gene            1198847..1199840
                     /locus_tag="THITE_2121054"
                     /db_xref="GeneID:11519805"
     mRNA            join(1198847..1199105,1199253..1199571,1199680..1199840)
                     /locus_tag="THITE_2121054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656389.1"
                     /db_xref="GeneID:11519805"
     CDS             join(1199103..1199105,1199253..1199571,1199680..1199714)
                     /locus_tag="THITE_2121054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656437.1"
                     /db_xref="GeneID:11519805"
                     /db_xref="InterPro:IPR005609"
                     /db_xref="JGIDB:Thite2_2121054"
                     /translation="MSSPRAGSPSSPAAGPAGASASGASAPRPSSPPPPGGARTAIRR
                     RAAADQKEKIANARPNSTRAAGAGGSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFS
                     VVALHIIAKITRRFSS"
     gene            1203541..1206747
                     /locus_tag="THITE_2121057"
                     /db_xref="GeneID:11519806"
     mRNA            join(1203541..1203713,1203940..1204083,1204150..1206747)
                     /locus_tag="THITE_2121057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656390.1"
                     /db_xref="GeneID:11519806"
     CDS             1204472..1206550
                     /locus_tag="THITE_2121057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656438.1"
                     /db_xref="GeneID:11519806"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Thite2_2121057"
                     /translation="MRPEDKPDSPEYKKKQAMIRGPVLDLAQENTDPYGMEECTFTGL
                     KDIFTALIESQSRTGVLSPRRFLDIFKRNNEMFRNSMHQDAHEFYGIVLNDVIANVEA
                     NGRRMQEVAASRKQGDPSQASGPALSTNEAALTTKSPGTGWVHDIFEGVLTSETRCLT
                     CETASQRDETFLDLSIDLEEHSSVTACLQQFSAEEMLCERNKFHCDHCGGLQEAEKRM
                     KVKKLPKVLALHLKRFKYTEDYSRLQKLFHRVVYPYHLRLFNTTDDAEDPDRMYELYA
                     VVVHIGGNAYHGHYVAVIKTKDRGWLLFDDEMVEPVDKSFVQNFFGDKPGMACAYVLF
                     YQETTFEKVREELDAEGLDQVKLANQTADLAATADHVNGASPSALSKLNSQPLPPVEE
                     HVTLAALEQTKSAPTEIDVVSPMDQLPPPLSQSGAHPLVAAPPPPPAVMTKSDEAAAV
                     PPKSKEEMAREKKELKAREKAEEKARKAAEKEQARIAMKERQEQLQRIRELARLEREQ
                     LQKAIQESKQTAAEEGKRQKKEAAAAAAAADASSSSEGGANGFLNRAGRTRKSMTRKS
                     FAFLHLGLNSKDEQKGDSQADRADRSEASDDRSDRGDRGETSAAGEGGHPSQQNGVSG
                     GKQGSHSSLTARPLPRSEPAPGAVDQLRNDKDKDKDKEKDKEKEKPPLKERLSFGLGR
                     KKSSRFFSPP"
     gene            complement(1206747..1208436)
                     /locus_tag="THITE_2121059"
                     /db_xref="GeneID:11519807"
     mRNA            complement(join(1206747..1207374,1207480..1207587,
                     1207748..1207807,1207879..1208436))
                     /locus_tag="THITE_2121059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656391.1"
                     /db_xref="GeneID:11519807"
     CDS             complement(join(1207319..1207374,1207480..1207587,
                     1207748..1207807,1207879..1207906))
                     /locus_tag="THITE_2121059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656439.1"
                     /db_xref="GeneID:11519807"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="JGIDB:Thite2_2121059"
                     /translation="MSLLGKLLYITVLLLNAICIPSEDRFLARVGLAPATYQRAFGQD
                     VDTSVKYRIIQLIASVRTVMRVPLIIINSLIIVYELVLG"
     gene            1208665..1209179
                     /locus_tag="THITE_2121061"
                     /db_xref="GeneID:11519808"
     mRNA            1208665..1209179
                     /locus_tag="THITE_2121061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656392.1"
                     /db_xref="GeneID:11519808"
     CDS             1208695..1208889
                     /locus_tag="THITE_2121061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656440.1"
                     /db_xref="GeneID:11519808"
                     /db_xref="JGIDB:Thite2_2121061"
                     /translation="MVNLEASSDSSHQLRARARQRRTNQERAAQSRSQTLRATCDGRQ
                     PAKAVPQATSEQQPPSKSTW"
     gene            1209958..1211993
                     /locus_tag="THITE_2121064"
                     /db_xref="GeneID:11519809"
     mRNA            join(1209958..1210285,1210407..1210571,1210970..1211760,
                     1211835..1211993)
                     /locus_tag="THITE_2121064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656393.1"
                     /db_xref="GeneID:11519809"
     CDS             join(1210430..1210571,1210970..1211760,1211835..1211870)
                     /locus_tag="THITE_2121064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656441.1"
                     /db_xref="GeneID:11519809"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_2121064"
                     /translation="MAPVIKLNSGYDMPQVGFGLWKVDSAVAADVVYNAIKAGYRLFD
                     GACDYGNEVECGKGVARAIQEGLVKREELFIVSKLWNTFHDKERVEPIVRKQLADWGL
                     EYFDLYLIHFPVALEYVDPSVRYPPGWHYDGKSEIRRSNATIQETWTAMESLVESGLA
                     KSIGISNFQAQLIYDLLRYAKIRPATLQIEHHPFLVQQELLNLAKQEGIAVTAYSSFG
                     PASFLEFNMQHAVKLTPLMEDETIKKIAAKYNRAPSQVLLRWATQRGLAVIPKSVRQE
                     TMISNLHCTDFDLSDEDIATISSFDRGIRFNQPSNYFPTELLWIFG"
     gene            complement(1212661..1214257)
                     /locus_tag="THITE_2121066"
                     /db_xref="GeneID:11519810"
     mRNA            complement(join(1212661..1212840,1212922..1213800,
                     1213859..1214257))
                     /locus_tag="THITE_2121066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656394.1"
                     /db_xref="GeneID:11519810"
     CDS             complement(join(1212821..1212840,1212922..1213800,
                     1213859..1214099))
                     /locus_tag="THITE_2121066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656442.1"
                     /db_xref="GeneID:11519810"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Thite2_2121066"
                     /translation="MTAHLDESGPSPGQHIELVDDNPSSRHDGETSPGLRNSKGWDGK
                     LRVPKSALLANPEALSDPEYSDEDNVIPGEEVAADEDLLDGEDPDTDEIICTHSRIQS
                     IPALRLERFKKVARICLRQNLIQDIEGFSCLASTLHDLDLYDNLISHVRGLDDLVNLR
                     SLDLSFNKIKHIKHISHLTNLTDLYLVANKISKIEGLSGLTKLRNLELGSNRIRELQN
                     LDCLTALEELWVAKNKITSLAGLAGLPRLRLLSIQSNRIRDLSPLKDVPQLEELYISH
                     NALETLEGLEHNTRLRVLEVSNNKIASLKGLGPLAELEELWASYNLIADFGELERELR
                     DKTALTTVYLEGNLLQLRAPALYRNKVRLALPQVQQIDATMVRAG"
     gene            <1214980..>1216325
                     /locus_tag="THITE_2055259"
                     /db_xref="GeneID:11519811"
     mRNA            join(<1214980..1215234,1215292..1215547,1215604..>1216325)
                     /locus_tag="THITE_2055259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656395.1"
                     /db_xref="GeneID:11519811"
     CDS             join(1214980..1215234,1215292..1215547,1215604..1216325)
                     /locus_tag="THITE_2055259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656443.1"
                     /db_xref="GeneID:11519811"
                     /db_xref="JGIDB:Thite2_2055259"
                     /translation="MIARSWGRGTQRRLLQLGRLLHTGRGSTRLHSTPIWAATKSSSL
                     SGFRRLRVSFVGRSCRSIHIPPILLPPVLFSGLLVGLWIWYCVMMVVFQNKIIYMPGL
                     PPTSRRECIANWASLCGGVEWVKQNTKAADGTELAMAVTTVPLPQGRRPVATKPGDPA
                     AAHVYVLYFQGNASSIPPRLPDLSWVLRAVSDSKTHVLAPMQLTFVCLSYRGYWTSRG
                     RPSESGLRLDAEAGVRWIADYHERTFGKDGGTRPILLVWGQSIGSGVATNLAATGRIP
                     PTMPIEGLLLETPFVSVRAMLETLYPQKWLPYRYLWPFLRNHLDSWKNLGLIAHGSKA
                     TGRTAPMIYILEAERDELVPKEQSERLYQRCVELGLPVEKGIVPVAYHQEAIARSDGK
                     RLAAQAILQLTKRALDRN"
     gene            1217740..1219042
                     /locus_tag="THITE_2121075"
                     /db_xref="GeneID:11519812"
     mRNA            join(1217740..1218072,1218141..1218544,1218594..1218825,
                     1218886..1219042)
                     /locus_tag="THITE_2121075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656396.1"
                     /db_xref="GeneID:11519812"
     CDS             join(1217885..1218072,1218141..1218544,1218594..1218825,
                     1218886..1218925)
                     /locus_tag="THITE_2121075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656444.1"
                     /db_xref="GeneID:11519812"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Thite2_2121075"
                     /translation="MFSRRFEPPSSSHSNKSFSKSGRHRRASSSFVKDAGISKRPIES
                     GRRRAGTVSNAGASESTLGNPISPIVTLIIGQEQRIFAAHENVLAASPFFQSILQHQM
                     MDSQTKKISLPDEEPEVFSSVLEYLYKGDYHPRLVHNKKRNCWELEQTGEDGRSEATI
                     YHPSVDGELLKDTAIYCAAEKYGLEELKRISLRKQGLQSGIQASTILTSARYAYANTP
                     DTDSKLRAHYLALIIRSRSTFKRSGTMQLEMFNGGTQLFFDLFVALCNHVDDISAAAT
                     TPRTPHSGRPF"
     gene            complement(<1227016..>1227171)
                     /locus_tag="THITE_27361"
                     /db_xref="GeneID:11519813"
     mRNA            complement(<1227016..>1227171)
                     /locus_tag="THITE_27361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656397.1"
                     /db_xref="GeneID:11519813"
     CDS             complement(<1227016..>1227171)
                     /locus_tag="THITE_27361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656445.1"
                     /db_xref="GeneID:11519813"
                     /db_xref="JGIDB:Thite2_27361"
                     /translation="PSTSLVDTPILFILKKGGELHFIIDYRILNHITYKNYTPIPLIS
                     EILNRLSS"
     gene            complement(<1234070..>1236003)
                     /locus_tag="THITE_46470"
                     /db_xref="GeneID:11519814"
     mRNA            complement(join(<1234070..1234153,1234432..1234840,
                     1234895..1234956,1235008..1235233,1235289..1235590,
                     1235704..>1236003))
                     /locus_tag="THITE_46470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656398.1"
                     /db_xref="GeneID:11519814"
     CDS             complement(join(1234070..1234153,1234432..1234840,
                     1234895..1234956,1235008..1235233,1235289..1235590,
                     1235704..1236003))
                     /locus_tag="THITE_46470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656446.1"
                     /db_xref="GeneID:11519814"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Thite2_46470"
                     /translation="MEFGPSFYHEFAEAWGKQDGYRLAPTLSPELSTEQLRTIYQSQN
                     AHNVKNALKHGLQGSVAGVDRIDQVELQAWVEVYAAYWKATGVILDAWETSDGDSKEL
                     PWSKVYEAWTDLLNFLLRGYQNAGFEAWTIPCLYVVCKHLRIFAIKADAERNSNSASS
                     LDDGAAANFQDDFDPETNKNQKLEDCARVLGRVFNVCHMDRAPIEESRKWASYYIANL
                     LLKTYFRLNSASLSKHILNSLRAGRADMPPFSAFPKSQQVTFEYHQGVLAFLEENYAE
                     AEEHLTAAWNQCHKAATRNKELILTYLIPCHLITNHTLPTEKLLEPYPRLQKLFLPLC
                     RCIKRGELHKFDLALQEGEDEFVKRRIYLTLERGRDIALRNLLRKVFIARGFEDAKEG
                     EKPVRRTRVPVAEFAAAISLGSQEKIDNDEVECLLANMIYKGHMKGYISRQHGIVVLS
                     KSGAFPGTGV"
     gene            <1236429..1237952
                     /locus_tag="THITE_2121081"
                     /db_xref="GeneID:11519815"
     mRNA            join(<1236429..1236432,1237003..1237187,1237245..1237421,
                     1237477..1237766,1237823..1237952)
                     /locus_tag="THITE_2121081"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_003656399.1"
                     /db_xref="GeneID:11519815"
     CDS             join(1236429..1236432,1237003..1237187,1237245..1237421,
                     1237477..1237635)
                     /locus_tag="THITE_2121081"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_003656447.1"
                     /db_xref="GeneID:11519815"
                     /db_xref="InterPro:IPR002670"
                     /db_xref="JGIDB:Thite2_2121081"
                     /translation="MGRLHEYQVIGRHLPTEANPTPNLYRMRIFAPNEVVAKSRFWYF
                     LRGLRKVKKATGEIVSVNEISEKHPLKVKNFGIWIRYDSRSGTHNMYKEYRETSRTAA
                     VEALYADMAARHRARFRSIHILRVVELEKTEDIRRPYIKQLVQKNLSFPLPHRVPKIN
                     TKKIFSATRPSTFA"
     gene            1237953..1238751
                     /locus_tag="THITE_2121084"
                     /db_xref="GeneID:11519816"
     mRNA            1237953..1238751
                     /locus_tag="THITE_2121084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656400.1"
                     /db_xref="GeneID:11519816"
     CDS             1238213..1238662
                     /locus_tag="THITE_2121084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656448.1"
                     /db_xref="GeneID:11519816"
                     /db_xref="JGIDB:Thite2_2121084"
                     /translation="MSPAPEQPTPSEPRPAPGPAPDPASFVRVRTTRPRSPFPPNSAR
                     QPIITPRLILRALTPEDIPALHVLRTQPEVMRWTALGRPDADLEETRRRMERSYPPND
                     TASFNFAICARGVDGDADAAGELIGIGGCALTKGSFGWSVKSELSFC"
     gene            <1240462..1243072
                     /locus_tag="THITE_2151762"
                     /db_xref="GeneID:11519817"
     mRNA            join(<1240462..1240590,1240646..1240733,1240806..1241221,
                     1242718..1243072)
                     /locus_tag="THITE_2151762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656401.1"
                     /db_xref="GeneID:11519817"
     CDS             join(1240462..1240590,1240646..1240733,1240806..1241221,
                     1242718..1242756)
                     /locus_tag="THITE_2151762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656449.1"
                     /db_xref="GeneID:11519817"
                     /db_xref="JGIDB:Thite2_2151762"
                     /translation="MTTAAGETKDGTAYYGYLFTKAKPIPLATPVLDALLRAIALHIQ
                     NEIGDKNEKHLTPAKLAAFYKTAGHDWDSFFVEMPHLAISTVYSGLGCQHWLLPSDDD
                     FAPPSIPALTLKGFVQWQTIQTLLGPQTQVPVLQFAAAHWALKHPDTGEPLPVDLPKE
                     AFPSEADPDTDHWHQECARRARLKATEGDPPEPPKEPPKPDFTDRKVPYSHVRGHGGR
                     WEDVP"
     gene            1246478..1247909
                     /locus_tag="THITE_2121086"
                     /db_xref="GeneID:11519818"
     mRNA            1246478..1247909
                     /locus_tag="THITE_2121086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656402.1"
                     /db_xref="GeneID:11519818"
     CDS             1246745..1247776
                     /locus_tag="THITE_2121086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656450.1"
                     /db_xref="GeneID:11519818"
                     /db_xref="JGIDB:Thite2_2121086"
                     /translation="MKGRPVEQLVYEYMFPKPRQSDPQNFQALLQRYLILEVRQETHS
                     FYGHLDTPEAKYPGLDYTHPIHRIRLSRFPWHRRLFRAFDGLRLTHAEISNLTKWEGT
                     KWAKERFEREQGIKIRDTTADGLPNYADPNDPYSAQALGARSAGTEDPVAAEEGNEEE
                     DENEDVEEEESDEELESVGEDLNERLRQRVAMRNISGDHSMPLDEEWENWLKHAIESG
                     ELPHVADQIARFPGPHNTLTADDIFPPRMMAAARAGHWEEIPDFLHDMIRQALESGRR
                     PAQTSTITGFSPRPSVRYAGALDTFNTVAVYAQGQQGSRPEFRPPEAIGRRAEQSGNR
                     PQQTAQPGA"
     gene            complement(1249097..1250101)
                     /locus_tag="THITE_2097063"
                     /db_xref="GeneID:11519819"
     mRNA            complement(join(1249097..1249437,1249515..1249707,
                     1249950..1250101))
                     /locus_tag="THITE_2097063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656403.1"
                     /db_xref="GeneID:11519819"
     CDS             complement(join(1249364..1249437,1249515..1249707,
                     1249950..1249973))
                     /locus_tag="THITE_2097063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656451.1"
                     /db_xref="GeneID:11519819"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="JGIDB:Thite2_2097063"
                     /translation="MSSKSGVNVLRYSALGLGIFYGFYHQRSITASQKAAAAQREYEH
                     KQELINKAKEAYAKSKQPATPSASATTGLDQDPMSPDFDLEAYFEALMKLKE"
     gene            1250261..1253077
                     /locus_tag="THITE_2121090"
                     /db_xref="GeneID:11519820"
     mRNA            join(1250261..1250768,1250827..1253077)
                     /locus_tag="THITE_2121090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656404.1"
                     /db_xref="GeneID:11519820"
     CDS             join(1250652..1250768,1250827..1252857)
                     /locus_tag="THITE_2121090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656452.1"
                     /db_xref="GeneID:11519820"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121090"
                     /translation="MQQRRDEILAKRAKLAELKRQRELRASQATARQSISQSELIAPT
                     PGRADNRREIESLIDSLVRESRPVSVPTGANSPARLGSRPNSVLSAGELSVENNSEFA
                     GPANGQVVTPQPQILSAVPLKTVYECPPSPVKEVYSYSKGVQTTEDWTLPTKSRTLSE
                     SENEEPPVTASPNKRLSRRERDREEELRQNIRKEIEEELKAAKELLVDGVLKPSAAAN
                     FPARTLTAEELSAVTHSDEFMDFIDRSTKVIEKALDQEYDILTDYTLQVHDVDDDDEQ
                     SGNTGGKGRRKVKEIAQFYDERWSKKRMVSAIDFSPKFSELLLASYTKNPTAPHEPDG
                     IVQVWNLHLHDRPEFVFHAQSDILTAKFSPFHPNLIIGGAYSGQVLLWDTRARSAPVQ
                     KTPLTGSGHTHPVYCVDIVGTQNANNIISCSTDGAVCGWSVDMLAQPQEAMTLLAPPP
                     ARTEDLSPTCMAFPQADPTFFLVGSEEGTIYPCHRYDRAGAKAGVDARVSYRGHAAPV
                     MSVSFHPARGPVDLGDLVLSASLDWSVKLWKVRAPAATSAVAASGTSASGATLGTSLG
                     VVVGAGGGAAGGAGLLEPAVTPLLDFVREDVVYGAAWSPVKPGVFGLVDGAGWLELWD
                     ITVETEEPVARISPSPRKDGRTMLSKSLNKLAWEPAEGKRLATGGIDGAVTVFEVGPD
                     LGGKEGLKNEEWTSVKKLVNRLEAVGANDGAGV"
     gene            complement(<1253447..>1254563)
                     /locus_tag="THITE_2056137"
                     /db_xref="GeneID:11519821"
     mRNA            complement(join(<1253447..1253806,1253890..1254458,
                     1254512..>1254563))
                     /locus_tag="THITE_2056137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656405.1"
                     /db_xref="GeneID:11519821"
     CDS             complement(join(1253447..1253806,1253890..1254458,
                     1254512..1254563))
                     /locus_tag="THITE_2056137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656453.1"
                     /db_xref="GeneID:11519821"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_2056137"
                     /translation="MPKINGQDVGATGYGLMGFTWRPDPIPHDQAFEAMRTALKHGMN
                     FWNGGEFYGTPECNSMTLLDAYFAKYPEDADKVVLSIKGGMNLKNHKPDGSPEGVRRS
                     IDAVLKQLNGRKKLDIFEYARRDPNVPMEVTFRTMQEYIDKGLLGGISLSEVAASTIH
                     EAVKHAKIVAVEVELSIFSPDVLTNGVAAACAQYGIPLIAYSPIGRGILGGKLQSQSD
                     IPPFLQQFPRFHPENFPHNLELFRLVNALAQKKGCTPAQLAISWTRCLSRRPGMPTII
                     PIPGSTRAERVAENAVEVDLTDAEMDEIDKILAKFEVKGERYPASIPTNT"
     gene            1255704..1257406
                     /locus_tag="THITE_2121093"
                     /db_xref="GeneID:11519822"
     mRNA            1255704..1257406
                     /locus_tag="THITE_2121093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656406.1"
                     /db_xref="GeneID:11519822"
     CDS             1256312..1257226
                     /locus_tag="THITE_2121093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656454.1"
                     /db_xref="GeneID:11519822"
                     /db_xref="JGIDB:Thite2_2121093"
                     /translation="MEFIDLIRRIQADEESSDEEAGLVLTAASTAAGTANHRRRASPP
                     DTDAVAGPSHLAGKAKFASGGGERNSVADGAPVAEVNGVVQADQTKNAQKRTLDSEKA
                     GDETEQQRATKSVKLENGRTVNGDTSGVKKVQVPVSVAAESSKTVATVPAARKPVHQM
                     EYFERRVYDMLSDPLGFDDCVYDANEQMRRHAARKLARHHRRRQNRPAPPLEMSGALG
                     PVHNLTPAAAKAKPAQSLAKMAQKQAHQRKVAEQVQALKGKGGASTKAGGMGKGKALE
                     SIRSQQGSVKEQGGQQRPSPTKQYSQLK"
     gene            1257947..1259407
                     /locus_tag="THITE_2121096"
                     /db_xref="GeneID:11519823"
     mRNA            join(1257947..1258261,1258323..1258371,1258447..1259407)
                     /locus_tag="THITE_2121096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656407.1"
                     /db_xref="GeneID:11519823"
     CDS             join(1258142..1258261,1258323..1258371,1258447..1259207)
                     /locus_tag="THITE_2121096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656455.1"
                     /db_xref="GeneID:11519823"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="JGIDB:Thite2_2121096"
                     /translation="MSGPGVGFEYPAKEVSWTKRDALLFANSIGCTAEELHFLYELDP
                     NFSVFPTYPVILTFKGTATDVIDFYAAQKAVRIPGVPEFDPARVVDGQRLLQSFKPLP
                     ASSAGRKFEVRTKVLGVYDKGRPGTVVETQSDLVDATTGDVYTRVISSSFFVAQGNWG
                     GPKGPATANFPAPKDRRPDVVFENQTTAETPLLYRLNGDYNPLHAHPEPGRKMGFGGV
                     IIHGLYTWNWAAHGLLQHLGGSDPANLKEYQARFASPVRPGDKLVASAWRTGEMRDGF
                     EEVRFEVRVAGGKVCLSNGRALIKCVGPVKGKL"
     gene            1259409..1261615
                     /locus_tag="THITE_2121098"
                     /db_xref="GeneID:11519824"
     mRNA            join(1259409..1259654,1259728..1260148,1260216..1261615)
                     /locus_tag="THITE_2121098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656408.1"
                     /db_xref="GeneID:11519824"
     CDS             join(1259477..1259654,1259728..1260148,1260216..1261461)
                     /locus_tag="THITE_2121098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656456.1"
                     /db_xref="GeneID:11519824"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Thite2_2121098"
                     /translation="MPSEARARIGERRSYDGALCTVRYVGEVAGTTGSWLGVEWDDPS
                     RGKHDGQHNGVRYFSCRSKSATAASFVRPTRPTDVPQTFLAALQLKYATDPTAGQNPP
                     RQIVFSGKVAEEVGFEKVRHKQAQLDELQFVILDGAQIAYASPPPGGAVDGAKGGQQS
                     IGQVCPKVKELDLSRNLFERFGPVVDICSELRLLRSLRANGNRFQHVLEDERLASAGD
                     AFNGVTEFALEDTLLDWNEICHIAAKFPSLATLHAGSNQLPSLTPVAPAPFTSTLVSL
                     HLEYNDFSSLADLAPLSAIPSLRNLLLKGNRISHITPPSSASATSPPNFPPSLHYLDI
                     SYNQIASWSFVDALPHSFPGLTSLRFTHNPIYDDPDLDDDGAPTSLAAPTTTTTQRKG
                     VAKTDEAYMLVVARMPALRTLNFSAVTPADRADAEMFYLSRIARQLAAVPEAAEPAVL
                     ARHRRWAELCAAYGEPPVVRRGRVDPNFLEARLITVEFHYPGGGAQQKSVVVQVPKSF
                     DIYAVKGLAGRLFGLPPLGLRLVWETGEWDPVGGFDEADGESEVEEEDLEAEWERRGE
                     AGEPVGEAMEGKTKAGRWVKREVELKDGPRQLGYCVDGLEARIRVERR"
     gene            <1261770..>1263269
                     /locus_tag="THITE_2091621"
                     /db_xref="GeneID:11519825"
     mRNA            <1261770..>1263269
                     /locus_tag="THITE_2091621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656409.1"
                     /db_xref="GeneID:11519825"
     CDS             1261770..1263269
                     /locus_tag="THITE_2091621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656457.1"
                     /db_xref="GeneID:11519825"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2091621"
                     /translation="MVSPPRFFIVRPDGKKPTADGKVNTLPGPIVPLIAVDELPEWLN
                     IVGVPRELTVEQTVGLYNLGTVSKSKGSYAVEITHQALPAVRQLPGTLKAIEPKPENH
                     TTANPPHETTTTRQSAAASPETAVHPADRMKAHWSEAHARAAGLVSNTTGSPTPRQQQ
                     QQLQPQRSLSAATSHPSPPRSSTKSSGSSSNNNPASSPNPSPSANPSTRTEYCRHWCH
                     HGTCKWGLHCRYLHAMPATPAELAAVGLRGLPAWWVALQQHCYNSNNNNDNHNNGHQS
                     NAIGNSSNGNGGTPGSRTVEHALGPDTAGGGSSSNNSKSSGGLYFDPRDVRAPGGGAG
                     GMMHPMGWGMVPGAVRAGGAVVSGHGGGQKAATRAQLRETLALLRELRLRLGLGSELG
                     GGGGGVGGGGKAVRKREVNPLEKGRGKGVVGGDKEAMLTAAKTGGLAASIHAPAAGAD
                     RGQAQTGTVVTPPAGLAVQTTGGKGCGEKATGLPAQPAETQKVDKLVDV"
     gene            complement(1263421..1265159)
                     /locus_tag="THITE_2121100"
                     /db_xref="GeneID:11519826"
     mRNA            complement(join(1263421..1263529,1263607..1265159))
                     /locus_tag="THITE_2121100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656410.1"
                     /db_xref="GeneID:11519826"
     CDS             complement(1263649..1265019)
                     /locus_tag="THITE_2121100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656458.1"
                     /db_xref="GeneID:11519826"
                     /db_xref="JGIDB:Thite2_2121100"
                     /translation="MSPAGGIWAPAALRALHKHLVVNVRVATKMLRSKLAAATRPVNA
                     ELQPVAVPVRAGNSRQPIHPAAWLRQQKRAGGFRYYSTASLNSTIRRFISSGAYPSAS
                     KPGFRFDRSKLPTSRVSRAVNQLTGRAPFAWTLRPNLTGGTLGRTAGGYGIPGSGRLG
                     GARYFSHTPAAPAQVIQNVSQAMRAFWLSGHRARFDGTGPNGEKRYRAVSAMQDEARL
                     KMESAMAGRRRAPGAFVDFKISPTITALSPLGVVMPFASAEEQVAAVGAATLNAEGFL
                     DVLSVDFARALKDLAAVMTDLKALAGLGDLPVFLEKNSVLRVRFPGMDAETVERLCDD
                     VGVKRGVVGQDPDFDASAGVEVALRFPFAPDASGEGTITSPGGSLRSRGSESSSSEVE
                     EAFIVDEFEENPWRLSGSEPEEGYESMSPPVLSTSGEHCSEDFEGLEGIYRFLEECDR
                     ARGRFQ"
     gene            complement(<1266622..>1268067)
                     /locus_tag="THITE_2010991"
                     /db_xref="GeneID:11519827"
     mRNA            complement(<1266622..>1268067)
                     /locus_tag="THITE_2010991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656411.2"
                     /db_xref="GeneID:11519827"
     CDS             complement(1266622..>1268067)
                     /locus_tag="THITE_2010991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656459.1"
                     /db_xref="GeneID:11519827"
                     /db_xref="JGIDB:Thite2_2010991"
                     /translation="LTIRNLTITPLELKQVERLDAHSHLHIPTTLHKTASRGGEEESA
                     SSARQEIKGIAIQPFSECHTPVYTPDPARHEHLRLTFEDPDSGHSYSAEIPASSRRSI
                     ILKSHPKGSEEETKEFTAIYLPQHAYLAVFSSANLSSWMATLDSSLPISSLSIPGTHN
                     SPTCHVALPSVRCQAVSVLEQLNNGVRFLDVRVSCPTYTPPKANRSSNNNDDSNNDNN
                     HASIPELSLVHSAFPVSLTGAKYLSGLLATLYSFLAAHPTETVLVSIKREGTGRGSDA
                     DLSQILYHHYIAPRRQHWYTSPQIPTLAGCRGRVVLVRRFRLAASVPAAEGGIDGSVW
                     PDNVADGTCGSGTIRIQDYYGVGSAADIQRKVQFAQEGLARAAQGVHATRPSEVPAGG
                     PQMPLFINFLSASNFFNASCWPDRIAAKINPSMIEYLCMSHGAPGKGPGQLDIGDAAT
                     GIVVTDWVGHNGDWDLIRCIVGWNARLQLRQ"
     gene            1269362..1270652
                     /locus_tag="THITE_2121102"
                     /db_xref="GeneID:11519828"
     mRNA            1269362..1270652
                     /locus_tag="THITE_2121102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656412.1"
                     /db_xref="GeneID:11519828"
     CDS             1269649..1270170
                     /locus_tag="THITE_2121102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656460.1"
                     /db_xref="GeneID:11519828"
                     /db_xref="JGIDB:Thite2_2121102"
                     /translation="MRLLILAVSAFASSAVAFPSIGSLFSPRQDKDCITRDEAKQIVD
                     IYASLIANYTPSVCEKYCADDFVDRSDSINTFIFQPLGQPTFATKQIFMDAQLSNPAF
                     PLVVDSIDAVDCESIALRWHATFGVANEPSRGITILGTTKAAGWWQIKSIDVEFNSLI
                     WLLDMGGNYTWEG"
     gene            1271624..1272944
                     /locus_tag="THITE_127447"
                     /db_xref="GeneID:11519829"
     mRNA            join(1271624..1272074,1272141..1272944)
                     /locus_tag="THITE_127447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656413.1"
                     /db_xref="GeneID:11519829"
     CDS             join(1271846..1272074,1272141..1272670)
                     /locus_tag="THITE_127447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656461.1"
                     /db_xref="GeneID:11519829"
                     /db_xref="JGIDB:Thite2_127447"
                     /translation="MRFSIATAFAFAASVLAQNPTAGFDVITKPTQDEKVPAGSTYEI
                     VWEKDARHPGPITIGLLGGKTPSSLTLVDTIATGVDGGAESFSWHVPKTLGDLATYGI
                     IIYLESDKNIFQYGFPFHIVGGSSGSSETGNNTVTLTGTQTTSQTSAAATTTITTIGK
                     NSTRTTFTTSPSVTSVPTTIRSNYTTTSTGSGSGSGSGSGSGPVITTVTSDVTRVPTP
                     TTAATTAVTTNGVASLAAGSFALFGGVAMAVLAL"
     gene            1273859..1276482
                     /locus_tag="THITE_2121106"
                     /db_xref="GeneID:11519830"
     mRNA            join(1273859..1274121,1274496..1274554,1274618..1274928,
                     1274985..1275488,1275552..1276482)
                     /locus_tag="THITE_2121106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656414.1"
                     /db_xref="GeneID:11519830"
     CDS             join(1274110..1274121,1274496..1274554,1274618..1274928,
                     1274985..1275488,1275552..1276033)
                     /locus_tag="THITE_2121106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656462.1"
                     /db_xref="GeneID:11519830"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="JGIDB:Thite2_2121106"
                     /translation="MRGEILHLHLGQAGVQLGNSAWELYLLEHGLGADGRPDPNAKDV
                     GDAGSFETFFTETSNGKYVPRSIFVDLDPSPIDEIRTGTYRQLFHPELLISAKEDAAN
                     NYARGHYTIGKEKIDDVVDRIRRVADNCQSLQGFLIFHSFGGGTGSGFGALLLERLST
                     DYGKKCKLEFTVYPAPRLSSAVVEPYNAVLSTHSTIENSDCTFLVDNEAVYDICRRNL
                     DIPRPSYEHLNRLIAQVVSSITSSLRFDGALNVDLNEFQTNLVPYPRIHYPLISYAPV
                     ISAAKSAHESFKVSDLTFQCFEPNNQMVVCDPRKGKYMAVALLYRGDVVHRDCSAAVA
                     ALKSKASFNLVEWCPTGFKIGINYQKPVAVPTASPQDGGLAAVDRSVSMLSNTTAIAE
                     AWSRLDHKFDLMYNKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVAADSFEPGE
                     GEAEY"
     gene            complement(1276482..1279120)
                     /locus_tag="THITE_2121111"
                     /db_xref="GeneID:11519831"
     mRNA            complement(join(1276482..1277377,1277447..1278634,
                     1278695..1278761,1278827..1279120))
                     /locus_tag="THITE_2121111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656415.1"
                     /db_xref="GeneID:11519831"
     CDS             complement(join(1276814..1277377,1277447..1278634,
                     1278695..1278761,1278827..1278837))
                     /locus_tag="THITE_2121111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656463.1"
                     /db_xref="GeneID:11519831"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2121111"
                     /translation="MAKDKSALSVLSKAIDPALDALFSQSAGPVKTPPKSRYAELLPK
                     KSLADEEDHDGFDGAEPEGSDEESEASENGSEERSGSESDAGSVDKGGGILSGEDESE
                     AEDAKGISSADDEAEATKVSERVISRGTSQEEGRKRKRKQRDGDEDFEAKYLERLADD
                     EAPSGKRRKADATEKTAAAEDAGGVSREGDDERMAGMEEDESSVGEVPVHESLTTGPV
                     ETELEKANRTVFLSNVSIEAITSRKAKKILLHHLSSVLDKKADPPQKVQSIRFRSIAF
                     ATTGIPKRVAYIKKSLLEATTKSTNAYVVYSTAAAARLAVAQLNGTVVLDRHLRVDSV
                     AHPAPVDHRRCVFVGNLGFVDDETVYSTKIDKEGKEITEKRKRTKTPMDVEEGLWRVF
                     GEEAGKVESVRVVRDAATRVGKGFAYVQFYDGNAVESAILLNGKKFPPMLPRELRVSR
                     CKAPHKTARAMEARREKIASSASSDRKGGGKHDGKKRKKRSADGETGEYVPKLTADAQ
                     TLAGRASKLLGRFGAAKLVGELPGKDKKRRRDRRERGIKGRGGEAAGEKPNGIKGPEQ
                     FVFEGRRASAKDGKPKDLKFKTKSKGKDKVHKKKKKKGAKGEK"
     gene            1279270..1282040
                     /locus_tag="THITE_2121114"
                     /db_xref="GeneID:11519711"
     mRNA            join(1279270..1280682,1280740..1280809,1280865..1281351,
                     1281410..1282040)
                     /locus_tag="THITE_2121114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656416.1"
                     /db_xref="GeneID:11519711"
     CDS             join(1279596..1280682,1280740..1280809,1280865..1281351,
                     1281410..1281817)
                     /locus_tag="THITE_2121114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656464.1"
                     /db_xref="GeneID:11519711"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="JGIDB:Thite2_2121114"
                     /translation="MATGDTAPLLASSSPPPPLLDNSPSNLSSPLSEPEDKDISGDEA
                     DMDLRAQSDDLNTPNRRGSRGDPSTDASESDDDSKLSEVDVNDSEAETERLYNTPPKN
                     GAARDTIDSAGSAGHRRFTDRRGRIFERSPSKLHQQLRADVDTEETNIRRDFGSEAEE
                     ESGDVPSSERELGSAKRPPPTSPSLAKKSQVVPANDTTAPQPSRQNSADSRKRKRSPV
                     AEHSESDLPLKKRTGSIGAADHQYADDIPMVDDEGISTNTQSGNHTAEEDNEEPAATG
                     EPIDEAQDLVEEDVAAPSRSRKGKRSPTKKRKSKSPEEVGAQEEAPDEPPEDADMHSP
                     EVPTPQAEDDHAEEVDEEAEAAHRNEEELERKKAAWEELVAIEKQFSSFRERLYQERL
                     EQLNQEEASLMGDNPTHPEYLAMLQCLEERRAEKIRRSDLELQFKLSVLRRRAVAERA
                     QIMSQFYQAVRDSREEVLTELGREWNEIQQERRRAANTIPDYGLRFPATRAQAVRNAV
                     SYNKEVSVLSGFAKHVGFPAAPPLNGASEEQLEADLEAIQSAREPMPRRIPNQMSVLR
                     PEYATSLGFGQGLGAAGEQFIEQTPWANPNHPSHQMQRQHAHRDAHPQPIYAGPSSAP
                     RRHSHQPGGLFSSSTSTIYNGDSPAQAPKTHSSAVTEPSLKGSKMGPEPLRREPAIHA
                     T"
     gene            complement(1282288..1282932)
                     /locus_tag="THITE_108954"
                     /db_xref="GeneID:11519712"
     mRNA            complement(join(1282288..1282585,1282658..1282785,
                     1282873..1282932))
                     /locus_tag="THITE_108954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656417.1"
                     /db_xref="GeneID:11519712"
     CDS             complement(join(1282488..1282585,1282658..1282785,
                     1282873..1282880))
                     /locus_tag="THITE_108954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656465.1"
                     /db_xref="GeneID:11519712"
                     /db_xref="JGIDB:Thite2_108954"
                     /translation="MAGYQPSTYYDSRFRQSPALIRARRPYLGKNAILGLGLSAFALG
                     VYAYTLRAIGQDEFEDVKVPDVPVKPSSEGEWR"
     gene            1283567..1286535
                     /locus_tag="THITE_2121120"
                     /db_xref="GeneID:11519713"
     mRNA            join(1283567..1284033,1284138..1284303,1284368..1284495,
                     1284552..1284755,1284820..1285165,1285229..1286144,
                     1286205..1286535)
                     /locus_tag="THITE_2121120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656418.1"
                     /db_xref="GeneID:11519713"
     CDS             join(1283675..1284033,1284138..1284303,1284368..1284495,
                     1284552..1284755,1284820..1285165,1285229..1286144,
                     1286205..1286329)
                     /locus_tag="THITE_2121120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656466.1"
                     /db_xref="GeneID:11519713"
                     /db_xref="JGIDB:Thite2_2121120"
                     /translation="MAADATDASSKTLSVAEQLEQLNAARKLVLDNIAYYDRIVKGVL
                     PIIGPTAALELRRWGAEFLAESLATPVLTMRDKENITVAVLDTLRRLIEGAGEDVIVL
                     KACVAAAASAYPIALRWIIHNSYHAESWEQMSATKSRILHIWDGAPAPVKLSCIKFAQ
                     RVVLCQTASNGMEQKYNGLDISLNMVPPNHPLLDPRQLEAEATGLLDRMLGVLQDNSS
                     DALLVDATLNCLSILIRTRPATSNRILNAVLNFNPLKLANSPMTPKTRVLVQSLVKTT
                     RIFLTNLLKRDPHNPMSGRIQQYLERLMRSRTEIFDEAGRKRALADHTAAAYGDAKRQ
                     KLEGGVAQVSIPPLGPGPHTLAAVFALTSNLGLQGFDATQLPANLAARISVSALATLD
                     EQVLNFAVAGVRDRLASLYGAGPAAAAGEPSVINAATAPLGVEEEDDDYEPDLTLAED
                     TEQILNKLDNAPPEEVIEPAADAAAALALGPFKLPPPPALDPDTAASLSQAAASRVFG
                     PVSALKDGGAVRKSKAGINRLAASSYDHESWMTLITRLATRSTAGLDDVSSSIKQEDA
                     GSALDRPRVSLGDTIREMLYTYILEDWRRRIEIAVAWLCEEWYNDQLTKRSGSNAPLH
                     YEKWTLRLVDGFLSYITTQDKVLTRFLAEIPELSKALLGKLKGLCADPTTVQLALTSL
                     LYLVMMRPPVREIALDTVADIWSEYEDARPLAAKYLAKWRPGFIESQTRGAQGDAAPA
                     NNVAIAA"
     gene            1287503..1289582
                     /locus_tag="THITE_2121122"
                     /db_xref="GeneID:11519714"
     mRNA            join(1287503..1287772,1288020..1289582)
                     /locus_tag="THITE_2121122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656419.1"
                     /db_xref="GeneID:11519714"
     CDS             join(1287694..1287772,1288020..1289497)
                     /locus_tag="THITE_2121122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656467.1"
                     /db_xref="GeneID:11519714"
                     /db_xref="JGIDB:Thite2_2121122"
                     /translation="MRNKLVKARPHSDQKPAFSIHQDDEHNLSSVTVVQAETTPATTP
                     SKPLPNKAPKSLHDHPSPRSTLTPASEGTINSAMSRTAVAGGVNGKANPPASSPPLSP
                     RIVNRMNSTIRTVPSFDDKPRQPGEDSSTDGTPSHSTSRDSGFSSSINSTASMSSATS
                     QQQQQQQQQQQQRGDANPNGISKMPSISRLKPSSSTTTPDGGEVLRDTAPRALRSRPS
                     FADFAQRDSSLSPSSSLLPPSTSADPGGGPSTTDASLTATEASLSHGWDNSVGKAGLG
                     KTGRVINRLVSDNEALKRDIQIERLRAEESRQTARLLEDKLERVVSDYESRLLEANVT
                     KALLARKERQVESLQDAVELERQRAVNAAERERIWKDEMEKARAEAKRQVEEATNYAA
                     FCEGRYNAISSHWKEQGEEVQRSITRMRKEVEDLAAERKRDDEKIETLRELCDQQDGN
                     IRELRRQKDEIEMQFQRYKAQQEEELREIKRLADQREKEQERMLREAKEALDKLRWAL
                     NVKEKIPWAQ"
     gene            <1291015..>1294063
                     /locus_tag="THITE_2036687"
                     /db_xref="GeneID:11519715"
     mRNA            join(<1291015..1291110,1291168..1291338,1291393..1291710,
                     1291764..1293514,1293577..>1294063)
                     /locus_tag="THITE_2036687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656420.1"
                     /db_xref="GeneID:11519715"
     CDS             join(1291015..1291110,1291168..1291338,1291393..1291710,
                     1291764..1293514,1293577..>1294063)
                     /locus_tag="THITE_2036687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656468.1"
                     /db_xref="GeneID:11519715"
                     /db_xref="JGIDB:Thite2_2036687"
                     /translation="MEGLTEFYLTTFWAYKPKAVRQVLDDLMNLGYDEADFSYDGEYQ
                     WFKIRCCESDASGIRRAFALTTRNIEEEAFGTHEDSILCDDDTLKSSFDNEWFSQGLE
                     GHSGLKDDDVEESHHHGTIAQYPYNSIWDDLDKHNEPYSVHDILTDQQLENLKAEAEV
                     ELSFHLAGKLVCISGGSEQMVRKTREKLKVMLAIKKLSEIPPMAEHLAYAEDYVEPGP
                     DEFTADIRYLANIDPVLVSSTLLDRVTVESLAASYQMIYREGASLRLCFWVPEKSCRV
                     SLLGPKVPFRHKDKSTLGNRPTIIQIDRGKVTFIAGEANDSVENPSPETENLDETWTE
                     PEPLGSATDAAYTIPDGDNTETNFDEFTDEEVVDSDDEPSASNHRTPSATASGPIVKQ
                     ADSISGVDEISNLDLSSSATHLTDVKASGDGAGLGEKEQDELAFTGTNCLVDMLAAVQ
                     TVTPSSDLSSCLKWTMAPLIPWPSENNGKEGSESDPKTFHSDKVSGAGGNENGTQTSG
                     ASYMSPHAQRFMEYLKSGAEDFKSMKSHDAAQQPEDPTIVGPSALSRPGVHPCPPSDL
                     RSGGGLLATDSFIKETEAAIARLLSLGPYRRGKVAVRAEFGRAILEVTDPSGVAFNDE
                     TTPSNGWRKSDLLTNMRMGFGGNRNIHFTKILSTYASDIVDMINTKLDGAQLWSREPS
                     RAWTTYSFYCIPRSRENSRRFIIDVEDDGSSGNVLRYSIRGDGDDPLSTEQPSLPVYI
                     HAIRRHWDLSIVVSHVNTEELHEAYGIFANYLLQTLDTSLRSKGAPSVYYASHESFTA
                     EVEEVRVLTKWRYPSLDRRSALEITEVEQMEIELPDYLENGWRAFLARPWNRREAKEM
                     RCRGEFPRWYEAAVVSSEIEELCRLNMELGLGEKADWDPEDLRTRGVFSTLYGPALQM
                     VREMDHVGRNDDNCQSQRYAHLLLRPN"
     gene            1295265..1297515
                     /locus_tag="THITE_2121126"
                     /db_xref="GeneID:11519716"
     mRNA            join(1295265..1295533,1295605..1296485,1296555..1296951,
                     1297028..1297354,1297413..1297515)
                     /locus_tag="THITE_2121126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656421.1"
                     /db_xref="GeneID:11519716"
     CDS             join(1295369..1295533,1295605..1296485,1296555..1296951,
                     1297028..1297156)
                     /locus_tag="THITE_2121126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656469.1"
                     /db_xref="GeneID:11519716"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2121126"
                     /translation="MDDFEKGNHPSSTGEASKPPRPGDAVSLSAGDNAILPEGQIDPV
                     YEKKARVLNRAIQEIGMGWYQWQLTAVISFGWASDNLWPIVTSLIFTPVTNEFLPGRP
                     PLLTLSQNIGLLAGALFWGFGCDVFGRRWAFNLTLGITAVFGMAAAGSPTFAAAGVFA
                     ALWSFGVGGNLPVDSAIYLEFLPASHQFLLTVLSVAWAVAQVVATLVAWPLLGNLTCQ
                     EKAVCTREQNMGWRWFMIVMGGITVLMFLVRFGLFTIYESPKYLMGKGRDEDAVRIVH
                     EVAKRNGKTTTLTVADLKACEPEGYVHESNVADAVKRKLQDVRLDRVRALFATRKLAL
                     STSLIMVVWAFIGLGYPLYNAFLPYIQATRGAGFGDGSTYLTYRNSLIIAVLGVPGAL
                     LGGLLVELPRFGRKGTLALSTILTGVFLYASTTALNSQSLLGWNCAFSFTSNVMYAVL
                     YGYTPELFPTPQRGTGNALTATCNRIFGIMAPIVAMFANLQTAVPVYISGALFIAAGL
                     LVLVLPFESRGKAAL"
     gene            1297487..1299252
                     /locus_tag="THITE_2121132"
                     /db_xref="GeneID:11519717"
     mRNA            join(1297487..1297573,1297646..1298247,1298321..1298778,
                     1298879..1299252)
                     /locus_tag="THITE_2121132"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656422.1"
                     /db_xref="GeneID:11519717"
     CDS             join(1297889..1298247,1298321..1298778,1298879..1298979)
                     /locus_tag="THITE_2121132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656470.1"
                     /db_xref="GeneID:11519717"
                     /db_xref="JGIDB:Thite2_2121132"
                     /translation="MSDERSAPKYPVSTDDHSGLQPVPVPGLERVPSGWARQNAWREQ
                     QQKEHYSPDVAPTWSAAAPGKAAPPNEPNEPKPRILGLSARVFWIVIIGLVLVVAGAI
                     AGGVGGGLAAQRRADSLSSPASSDTVSSTDPGPSTDPVSSTDTAATKTSRPGTATPTT
                     SRSGVVSPAPTDGGCPNINGSIYTPLDGQGKDIPLRAGGAAQVFTVLCHTNYPAGKTY
                     GNPHLYDIMRLYLPSLEDCIAACAMYNAKYETNLDSHVFPDDTGLCRSVAIVKAPGEY
                     CYLKNGTGTNDTFGYPATFTSAVMLLANT"
     gene            1299253..1300276
                     /locus_tag="THITE_2121135"
                     /db_xref="GeneID:11519718"
     mRNA            1299253..1300276
                     /locus_tag="THITE_2121135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656423.1"
                     /db_xref="GeneID:11519718"
     CDS             1299525..1300073
                     /locus_tag="THITE_2121135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656471.1"
                     /db_xref="GeneID:11519718"
                     /db_xref="InterPro:IPR013901"
                     /db_xref="JGIDB:Thite2_2121135"
                     /translation="MTTLTPAPTTAVRLTQGAALFLSSFTTGISLSLSAVVVPCLLDD
                     APRDVMLAQWARVYALGARTMPFAAAATAAAYLWLGLRGVAGSPLGFRSRCYLAAGAL
                     TLSIVPYTFAAMRGLNARLLEMRRRATVTAGTPAEVSAEEQVKEEEEMSAKAAVDWWG
                     VLNLGRTALLAGGAICGLVAVL"
     gene            complement(1300263..1301134)
                     /locus_tag="THITE_2121136"
                     /db_xref="GeneID:11519719"
     mRNA            complement(join(1300263..1300626,1300689..1300750,
                     1300826..1301134))
                     /locus_tag="THITE_2121136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656424.1"
                     /db_xref="GeneID:11519719"
     CDS             complement(join(1300479..1300626,1300689..1300750,
                     1300826..1300873))
                     /locus_tag="THITE_2121136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656472.1"
                     /db_xref="GeneID:11519719"
                     /db_xref="JGIDB:Thite2_2121136"
                     /translation="MSDRGYTYKSSGINTHGNHYCARDYGNNSNSYHYSNRDGSYYYS
                     NPNGSTYYNNGQGGSTYTSPSGAKYSSGYGSSSGGSRGSSK"
     gene            complement(1301138..1302952)
                     /locus_tag="THITE_2121138"
                     /db_xref="GeneID:11519720"
     mRNA            complement(join(1301138..1301481,1301541..1302359,
                     1302419..1302952))
                     /locus_tag="THITE_2121138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656425.1"
                     /db_xref="GeneID:11519720"
     CDS             complement(join(1301387..1301481,1301541..1302359,
                     1302419..1302500))
                     /locus_tag="THITE_2121138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656473.1"
                     /db_xref="GeneID:11519720"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Thite2_2121138"
                     /translation="MHSRVVIIGSGPAAHTAAIYLARAELKPVLYEGFMANGIAAGGQ
                     LTTTTEVENFPGFPEAVTGQELMDRMRNQSERFGTVIISETVGKLDLSKRPFEYSTEW
                     NPDEIHTADAVILATGASARRLGLPGEDKYWQNGISACAVCDGAVPIFRNKPLVVIGG
                     GDSAAEEALFLTKYGSHVTVLVRRDKLRASTIMAKRLLSNKKITVRFNTVGVEVKGDE
                     KGLMSHLVVKDVVTGREETLEANGLFYAIGHDPATGLVKGQLETDADGYVVTKPGSTL
                     TSVKGVFAAGDVQDKRYRQAITSAGTGCMAALDAEKYLAELEEEQADGKAANGNL"
     gene            <1304350..>1307445
                     /locus_tag="THITE_115141"
                     /db_xref="GeneID:11519721"
     mRNA            join(<1304350..1305136,1305198..1305250,1305415..1306813,
                     1306877..>1307445)
                     /locus_tag="THITE_115141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656426.1"
                     /db_xref="GeneID:11519721"
     CDS             join(1304350..1305136,1305198..1305250,1305415..1306813,
                     1306877..1307445)
                     /locus_tag="THITE_115141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656474.1"
                     /db_xref="GeneID:11519721"
                     /db_xref="JGIDB:Thite2_115141"
                     /translation="MSGKGNPQAQDPPTDSAATEGSTKPGHTGVASQRSITPKGTLFT
                     NLGEAHQAITSRLASRSRSPGNRVPNTFAQPSSSASDDVSDCTSSSMGPSGARHMEFA
                     EPSRSAHQQCPTFFDMSGPAGGLGTSLTPTDPSPVVSSLALSSSKSDNPIKGNLDSDA
                     TKALACSDALEAESTEDSIYEHYSPFSMVEPCSSAQPRQGIANGDAHPSEEYWYYSKA
                     GSRGGTGPSSGIRQADAYTDSEKNRQQMSVPVSTWHQTSLPEFPPSAPRSLWIPPLVL
                     KSYLDHLEDGETSHGGVSNSGLSAGGTTDSDEDPFKYDRGPFTVFLHPSKEREVSAAL
                     RCVSGNSTASAMGVVEPVPSREPATPQPVESKKPFLNKRQPPIVDYDWDTDSKHNEVK
                     VSIRSPPLPPNAPVPPVIGLGRLDQNPDSERRKDDAQTLTSDGADWETVATSLVHYDN
                     NRDQTSSSRFWETHPAKVTGSSIADYSDTSSIKTRQCDVRSSIEQIPQPPRAIYAPRS
                     RFGRTLEDVGAPVFLPRPRIHRVNGYLPNPNRIFSDPTTSSIGNSTTGASAGEPSASM
                     RPQSDRKLAQRQNQHLNAEEEPDSRFRSLDSLSSTNNGQSSATNGNQALSSFSRDRNQ
                     LGERKPGWDQQLHENNEDMLPSPMPHESSAGVGQQGHNLTGSDQFDNSFGPKSATLFS
                     FPLISLEEAARREALKSRDPDSCTPTSGGGTQKNSSMLSKAPQMTTPPALPAAHSRRR
                     TISMAQDRQSTGYDTGTSNRTSDQSTTPLVTGGSAMSRSFRNPFGTAHTSLRNNQALP
                     TQPSIFDSPRLIAHDRRGASRGISLAETAREFASFHAGAAPSGHHATEDGHLPREARQ
                     RRQIWYYVMCCLSILPFVAPLVYCGVLDAALSWCTRGEATRLSPKQRGRILFLGLSAL
                     IFWLCIVGAVTAVAWINNAHG"
     gene            complement(<1308213..>1313226)
                     /locus_tag="THITE_45545"
                     /db_xref="GeneID:11519722"
     mRNA            complement(join(<1308213..1308809,1308884..1309201,
                     1309260..1310188,1310260..1312834,1312924..>1313226))
                     /locus_tag="THITE_45545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656427.1"
                     /db_xref="GeneID:11519722"
     CDS             complement(join(1308213..1308809,1308884..1309201,
                     1309260..1310188,1310260..1312834,1312924..1313226))
                     /locus_tag="THITE_45545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656475.1"
                     /db_xref="GeneID:11519722"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_45545"
                     /translation="MTLGDSMLIAAGTGIAFIGLCSVPALGTVATRLGKRDARQDAYE
                     DADGKASPESLKAYSAALPKSVVLASGAAGLGVSIVLLVISPHAEGLLVDSLSTASWA
                     VAIASSRSSVRAFRLGIYTFFSAIALAGFRLIQGVRIAEPLFHSAPAALALRVAELAS
                     SISLAFSALCIPRRPDVFYQGGLVDRRYTASALGRFTFGWPTALLDLAARKKDLDLAD
                     LTRPDHNTRAASVSADWKTKDKGGRRLWLAIALAHKESLAIQWFLTLCSSVLNFLPQW
                     VILQFLRFLENRRPGSRQNVEAWMWVVWLCIAIIAQSWVESYVWWLSYADLQIPIRAQ
                     LAALVFEKSMRRKDVKGAGKAKKKDPGPESGSAEPAIGGPALASTAPDHSDTDVEKED
                     DSEELKKSKQSTVNLIGVDGKRVAEFCSYQNIFPGSLFKLIISLAFLIDLLGWRALLA
                     GFSAMLAIMPVNIYFSKKYSAAQDRLMKLRDEKMEVVTEALQGIRQIKFSALEPEWEK
                     KINGVRKRELSAVWSVFMNDTMLIACWITSPILLSALSLAVYAALTGSLSPSVAFVSL
                     GVFRALEVTLSIIPELTTDLLDAWVSVKRIEQYLNSPEVEKVAKDSDEVSFDNASIAW
                     PSDEEIDEGDRFVLRNINVTFPKGELSVISGKTGTGKSLMLAAILGEVDVLGGTLYVP
                     RAPPLSERHDDKANKGNWIIPEAIAYVAQIPWIENASIKDNILFGLPFDEERYNKTVE
                     VCALKKDLEMLSDGENTEIGANGINLSGGQKWRVTLARAIYSRAGILVLDDIFSAVDA
                     HVGRHIFEKCLNGELAAGRTRILVTHHVALCEPKTKYLVELGDGGVLHSGLLSELREE
                     GTLQKIKSHEQSAEEIEADELTTAVNSEGASDAEREESDDAEGNTLKKVASRSQVPRK
                     FVEEESREQGAVRKHVYLTYLKDSGGFFFWAFACVVFITVQGFSLGRSWWLRIWTGSY
                     EEQGVHQLQAAGPSSEYSFAYIDSARQNPIHAMSAPLPAIEGTLPFYLGIYVALSVMS
                     CVIGTSRFLYIYLGSIRASRKLFTKMNFTILRTPIRWLDTVPVGRILNRYTADFSVID
                     SQLANSVSFGVNSFLGLMAVVIAGLFVSPYIVLLASVLLLICLYYAIRYLNGARPVKR
                     LESTTKSPVFEQFGSALTGVATIRGFDKAQVYIERMYRKIDDYSTSTWHLWLFNRWMG
                     WRMSLVGSFFSSVVSILILLTPDIDSALAGFALAFALGFSDSIIWTIRLYANVELNMN
                     AAERIIEYTELPTEALDGESPPAAWPTEGRIEVHDLVVGYAPDLPPVLKGLTFSVNRN
                     ERIGVVGRTGAGKSSLTLALFRFLEARSGSIHIDGLDISKIKLHDLRSRLAIIPQDPV
                     LFSGTVRSNLDPFDHHTDAELRDCLERVHLVTNQPSSSTATASGSGSGSGSVTPVDST
                     TPKNANPFADLASPISEGGLNLSQGQRQLLCLARAIVSRPRVMVLDEATSAVDMHTDA
                     LIQRSIREEFTDATLVVIAHRLSTIADFDRVLVLSDGRVAEFGTPRELWEKGEQQGVF
                     RAMCEESGERDKLRAIIFGSQ"
     gene            1315734..1319069
                     /locus_tag="THITE_2121145"
                     /db_xref="GeneID:11519723"
     mRNA            join(1315734..1316052,1316130..1316223,1316293..1316526,
                     1316583..1317687,1317743..1319069)
                     /locus_tag="THITE_2121145"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656428.1"
                     /db_xref="GeneID:11519723"
     CDS             join(1315921..1316052,1316130..1316223,1316293..1316526,
                     1316583..1317687,1317743..1318379)
                     /locus_tag="THITE_2121145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656476.1"
                     /db_xref="GeneID:11519723"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121145"
                     /translation="MKATPLIINWHHDNNHPYPIYSVSLEPAGGKGRLATGAGDNNVR
                     IEENGESHKVEYLATLAKHTQAVNVVRWAPKGEILASAGDDGNVILWVQSETHHPAFG
                     SESLDDKETWRAKHMCRSLGTEIYDLAWSPDASFFIIGSMDNVARIYNAGTGTLVRQI
                     AEHSHYVQGVAWDPLNEYIATQSSDRSVHIYSLRTKDGQYTLNSHDDKPPKIASHAKT
                     DLPPRRISSSSPAPPDIGYRSVLAAVDAVPGVAVGSPVPSAPGTPTSAALPMNPPSVI
                     THSRRSSFSSRRSVSPAPSMPLPAVMPIEASPKPHLNSTSLGMKNASLYANETLTSFF
                     RRLTFTPDGSLLLTPAGQYQTQHQVEGAKPTYEVINTVYIYTRGGINKPPIAHLPGHK
                     KPSVAVRCSPVVYTLRQSPPVTKHITIDSSSAEEAIPSLPEPLSKPSPAPSVMEPPPP
                     PISADTSSSASKSLSLETSVQSTGPKSVFALPYRMVYAVATQDSVLLYDTQQHTPICI
                     VSNLHCATFTDLAWSSDGLTLLISSSDGFCSALSFAPGELGTVYTGDLGPPKHAGAAV
                     SSNQNTPVPTPTSVFAPPSPFPNGSHHRHRDSASSLTAPSPPTTTASFVNARAGSPAR
                     SNSAASSVVAQSCVPQGGVLSNPPLIAGQVPSIAATNSSKVVGIPITTPPETPRSSFT
                     APTGAKRETAEGEADESSGSQPKRRRIAPTLVSEAAPSTGNGRNDDVESKA"
     gene            1319314..1321340
                     /locus_tag="THITE_2121148"
                     /db_xref="GeneID:11519724"
     mRNA            join(1319314..1319438,1319514..1320912,1320971..1321340)
                     /locus_tag="THITE_2121148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656429.1"
                     /db_xref="GeneID:11519724"
     CDS             join(1319401..1319438,1319514..1320912,1320971..1321243)
                     /locus_tag="THITE_2121148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656477.1"
                     /db_xref="GeneID:11519724"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Thite2_2121148"
                     /translation="MFLLEYLQHRRDCRLKQAERASRIESLTAYHGPLTDADKAVLTQ
                     PIEDLVSSVRSGTTTPLSVLRTYGRVALRAHARTNCLTEILLPSAEAWLAGGSGEINL
                     RGPLAGVPVSLKDTVVVGGYDTTVGYSAFVGNRGDRDGPMVRLLKDAGAVPYVKTNLP
                     ITLLSFESTNAVWGRCVNPHNAAYSPGGSTGGEAALLAMGGRIGIGSDVAGSVRVPAH
                     FSGCYSIRCSTGRWPKIGICTSMPGQEGVPSVYSPMARTLGDLVYFTRAVLGEMKPWR
                     YDYTVHPLPWRAEVEKEFGDVGRKLKVGVLRTDGVVDPSPACARALRMAEHALRRQGC
                     EIVEVKGAPDMYEGLRLASLLLNADGCQMFESFRRAGEWNDPGAAQMRRLAGLWAPFR
                     YLYYLWVKYVRRDHIWAGLIRHWRAHSAFENWKLVSQRELYRARWFEWWNEQELDVIL
                     APPNATPAVPHDGMRDAVSSCGYTFLFNLLDYTAGVLPITRVDKTLDRLPASFNVKKL
                     NGVARGAYKHYDAERMHGLPVGVQVVGRRLEEEKVLAVMKRLEDALGDDKYQLLGFDD
                     LDD"
     gene            <1321729..>1322835
                     /locus_tag="THITE_123024"
                     /db_xref="GeneID:11519725"
     mRNA            join(<1321729..1321764,1321852..1321954,1322052..1322195,
                     1322282..>1322835)
                     /locus_tag="THITE_123024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656430.1"
                     /db_xref="GeneID:11519725"
     CDS             join(1321729..1321764,1321852..1321954,1322052..1322195,
                     1322282..1322835)
                     /locus_tag="THITE_123024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656478.1"
                     /db_xref="GeneID:11519725"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_123024"
                     /translation="MAAEQRDNWSSEAYQNAASFVPKLATKVMQWLDPQKDDVILDVG
                     CGDGVLNVEMARVVAQGSGRIHGIDSSPAMIAAAQKAAESAALADRCTFEVLDATALV
                     STPSLQQGKFTKAFSNAALHWILRPERTREDVFRGVREAVAPGGAFVFEMGGLGNVCE
                     VRAALLSAVGRRVGLARAQEADPWFFPDEDWVRQVMEERVGGWKVERAEREWRPTRAD
                     KGGVEGWVRLMAKNWFEILPEAEREECIREVVEVLEIAQRQPSGGHSFNYVRLRVFAR
                     RV"
     gene            1323860..1325822
                     /locus_tag="THITE_2121151"
                     /db_xref="GeneID:11519726"
     mRNA            join(1323860..1324152,1324222..1324731,1324791..1325822)
                     /locus_tag="THITE_2121151"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656431.1"
                     /db_xref="GeneID:11519726"
     CDS             join(1324120..1324152,1324222..1324731,1324791..1325729)
                     /locus_tag="THITE_2121151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656479.1"
                     /db_xref="GeneID:11519726"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="JGIDB:Thite2_2121151"
                     /translation="MSADDQAFLDVLSSLPTDIQKYSRDVADFVDRHVDHIAETLRDA
                     LAKSQWVPEQFRPRPPPPPTIITVPTSALEKIQSWISRHKILVGFIAVTTGVVAYRTY
                     RSSALWRKTRRAKRARSGGRVEVVVIAGSPALPLTRSLSLDLERKGFIVFVVSNSHED
                     EVMVQNLSRPDIRPLSIDITDPPSAGNSIDNFVRYLQSPHAAIPNGKRHHLSLQAVIL
                     IPSLHYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTARLNPTADKERPSPKV
                     LVFTPSIISSINPPFHAPEATVCSALSAFTEVLTAELRPLGIPVTHMQLGTFDFVGFT
                     PAANSRLVQPHGLLPAPEDAEALPWPDSARHAYGRNFVSQSGSAISAGRIRGLRGSSL
                     RELHNAVFDVIDGSITSGTVRVGLGASVYGFVGRWVPRGLVAWMMGIRRVDELATWQG
                     NGSSAFGSPKSAGSDREGVVGSDSFVTVPPLEHAGEANVWKET"
     gene            complement(<1325916..>1326761)
                     /locus_tag="THITE_2057738"
                     /db_xref="GeneID:11519727"
     mRNA            complement(<1325916..>1326761)
                     /locus_tag="THITE_2057738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656432.1"
                     /db_xref="GeneID:11519727"
     CDS             complement(1325916..1326761)
                     /locus_tag="THITE_2057738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656480.1"
                     /db_xref="GeneID:11519727"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2057738"
                     /translation="MATDTLSSSNLDEHRPSYLASQLLAHAAPAYSFSFTPFLQRTYQ
                     HSLPPDRPICKAYLAGNCPLKSRCPDRHATSAATAPGGGGGGGGFGSLVCKHWLRGLC
                     KKGETCEFLHEYNLRKMPECNFFVRNGYCSNGDECLYLHIDPSSRLPPCPHYERGFCP
                     LGPRCDKKHVRRRMCPFYLAGFCPDGRACREGAHPRWVPEGQLEKPKAKEERKEEVGG
                     AGGAMEDRERELQREREREMDRGGRDRERDGERGHDGRHKDRFGGGRGGRWRGKGGRF
                     RARGH"
     gene            1327151..1328594
                     /locus_tag="THITE_2121156"
                     /db_xref="GeneID:11519728"
     mRNA            join(1327151..1327393,1327482..1327617,1327683..1327994,
                     1328056..1328594)
                     /locus_tag="THITE_2121156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656433.1"
                     /db_xref="GeneID:11519728"
     CDS             join(1327361..1327393,1327482..1327617,1327683..1327994,
                     1328056..1328585)
                     /locus_tag="THITE_2121156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656481.1"
                     /db_xref="GeneID:11519728"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2121156"
                     /translation="MRGIQLSQYVKGPHELKVTELPDPKPGPDDYLIEVHAAATNFFD
                     ILQIQGKYQHQPPFPWISGAEFAGVVLATPSGSKNPKFPVGSRVFGATQGAYATRTLA
                     KEVSLLPVPKGWSYTEAAGLFVTAPTSYGALVVRAGVKAGDYVLVHAAAGGVGLAAVQ
                     VAKAFGATVIATAGNKRKLEVAKSFGADHVVDYRDEKWPEIVKKLTPKGRGVDIVYDP
                     VGMVDKSTKCTAWNGRILIVGFAGGSIEKVAMNKVLLKNISLVGIHWGQYAVHERDTV
                     LKVWEGIMKLIADGKFRGTEFTDREFVGLEAVPDALKALGGRETWGKVVVKVPQEGQS
                     RL"
     gene            1329047..1331451
                     /locus_tag="THITE_2121157"
                     /db_xref="GeneID:11519729"
     mRNA            join(1329047..1329296,1329407..1330102,1330170..1331451)
                     /locus_tag="THITE_2121157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656434.1"
                     /db_xref="GeneID:11519729"
     CDS             join(1329245..1329296,1329407..1330102,1330170..1331326)
                     /locus_tag="THITE_2121157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656482.1"
                     /db_xref="GeneID:11519729"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Thite2_2121157"
                     /translation="MAGLSDLPEEILLHILSFLDPREITILQLVSRGFYNLARDDAFW
                     RARCLEESSFLDVLHRRRRLAKQIHQALHGGAATTINGVGSSTDDSDDDGDSPRRTAE
                     SRERERVRIMANWDPCFPSERVSWYGEYIQRHGPVVVNWMQYAYDEDRASPENFIEAR
                     GVALYYPDGELGETVLAVSPLDDGGVCLWDVGGTRGKRGAIVARSRPGILFIDGPEAD
                     NRRRSKRIDSGVTECVSVDSRQHKAFFAVQSHLIEVDLQRLSVVDCESFPWSITALSA
                     ASPSVPLTIGTSLGIHLHDYRSRKPLRNDESDRVDGFERMGAKAFYERSIRHIFDDEP
                     LPPYAPLSQPGPLSILHLQQPGREADLSDDIYVAGRFSNILHYDRRKFPSIRGSIHSG
                     ARLCSMTSLPYPFSTLDSELRRKGELSVEQVEASKSAVGGRTLVACGEYNTKGSLELY
                     GLTSSDSAHTSTPGGLQNCTFKNRQTCSQSKLLSVVNHGTRIAFSDGSGYIKWFERDG
                     FTEVRRCRIGHSERSQGPSIFASMPGSDDMARKLLPTRPAAKAGNGTGGGQATNVDDL
                     LFWTGEKLGLVTFSARPGFTAEDFEQQAEMPDAETLAAQNEYSEMMRRALERQADDVR
                     FVRDLGLPSF"
     gene            1332414..1334414
                     /locus_tag="THITE_2121158"
                     /db_xref="GeneID:11519730"
     mRNA            1332414..1334414
                     /locus_tag="THITE_2121158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656435.1"
                     /db_xref="GeneID:11519730"
     CDS             1332564..1334015
                     /locus_tag="THITE_2121158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656483.1"
                     /db_xref="GeneID:11519730"
                     /db_xref="JGIDB:Thite2_2121158"
                     /translation="MALPVTGGDGYPPFSPLGGPSYLAKRRVAEGVDDDHHRYSRHKR
                     PKYVGPSQFADPVAYKAVDEPSGDPSLGRRYASPRPHCASPEPSGAAAPAMERTASGH
                     SIRPDPVERCASTELLEDQEAAQRVRDHLAAFRRRNPDSKHERILRSIISPRTRPTHR
                     HRRHFSHRGGSPTDRGGDGQEEAESYPLDNAALESIFSAVNEIFFNGRLSQRVTWDWS
                     HSSSTRYDSSVIGTTALRRAAASTRGFETLIVLSSPILRDPRFSRRLLISTFLHELIH
                     SYLFICCGFRARWCGGHTPGFREIAAIMEEWIGEAAGLYLSRVEADLELFRIDAGFPR
                     GPEAGRDGDGGVGGRKDVKAEFETTATVNVYPCSGMAAEQNEDTVATAPIGPGPPEMV
                     YFGGGLVPGPGACVGDRDGLYLGSGGSPSGHEIPPYHDDRWGGSSSLISSSGSGNIWW
                     RQRRANLPVYVYTGDKSPATYVYPNTALQRPWS"
     gene            complement(1334416..1336866)
                     /locus_tag="THITE_2121159"
                     /db_xref="GeneID:11519731"
     mRNA            complement(join(1334416..1336279,1336347..1336866))
                     /locus_tag="THITE_2121159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656436.1"
                     /db_xref="GeneID:11519731"
     CDS             complement(join(1334668..1336279,1336347..1336432))
                     /locus_tag="THITE_2121159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656484.1"
                     /db_xref="GeneID:11519731"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2121159"
                     /translation="MQQSQLDPLPSDLPFRIISKTIGRGAYASIKKAIPLDADSPVFA
                     VKLIHKDYAVRQGRISAKQIAMEVSLHSHIGQHPNIIEWFATGEDAVWRWIAMEFAEG
                     GDLFDKIEADVGVQEDIAHLYFQQLISGVSFMHSKGVAHRDLKPENILLSASGNLKIA
                     DFGMATMFEYKGARKLSSTMCGSPPYIAPEVLQCARQDKKTPDGAKYSSDLVDIWSCG
                     VILFVLLVGNTPWDEPTSESWEFQEYVRTNGRSTDALWGRVPAEALSLLRGMMNIEAN
                     KRFSFAQIRQHPWYTRRNPLLTADGKVSDPIALATQMLAGLRIDLSAEPTPSQRQSQP
                     EAMDVDSQPTPGWSAKLPATQPETPISDALFDWERPARRTLGTYAISATQPLARTDAA
                     AAAHLGYSSALEALADEPTMSQFSQTPGVPLSLTQHARQFRDIVPSYSLTRFFSHVPP
                     ALLVQMLADALHQLNVPQPGRAPAVDPNAEHVATLKVKTLDGRRQGLHGDVLVDRYRL
                     SEEQELLEVRFVKVKGDPLEWRRFFKKVTLLCRDAVYSGDRGGNGGTGNGTGNGNGA"
     gene            1337029..1338600
                     /locus_tag="THITE_127440"
                     /db_xref="GeneID:11519732"
     mRNA            join(1337029..1337121,1337199..1337404,1337490..1337822,
                     1337890..1338600)
                     /locus_tag="THITE_127440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656437.1"
                     /db_xref="GeneID:11519732"
     CDS             join(1337298..1337404,1337490..1337822,1337890..1337992)
                     /locus_tag="THITE_127440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656485.1"
                     /db_xref="GeneID:11519732"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_127440"
                     /translation="MSFMDDNQNSAPSSVQSNKLGGARKAAEPGQNAAKRLQTELMQL
                     MTSPAPGVSAFPSADGNLLSWRATIEGPDDTPYAGLTFKLSFEFPSNYPYAPPTVLFR
                     TPIYHPNVDFSGRICLDILKDKWTAAYNTQTVLLSLQSLLGEPNNSSPLNGEAAELWD
                     KDPALFKTKVMDRHKDIEDD"
     gene            1339734..1341201
                     /locus_tag="THITE_2121166"
                     /db_xref="GeneID:11519733"
     mRNA            join(1339734..1340031,1340088..1340772,1340826..1341201)
                     /locus_tag="THITE_2121166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656438.1"
                     /db_xref="GeneID:11519733"
     CDS             join(1339862..1340031,1340088..1340772,1340826..1341062)
                     /locus_tag="THITE_2121166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656486.1"
                     /db_xref="GeneID:11519733"
                     /db_xref="JGIDB:Thite2_2121166"
                     /translation="MADDAAASPSPQPDLTRNRLPTLFEVLSRRTLPPVDLFSFYIYM
                     RDQQRSVDYLDFWLDVAQHMSLCRHYVRELRRSVLVGTPDPDKSSKRSSGILEALGEM
                     SHPVAGPSMYASEKEKEQDAQMSAFLREDRGDRHDSPAGSARQDRPSPNVSTPREFNT
                     DSNSPPHTVARQDIRASAEKILYTFLLPGAEREIILPGSITQDVTTAIEEFGRDDPEV
                     FDVAKDYVFQAMERDAFPGFLRMKALGNLIPPTLVMRLILGLVSMFGGFWAAFILIFL
                     NETRRVRLWLILPFTIGVYFLASYQYSLDPVLALIGLSEYTPFNFSRVREPYVRKLLA
                     RRAIMVLAVTVLVDAALCVLFIFVPGKRL"
     gene            complement(1341865..1343134)
                     /locus_tag="THITE_2121170"
                     /db_xref="GeneID:11519734"
     mRNA            complement(join(1341865..1341907,1342026..1342683,
                     1342767..1343134))
                     /locus_tag="THITE_2121170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656439.1"
                     /db_xref="GeneID:11519734"
     CDS             complement(join(1341891..1341907,1342026..1342683,
                     1342767..1342799))
                     /locus_tag="THITE_2121170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656487.1"
                     /db_xref="GeneID:11519734"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Thite2_2121170"
                     /translation="MEQTRALNALEPFLALSKSATSPRAAADLIVRATSAPNTYIFTE
                     LLQTPQVQALASSPEFAPFLTLLQIFSHGTYSSYTSTPGLPELNEAQRLKLRQLSLLT
                     LAKKDSRTSTASSPALDYASLQKALDLPSRQALEELVISAVYAGLLKAQLNPKASVVQ
                     INSVSPLRDVAPSDISDLLASLQAWAGRCDATLESLSAQMNQVRAEADRRAARAAARA
                     EETHKLMEKEQKAPQIR"
     gene            1344485..1348417
                     /locus_tag="THITE_2121173"
                     /db_xref="GeneID:11519735"
     mRNA            join(1344485..1344817,1344876..1348417)
                     /locus_tag="THITE_2121173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656440.1"
                     /db_xref="GeneID:11519735"
     CDS             join(1344720..1344817,1344876..1348281)
                     /locus_tag="THITE_2121173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656488.1"
                     /db_xref="GeneID:11519735"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Thite2_2121173"
                     /translation="MAPSITIPSKDGASLAAPAAHMATTTLKVEGMTCGACTSAVEAG
                     FKGIDGVGSVSVSLVMERAVVMHDPQRISADRIREIIEDRGFDAEVLSTDLPSPMAPR
                     ASFGAFPTDDAPATLVTTVAITGMTCGACTSAVEGGFKDVAGVKHFSISLLSERAVIE
                     HDPALLTAETICEIIEDRGFGAEVVESNEKAPATKMAPEGLRPVSTATTTVAIEGMTC
                     GACTSAVEEGFKNVDGVLRFNISLLAERAVITHDPTKLPADKIAEIIEDRGFDAKILS
                     TTFDSVDHASGTSTAQFKVYGALDAAASKALEEKLTALPGVKSARLALATSRLTVVHM
                     PSVTGLRAIVETVESTGLNALVADNDDNSAQIESLAKTREINEWRRAFKISVAFAIPV
                     FLTSMVLPMCVPALDFGAIRILPGLYLGDLLCFVLTIPVQFGIGRRFYKSAWKSIKHG
                     SPTMDVLVVLGTSCAFFFSVLAMLVSVLFPPHSRPSTIFDTSTMLISFITLGRFMENR
                     AKGQTSKALSRLMSLAPSMATIYADPIAAEKAAEGWNTGAGVEDPKQPVGGNAAEEKV
                     IPTELIQVGDIVILRPGDKIPADGVLVRGETYVDESMVTGEAMPVQKTKGSIMIGGTV
                     NGHGRVDFRVTRAGRDTQLSQIVKLVQDAQTNRAPIQRLADVLAGYFVPTILVLGLLT
                     FLVWMVLSHVLPHPPKIFLQEASGGKIMVCVKLCISVIVFACPCALGLATPTAVMVGT
                     GVGAENGILVKGGAALETTTKITQVVLDKTGTITYGKMSVAKANLASPWADTDWRRRL
                     WWAIVGLAEMGSEHPIGKAVLGAAKTELGLGSEATIEGSIGDFSAAVGKGIGAYVEPA
                     TANERARYRVLIGNVQFLQESNISVPQSAIEASERANTARPTKSNAGTTNIFIAIDGV
                     YAGHLCLSDTIKEGAAAAIAVLHRMGVKTAMVTGDQRGTALAVASAVGIGAEDVYAGV
                     SPDEKQAVIRQLQEAGSVVAMVGDGINDSPALATADVGIAMSSGTDVAMEAADVVLMR
                     PNNLMDIPAALHLARTIFRRIKMNLAWACLYNAIGLPFAMGVFLPLGWHMHPMMAGAA
                     MAASSVSVVVSSLCLKFWKRPRWMDEAEAAEKGGVVRKGDGWGWMGGLRQAIGGLFGG
                     RSKKAEGYVPLATLDRGEFVV"
     gene            complement(1348898..1349755)
                     /locus_tag="THITE_2121174"
                     /db_xref="GeneID:11519736"
     mRNA            complement(join(1348898..1349189,1349279..1349755))
                     /locus_tag="THITE_2121174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656441.1"
                     /db_xref="GeneID:11519736"
     CDS             complement(join(1349085..1349189,1349279..1349551))
                     /locus_tag="THITE_2121174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656489.1"
                     /db_xref="GeneID:11519736"
                     /db_xref="JGIDB:Thite2_2121174"
                     /translation="MAEDRQPADIVEGATTGDVEDEVQPTAKSAEDRKAAAALSKLDA
                     HGDDETAPAREVDQEAVKNAMSALGDGAVKKEVKKAVKVDAADVNLLVDELELPKAKA
                     TELLKAHDGDAVKAMRAYLQPDF"
     gene            1350029..1351817
                     /locus_tag="THITE_2121177"
                     /db_xref="GeneID:11519737"
     mRNA            join(1350029..1350727,1350802..1351817)
                     /locus_tag="THITE_2121177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656442.1"
                     /db_xref="GeneID:11519737"
     CDS             join(1350231..1350727,1350802..1351726)
                     /locus_tag="THITE_2121177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656490.1"
                     /db_xref="GeneID:11519737"
                     /db_xref="InterPro:IPR002480"
                     /db_xref="JGIDB:Thite2_2121177"
                     /translation="MSEESSLPATNGHAPEWTPDSWRSKPIKQCPEYPDQAGLAKAVS
                     ALKRLPPIVHPREIIQLKQHLRDVAQGKAFVLQGGDCAELFDYCEQNAIESKIKLLLQ
                     MSLVLIWGANKRVVRIGRMAGQYAKPRSSPMETINGRQLPSFRGDILNGFHPDERDLD
                     PNRLVRAYHHSSATLNYVRAAISSGIADISRPLDWGLGHVRDPVLKAKYQKAVDFLKD
                     MRSFMHTIGAENEKFHTVDLFTSHEGLLLEYEESLTRLLDDPTSPPSQPHKAYYDTSA
                     HFLWIGDRTRQLDHAHVEFFRGVANPLGVKVGPTTPASDLLALLRTLNPAREPGKITL
                     ITRYGADKVGALLPAHIRAVEDSEYARTVVWQCDPMHGNTQSVNGGIKTRRFSDIFSE
                     LQQTLRIHKEQGSYLGGVHLELTGDAVTECLGGSEGLDEDDLSTNYTSFCDPRLNEKQ
                     ALELAFLIADHYRSERRDEDESA"
     gene            complement(1351831..1353515)
                     /locus_tag="THITE_127436"
                     /db_xref="GeneID:11519738"
     mRNA            complement(join(1351831..1352497,1352646..1352978,
                     1353071..1353515))
                     /locus_tag="THITE_127436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656443.1"
                     /db_xref="GeneID:11519738"
     CDS             complement(join(1352111..1352497,1352646..1352978,
                     1353071..1353334))
                     /locus_tag="THITE_127436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656491.1"
                     /db_xref="GeneID:11519738"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Thite2_127436"
                     /translation="MVERANKPKPPTLSSTPGLPPQATVTFSDDNSRVIAELPTGESV
                     TVLLYGATVISWKDAQGDEKLWLSEAAKLDGSRAVRGGIPVVFPVFGTAPTHPQTKDL
                     PQHGFARTSRWEFLGKSTSESQTGSAANGPAVKLDFGLSSAAPGLDPIAAARWPFKFN
                     LIYSVTLTQTSLTTSIVVTNDDSAPFDCQVLMHTYLRVKDITAVQVQGLADASYIDKV
                     DGGARKTQSAAEVTITGETDRVYTPAGDPGAGPVTVVEAGRPVYAVTRDNLSNVVVWN
                     PWADKAQGIADFAPKDGFRNMICIEPGAVGAWQSLEAGDAFEGAQTITLLG"
     gene            complement(1353975..1360046)
                     /locus_tag="THITE_2121179"
                     /db_xref="GeneID:11519739"
     mRNA            complement(join(1353975..1356727,1356777..1360046))
                     /locus_tag="THITE_2121179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656444.1"
                     /db_xref="GeneID:11519739"
     CDS             complement(join(1354364..1356727,1356777..1359731))
                     /locus_tag="THITE_2121179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656492.1"
                     /db_xref="GeneID:11519739"
                     /db_xref="JGIDB:Thite2_2121179"
                     /translation="MSSPAVLSSLLSCLPPRPPTPPREADHDATAPVKPTLGSGDSRL
                     SLHTPPGFQSPASSSATDSASRRIRKKVGFSVQAEYKDPPVYTDGVTQHPTPVSLPRS
                     ASKPVKSILKATNQVPNLLEPATANDCDPSDFQLNLGAMLESTVQQLAGGDRESKLDA
                     YLMLTRAWKASNNLPDRVALQEKMGLFTQFMQRDVVARTSEGNLDTSLVNHALNLLNT
                     FLHFPAIASTISNDFGVFIIDHCIRSFEDVSTPKDTARRLMQVISLQNFSPKVMSSDR
                     VARLVSSLHNIEEHLKGKSIVLSRIFVYRKLVQQSRQPMIAHSDWLLDLFTDMLSNLR
                     DIRSAAISLGLEAAFSIGHEKQLSRKVMEILNLAYEDRRYIQYYEERLRAMAKDKHES
                     AVVPEIWSVVILLLRVRLDKWEYAGPWLHIIQNCFNSVDFPTKIAANRAWGRLTYLMH
                     LEEPVSPKDLATLTRPFISQLRRKSSGKPLEEELRQAVLGGICNLFYYAFKPNTNSTL
                     LETYWDTSVKPVLSKLLDRTAESAEDNRHQATAILTGLFDCLTPRRWRVDHIVETALV
                     KPAELPAIDPKWIRRNAGRVFAAIEPILEQDFLAMARTDTTTFALWRTLVSAVASAAA
                     KEIKVSKDTALFVTEALNLLQRIWERGLPNQDGAEPSVLEFLLAVQAYLKAMISSLGL
                     PPFTEKSGKHQAPAKAPLHTLFSMLSTLPPGVPDDKEFAEFFGLVFAPFFTSKGDRAR
                     MDLAQDLLSGIPMDIPLPYGTWLLVAENILCWLEPIQNSHHSSGSGGETPVGHDYRDI
                     VKVLERGIRSTPNLPPKHWESLFFAAFKRAREETGDAGVAMVMIEPLAKVLVDQPATG
                     GTNDKQLNRARYVTELIAIATQPRERQAVDAARKHLWGTVFAGSRSSSFDTFDSLYKV
                     VNEVLEDLYTNFGPTNAEQSARLLRELGGFFDRCNRQLFLKAMAALQDGFLPWFQDSQ
                     RLLGSQSSAVLASTKSLWDKLSHLISEVEHPERHLQCLGPFFRASFASCHRAIVNASI
                     SLWNRLFENVGHIDYPEDLKAALVQLQLHADIILPGLETSSVECAGQQQSFVDSDDDF
                     SLPRYPSTRSSSRRGTPRPDSSRSKSPKPPASLKLAMKPTSASPQRIPVSRNRQNTPR
                     RFRHDDSQLHFAAIEPSSVFGNPVESQVLTERQQEVRERQRQNAALFPAMRSSPGVTP
                     KEADWQMMRLSGSRMRQATTPEPEKAFDDYVSSTPTPRRGQALVMPEHDLTDPPSSPP
                     ELRGNPLAAEIRSRSASHSLLEEWQFSSSPVSGSPNANRHAVIPDPSSQRGYVSVVSL
                     PEVVDATDSPENATGVYDGAEPESPADEIVEDSMVLDPLNGVAVPEPSGNSAEEDPST
                     PRRSARLSQSRAPRETPTPKSDGEVFVDAPSSPLPPTPRRPERASNGAEAPDANRIPV
                     VPTGDTSFDLSDIDDTSFLKLVVELDSGKSDRSDYHRTSPSVSPDGKGRDSPIADCIV
                     VGDSPEKAELPALSRSTRGCSTRSPSILPENVASSQSKSRVGRRKRKRASSKSSENSP
                     KRHRHEHGSVAGSVKASDIEPTPTQNSDVEVHGSGEAPEVILGCAEADSIVHEERIPS
                     SSAEHESSGSASDGDSWQGFTVSDTRDAMEVEADDQDVQCQIALEFSHSQHQEEDSTP
                     ASAEDCPKPASAEQPMHASVQQPLTEEEEVQNMIPTTNTTGSVAMVDQAETAAPKPVE
                     KIMNLFRSGLDELRTARLSRQEVYQIEDMFMDMKRELYEAERRGRA"
     gene            1360662..1362889
                     /locus_tag="THITE_2121182"
                     /db_xref="GeneID:11519740"
     mRNA            join(1360662..1360922,1360979..1361053,1361109..1361185,
                     1361241..1362436,1362512..1362889)
                     /locus_tag="THITE_2121182"
                     /product="guanine nucleotide exchange factor
                     synembryn-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656445.1"
                     /db_xref="GeneID:11519740"
     CDS             join(1360892..1360922,1360979..1361053,1361109..1361185,
                     1361241..1362436,1362512..1362623)
                     /locus_tag="THITE_2121182"
                     /note="Contains conserved domain Ric8[pfam10165], Guanine
                     nucleotide exchange factor synembryn. 1| guanine
                     nucleotide exchange factor synembryn [Glomerella
                     graminicola M1. 001]. Contains conserved domain
                     Ric8[pfam10165], Guanine nucleotide exchange factor
                     synembryn"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor
                     synembryn-like protein"
                     /protein_id="XP_003656493.1"
                     /db_xref="GeneID:11519740"
                     /db_xref="JGIDB:Thite2_2121182"
                     /translation="MLSFGSLSGPDKLGAVRRLLDKLTEDLKSATLSLQERDAALEEL
                     KVYGRDPSFADPIFTKDGIETLTKHAFESTSDSTSLNALRVLCNSLFLKSETRQIFVD
                     LGYEPKACERLKNDSRDYEFLISRLILLTTYGTTINLPDLIEKHGLAAAIAQNLSRHA
                     ARVSAQSVAATTTDPMEEMALAETLKLLFNVTNFAKDHVSFFDLALKHIATILCNHAL
                     LQTTKTPLDPPFGLLINALLNLDLTTPTAQSALYPAAEPARIAGRLIQLLDLSMKAYT
                     DSELDQAVSPLMCVLSAVYKHAPVASPGKGSGDGDGDARGFIRSKLLPTEEDRKSVLG
                     KADTLPSRLLRNWSNPLAPQFRSAVAHLYFDMSDKNAAQFIENVGYGYASGFLFENHI
                     PVPEEAMGQDGKASSSSGGGSGGDRGPKRPVNPITGQFLDEERVVDLPEMTAEEKERE
                     AERLFVLFERLKETGVMSVQNPVEKAVQEGRFEELPDDDDLAEDLD"
     gene            1363453..1364810
                     /locus_tag="THITE_2121185"
                     /db_xref="GeneID:11519741"
     mRNA            join(1363453..1363735,1363975..1364443,1364497..1364810)
                     /locus_tag="THITE_2121185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656446.1"
                     /db_xref="GeneID:11519741"
     CDS             join(1363665..1363735,1363975..1364443,1364497..1364760)
                     /locus_tag="THITE_2121185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656494.1"
                     /db_xref="GeneID:11519741"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="JGIDB:Thite2_2121185"
                     /translation="MPFGEDILDGDLSPPLVQSDLIGGSVEPESPVGQGSAPGRGLTV
                     VTLDDQAGMNGSAAPAPEAELDIDAKDEAEVTSTAPAPPSTIKKRGRPSLSGPATPAK
                     SVSSKTPTSTNSAAAPKSAGRSTGKRKAAESEPELKEAETTPARKRGRPARSAGSSAS
                     ARLAAKAANKPTRGRPKSAAQPAPKPAKKSGRAKKVTTNDEVPAGEYEVEEIVDSAID
                     ADTLEHMYLVKWYVKSELFFFQRWFRVPFSCSPESSFAPGLLAMSRFME"
     gene            1365712..1367246
                     /locus_tag="THITE_2171226"
                     /db_xref="GeneID:11519742"
     mRNA            join(1365712..1366387,1366467..1367246)
                     /locus_tag="THITE_2171226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656447.1"
                     /db_xref="GeneID:11519742"
     CDS             join(1365791..1366387,1366467..1366724)
                     /locus_tag="THITE_2171226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656495.1"
                     /db_xref="GeneID:11519742"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Thite2_2171226"
                     /translation="MDALRSAIQPITNNLPGPIRDLGVSIIGDKCYKALLLDVDLDNA
                     DCLKLAISKGLGIGIVGASSIVKVPQIIKLVQSQSASGVSFLSYLLETSSYLISLAYN
                     VRNAFPFSTYGETALVLGQNVIITILVLNYSGRPSMAAMFVAALGISVVTLFSESMLE
                     MQKLRYLQAGAGALSVASKVPQILAIWQEGGTGQLSAFAVFNYLLGSLTRIFTTLQEV
                     NDKLILYGFIAAFALNLVLALQMLYYWNAPSTKAKGKQKEDPVQGTDSATTTATPKSK
                     APTTRRRG"
     gene            1367926..1370420
                     /locus_tag="THITE_2121196"
                     /db_xref="GeneID:11519743"
     mRNA            join(1367926..1368534,1368587..1368761,1368923..1369257,
                     1369332..1369898,1369969..1370420)
                     /locus_tag="THITE_2121196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656448.1"
                     /db_xref="GeneID:11519743"
     CDS             join(1368044..1368534,1368587..1368761,1368923..1369257,
                     1369332..1369898,1369969..1370095)
                     /locus_tag="THITE_2121196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656496.1"
                     /db_xref="GeneID:11519743"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="JGIDB:Thite2_2121196"
                     /translation="MPPDLNSLPASPLPRKTVNLTRNGTSTAGRASGEKQPNILYIMA
                     DQLAAPLLKMYNPDSQILTPNLDALAARSVQFDSAYCPSPLCAPSRMSMITGLLPMKI
                     GAFDNAAQISSDIPTYAHYLRLRGYHTVLAGKMHFVGDQLHGYETRLTSDIYPGDFGW
                     VVNWDEPDTRLEWYHNASSILQAGVCVRSNQLDYDEEVMYRSTQFLYDHVREGPDARP
                     FCLTVSLTHPHDPYTIEQKYWDLYEGVDIELPKVKIPKEEQDPHSKRLLKVCDLWDTE
                     FSDEQIKRARRAYYGAVSYVDDCVGKLLNVLKQCRLRENTIIIFSGDHGDMLGERGLW
                     YKMNYFESSARVPLLVSYPARFTPHRVSSNVSTLDILPTMCDLVGTKPAPYLPMDGVS
                     LLPHLEGRSGEGHDEVFAEYTGEGTVSPLMMIRRGKWKYITCPADGSQLYDMEADPLE
                     LDDLVKSGAAARDEKIKRVFDAFEQEAREKWDFEDITRQVLLSQRKRRLVWSALTKGR
                     FTSWDFNPEDDGREKYIRSHIPLDDLERRARFPPVDEFGRETGAAIVADQAGSHGE"
     gene            1370425..1371602
                     /locus_tag="THITE_2121199"
                     /db_xref="GeneID:11519744"
     mRNA            join(1370425..1370722,1370781..1371602)
                     /locus_tag="THITE_2121199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656449.1"
                     /db_xref="GeneID:11519744"
     CDS             join(1370592..1370722,1370781..1371471)
                     /locus_tag="THITE_2121199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656497.1"
                     /db_xref="GeneID:11519744"
                     /db_xref="JGIDB:Thite2_2121199"
                     /translation="MASLNMAPEELKQLELLRNRYAQLTSSLASLRAGIINSNPLPSR
                     ESLQASATILQQNIRTLQELATENADLFQRTAVHPSTNFPGRTQEHVLLQLVRKKLEP
                     DVESWVEEARETAAAAGVDATKLATGVPTRREHDYDEDIYGMDQDEDVSSDPFTDQWA
                     DMHDAFQETLQHYVTVQVKKKYTIEEQAMGIENVRTGLRQNLEESDEEEDEEEEEEEE
                     DEAAGAAEHARDAGSGAGGPGAAGGKPTLEPEHLFWLAARGDLDIPRNIPFVSQR"
     gene            1372408..1374094
                     /locus_tag="THITE_2121201"
                     /db_xref="GeneID:11519745"
     mRNA            join(1372408..1372596,1372697..1373091,1373188..1373220,
                     1373287..1373332,1373393..1373607,1373674..1373689,
                     1373823..1374094)
                     /locus_tag="THITE_2121201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656450.1"
                     /db_xref="GeneID:11519745"
     CDS             join(1372916..1373091,1373188..1373220,1373287..1373332,
                     1373393..1373607,1373674..1373689,1373823..1373924)
                     /locus_tag="THITE_2121201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656498.1"
                     /db_xref="GeneID:11519745"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Thite2_2121201"
                     /translation="MNATCQCGSVSFKTPTPKPLALYICHCQDCQRQTSSAFGTSAIF
                     PRFPLPDAELLSCYKRPTSTGETLYCYFCKQCGTRLIHTTPTKNVGACPTETPSLLQC
                     SRPPRSCVVSCPNSGVIVPYLYTLQHQLGMAHSLLVSVKAGCIEGLDWKTAIHIWTKS
                     AMVPIPEGCESYTESPGPTEYSDSQEVLDQPTSLI"
     gene            1375705..1377181
                     /locus_tag="THITE_2121208"
                     /db_xref="GeneID:11519746"
     mRNA            join(1375705..1375869,1375925..1377181)
                     /locus_tag="THITE_2121208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656451.1"
                     /db_xref="GeneID:11519746"
     CDS             join(1375813..1375869,1375925..1376992)
                     /locus_tag="THITE_2121208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656499.1"
                     /db_xref="GeneID:11519746"
                     /db_xref="JGIDB:Thite2_2121208"
                     /translation="MRIYVPSLVVFLGALSLAQAAAYERREGGSPRPNLASEILSMLS
                     RLGGAQTVTQTLRQTITVGAAGAVGAGTNATGAITVTVTAPASTVTVCPPGQAQGAVV
                     SSQSTGLTSAAPAGGAGATTAPAVAAHGGVGVTTIPVPTDARKTSLVGTKTVALQPAV
                     SQPAVSQPAVSQPTSSSSSASAATSLAANPYAGSSTVTSAVSSLAPLPSQGGATQPGL
                     SQSATSLAALPSLQTTSQSVMSLAALPSLQTTTGSASPTTLPIVGAPVSEGSTGTSAS
                     TLAPLPGLASSLSTLSLPPVATVNPSAASPVAAPAGAFGGSAGMIQISSAAAAVPPSA
                     TTPAVANGAGAGPTINVSGLTLSSQLNLGKLASPTASASA"
     gene            complement(1377181..1378746)
                     /locus_tag="THITE_2121210"
                     /db_xref="GeneID:11519747"
     mRNA            complement(1377181..1378746)
                     /locus_tag="THITE_2121210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656452.1"
                     /db_xref="GeneID:11519747"
     CDS             complement(1377370..1378473)
                     /locus_tag="THITE_2121210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656500.1"
                     /db_xref="GeneID:11519747"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="JGIDB:Thite2_2121210"
                     /translation="MLYDLNIAWSPGTPAAELERTLRFAKTLGYDVVALNHIISGPIP
                     TLPNPITNPIPQLTPPHPSYPGGSTTTRTTTAPPKTQSGTTTNLSTTAASALPATSRS
                     RSAPALPTTLRRATLVITDPATTNYRLPDFARAYDLLALRPTSDKSFSWACLATADPP
                     ALVSLDLAAHLGWHIHHRTAMAAVQRGVRFEICYAQALGGGGGGVDAARQRANFIGNV
                     QALVRATKGRGIVLSSEARGALGLRGPADVVNLMAVWGLGPEKGFAALGEGPRAVVVN
                     EGIRRRGFRGVVDIVRPAEGGDVEARKGAGQGDEEGGNKGKKQKKQQQQLEQGCKRKN
                     GDGGDGGGQQGEMSKRQAKKMRKEAAQRRPEGA"
     gene            1379277..1380301
                     /locus_tag="THITE_108939"
                     /db_xref="GeneID:11519748"
     mRNA            join(1379277..1379480,1379570..1380301)
                     /locus_tag="THITE_108939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656453.1"
                     /db_xref="GeneID:11519748"
     CDS             join(1379337..1379480,1379570..1379773)
                     /locus_tag="THITE_108939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656501.1"
                     /db_xref="GeneID:11519748"
                     /db_xref="JGIDB:Thite2_108939"
                     /translation="MCLVFTCGEHTFRREVEGYEGLVCQCHNCGNYSASVIRSHPWFT
                     FCFVPVIPFSIRGYEDVACRICHFEQPLAHRPDVQALRGQGGHGMPMQPPGPPQGWGP
                     QGTPKPNQPMRYG"
     gene            1380658..1383014
                     /locus_tag="THITE_2121211"
                     /db_xref="GeneID:11519749"
     mRNA            join(1380658..1380808,1380865..1382215,1382319..1383014)
                     /locus_tag="THITE_2121211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656454.1"
                     /db_xref="GeneID:11519749"
     CDS             join(1380776..1380808,1380865..1382215,1382319..1382824)
                     /locus_tag="THITE_2121211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656502.1"
                     /db_xref="GeneID:11519749"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="JGIDB:Thite2_2121211"
                     /translation="MSSTKRSPSVLMTDSREPAPARGAPQRGLATPVRPSTRLISVDN
                     VLQNSSDIPSGQPRVPLGSRPTRATAKRRTSQGGGLPTLASTRTGQQIVPSRTTKVSQ
                     KLVLLPEAPGDRDEEGESDDELAQRASLMRDDDETRPLKDEELDVLRKRGGIRGKSYA
                     ERLPKVQRGEKVARLTAYCTAQAYKMQATAEFLRTKHDAKTKLYDDCLYTVYHLPLLP
                     GIDGYRLRSRPVLKTPGTGKTVLDLEIERSERRDEHEGFGDEYSYFTQGLATRPITAP
                     LLQPVGRDPSALPQTDGSYETEHLTVSPINRLVPDAKHFGEMFVFSYGVVVFWNFTEH
                     QEKDLLADLTFAENETGVPLVTGALDETDFETEEFHFEYSDDIKRPRVFNDMITLLRR
                     SDHMVKLTISHAIAQSTKLCFFEERMSETMLDVQHVPKRLALTGDLNMKRADILKILG
                     RLFKSRVDINVSSNVLDVPNFFWDSEPTLHPLYVAIREYLEIDPRIKVLNERCRVFLD
                     LADILADSVADAKMSNITWIIIALIVVSIVVTMSEVLLRFGMLSKGKSAHGGLGNVIG
                     GGDRDGNGESGGDGGGKAGLDLRWLRESNISLEELRLWSRALSEREKAAVCGQEFVGR
                     TFAGV"
     gene            complement(1383125..1387197)
                     /locus_tag="THITE_2121214"
                     /db_xref="GeneID:11519750"
     mRNA            complement(join(1383125..1383972,1384027..1387197))
                     /locus_tag="THITE_2121214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656455.1"
                     /db_xref="GeneID:11519750"
     CDS             complement(join(1383333..1383972,1384027..1386965))
                     /locus_tag="THITE_2121214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656503.1"
                     /db_xref="GeneID:11519750"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Thite2_2121214"
                     /translation="MDAHSPPKRMTRARAAAATSESAAKSTRAVTTTAKARTTRSSST
                     NDVARTAIKRKSPADEDEEDRELAPAKKMPTGDAKPTRGRGRPKKVAFEQAPAEPAPE
                     PAPATTVRTRGRPKKTVDPVADEPVSSKRTTRNKKSERAAGEEMGPAAEPIKNSTRGR
                     PAISTSATKTETQSLSKPAIKKTVKFEEPEKENMVPATKTAPTTGTAAGLRGKPVRKA
                     ASATAARSSRSTRAAASTAEPTEKEEKPAPLSPKKVNQLVLNLRVESDDELGMDEKVP
                     VKRLKKLPIKPALGATKPPSRAKTAAPCVENDENAASVARPETEAGNMLASPAKRLPP
                     SPWKGSIKKSPARRVEGLLTTTALQLDSQDTGAPTKTGLLLSPAKRQPLNLNPPGADG
                     INGTGASPVKLSLLSSPAKRPISPAKPLSKTIGEKERMNQSPAAEPTLLATPLAPGVS
                     GIFEERRSEENALDRQPIGDIVPESPKGLGFPGRLSAVLPRHADPTLTPPMLALPEEA
                     AQHEVQDGAVEQVAEQSANVMSSGEPMALDREQTEGPAAQSASTTPPSSPPKAPNPMF
                     ELREQVLNPYDNGLDLESDDESPAGQNRFTSAFTALPTTPCAAHTISPNDVTRSAGGS
                     AAIRFQSDSKFGFTPLAQQLSRWTAAPSPIKAEIPSAPVSGRETEASSTLMEPAQSTF
                     FEDEMHARPEATELDEEASTDLEDDGEPILEDVSFTEEDAALAAEANDMSLLEREQNN
                     GDALDPDDSRSHTSEQYGDENEFPVEPPVSVSNVANALSVPPVTPQRIVHREFYTVTK
                     VPLKAADNSTPQPQVEKRSYSASRLPPVRPTERLTRDAAIIACSPSKRGDGNPFEEPS
                     KQEAESLLPVTPEKSDVWSTIGTPARTPRRDVNPALLRGAVVFVDVHTSEGADASGLF
                     VELLTQMGARCVKSWSWNPNNSSEQGGDPRVGITHVVYKDGGKRTLEKVRASRGLVQC
                     VGVSWVLDCERENEWLDEGPYSVDTTVMPRGGARRRKSMEPRAIANLDGILVPSSAGN
                     SSRGSRTAPSTPANNRRASALWIRSPEVCLDDNENNDIAEDNDEHGGAKWAAPLTPVP
                     KTPAPETIARIAANLSPGSTSPSSVGSVDSEDPLARNDDSRRHQEMLTRTCPPKRTAF
                     VELGEGILSREKDERVLMRLMAARRKSLQFAPKVGSPLAKSWKASN"
     gene            <1387618..>1389078
                     /locus_tag="THITE_2057447"
                     /db_xref="GeneID:11519751"
     mRNA            <1387618..>1389078
                     /locus_tag="THITE_2057447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656456.1"
                     /db_xref="GeneID:11519751"
     CDS             1387618..1389078
                     /locus_tag="THITE_2057447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656504.1"
                     /db_xref="GeneID:11519751"
                     /db_xref="JGIDB:Thite2_2057447"
                     /translation="MSIDLNWETVTGGPDGQELACKIRDFIHTKFQSVPLPRFIKSVT
                     VHDFQFGTIPPEIELKDITDPLPDFYEDHVDSDLASDSEGEDNLADSRVLDERRRRQA
                     ESDVLVSGARHVSHLPPHLSLGGPGGGNSRNGDTGSPFMRVSTPGIPGGTSNLHYFHS
                     HLASGLSGTQTPLAAVASAHHLNTANWLEGHGHSSSVPNLHHYAANYLGTTDGQARQN
                     YPQPSHSRNPSQSSISIADYSPTGHLAPPASSAVHGLPSLREKHSVSTLAPTSAGASR
                     PPTRDAAATLMGSAVAEDSDSHSSPTGSSVADSSPQAQDQQENQPRLRERRLEDMQAV
                     FRIRYAGDVKLLLTADILLDYPMPSFVGIPVRLSITGLTFDGVGVLAKIRKRVHFCFL
                     SPEDAVAAVGDENTEADGADGHGQGSQRGPAGEPGSTKLGGLLQEIRVESEIGQRESG
                     KQSLKNVGKVERFVLEQVRRIFEEELVYPSFWTFLV"
     gene            complement(1389115..1390096)
                     /locus_tag="THITE_2121216"
                     /db_xref="GeneID:11519752"
     mRNA            complement(join(1389115..1389541,1389609..1389845,
                     1389908..1390096))
                     /locus_tag="THITE_2121216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656457.1"
                     /db_xref="GeneID:11519752"
     CDS             complement(join(1389152..1389541,1389609..1389845,
                     1389908..1389991))
                     /locus_tag="THITE_2121216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656505.1"
                     /db_xref="GeneID:11519752"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="JGIDB:Thite2_2121216"
                     /translation="MIPRQPYAPTPHSYVPNSTLSATINLDEEVKLAETRAERDLQDS
                     LAEIFSIIVTIDELEKAFLKDAIPEADYTEICERALKQYKSLIADETVAKAFVGLEEF
                     KAEWDLEVPRATERIRVGMPSTAVTASAGPAAAPAATGSTSGALILEATQDFITFLDA
                     LRLGLLAKDQLHPLLTDVIQSVNKVTDRDFENRGKIVQWLITLNQMKATEELSEEQAR
                     ELELDINSAYQGFKNTLT"
     gene            1390204..1392806
                     /locus_tag="THITE_2121217"
                     /db_xref="GeneID:11519753"
     mRNA            1390204..1392806
                     /locus_tag="THITE_2121217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656458.1"
                     /db_xref="GeneID:11519753"
     CDS             1390314..1392722
                     /locus_tag="THITE_2121217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656506.1"
                     /db_xref="GeneID:11519753"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="JGIDB:Thite2_2121217"
                     /translation="MTASKKNLKATKKFEKKHLKGVLERRKAAAKIKQRQRLKEKKKA
                     KRAQDEEFYKGPGADASDDKRAARKNKVGAKASEMSVDDFFKGGFEILGTEASSKSKE
                     KRQSAAKLGKRKRGEADARADSPEGSGSESEISDNEEVAVSDSESDGGEGSDDEDLGM
                     SKSAMDALAEKDPEFYKFLKENDPEALDFDENADLAEIDELSGSDGESEQPKKKQKKE
                     QKATKAQAKDDRELTQAMVARWKAAMAETHSLRAARQVAIAFRCAAHLNESDEEHPQR
                     YNITSPEVFHDIVVAALKGIPEVLQHHVPVKESAAGRAYVQTEGKKFKTLSMLIKSFT
                     TSVIRLLSTLSDDATLKLTLSALQPLVPYLLSFRKILKMLIKTVVAFWSQSASTESTR
                     ITAFLVIRRLMVIGDKAVREVVLKAAYQGLVQGSRLTNANTIQGINLMKNSAAELWGL
                     DQNLGYTTAFTSIRQLAIHLRNSIVHNKNDSYRAVYNWQYVHSLDFWSCVLSEHCSPL
                     KEAEAGKESPLKPLIYPLVQVTLGAMRLIPTALYFPLRFQLIRSLLRLSRATDTYIPL
                     VSALLEVLNSAEMRKPPKPSTLKALDFSTAYKAPKSYLRTRVYQDGVGEQVVELFAEF
                     FVLWCRSIAFPEFSLPAVVSLKRWLKESRKPGKGNKNGKLASSLGLLVQKLEANARFI
                     EEKRAKVDFAPKDRAQVDAFLKDLEWERTPLGAYVVSQRKLRAERLRVLEESRKEEER
                     KRKEEERKALEDGEGSESGDGQEDDAEVDGTVSEDDEESEEEEEDEDEDEEEEEEEGE
                     DEDE"
     gene            complement(1392806..1395738)
                     /locus_tag="THITE_2121218"
                     /db_xref="GeneID:11519754"
     mRNA            complement(join(1392806..1394413,1394465..1394509,
                     1394637..1395738))
                     /locus_tag="THITE_2121218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656459.1"
                     /db_xref="GeneID:11519754"
     CDS             complement(join(1392890..1394413,1394465..1394509,
                     1394637..1395635))
                     /locus_tag="THITE_2121218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656507.1"
                     /db_xref="GeneID:11519754"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="JGIDB:Thite2_2121218"
                     /translation="MAPLASEPRQVLTVLNPARRKALYTLLVEITAFMRSQIEFHEST
                     GNSGSAPLLIDPSAENSIIIPGEAAAADSTPPSPALVRLRTAAIEHFDAWRKDVLAKL
                     KELLSTPDDAAVVEERRKRAERVTQQQQRQQGTQSRTRSSAGHRADLMGALDARPENE
                     SEGTMGRGNEEDPAQAVARLQAHWHPIPTRLVTIPEVDRKEALSCVLLVLLSTGHYSA
                     HSRALAVYLTSALELPLAVLNAEEVEIAKSLVERSAEAARQQRTMSADAEAEQRKQQN
                     QASRYWKVGLASVAGAAIIGVTGGLAAPVVAGAIGGLMGSVGLGGVASFLGIFWMNGA
                     LVGTLFGAFGAKMTGEMVDRYARQVEDFRFVPLKDEWGTRSATQDDRRLRVTIGINGW
                     LNAKDDITKPWRALGDDSEAFALRYEVKSLLGLGQSLKELVSSYAWNTVKLEILKRTV
                     LATLWSALWPAYILSAASAVDNPFSLAKNRSEKAGEILADALINKVQGERPVTLVGYS
                     LGARVIYSCLRSLAARRAFGLIDTVVFIGAPVPSNKQHWDMMRAVVSGKMFNVYSEND
                     YLLAFLYRATSIQLGVAGLQEIKDIEGVENLNLSEEVQGHMRYAKLIPQILARCGIPV
                     VRGADGPIEEDEDSIRLADLDKDGTDLIDLEGLPTGAPPKQNQPVPPSLSRTTSPHQP
                     PAAPAKNQQRMTVIRATPSAVTVSQDLLGLELSDIPSSSPNTATKPTSPFAPQPQAAA
                     GPQRNPSLPKSVPPERSNAQFTAREEPNTPLRADGTSGQAGSPALVPASASAVPMSQM
                     PYAAKPPSPALASSHSAVDYKDDDDDDSDEEGGTGIQMVDHDEDGLTHCDPTPIDDY"
     gene            1397611..1400135
                     /locus_tag="THITE_2121223"
                     /db_xref="GeneID:11519755"
     mRNA            join(1397611..1397805,1397953..1397977,1398298..1398376,
                     1398443..1399907,1399962..1400135)
                     /locus_tag="THITE_2121223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656460.1"
                     /db_xref="GeneID:11519755"
     CDS             join(1397796..1397805,1397953..1397977,1398298..1398376,
                     1398443..1399907,1399962..1400002)
                     /locus_tag="THITE_2121223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656508.1"
                     /db_xref="GeneID:11519755"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2121223"
                     /translation="MSMSLNEIRNVVLLFSNPSWRGVGTVSSTVIRNITALSSQMAYS
                     SRFTGNTTVLSTRYAETTNGGLAGLLYVPDLPPGDSCVQETAPHVPSSAVRQSDLPPT
                     NYHLVALAPWVSDRCASFYLAAARTDPVRAFLFYMPEEPDSPPPADSEKWYIGDGADW
                     MAKTGYPVFAVSGTVGDLMMQHLSLYSGNMTVVPYGRNISALFLTDTEDYLRIWTELD
                     VSVPPVPLGTWVYFLIVLGVLLTVISATSFLMHFVQARRRASLRRRVIAGEVNLEAMG
                     IKHLTVPMEHVQNFPLFTYNYEPDISCPSASPQSAERSRSQTGIPPSDQTEIAAASRV
                     ARSGTVPEQGLGRTCAASTAGTDYQPTCEICLEPYENRVTVIRELPCGHIFHPDCIDE
                     FLHEVSSLCPICKASMLPEGYCPNVTNAMVRRERAIRRLRGRIVVDDGRSPKKPLGWW
                     AGLFSAKKDPTHSNSIELQEGQPTPNTRRPQRLQLRLRPHSRANADLYGAPTVLARER
                     MRALAGFEPDYGESRSTRWERIRTRIFPGFD"
     gene            complement(<1400649..>1402982)
                     /locus_tag="THITE_122992"
                     /db_xref="GeneID:11519756"
     mRNA            complement(join(<1400649..1400717,1400784..1402306,
                     1402481..>1402982))
                     /locus_tag="THITE_122992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656461.1"
                     /db_xref="GeneID:11519756"
     CDS             complement(join(1400649..1400717,1400784..1402306,
                     1402481..1402982))
                     /locus_tag="THITE_122992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656509.1"
                     /db_xref="GeneID:11519756"
                     /db_xref="JGIDB:Thite2_122992"
                     /translation="MAPSSSQKGTGKKAGASAIRQQQQQQQQRSRNTTPGPATPIASL
                     PPFETVETETIDLRFDVFRNLTFEDMVDPTAAAALIPDSKNLDGILTRLQRLSDVIEK
                     RGIHCDRGMRLLAQNRRQRMDELALQRGREEERRQREAEDEERERKSNKKKRKGADTL
                     APQGGNLERSSPLGESTGKVRRLSRDHDSASSSLSPVAPRTPSNMDVDDKAKVEANDD
                     DSSSDDGRPPPPARPQANTFGDDPSTFPDPTVYEILPVQPGMTEDEIKQIYSVASYPK
                     SDLRDLIAGDPPDKDFSNAKPTNQISFSTFSASIEPYFRPFTEEDLAFLRERGDRVTP
                     FVMPKRGKKHYTEIWAEEDGVMAVDSSPPGGRDRLPPNQARGTIENMNDEVAETDKLS
                     VGPLLSRLLQAMRPEHRAPPAEDKPGGINGVNGEGDGTNGTASFDFSSGDNPPHSQAN
                     GVNGINGSGASFSQQPDPPQPQGQSQTLPPATYMPESNTEAWKKAIHPKLDYVQVDER
                     LKQELRHIGFLPLPPHQDPSASSTTANPSSGPPQPDSTATTAEYDGHYDDEVAARLRL
                     LQSRLREQVLINGARKARLTELVKERMAFQEYQTILEDLDGQVQAAYLKRTRTMGKKP
                     KKARPGQSAAAAAAGGAGASGVAAGMARPGIGDLTRTLMERRKRWIESIGTPAEMAEL
                     IKKEREAWDEEVEEE"
     gene            1405561..1408075
                     /locus_tag="THITE_2121230"
                     /db_xref="GeneID:11519757"
     mRNA            join(1405561..1406059,1406122..1408075)
                     /locus_tag="THITE_2121230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656462.1"
                     /db_xref="GeneID:11519757"
     CDS             join(1405778..1406059,1406122..1407972)
                     /locus_tag="THITE_2121230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656510.1"
                     /db_xref="GeneID:11519757"
                     /db_xref="JGIDB:Thite2_2121230"
                     /translation="MSEFLDVPKFFSSVYLVDFSPSLCEVARKRFARLGWSNVKVICE
                     DARKFRLEDYENGLSGGRTTPTRSSASYFEPRPDHGGADLVTMSYSLSMIPDYYSVID
                     SLTSLLSPHGIMGVVDFYVQSKVDVSFRNYTGGLAGRHVNFLGRTFWRSWFDLDRVSL
                     EPGRRDYLEYRLGTILTANLRNKALGSIPYYIWLGCHKKPFSSSSLPHEIVERIDALA
                     TESPYLFPANNQKGTNALTRAVERTAPEIRSKAFDAAVGNLSANLPLPSFFYQNHHWR
                     IYYDDQLEKHMQFNDEYIYAFTWEDSHVDAELLKLGPDDVVLAITSAGDNILSYAMQS
                     PARIHAIDLNPSQNHLLELKVASFTALPYEDFWKIFGEGKHPEFRSLLLSKLSPHLSS
                     RAFQYWLDRASIFTNDRGRGLYDTGGSKHAIRVFRWVSRLFGCRKAVKQLLESKTLAE
                     QRQIWHSKIRPALLSPLVSNIVVSSEAFLWAALGVPKNQLAMIEADHATSEAVTGPSP
                     TAKNKRSHAIWHYMVNTLDPVIETTHVGTDNPYYHVCLAGEFSPQCHPDYLSPRAHAI
                     LSRPDAFDGLRIHTDEIEEVIARITPGTLTVAIVMDSMDWFDQQPAGAGTGTAARQIA
                     KLNRALKMGGRVLLRSSARRPWYIREFEAHGFVGKQVGDREPGRCIDRVNMYASCWVC
                     TKVENLPPPTPGSEAEVGQGIAEDLLRL"
     gene            1409359..1412193
                     /locus_tag="THITE_2121232"
                     /db_xref="GeneID:11519758"
     mRNA            join(1409359..1409917,1410013..1410600,1410658..1411011,
                     1411078..1411397,1411464..1412193)
                     /locus_tag="THITE_2121232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656463.1"
                     /db_xref="GeneID:11519758"
     CDS             join(1409784..1409917,1410013..1410600,1410658..1411011,
                     1411078..1411397,1411464..1411525)
                     /locus_tag="THITE_2121232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656511.1"
                     /db_xref="GeneID:11519758"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2121232"
                     /translation="MSATSSSPAASPVSRVAKPRPKNCMECKKMKRKCDKGFPCSECA
                     KTNRTCEYKDPAEDGLFGPINSAKDIHSLAFGTLLDILITRPRVMEAVDQYFAGVNSW
                     FTIVERASFEERLEAAWAKLPAEDSILALCMALIARPPNQRPSKIGDTVYLSTKAILS
                     LVQCKVPMSVPLLQAELLVALYEFSQSMPQQAYLTLGRCLQMTKAFGWHNVEFWSDDR
                     KAAMPRELKLCSILWWAIVYVDCLLHVGYQDQVFPMHTSGLAQVSVIPLPEAFDQHFP
                     GSAPFHGPGFRDANSDRIEGMVLPEATSAWYLSRVLQQLSDPALPGNIDPEVLSNLIL
                     QHARDVDSAKWRAGDRNAAFGADLISLMKLNQPGLFSGIDPMSTSDPSHVQAVQRIRI
                     FTDVIHGQAGKLVEQQERLRKGSIAPCAAFAMSYAALLLISHGDGVLQDDQWLMKVEN
                     LRSTLEQVSKRWKVAEWYCESVKVALDNRLTGYAP"
     gene            complement(1413636..1414524)
                     /locus_tag="THITE_2121235"
                     /db_xref="GeneID:11519759"
     mRNA            complement(join(1413636..1414030,1414127..1414144,
                     1414212..1414524))
                     /locus_tag="THITE_2121235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656464.1"
                     /db_xref="GeneID:11519759"
     CDS             complement(join(1413678..1414030,1414127..1414144,
                     1414212..1414377))
                     /locus_tag="THITE_2121235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656512.1"
                     /db_xref="GeneID:11519759"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="JGIDB:Thite2_2121235"
                     /translation="MMASIARSSLLRQVALVPKLPIATRLASQQSAIVNAARVATFHT
                     TARRDLLPPLPQRVEGTVNDAAPVPETSPSHGSYHWTFDRLVAASLIPLTVAPFAAGS
                     LNPTLDALLCATILIHSHTGFQNIIIDYVPKYRTPRARKLFVWGLNAATVVVGLALYE
                     FETTDVGVTETIKRIWTA"
     gene            1415142..1417632
                     /locus_tag="THITE_2121237"
                     /db_xref="GeneID:11519760"
     mRNA            join(1415142..1415600,1415683..1416123,1416179..1417632)
                     /locus_tag="THITE_2121237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656465.1"
                     /db_xref="GeneID:11519760"
     CDS             join(1415365..1415600,1415683..1416123,1416179..1417523)
                     /locus_tag="THITE_2121237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656513.1"
                     /db_xref="GeneID:11519760"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="JGIDB:Thite2_2121237"
                     /translation="MAPSQALLLNRGPVCRRCLVVSAIAIVPIQRRSISSKYLRKLAE
                     AERQWQKRAELIKEGKLPNFWDLLEERGYVKDTAGSRDTIRELMRRKRIGAYAGVDPS
                     ASSLHVGHLLPLMAIFWMYMHGYRAVTLIGGSTVKIGDPTDRLKTREAMRSADVAINI
                     TKIHYQMKKLWTNVEAQAKRFGYTKEWAWRRAIVNNNTWWNSTPMLDVLKRVGRSIRI
                     GPMLSRDTVKRKMTEGDGVSFAEFTYPIMQGWDWWVLFKQQGVQMQIGGSDQYGNIIT
                     GIDIVKTARDNEPDPVQVLPARDEFDDPVGFTVPLLTDSSGAKFGKTAGNAVWLDPFM
                     TSPFDLYGYFVRRPDADVEKLLKLFTFIPMHEIQVIMEEQNKDPSKRVAHHRLAFEVL
                     SLVHGEEVARKTQKEHEMMYSKGGAAIPLPTGTWESQYAEPEHQTNPNNAPRIDMILP
                     KSLIMGKSIGRILYAAGLADSPTKGHKLALQQGVYVAGHPGARKGHGEPLKPGELTWT
                     SIKLWFPQETQRYLIDDKILILRKGKHNVRIIEMVSDEEYEKSGQRYPGQPYTGYLRA
                     LRQQLKWLKLGKISPERVKEVLQKAAAKEDEAAGPEAIKFPKKKSQEQIDLEAQLEEL
                     LASLPSQAEGASQESQAAGASQESQAEKASQESEAAKASEKSQAERASE"
     gene            complement(<1417742..>1419316)
                     /locus_tag="THITE_2056097"
                     /db_xref="GeneID:11519761"
     mRNA            complement(join(<1417742..1418676,1418762..1419211,
                     1419274..>1419316))
                     /locus_tag="THITE_2056097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656466.1"
                     /db_xref="GeneID:11519761"
     CDS             complement(join(1417742..1418676,1418762..1419211,
                     1419274..1419316))
                     /locus_tag="THITE_2056097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656514.1"
                     /db_xref="GeneID:11519761"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="JGIDB:Thite2_2056097"
                     /translation="MIQGIFYARFFPKEGTKIVAQSPPGCIVPVPGSSTTKPPLFDFS
                     VLQEYIIPRQAFCNRYITVADPEGKYFVLGFPVSIPSPRYDRNEFIFNFGLVVESDAD
                     QVPYEPVVRRLAATFSEMEKQSGYLSQDEDSAEANQTRRPIESLLEIVKEDLNNYGEC
                     MIPVDDANTINMKLFPHHPTPPEVKGWHVPVAKMKFADVVDPTWDLTLQRVIAHIDGV
                     SDVRRIAFLADVSLELTQLALRHLLYYDTILLLDMFFFGACYAPRPGIHDFIANVGGM
                     VDECANYVCVGASYRSGAQGVGPGVGGAGAGSMSEHRHGHGHGHGHGELSAEGITGAD
                     GDGDGGHPRDAAHGHRVSNYMLIKLMTTFCVGKTVMEWLKGHMDAGFDVLRFVDVRRL
                     VQFGLIKGCLYRVHKYVVSKQYLAALATGQARPVAGGDPLQKYTDGCHTFDQIITEQN
                     LTDAEIMDKLKSFPAPAGDLTVLYR"
     gene            complement(1419657..1422736)
                     /locus_tag="THITE_2121243"
                     /db_xref="GeneID:11519762"
     mRNA            complement(join(1419657..1422540,1422623..1422736))
                     /locus_tag="THITE_2121243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656467.1"
                     /db_xref="GeneID:11519762"
     CDS             complement(join(1420046..1422540,1422623..1422662))
                     /locus_tag="THITE_2121243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656515.1"
                     /db_xref="GeneID:11519762"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="JGIDB:Thite2_2121243"
                     /translation="MNAALAESASLDSVEYDPIAHLNLLFSHPSTVSSVARVSTTIRQ
                     RKDELSQSIAALEVAQAYGPNSSLERMQSAQAELASLFRRIEDVRSRALQTERDITVM
                     TADIKRLDATKRNLTLSMTALKRLQMLTTAYEQLRGLARTRQYRECAGLLQAVLQLMR
                     HFNSYRSIEQIAVLSRNVSELQRELLEQVCEDFEMAFAKGEVTARRAMLVEACLVMDA
                     LGEHAKTRLVTWYVNTELREYRQVFRGNDEAGSLDNIGRRYAWFKRMLKTHEDEHAAI
                     FPPHWRVSETLAMAFCDGTREDFKGILEKSLRRIDGAKLDVNLLLSCLQETMDFEQSL
                     ERRFASDPRASIDTLSSADDRIQNFNGSISVAFEPYLSLWVESQDKALASMIPKYKTQ
                     PIIPADEEFSPQAVVPSAIELFHFYKLTLSQCAKLSTGERLLDLSKTLAKYLDEYAQQ
                     VLLNFLQRGGPQGPPIREIVLVLNTADFWHVNTNQLEESIKKRIDPEMASRVDLSAQS
                     DAFLGVASAAVMALVAKAELDCEGAWREMKNTNWSRMESVSDQSSYVGELLKHINGKA
                     QEILPMVIKHQYARAFCDNLVEHLATAYLTNVVQCRPIGEVGAEQMLLDKYVLTKSLE
                     NLLSYHNNPAATQPAAPPPAGFVKRVNQSMTRVDPLLKTLQVRPSPPEGLVQAYLIHI
                     GDRSDTNFRKILELKGVRKQDHAYLLELFAIHREGSSVPLVQSSPLLTPLMAAGSSGG
                     LGSAGIASNSGAAAAASAGLQGRFDAASLGEKLLNAARDGVERMGTTAAGGVPGAGGA
                     GGAAQGEKATINENLKNIGKFFRRDIGGLGARFGKRDITPTGGADG"
     gene            complement(1424336..1425685)
                     /locus_tag="THITE_2121244"
                     /db_xref="GeneID:11519763"
     mRNA            complement(1424336..1425685)
                     /locus_tag="THITE_2121244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656468.1"
                     /db_xref="GeneID:11519763"
     CDS             complement(1424651..1425334)
                     /locus_tag="THITE_2121244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656516.1"
                     /db_xref="GeneID:11519763"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="JGIDB:Thite2_2121244"
                     /translation="MSSPKTFSVGIISGSQRAMRVAPQVAAFVLEAIEAHRESLPPSA
                     TTASARAITFDHIDVGTLNLPLFDEPGLPAEIHSPAEYAHAHTREWAARVAALDAFIF
                     VSPQYNWGIPAGLKNAIDYLYHEWRGKPAVIVTYGGHGGGKCAEQLRTVLGGGLRMRV
                     VEPAVCLSFPSREVVGRATRGEDLELWSRRRQGQADGGANGLGLWSDRRGDIVEAWEA
                     LVKLLETKE"
     gene            <1426785..1429892
                     /locus_tag="THITE_2081442"
                     /db_xref="GeneID:11519764"
     mRNA            <1426785..1429892
                     /locus_tag="THITE_2081442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656469.1"
                     /db_xref="GeneID:11519764"
     CDS             1426785..1429682
                     /locus_tag="THITE_2081442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656517.1"
                     /db_xref="GeneID:11519764"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Thite2_2081442"
                     /translation="MDTTAAASTLTRQRFSVAVLSLAAAATLGYFCYRIYSPPLPEPS
                     PDRRLHRSNAVRHRRRSLPDVTHTHAHTHANDRGRDREPSEASTTSAETQPDENIDVN
                     TVRPLNDAETVADEHVLDDNWYDDANNQFGGLQQRAGQNIVSLLFRVSEDNARRNAYV
                     HRGCQCNSCGVTPIRGIRYRCANCVDFDLCEACESQGFHIKTHVFYKIRVPIPRLGAR
                     QLQPTWYPGDPDNCLRPLPKHLMPRLSKETGFERPELEALWEQWTFMANTEWREDPDE
                     LGLAMDRKTFERYLVPSGGYRHIAPNLLHDRMFAFYDDNNDDLIGFSEFLRGTAYRKR
                     KDRLRRIFNGYDIDGDGYVSRRDFLRLFRAYYVVFKHLHKDIVDGLDDQLMSSTDVEQ
                     LVTSRQPLSSLFGREGGIAEADLGRPLEGKVVNLHTGEVRVTDGATRAVNESAPDTAD
                     RRSVLTSVYTRQAHGAESLFGPVTDNPRPAGERASGLEYLSGLLNPPSRVNELPALLV
                     GERRDNGDFLFVLNGRGGQEGSGEAQETQARGEDAPTSGDHGTSASGEDRAEDRLGAN
                     GSSDGGVADEPDMRRPAYSAVSSRRIKVNARRKLFDRWKRRQFYLDEEEGVLPPEDWS
                     DDDDVLASLSGPADDTKACQPPLSSRSRSSSKVRFAEDADDFDVRSNPSTSSRSIPER
                     WGGMEIPDAERDVGKEIFYQVIQQAFNEMLDTIFKEKEDLAVQAAETKELRDKYRHAF
                     ESINPDEENEPQANLDSASGRSKSPRDQSLQELPDASGYSVDPAAAQPEGHPREEVED
                     DEDDGETSAEEDDDSLPPLIAEDERSGSAEFEVYRDPTMPQFRPNSIPTVREREPKQR
                     EPPSSSSVPSIEGVTPPETRVPPSAPGKPTSMSAGTGTGARGSASPVPIPRSTLIQWR
                     RLDLAEEEAKTRGGWGRLNYDEFERAYKAADARGTRMDYLGTWVDFCIPCV"
     gene            complement(1434765..1437144)
                     /locus_tag="THITE_2121245"
                     /db_xref="GeneID:11519765"
     mRNA            complement(join(1434765..1434864,1434947..1437144))
                     /locus_tag="THITE_2121245"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656470.1"
                     /db_xref="GeneID:11519765"
     CDS             complement(1435065..1436390)
                     /locus_tag="THITE_2121245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656518.1"
                     /db_xref="GeneID:11519765"
                     /db_xref="JGIDB:Thite2_2121245"
                     /translation="MDPNRDLSYHHESYYLSPLSARSALETRSSSVSSNSSSTSYSTP
                     FSTVSAPPGNMSRALSPASGISEPGSDSLVYARSHYPGPAHDRAHQTQGLPTSLMPSP
                     SQFELSAPLALYPQIQAPRAFSQSSACGGYLVASLPSQSSDLSYQAYAQPYPSFATTA
                     PGYHPSPDLPSYQVPRPTRRQAVMNKPEAAKKPNGLKLLQRLPPCVVAEIRKYLTWYQ
                     CCRAAQASRWFRENFHPDNLPDHVKLEGMLYAEQYYGRYGEDEKPESGSAKRCKGKTP
                     PWFACYHCFKLKGFDRFELFKWGNSSPRQTGAIEDGGEGARSAGLTPPANPHYDPTLT
                     RSSLAGAAASDGRSGLGITATANGPADDDGNMDQRIRETWGVRRFCIDCGLRKGYYRA
                     LDLIELHKPLKPNEAVWVCRCLKFHWRPHETKCFDCHAIVPLSSPSRRR"
     gene            <1444689..>1445706
                     /locus_tag="THITE_2091683"
                     /db_xref="GeneID:11519766"
     mRNA            join(<1444689..1445359,1445409..>1445706)
                     /locus_tag="THITE_2091683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656471.1"
                     /db_xref="GeneID:11519766"
     CDS             join(1444689..1445359,1445409..1445706)
                     /locus_tag="THITE_2091683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656519.1"
                     /db_xref="GeneID:11519766"
                     /db_xref="JGIDB:Thite2_2091683"
                     /translation="MSTTQSSVAGLPAAALISLKADQSVLDRSCFAGFGAQHETEAAM
                     PLPSNESVAAGISQLSIGSSKQEPPKREPRREGNENPEPTLLPEPAITGTPEGSGAAT
                     SPSGGGSSSQDEDVAGGWDPRDEEYPVAPPPSPADRKTAAGFEQFFRIQPSRLGGLGA
                     FAVRELKRGETILVEKPILRTTHFRLMPDYHSLSEEAKRVYLSLHGGEDGDPFSRVER
                     IKSLNSFVVPGGIAIFEIASRFNHACASVRNVQYVFDDERGVLSLTICQDVVPAGTEL
                     LLNYGGSPIDLYTTYGFRCACGGCTPLTDEDIRRLKDETYGIFEPW"
     gene            complement(1447173..1448160)
                     /locus_tag="THITE_2121250"
                     /db_xref="GeneID:11519767"
     mRNA            complement(1447173..1448160)
                     /locus_tag="THITE_2121250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656472.1"
                     /db_xref="GeneID:11519767"
     CDS             complement(1447295..1448146)
                     /locus_tag="THITE_2121250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656520.1"
                     /db_xref="GeneID:11519767"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Thite2_2121250"
                     /translation="MLIGREAQIYKDFDSWPSWRKFKVDRVIPESDDIYSFYLVPLDG
                     KKLPKFFPGQYVSLRIPTPDGYMQARQYSLSESWREDYYRISVKRDEGALYANSVSTS
                     YFYPGLVSNMLIDHMTPGSTVELSHPAGEFFLDVNNTSTMPIVLISAGVGVTPMVAIA
                     NTVAQTQPGRPVSWIHSSRHSVPFAEHLAQLQRENPNFRTCIFKTRVTSSDVAGVTYD
                     YGCRMDLAKLDPQDLHLQNSGTEYYICGPEQFMLDISEYLEARGVAAARIKLELFSTG
                     DLTLKHK"
     gene            1452408..1453664
                     /locus_tag="THITE_2121252"
                     /db_xref="GeneID:11519768"
     mRNA            join(1452408..1453203,1453272..1453664)
                     /locus_tag="THITE_2121252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656473.1"
                     /db_xref="GeneID:11519768"
     CDS             join(1452566..1453203,1453272..1453569)
                     /locus_tag="THITE_2121252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656521.1"
                     /db_xref="GeneID:11519768"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2121252"
                     /translation="MATSFIPRTTLKVGPRAMLARQSLCSPSIILARAFHQTQNRRSQ
                     NRSALLPEFSLKDRVVIVSGGARGLGLTQAEAVLEAGAVVHALDRLPQPAEGSDFSRV
                     AERAASELGSRMSYHRVDVRDQKALSEIIGGIANKEGRIDGLIAAAGIQQETPALEYT
                     AEDADRMLGVNVTGVFMTAQAVAREMIKRKQKGSLVLIASMSGTVANRGLICPAYNAS
                     KAAVLQLARNLAAEWGEHGIRVNTLSPGYIVTAMTDGLFEAVPERRTAWPDANMLKRL
                     SYPREYRGAAVFLLSDASSFMTGADLRIDGGHCAW"
     gene            complement(1453665..1454234)
                     /locus_tag="THITE_2121256"
                     /db_xref="GeneID:11519769"
     mRNA            complement(1453665..1454234)
                     /locus_tag="THITE_2121256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656474.1"
                     /db_xref="GeneID:11519769"
     CDS             complement(1453759..1454118)
                     /locus_tag="THITE_2121256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656522.1"
                     /db_xref="GeneID:11519769"
                     /db_xref="JGIDB:Thite2_2121256"
                     /translation="MGIVQPNPTYSPSSIASPFQDASGISQSLSTPRFPSSSSNATLG
                     VLEVRRRLEARAKDELENVGKSTDTGREFLDISTVKQILLRRQRGESATEIEARLNLK
                     PGVVARLGPESVVAPAS"
     gene            1457461..1460595
                     /locus_tag="THITE_2121261"
                     /db_xref="GeneID:11519770"
     mRNA            join(1457461..1457868,1458116..1459811,1459967..1460595)
                     /locus_tag="THITE_2121261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656475.1"
                     /db_xref="GeneID:11519770"
     CDS             join(1457638..1457868,1458116..1459811,1459967..1460214)
                     /locus_tag="THITE_2121261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656523.1"
                     /db_xref="GeneID:11519770"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2121261"
                     /translation="MESPEFAAGVRSQGANGGGPIKRKRSTLDSSPASLADHDHDHDQ
                     DIDHDERTDASPDTKSRRLPGVKRACNECRQQKLRCDVVQEPFQSCSRCNRLKLECKI
                     ESNFKRIGKRSKHAEMEKEIERLRRAVQIAKSQGFTFDEDDELANSAMQSQLHSPVVA
                     SQYTHTRNPSLIGSEEAVSSLLHLKRGGSYAMPRIARELDDFRLTEDEESQLFSQFFN
                     YYHPFLPFLNPAQTPDQYYQQHPLLYWSIAAVASRRFGLDSNILTRLSGPLTRLLWAT
                     VGDVPQSYFVVKALCLLCTWPLPTSTTSSDPTHILCGVMMKTATGIGLHRPNHINDFS
                     RVAVELNKEGLHDRIKTWAVCNIVAQTIGTGYGQPASTLYDWTLAIRPGVEGPYSLGP
                     ELEARLQIERFCDKVSKEMYSNASDPRGVAGDEHRAMLMRVYRREFNELQASIVAQNL
                     SPIVYLHLKAACLHLRLAGFFDSSRTPGYLDDLMALWRATTSYLDYILDGPETCPEAY
                     QYQLRDQFLLKYATNYIQQMLVAAGFALLKLMRSFFVKQVEFERGRSLFHRTIQAIRT
                     TSVVHNDLNWRLAELMVQIWNGARIEGKSPSFQGDDPEIDDSLQLKVRCRHSMSLVFD
                     SIWHWREEYQARGRGTLDASSTHLDSTLAPASQGLTANLGLATSNGALTPSGGSAVGG
                     GTQNSLMGMNYDSTYDFWDPQHWMLDGLLDFNYTFVPIESNT"
     gene            1471210..1473557
                     /locus_tag="THITE_2121267"
                     /db_xref="GeneID:11519771"
     mRNA            join(1471210..1471663,1471757..1472749,1472841..1473557)
                     /locus_tag="THITE_2121267"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656476.1"
                     /db_xref="GeneID:11519771"
     CDS             join(1471379..1471663,1471757..1472749,1472841..1473473)
                     /locus_tag="THITE_2121267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656524.1"
                     /db_xref="GeneID:11519771"
                     /db_xref="JGIDB:Thite2_2121267"
                     /translation="MDTERQAEVESPLLEDFLDCDQLVSDSDGGSSSSSASPRRTLKR
                     LHIHVDMTRAPQYLPPSAHHAERPQMDGLPVCTSGPQTVAFSSPDLDPYSAVSGVSSF
                     NYPAAVDPSLLTPVSSAGSPPLQHRQSAKPMRNYHPSQPSAPASQAPTPPNTSKLYFE
                     NYAVSSSSQGSSPMTVNPAATEGGPFDMTPYMAHSPPVSHHPSSPKSEIPPPIDPYLG
                     HFAVSGTNDGEVTHQPLPEYHTYGVEVAAPGAYLGQSHVPVGTPHMHHRMPSNGAAPV
                     LSQPHPSHYRPPPSQVGAIEDLRDPSMLLGAYQAHGALSPGRRPQPRKKPSPARKPSR
                     TPKATPHLGSDVNGPFKHEDEDEELTLNDDAPEDDKYLFQLRKQYLSEKGKGMWEEMK
                     AKYSEKHQGNWEKAALQMKVSRAVAKYGVWPEKEIERLKEAFHYFEEKRYHFIIARMK
                     ENGGCRAWDWKPAHIECQLVKLGLEEPTVNEKTGSRRRRQKAARRQASPQNGGHAVMG
                     DWGNGLGLQHAGFHSHAHQVAVQAAARQGGPYSNHNNTTTTMMGDSHFGAAPSLTPAQ
                     TDELINQVFSKVKEEDSLSPDEGMEGFSYDHDAGSRRPSTSAARELDHQGSERVARGT
                     CQQMLGNAYGAQ"
     gene            <1477342..>1480492
                     /locus_tag="THITE_73286"
                     /db_xref="GeneID:11519772"
     mRNA            join(<1477342..1477440,1477505..>1480492)
                     /locus_tag="THITE_73286"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003656477.1"
                     /db_xref="GeneID:11519772"
     CDS             join(1477342..1477440,1477505..1480492)
                     /locus_tag="THITE_73286"
                     /note="CAZy_ID 269875"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003656525.1"
                     /db_xref="GeneID:11519772"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_73286"
                     /translation="MRSDRVRELRQETVDMFYHGFDNYMKIAFPEDELRPVSCTPLTR
                     DAKNPRNVELNDVLGNYSLTLIDSLSTLAILASAPPDDRGTGPKALRDFQDGVAALVE
                     QYGDGSPGPSGVGLRGRGFDLDSKVQVFETVIRGVGGLLSAHLFAIGALPIAGYHPRR
                     PGDDPLNPRPVVWPSGFRYDGQLLRLALDLAQRLLPAFYTKTGMPYPRVNLRHGIPFY
                     ANSPLHEFSPDATPEGPPEITETCSAGAGSLVLEFTVLSRLTGDARFEQLAKRAFWAV
                     WYRKSQIGLIGAGVDAEQGHWIGSYSVIGAGADSFFEYALKSHILLSGHELPNQTAVP
                     PPHDDAWLDPNTLFAPLSDVENSADTFLEAWHHAHAAIKRHLYSERDHPHYENVNLWT
                     GSLVSNWVDSLGAYYSGLLVLAGELDEAVETNLLYTAIWTRYAALPERWSIRDKTVEG
                     GLGWWPLRPEFIESTYHLYRATRDPWYLYVGEMVLRDIKRRCWTPCGWAGLQNVLDGQ
                     KSDRMESFFLGETAKYMYLLFDDQHPLNALDAAYVFSTEGHPLIIPKAATPSVRPRSP
                     SGSDNRDLTVYYDEAFTNTCPPRPASTPLSGSVVAARDDIYHAARMLDLHLLSTSRIT
                     IDGGQVSGLHMARSNFTLFPWTLPPELLPSNGTCSKVYQPHEVTLEFAATAGQSVGGS
                     SFNFMLGGQNLERLSTDRIRVSSLSSLKITLRLEEGGEQEWQVTKINGFPLGRDEFAV
                     FDRAILGDLSDPRFHLVRDPVMVKLQQLHRVALHENDTSSHDRAPGDHHEEMPQLDPL
                     QDPNRPAALSELSSLVRSIFTRVAASLDIQLPTSLPGMATAPLPYNLVINQTAITPVG
                     IGAGPLPPATAAADAAAARIPPFGPVPAGLFPWTTIYAAGDACSGPLPQSAPRDHQVI
                     LIRRGGCSFSAKLANIPAYAPSPTSLQLVVVVSDDEEGGGAGLVRPLLDEVQRTPGGM
                     LRRHLIPMVMVGGGDVAYQRLRYAAGVGLAKRYFIESQGVRVRNIIVDEGDVETAL"
     gene            complement(1481057..1482291)
                     /locus_tag="THITE_2121269"
                     /db_xref="GeneID:11519773"
     mRNA            complement(join(1481057..1481311,1481494..1482291))
                     /locus_tag="THITE_2121269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656478.1"
                     /db_xref="GeneID:11519773"
     CDS             complement(join(1481163..1481311,1481494..1482076))
                     /locus_tag="THITE_2121269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656526.1"
                     /db_xref="GeneID:11519773"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Thite2_2121269"
                     /translation="MSAPVDAAQSLAQTSNDEKTPSTSAEAAVLASSTASNTANPSST
                     PSDASRGQSSAATASASELARTKITLLGALKHFPDFPIPGIKFIDILPLFQDPAIHNA
                     LLRALELQILEFGDHAKPDVIVGLDARGFLFGPSLALRLNASFVPVRKKGKMPGPCVT
                     ATYEKEYGTDYFQMQEGAVKPGQKVLVVDDIIATGGSAAAAGSLVKQLGGNLIGYLFI
                     LEIPILNGRSKLGGVPTVTLLETNE"
     gene            complement(1485715..1487833)
                     /locus_tag="THITE_2121273"
                     /db_xref="GeneID:11519774"
     mRNA            complement(join(1485715..1486029,1486111..1487012,
                     1487129..1487833))
                     /locus_tag="THITE_2121273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656479.1"
                     /db_xref="GeneID:11519774"
     CDS             complement(join(1485927..1486029,1486111..1487012,
                     1487129..1487710))
                     /locus_tag="THITE_2121273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656527.1"
                     /db_xref="GeneID:11519774"
                     /db_xref="JGIDB:Thite2_2121273"
                     /translation="MPHFFSFQQGSERAQNVRYLSEASPLLGRFRVVPRPSDRPTSGV
                     SRTAGGIAGGGGGSGGGRGRARVTAGGLGLLPGGQIGLLSSGEPGWRGSVHVGYGALV
                     AAAAAAAEAEALEAGEGQSEEEEGDGDAGEGDSLCCCAGGSGRWWKRVKARIKRELRK
                     LEDTWVEPKASAIRRVVDVWWSRWGALVVLPASLAVAWCAVPFPQYPLPSGGEDGMHR
                     PGEPQPTPGTKVPGHGAARVQVNFWFFLFVYYSFYNLTALIWITKVFNIYSLNWWPPS
                     LGFPITVSAIAILSIAVPIPIYLVPNAKFLTVHNTAWISWTFLIMAMPVAIAFCLLMT
                     HERHLGLRHSLSETQRIFTSSWWAGDPDRTLSNREGRRYLAASDHDPFDSTLGASAVG
                     FVDERYPRRRLPVRLRRQWLPASFVRFVWFCLALSIGLLAYVIGEAYAEIYLSTLPHN
                     NWETIVYVYGWITTVHLLDGLTGWILGGNEGERVGSYPLSWIFKLPTFAPCMLACGAR
                     PSSSFSKYFRRRASSSSLQY"
     gene            complement(1487834..1488351)
                     /locus_tag="THITE_2121275"
                     /db_xref="GeneID:11519775"
     mRNA            complement(1487834..1488351)
                     /locus_tag="THITE_2121275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656480.1"
                     /db_xref="GeneID:11519775"
     CDS             complement(1487973..1488170)
                     /locus_tag="THITE_2121275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656528.1"
                     /db_xref="GeneID:11519775"
                     /db_xref="JGIDB:Thite2_2121275"
                     /translation="MHRPSRACLKTPAQATATAQVEGDASATPARDAEKPATHDPGTP
                     ITRSHAAINPVTRSQAEGTNG"
     gene            complement(1488859..1492668)
                     /locus_tag="THITE_2121276"
                     /db_xref="GeneID:11519776"
     mRNA            complement(join(1488859..1489334,1489473..1492134,
                     1492217..1492668))
                     /locus_tag="THITE_2121276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656481.1"
                     /db_xref="GeneID:11519776"
     CDS             complement(join(1489021..1489334,1489473..1492134,
                     1492217..1492384))
                     /locus_tag="THITE_2121276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656529.1"
                     /db_xref="GeneID:11519776"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Thite2_2121276"
                     /translation="MSFAIEVPGEAAPLSQWELVKALSAAATSTNHAQRQSASQQLQT
                     WEAHPDYYTDLQTTFLDTSQDKQVRFLAIILLKNGIDKYWRHTAKHAIKPENKQLIRS
                     RLLQGSLNEQDRTLALHNALVTAKIVRIDYPNEWPDAFSTLIELTRSASASNPLHLRG
                     ALLVLLRIVKELSTARLRKSQTALQGVTPELVQLLGGIYTEKTAHWQGLWTRGAGDQA
                     AAEFSVENSLAALKILRRLVTVGYEQPHADAMVCGFWSLSQSQFDQFLSGISQDSWVP
                     ISHQDMVGKHLIQFAKLHIDMSEMHPASFPALPNSIPLVKAYWNLVKAFSEVFEKSGG
                     IKQTSSETAGGHPKHEGPLYEKLALKGLLLLRSCVAIAHHPVQTFKYRSAEAKELEKQ
                     AVHTIKVELLTRDMLLDMVQVIISKLFVFRKSDLDAWEEDPEGWESQERTEGQAYEWA
                     VRPCAERLLLDLLTHYKELGEPLLEYCDLVTKAGMDVVAKEAAYCALGCAAAVIHQSF
                     DFDRFLTTFLVKDAQIQGPMAKLLRRRIAILLSQWISIKISQANRPVVYDIFRHLMNP
                     KDEHNDEVVRITAARQLKYIAEDFEFNGESFQPFAADVFNLLVNLLQEVESDETKLAV
                     LETLRLIVTRMETHISQFGDAIMLTLPKLWESAGTEEYMIKQSILAIMSSLVSSMRAE
                     SQRYQGVIIPLLREAMNPESALHLHLIEESVDLWKSILTQSLPPLNPDLTQMVQLALP
                     LLEYDSEVAIQCLEIVKDYILLAPQDILRDALRQPTLAALAKTLDSRSRDQSQLGAKS
                     IELVIRVADAFGGAQGVSVVVQDLLEIGVLRAILEGLHSAWESSQTTGPNRKPSKINT
                     VKETDYFALLARIALADPALLVTMLTSFGSPIEQVWSWLSSQWFANFDCMGDIEREKL
                     SCLALTRLWELPNPMQDLVLARLQDYLSMWTSVVTELADGTSGETLGGQDSLVWTEVG
                     RYEYDTPLDVHEREFAAKDPVHSVVTYEFVRARLADVVQRVGGEQAFEANWAVNVDRE
                     VLIGFQRLSQPGGQVDG"
     gene            complement(1492670..1494264)
                     /locus_tag="THITE_2121277"
                     /db_xref="GeneID:11519777"
     mRNA            complement(1492670..1494264)
                     /locus_tag="THITE_2121277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656482.1"
                     /db_xref="GeneID:11519777"
     CDS             complement(1492913..1493842)
                     /locus_tag="THITE_2121277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656530.1"
                     /db_xref="GeneID:11519777"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="JGIDB:Thite2_2121277"
                     /translation="MACWKLPSTTGRSVCILGAGVLGRRIGACWASTGYKVRIRDPDA
                     RQVESAQQYIKSELPRYKPTIRPGDVSVQVFQDLKPALRDAWLVIECVPEKLDLKIDT
                     FAELEQLAPSDSILATNSSSYKSREIAAKVKPETARRMLNTHYFIPPKLRIVELMTSG
                     STHDEIFPFLQAHLRSSGMFPIVARRESTGFILNRVWAAVKRECLMVLSEGVATPEEL
                     DAAWTELFVKNAVRPCEMMDQVGLDTVCLIEQHYIAERGLRDPGLIPYLQRFINEGRL
                     GAKSDKGGLYPAKQHTEPPGHGVEAGTSDGPGW"
     gene            1494398..1496513
                     /locus_tag="THITE_2121278"
                     /db_xref="GeneID:11519778"
     mRNA            1494398..1496513
                     /locus_tag="THITE_2121278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656483.1"
                     /db_xref="GeneID:11519778"
     CDS             1494564..1496111
                     /locus_tag="THITE_2121278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656531.1"
                     /db_xref="GeneID:11519778"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Thite2_2121278"
                     /translation="MNDPNHRTHGGSGGANAHTHNNNNPHSFAQAQQRLAARRQAREA
                     EVAARIATVQSASQLRARIATIQSPLLRRIGTSTLSFWDTISSREGTRPAFRVGQVDA
                     ELLDEELIELLRGQVGDALKYIGGGRGGAGTSNSVLHDWEAEISLALRAVLFKLTVWD
                     HDATYGAALQNLKYTDARRDGPVLVPPTRWQKSLYGLATVGGRYLWAKWEAWLLEQDD
                     GFEGPSPRVRQLSRWTSALSTMHAAAALASFLVFLVQGRYRTLLDRVLRMRLAPPTSQ
                     VSREVSFEYLNRQLVWHAFTEFLLFVLPLVGINRWRRWLARTWRRTKKIMSAGAEGTG
                     DEKKGEYAFLPERTCAICYLDQNSATSENELMAAASSGLIGSSQTDITNPYEAIPCGC
                     TYCFVCLATRIEREEGEGWTCLRCGALVKECKPWGGDVLEPAGKSTAPKTVVFADDVN
                     APSDGGHSADEQHSQVLVEADSHSGVKSLSSRTPSVASDEAGGSGSSASEDFEAEEEG
                     FDEDADR"
     gene            1496514..1500833
                     /locus_tag="THITE_2121281"
                     /db_xref="GeneID:11519779"
     mRNA            join(1496514..1496638,1496708..1496864,1496925..1497287,
                     1497353..1499450,1499507..1499708,1499809..1500833)
                     /locus_tag="THITE_2121281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656484.1"
                     /db_xref="GeneID:11519779"
     CDS             join(1497044..1497287,1497353..1499450,1499507..1499708,
                     1499809..1500393)
                     /locus_tag="THITE_2121281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656532.1"
                     /db_xref="GeneID:11519779"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="JGIDB:Thite2_2121281"
                     /translation="MDFAARVARAQRKNTLFPLGFHATGMPIKACADKLAYEMTLFGE
                     LFSECPAPDANVDGQQEGPTAPPRPREDVTRFTNVKKGKAALKSAKAKHQFQVMLSLG
                     IPREQIHKFADAGYWLQYFPQLWQQHLTEFGCGIDWRRSFITTHVNSYYDSFVQWQMR
                     RLRDAGKIRFGKRYTVYSPKDAQPCLDHDRATGEGVLVQEYVALKCKVVRWSARASDV
                     LSSCDSIPSDADVFMIAATLRPETMYGQTNLFVSPSLTYGIFRISAKEFYMTTDRAAR
                     NLAYQSVFPNWGVIPRVAGVSGSDLLGTLVRAPLSAKGDIYVIPMDSIKESKGTGIVA
                     SVPSDSPDDYITTVDLSKKATLHGVEPEWVCLDVLPIINTPEHGNMIAPALVEKLKIN
                     SPNDERRLLEAQEIAYKTGFYHGTMAYGPFAGKSVQEGKALVRQQLLDSGDAFTYCEP
                     ESPVTSRSGDECVAAFLDQWFLTYGVDEEWRNDTLEHLRGEDGLGFNCFGSVTKHSLE
                     QSLAWMTEWCVTRQYGLGTQLPWDASQLVEGLSDSTIYMAYYTVAHFLHSDMYGKEAG
                     TGNIRASQMTDNVWDYVFALSDDVGSSDIDKSTLDAMRREFTYWYPLDVRVSGKDLVN
                     NHFVFFLYIHQAIWGKQAPQYLPKGIRLNGHLMLNGEKMSKNTGNFLSLDSTIHKFGA
                     DATRIALADGSDGIDDANFEETTANAAVLKLFELKRWAEAVICRPRLLGPEETFEQVR
                     AAEKPDDADTIQRTGSMSFWDELFLNELNSLVRDTVRAYDATHYKAALKAGFYDLASA
                     RDTYRAWTAAASSSGMHQFCVRRYVGLQALMLAPIAPHWADYIWREVLGKPSTIQTAP
                     FPSPAPPSRSLTLTWAYIKHTLSRLTAACAAQSKRRAKSRAKNDAHAGDATAEQTLIL
                     RVATAWPPWQTQYLALARRHFFSSDAGLDIKALTREIDKSELKRAMPFLQQVKKQLKG
                     GAEPAEVFERQLGFDEVAVLNEMAPLMRRMVAGLKEVRIVKVAGADETSAEPGRPAME
                     FVGCELDGKQAG"
     gene            complement(1501352..1504876)
                     /locus_tag="THITE_2171246"
                     /db_xref="GeneID:11519780"
     mRNA            complement(join(1501352..1501786,1501864..1502682,
                     1502746..1503155,1503216..1503470,1503552..1504738,
                     1504811..1504876))
                     /locus_tag="THITE_2171246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656485.1"
                     /db_xref="GeneID:11519780"
     CDS             complement(join(1501710..1501786,1501864..1502682,
                     1502746..1503155,1503216..1503470,1503552..1503652))
                     /locus_tag="THITE_2171246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656533.1"
                     /db_xref="GeneID:11519780"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Thite2_2171246"
                     /translation="MELLTLLKKQLTPTKLLFHFLFWGLHWGLFAYGWYKQEADPRLA
                     GLNTLQYSVWISRGAGLVLSVDGMLILLPVCRTIMRFIRPKIRFLPLDENIWMHRQLA
                     YALLLFAIIHTAGHYVNFFNVEKTQIRPVTAVQIHYVQPGGITGHVMLLCMLLMYTSA
                     HHRIRQQSFETFWYTHHLFIPFFLALYTHTVGCFVRDTPNAFSPFAGEQYWEHCLGYL
                     GWRWELFTGGFYLLERLYREIRAVRETKITRVIRHPYDVVEIQFSKPSFKYKAGQWLF
                     IQVPSVSKYQWHPFTITSCPYDPYVSIHIRQVGDFTRALGDRVGAGAAQSKLYEGVDP
                     MGMYEVALQNGQQMPAIRIDGPYGAPAEDVFENEIAVLIGTGIGVTPWASILKNIWHL
                     RNGPNPPTRLRRVEFIWVCKDTTSFEWFQTLLASLEQQSSEAARIPGSGGVEFLKIHT
                     YLTQKLDMDTTQNIVLNSVGAAVDPLTELKSRTNFGRPNFNKIFTSMRDGILNRTYLH
                     GLEGNMRTTVGVYFCGPSAAARDIHKAAKAATVREVRFRFWKEHF"
     gene            1507880..1512142
                     /locus_tag="THITE_2121288"
                     /db_xref="GeneID:11519781"
     mRNA            join(1507880..1508198,1508299..1511617,1511674..1512142)
                     /locus_tag="THITE_2121288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656486.1"
                     /db_xref="GeneID:11519781"
     CDS             join(1508196..1508198,1508299..1511617,1511674..1512023)
                     /locus_tag="THITE_2121288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656534.1"
                     /db_xref="GeneID:11519781"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="JGIDB:Thite2_2121288"
                     /translation="MGITRRAKDKAARADRSAAGTGQAGPSKPKKATFDTTKKKEIGV
                     SDLTLLRTVSNEAINENLKKRFEGGEIYTYIGHVLVSVNPFRDLGIYTEQVLNSYRGK
                     NRLEMPPHVFAIAESAYYNMKAYKDNQCVIISGESGAGKTEAAKRIMQYIANVSGGET
                     GDIQQIKDMVLATNPLLESFGNAKTLRNNNSSRFGKYLQIHFNAQGEPVGADITNYLL
                     EKSRVVGQITNERNFHIFYQFTKGASQHYREIFGVQKPETYIYTSRSKCFNVDGIDDL
                     ADFQDTLNAMKVIGLSQAEQDSIFRMLAAILWTGNLVFREDDSGYAAVSDQSVVDFLA
                     YLLEVDPARLVHAITIRILTPRNGEVIESPANVAQAMATRDALAKAIYNNLFDWIVER
                     INQSLRARQATANSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQEE
                     YAREQIKWTPISYFDNKIVCDLIESIRPPGIFSAMKDATKTAHADPAACDRTFMQSIN
                     GMSNPHLTPRQGSFIVKHYAGDVTYTVDGITDKNKDQLLKGLLNLFQISQNRFIHTLF
                     PDQVDQDNRKQPPSAGDRIRASANALVDTLMKCQPSYIRTIKPNENKSPSEYNVPNVL
                     HQIKYLGLQENVRIRRAGFAYRQSFEKFVDRFFLLSPATSYAGEYTWQGSYEAAVKQI
                     LKDTSIPQEEWQLGVTKAFIKSPETLFALEHMRDRYWHNMATRIQRMWRAYLAYRAEA
                     ATRIQRFWRKKRVGAEYLQLREEGHRVLQGRKERRRMSLLGSRRFLGDYLGINASTGP
                     GAQVRNAIQLGSNEKAVFSCRGEILEAKFGRSSKPSPRILIVTNSKYYIVAQVLGQNH
                     QVQIVVERALPLGAIKFIGTSTCRDDWFSLGVGSQQEADPLLNCVLKTEMFTQMKRVM
                     PGGFNLKIGDTIEYAKKPGKMQVVKVLKDAPTPHDFYKSGAVHTQQGEPANSVSRPTP
                     KGKPVPPRPITRGKLIKPGGPGGRPSRFPVNRTPQPRPSAVTSTSAAATASSRPVPQP
                     HAAAAAAAAAASVTIPSHTRQQSNSSAVRAPPPPPPAAPPVKPKIMAKVLYDFVGQRD
                     NELSIKAGELIEIVQKENNGWWLAKNAAGQAWVPAAYVEEQEAAPVVAPRPPPPPPAA
                     NGAVAKAKPAAPQPPAKRPAAGKKPAALQARDSGMSLNGSDSSRSNTPTPSLAGSLAD
                     ALLARKNAMAKKDDDDDEW"
     gene            complement(1512126..1513811)
                     /locus_tag="THITE_2121289"
                     /db_xref="GeneID:11519782"
     mRNA            complement(1512126..1513811)
                     /locus_tag="THITE_2121289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656487.1"
                     /db_xref="GeneID:11519782"
     CDS             complement(1512262..1513716)
                     /locus_tag="THITE_2121289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656535.1"
                     /db_xref="GeneID:11519782"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Thite2_2121289"
                     /translation="MTSLKTGPATPGLHLLYIPAVCALILFQGYYSQYLFNSDPALDP
                     GPLTRRQTLTFNILLLCLWWTYYRACTVDPGRYRFPPSPPSSSSSAPNPSREREPDLR
                     AAWSSTSISTLHKRARWCKKCAAPKPLRAHHCRHCGRCIPKMDHHCPWTGSCVSMQTF
                     PYFLRFLLYTNLALWYLARLLWHRAAAVWAARRLPAYLGPSLSSLIGLTVLALANAAT
                     VFALGVLLFTTVKGWVFNCTMIENWEVDRHEAVLARMDDTGPGGGHFWSDDDAALRET
                     LERIEFPYDIGVFANMAQAMGTRNPLRWFLPVFGGGPVINNETPGKGPGWEWEENGFN
                     DLPGLWPPPDPERMRQARRGAWPGAAQQLGPRYDQYQTPEEVKAAFAKRQKEDFLRRR
                     RVHAQQVHQRSGIIAELEETDELPRSGEERDGENDEWVETHLWTNSDGDRLWDYGVDE
                     DVEEELISADNKDDDVPLAELIRRRTVRSREDDG"
     gene            1514661..1517498
                     /locus_tag="THITE_2121291"
                     /db_xref="GeneID:11519783"
     mRNA            1514661..1517498
                     /locus_tag="THITE_2121291"
                     /product="glycosyltransferase family 90 protein"
                     /transcript_id="XM_003656488.1"
                     /db_xref="GeneID:11519783"
     CDS             1515032..1517434
                     /locus_tag="THITE_2121291"
                     /note="CAZy_ID 269968"
                     /codon_start=1
                     /product="glycosyltransferase family 90 protein"
                     /protein_id="XP_003656536.1"
                     /db_xref="GeneID:11519783"
                     /db_xref="JGIDB:Thite2_2121291"
                     /translation="MTLFDALGVWINESRASLIIGVVMLTLGTYLASSQDPPSTFFCS
                     SQDRRLFIGFLQWTGLLLDAAIAVVAWRTLAWARTTKSRLRTLSVILLVSSLGAALAY
                     WTSRLVFHASLAGYHFRGLDSLYFFDVVVDGLAFSAFLIATSLLATEGSPLSLVGTIT
                     FILGLPLAVQKTRLIGTWENVSPVVTYLALMCICFGFSSFIYASNMQSVAIVHRAFVV
                     FLLVILTIAATIYTPIKALQIVDNHPLVKVIYNARIEADRWLRHATVSDSLPVAVQEY
                     KERHNGREPPPKFDIWYDFAKNRRSEILDHFPQMENDLLPFWGIPPAKIREDTRRAAA
                     EPDMAMLQIRGGKPQHNLPPGSPYKAVMDDLLDLVKGFAGHLPDMELTINLDERPRVL
                     APWDEVQRVTRTAYRKRVSKLLPRAAPNLGEMPEAQAAITDKLVAQKNFTSVRALREM
                     TALTCPPGTKARAATHWDIRDFCTACAEPQSQGLYLANWPLSQDICHQSDLLRLHSFH
                     MTSPELRPLQELVPVFSRAKTDSYSDILIPLRRISEPAEPTTETFDMKYKQLFWRGNV
                     ARLGSSHELVRGGHQERLVHALNNPTRSEKTRLLLPRKKNRWAFEELPTAELNTFLPI
                     DVSFASYTACRSPNGGDCDAAANEFPKKPEVTEPLRNQYVMVVDTDNGPPREFLRTLR
                     SNSVPFYASIFKEWYSERLRPWVDFVPIDLRLHALHGTLAYFTGIQDGKKNQDIRKLN
                     GRELVMRGRPEDAEWIAEQGKRWAEKALRREDMEVYLFRLLLEWGRIVDDNRDESRFV
                     LP"
     gene            complement(1517499..1519012)
                     /locus_tag="THITE_2121292"
                     /db_xref="GeneID:11519784"
     mRNA            complement(join(1517499..1517915,1517995..1519012))
                     /locus_tag="THITE_2121292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656489.1"
                     /db_xref="GeneID:11519784"
     CDS             complement(join(1517563..1517915,1517995..1518601))
                     /locus_tag="THITE_2121292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656537.1"
                     /db_xref="GeneID:11519784"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="JGIDB:Thite2_2121292"
                     /translation="MVSSSSYLVCNTCGTQHGTADRTALTTCFICDDPRQYTPPSGQS
                     FTTLAALREAGEHHNEFHPFRPHPLPSLSASGQPPLFTSIITVPKFAIGQRAVLIPTP
                     AGNVLWDCITYLDEETVQKVNDMGGVKAMVISHPHFYSSHLEWAERFNCKVYLAADDK
                     RWLARRNEERQLFLDEIETKVEVDGVDTGVRVVKLGGHFPGSLVLLYEGHLFTADTLM
                     MTPAGRSNWSIDALGNPRERPKGVNTFSFLWSIPNMIPLSADEIMRMWHILKNYHFTS
                     AHGLFPDWDIEDQSLKARVLESMQIQIRAMGHGQHPLLEESLS"
     gene            complement(1520238..1521778)
                     /locus_tag="THITE_2121296"
                     /db_xref="GeneID:11519785"
     mRNA            complement(join(1520238..1520489,1520603..1521135,
                     1521215..1521446,1521503..1521778))
                     /locus_tag="THITE_2121296"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003656490.1"
                     /db_xref="GeneID:11519785"
     CDS             complement(join(1520400..1520489,1520603..1521135,
                     1521215..1521446,1521503..1521682))
                     /locus_tag="THITE_2121296"
                     /note="CAZy_ID 269969"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003656538.1"
                     /db_xref="GeneID:11519785"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="JGIDB:Thite2_2121296"
                     /translation="MSSSSRKSRITSAAHVIYTNAVYWPNYRVYNGDTPGQLNYGCIN
                     RVYYAFANVMPDGGVLLSDEYADARAPCDGVQGALGSLMHLKARYPHLQVLLSIGGGE
                     SAETFPIVASNAVLRDNFARSARGLVEASGLDGIDIVWEYPCTPQQGNDFLALVAAIR
                     IHLPEDRYLLTAALPAAKPILQNIDLQQTSAYLDTLNLTAYDFFGDWTHKSGHHAQLY
                     AINKDEPSGASGAQYIMSSGVPGKKILLGIPLFGRSFLHVTGPGHKNRGSGGNDGSFE
                     YSQLPRKGTKEQVDKRAVAAQCVGGDGGFVTYDNPDTVKGLFYWSAPSDAKDTKRSLV
                     ATGFKTLHSS"
     gene            1525719..1527611
                     /locus_tag="THITE_2121299"
                     /db_xref="GeneID:11519786"
     mRNA            join(1525719..1526563,1526641..1527611)
                     /locus_tag="THITE_2121299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656491.1"
                     /db_xref="GeneID:11519786"
     CDS             join(1526123..1526563,1526641..1527540)
                     /locus_tag="THITE_2121299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656539.1"
                     /db_xref="GeneID:11519786"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Thite2_2121299"
                     /translation="MADSGESGGDVQITFKVKCSNDKIHTITMPESATVLDLKTKLAG
                     SDFEDTPVERQRLIYSGRIMKDSDALSVYKIKNMNTIHMVKSARSNPTPAASSAASTT
                     PTPPAVPQNMASGSSASDLLAGLTGARFAGHANLPSADLFGADGGMGAPPSEEQMAEM
                     LSNPMIAQTMNEALNNPNFIDYMIRSNPALASMPNAREMLQSPYFRQMMTNPEAIRMA
                     ARMRRILQGGGGGGEGSAFPAPGATDNTPADAPSAGSSATASNNTDQALRALFGAPGA
                     SGGPFAPGANPFASLLGIVPPAGPSSGAAATTQGPSASNPAASPENQNGPTGSSPNAQ
                     GQAGNAGQPFNPFSALFGQGQPGGAQGANASNPFALPPISPEVLQQVLQSWGLASPSA
                     TTAPPDNRPPEERYAEQLRQLNDMGFFDFERNVTALRRSGGSVQGAVEYLLSNP"
     gene            1528142..1529192
                     /locus_tag="THITE_2121301"
                     /db_xref="GeneID:11519787"
     mRNA            join(1528142..1528344,1528412..1528572,1528693..1529192)
                     /locus_tag="THITE_2121301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656492.1"
                     /db_xref="GeneID:11519787"
     CDS             join(1528334..1528344,1528412..1528572,1528693..1529036)
                     /locus_tag="THITE_2121301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656540.1"
                     /db_xref="GeneID:11519787"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="JGIDB:Thite2_2121301"
                     /translation="MLRWYQARLAARPLLTQAVTTSILFAIGDVTAQQLVDKKGLEKH
                     DLARTGRMALYGGVVFGPAAATWFRLLSRHVNLRSPNATILARVACDQGIFAPTFIGV
                     FLSSMAVLEGTSPREKLAKSYSDALLTNWMIWPFVQLVNFKLVPLQHRLLFVNVVSIG
                     WNCYLSFLNSS"
     gene            complement(1529179..1531273)
                     /locus_tag="THITE_127415"
                     /db_xref="GeneID:11519788"
     mRNA            complement(join(1529179..1529594,1529651..1531273))
                     /locus_tag="THITE_127415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656493.1"
                     /db_xref="GeneID:11519788"
     CDS             complement(join(1529526..1529594,1529651..1531078))
                     /locus_tag="THITE_127415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656541.1"
                     /db_xref="GeneID:11519788"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="JGIDB:Thite2_127415"
                     /translation="MTSTGAPQDQTPTPQQLSELRQKYTLAGQGHVFTFYDSLSAAEQ
                     ASLYGQLTLFDPTYINTIAAKALAPPAAADGSAAQPSLEPLPDSARASIMDSRPEDID
                     RWYSEGLDLIAANKVGVVLMAGGQGTRLGSSAPKGCFDIGLPSGKSLFQIQAERIRKI
                     EELAAKNAGSGRSVTVPWYVMTSGPTREPTEQYFKEHNYFGLKPENVFIFEQGVLPCI
                     SNDGKILLESRSKVAVAPDGNGGIYNALVECKVLDDMKRRGIEHVHAYCVDNCLVKVA
                     DPVFIGFSASAKVDIATKVVRKRNATESVGLIVCKNGRPDVVEYSEIDPAVAAEEDPK
                     QPGVLKFRAANIVNHYYSFRFLETIPQWAKTLPHHVARKKIPYADLETGETVKPTKPN
                     GIKLEQFVFDVFPMLPLSKFACMEVRREDEFSPLKNARGTGEDDPDTSKYDIMAQGKR
                     WVQAAGANVVSEDPKAGIEVSPLMSYGGEGLEKLLNKTIVAPAAIEVE"
     gene            1531845..1533201
                     /locus_tag="THITE_2121304"
                     /db_xref="GeneID:11519789"
     mRNA            1531845..1533201
                     /locus_tag="THITE_2121304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656494.1"
                     /db_xref="GeneID:11519789"
     CDS             1531988..1533010
                     /locus_tag="THITE_2121304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656542.1"
                     /db_xref="GeneID:11519789"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="JGIDB:Thite2_2121304"
                     /translation="MPPSETVEDGCPQPTFQGRLKLESFMFNGGATAGGLRRSPRLSV
                     TPSATASPPAPSPIPTSRSPAKRKALSLAGDGVDSSPSASSSTPSSPSSRLKKKRARQ
                     RSGYAPPSTYAHLPLLPDAIAPNLLVLFVGLNPGIETARTGHAYAHPTNLFWRLLYSS
                     GVTPRLCSPTEDRQMPALYSLGLTNIVARPSRNGAELSKAEMDAGVEILEEKVRRWRP
                     EVVCVVGKSIWESLWRVRHGRAIKADEFSYGWQDERENLGLVQGGVQKEEEKETGVDY
                     SADWKGARIFVATSTSGLAATLRPKEKEEIWKKLGAWVEERRAQRAQAAASATEPISQ
                     SNLNEG"
     gene            complement(1533174..1534773)
                     /locus_tag="THITE_2121305"
                     /db_xref="GeneID:11519790"
     mRNA            complement(join(1533174..1533917,1534163..1534773))
                     /locus_tag="THITE_2121305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656495.1"
                     /db_xref="GeneID:11519790"
     CDS             complement(join(1533338..1533917,1534163..1534473))
                     /locus_tag="THITE_2121305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656543.1"
                     /db_xref="GeneID:11519790"
                     /db_xref="JGIDB:Thite2_2121305"
                     /translation="MRLSCLLLASALLGDAAVSAAVAPPFAEVAAHQPYQDSKRDAPS
                     YEDLWKRKGGGGGGGRGGGGGGSSGGSSGSSSGSSSSGGGRGGSSGSSGSSSSGSSGS
                     GASGGRGSSSSNAGGRTTTGSGPAPVYGGGRYYSGGAAVPYTAGSRSPSGLVPAFFIG
                     SALAFWPGVWLYGAQLYHFNHPYSFYNASSKQNETKPVTCGCDPYNECSCDENGDNQY
                     MKDLVGNGSYAGLNKSVINVANVNGTSTILINGTLPNGTTAAGGSESPNAAGDGLHGL
                     LQHAGWWPVVATVCAIVLTA"
     gene            <1535838..>1537016
                     /locus_tag="THITE_2055241"
                     /db_xref="GeneID:11519791"
     mRNA            join(<1535838..1535926,1535996..>1537016)
                     /locus_tag="THITE_2055241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656496.1"
                     /db_xref="GeneID:11519791"
     CDS             join(1535838..1535926,1535996..1537016)
                     /locus_tag="THITE_2055241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656544.1"
                     /db_xref="GeneID:11519791"
                     /db_xref="JGIDB:Thite2_2055241"
                     /translation="MAPPHPDDRSLLDRLNALKSTSVSLDKPANTATAAAAVPGSESP
                     PGASREDALAARLRILRSRQGSSNHDGTGTIPPPAAEPTSSGGRPAKGKPAGEASPLS
                     RPGPMNASAKLDSYQFFSSEADDEEALDELLESLGDAHFDLAEGEDAGTKPDSDPSGD
                     AKKVADFLNSLQQGSENPLPKGDSAASADDDDDSDGEHMTRAVETILSQLGDEITSLP
                     PPAPAAETATGPDPEADELSLTLPAVPSQLQDPAPDPKPEDDFERNISARLASLRGLG
                     TLDALGLPSAPTFRPQDRRASDLGQGLLRSTKYTDEDQMTWCVACLDDATIRCVGCDN
                     DVFCARCWKEMHLGPSAGYDERGHKWVKFERSRRA"
     gene            complement(1537414..1539566)
                     /locus_tag="THITE_2121308"
                     /db_xref="GeneID:11522399"
     mRNA            complement(join(1537414..1539157,1539294..1539566))
                     /locus_tag="THITE_2121308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656497.1"
                     /db_xref="GeneID:11522399"
     CDS             complement(join(1537428..1539157,1539294..1539396))
                     /locus_tag="THITE_2121308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656545.1"
                     /db_xref="GeneID:11522399"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="JGIDB:Thite2_2121308"
                     /translation="MASAGLLQTSLIWVSYGVAVALVLFVAIITTITWQTPHERSIAV
                     TAVSIFSLTALLATVLLLPVDIALVSSTASAHLGAKKDWATPARVEGILQTLKIVYYT
                     LYTLDALLCLIVLPFTYFWYEEYDEVEEEEDRTSSRGARLWRALKYTLGFVFLVVVLF
                     LIGFFVPAAGKASSGRHLDLDYFKRLLVANNGEKALTFGVGLLMTLGTLLYVLYTGSG
                     LALLPVSFIKSAPSISAPQLSATTASALERNRELQRQLEMRNAGRPEGMSQKDRRELD
                     ALLREERTLVRRERLAAEARGEGRGRIYRVWTKLEAVFRPLKLLGGLFLLLLAILVWV
                     SMLITGIDKAANSLCKQHCGYILGHLNVFQPINWIFVQSAKAFPVDYILMALLVLVFF
                     SSSITGLASIGIRFLWVRVFQIKKGRTPPQALLIATVLLALIILAINYAVAMLVAPQY
                     AIYGTQTFCVNPPRHPGEQPDCREHHDMVRPCSEAFSEPAAKDVCTPTVMSTFLNRVT
                     INWPVFGAVDFWAQFAFFAVFLIVFLTSLFRAPRLNLSELDEEAEADEEEGLLASTGR
                     RFGATWGDITGRPTMATGGQGRAQGQEGYGTAAGRDGSGSGPVA"
     gene            1539740..1544993
                     /locus_tag="THITE_2121311"
                     /db_xref="GeneID:11522400"
     mRNA            join(1539740..1542031,1542106..1542422,1542482..1542655,
                     1542710..1543952,1544030..1544993)
                     /locus_tag="THITE_2121311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656498.1"
                     /db_xref="GeneID:11522400"
     CDS             join(1539934..1542031,1542106..1542422,1542482..1542655,
                     1542710..1543952,1544030..1544580)
                     /locus_tag="THITE_2121311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656546.1"
                     /db_xref="GeneID:11522400"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="JGIDB:Thite2_2121311"
                     /translation="MQCYTELTPPTAVTHSTTLQFIPGQGTNLVVAKSSLLQVFRTKV
                     VSTELEASPDSGHRSRNAARYESRLANDDDGLEASFLGGDSLALRTDRANVTKLVLVA
                     ETPLAGTVTGLARIKTPHARHGCDSLLIALKDARLSLVEWDAERHALATVSIHYYEQE
                     ELQGSPWAAPLSHYVNFLEADPGSRCAALKFGARNLAILPFRQADEDIDMGDWDGELD
                     GPRPAKDQSSAVIDGASNIEDTPYSPSFVLRLSNLDPSLLHPVHLAFLHEYREPTFGI
                     LASTASASNSLGRKDHFTYMVFTLDLQQKASTTILSVGGLPQDLFRVVPLPAPVGGAL
                     LVGSNELIHIDQSGKANGVAVNPMTRQCTSFGLVDQSELNLRLEGCVVDVLTADLGEL
                     LVILNDGRMALVTFRIDGRTVSGLELRMLPASSGGSIIPGRVTTLSRVGRNAMFAGLE
                     EGDSVLFGWAKKQSQAGRRRPRAKDAVLQMDEEAGEEEEEEEDEDEDDLYGEEPAARQ
                     QPSSTASSLMTGDLTFRIHDRLVSIAPIQAMTYGQPVWLPGSEEERNSAGVHSDLQLV
                     CAVGRDKSASLATINLAIAPKVIGRFEFPEARGFWTMCAKKPIPKSLQGDKAGASLGN
                     GYDTSGQYDKFMIVGKVDLDGYEKSDVYALTAAGFESLGGTEFDPAAGITIEAGTMGK
                     GSRIIQVLKSEVRCYDGDFGLSQILPMQDEETGAEPRAVSASVADPFLLIIRDDSSVF
                     IARIDSSNELEELDKDDPVLSTTKWLTGCLYADSAGVFAEESMGKPASTAQCVLMFLL
                     SASGALYIYRLPDLARPIYVAEGLSYIPPGLSADYAGRKGTAKETLAEILVADLGDST
                     HKSPYLILRHANDDLTLYQPFRSRKATEQAFSETLFFQKVPNTALAKSPQEADEDEAS
                     HQPRFLSMRRCDNVGGYSTVFVPGASPSFIIASSKSMPRVMPLQGSGVIAMSPFHTEG
                     CEHGFIYADSRRIARVCQFPDGCIYAETGVAVRKIPIGEDIAAVAYHPPMQSYVVGCN
                     TSEPFELPKDDDYHKEWARENLSFKPTVDRGILKLLSPITWTVVDAVQMEPCETILCV
                     ETLNLEVSEFTNERKQLIAVGTALTKGEDLPTRGRVYVYDIADVIPEPGRPETGKKLK
                     LIAKEDIPRGAVTALSEIGTQGLMLVAQGQKCMVRGLKEDGSLLPVAFMDMNCYVTAA
                     KELPGTGLCLLADAFKGVWFTGYTEEPYKMMLFGKSSTKLEVLNADFLPDGKELSFVV
                     SDADGYIHILQFDPEHPKSLQGHLLLHRTTFNTGAHHATKSLLLPASTPADKEKNDGN
                     AANAQAKAKASDNKQPREPAAQRPHVLLLASPTGVLAALRPLSESAYRRLSSLAAQLT
                     NSLPHPAGLNPRGYRAAGAECPPAGVDAGLGRSIVDGTVLERFAELGMARRVELAGRA
                     GYAGIGEVRAELEGVLGWAGLSYF"
     gene            complement(1544994..1546181)
                     /locus_tag="THITE_2121314"
                     /db_xref="GeneID:11522401"
     mRNA            complement(1544994..1546181)
                     /locus_tag="THITE_2121314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656499.1"
                     /db_xref="GeneID:11522401"
     CDS             complement(1545407..1546063)
                     /locus_tag="THITE_2121314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656547.1"
                     /db_xref="GeneID:11522401"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="JGIDB:Thite2_2121314"
                     /translation="MAAAADQNSSRRRAGSLAEPYPADKSHRPHGMLAPEYQAREPGD
                     EPRDTLPRRTASLRERYPGDMSHRPLAMITREHRAADRAPHLHNHRRQQPSDIIDLLD
                     VTGPVPGVSYHHGGPYDATMKERNTNTKYPPVEAVRDTNLEALKATPAEFVQDSLVKH
                     VPLRGTAVIPPGMKDLAGRTMEYEEGTDLTRDGDALGGTYDSWEYMVSQPAALSEPGC
                     "
     gene            <1548011..>1548790
                     /locus_tag="THITE_2021557"
                     /db_xref="GeneID:11522402"
     mRNA            <1548011..>1548790
                     /locus_tag="THITE_2021557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656500.1"
                     /db_xref="GeneID:11522402"
     CDS             <1548011..>1548790
                     /locus_tag="THITE_2021557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656548.1"
                     /db_xref="GeneID:11522402"
                     /db_xref="JGIDB:Thite2_2021557"
                     /translation="LPPLPPSFHDLYASTVRTATRDDPSLHQGRTRQNPHVPGNWPSH
                     IYIEWHPPSAVHSLLVELVSSLQAQARTLSSAVQVTSLLLSDLAAPQPLHISLSRPIV
                     LSSAQKDTFSAEVEAAIRASGIAAFTLACSTVEWHRTAESGRSFLVLRVHGTQGTREG
                     DTEDNPNPELTELLRRCNAVVAKYGQPGLYRWAEGDDVSRVWKAFHVSIAWSFAEPTE
                     ELKMVTERVFGQTTAKGRIQEVRVPVEGIKVKIGNTVNHVAL"
     gene            complement(1549003..1551803)
                     /locus_tag="THITE_2121318"
                     /db_xref="GeneID:11522403"
     mRNA            complement(join(1549003..1549266,1549327..1550945,
                     1551067..1551803))
                     /locus_tag="THITE_2121318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656501.1"
                     /db_xref="GeneID:11522403"
     CDS             complement(join(1549158..1549266,1549327..1550945,
                     1551067..1551168))
                     /locus_tag="THITE_2121318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656549.1"
                     /db_xref="GeneID:11522403"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="JGIDB:Thite2_2121318"
                     /translation="MKSAARLFYLSVFALWGPQVRCQNSERPSQDACAISPKAIVSDA
                     CASYSTLERLNRNVKPALDDLTQTTDFFSHYRVNLFHKKCPFWDDGNGMCGNIACAVE
                     TLDNEDDIPPVWRASELGKLEGPRARHPGKTVQKEEPQRPLRGGLGADVGESCVVEYD
                     DECDERDYCVPEDESATSKGDYVSLLRNPERFTGYTGVGAKQVWDAIYRENCFQRSSF
                     PHSAALGHDTAAKGPAAMDFRAVIEAAGRQQALEQQRQQNPLTPFVAQTGLELEDECL
                     EKRVFYRVISGMHASISTHLCWDFLNQTTGQWQPNLDCYVSRLHKFPDRISNLYFNYA
                     LVTRAVAKLGPYLSEQQDYTFCLGDAAQDAETRTKVLAVTEKAASVPQIFDESLMFKN
                     GEGPSLKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQTAGYGTALKVLFEFDNNVKPQV
                     PVLKRTELVALFNTYARLSSSMEAIQKFRDMVMQAEAAEKSEERLREAGEAHVIPDQA
                     KKPQHAIVPKSSEAAPSEAEDEAFEESESFEDRSRTIKAEFDEELGRVIKAFKYVLKS
                     WINFPVTLWHIILSELERFWQYYLGLPVSPRSWAFDPPHVDEL"
     gene            complement(1552125..1553400)
                     /locus_tag="THITE_2069837"
                     /db_xref="GeneID:11522404"
     mRNA            complement(join(1552125..1552598,1552654..1552712,
                     1552771..1552915,1552976..1553400))
                     /locus_tag="THITE_2069837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656502.1"
                     /db_xref="GeneID:11522404"
     CDS             complement(join(1552568..1552598,1552654..1552712,
                     1552771..1552915,1552976..1553097))
                     /locus_tag="THITE_2069837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656550.1"
                     /db_xref="GeneID:11522404"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="JGIDB:Thite2_2069837"
                     /translation="MPTPEQMGIDISRRNRTPRQLTEKERAALDEFIDLIHYSTRYSD
                     NEFEYRHVQLPKAMLKAIPAEYHDKSKGTLKLLWEEEWRAMGITQSLGWEHYEVHEPE
                     PHILLFKRPLNYQPPQ"
     gene            <1553396..1557408
                     /locus_tag="THITE_135209"
                     /db_xref="GeneID:11522405"
     mRNA            join(<1553396..1553415,1554398..1554461,1554690..1554790,
                     1554948..1555640,1555698..1555953,1556011..1556563,
                     1556643..1557408)
                     /locus_tag="THITE_135209"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656503.1"
                     /db_xref="GeneID:11522405"
     CDS             join(1553396..1553415,1554398..1554461,1554690..1554790,
                     1554948..1555640,1555698..1555953,1556011..1556563,
                     1556643..1557076)
                     /locus_tag="THITE_135209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656551.1"
                     /db_xref="GeneID:11522405"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Thite2_135209"
                     /translation="MGSVRNLSAGAGFADGDDRAGKRQKLPGPPSDYNLMQGESYEST
                     TAYGLHFLETIRRTKDKSGRLVASYFEDLVPRETNPEYYNRIRMPISLKIIEQKLRNQ
                     EFKNLSELESYFKRMVTNAKEFYPKNSEVFEDAERVRKALSNYMTKTNPAYKLNPRYS
                     CQATPLPSDTQTAAEEARAPENGTDGAQGEDEKANGEEAAQGDEEDAEGDEGDEGEEG
                     DEGGEEDDENPKRIILKRKGPGRPPRAGSEQARKFDKSGRVKADHEYEGVPYKGLSFQ
                     QAQEKIVEELIRKSDGSGPYFLDFINLPARTYKDYFAVITSPLSLKGLQKLVKGIHGR
                     QPATGVSDFKSWAAFEEKASLLWTNAHFYNEEGSVIHSLATELKECFEKELNEAKAQV
                     QEPPQPKIKLKMTPGQETPVVGSKKITIHVGGSRGSAAASPAPQANQPNDSGRHDGAT
                     DGSRPVSPPAANTSGAGFQADSARPLPGSVASPGPSLAGPTPGVVSQQSPAALPRQNG
                     SVAPGAANVPNGTSAPGQNLQSHPSTHQLQNGHPTAVSLNVPQIWDHKYRAPGRGLAD
                     SLMPSVVIRTHPSVVMDHRFRLEIPAHPKEAQQNLAIHIPGQHSRLQLIPRLAPFEQQ
                     GRSYRLFVTVNGQMVGRATPLPVADDPLPVNAVVFDLSLQHITNIIGITVIAALPKGQ
                     RLPNGSDCEVEKLVINAQLLRVYS"
     gene            1558524..1560022
                     /locus_tag="THITE_2121333"
                     /db_xref="GeneID:11522406"
     mRNA            1558524..1560022
                     /locus_tag="THITE_2121333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656504.1"
                     /db_xref="GeneID:11522406"
     CDS             1558732..1559979
                     /locus_tag="THITE_2121333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656552.1"
                     /db_xref="GeneID:11522406"
                     /db_xref="JGIDB:Thite2_2121333"
                     /translation="MLRDDALTPEFWPCVDQLAMQLMVLLLPLIRLMDKYFPASQAKP
                     MRDIYQALHAIVAEAAYLSIGIRWSRNIFRFSLPYPGEPWDMDQEQVDNAVYNASEAA
                     RDKADKIDEELWKAKREPPRQPGAVAGSNIPIIGGRAGMMIAAVRNRLEAVMRRVIGQ
                     GHEEGVNDEEDAAHFRPSSRLAKVQIILWPMLQRFAAVGEIDPKTGAANGENVTTIFK
                     SQVVYYCGWADESGGSQSEHYPTLADWVHESKRERMWKSLMRLRWIAYAAAVWLLLGF
                     LSRYISVVDDILQIVRHGLVGLAKYVAREALLFVMEVLITVIAIAIGIAKIVMFLAYA
                     VRNTLGHLLALAARLLWGAVGSIGGAAETAGVDRAAGWYDPAFSLPELSWQSMRGMAK
                     AVAGEVVWKTVTVQVPAGYTRTG"
     gene            1560313..1561155
                     /locus_tag="THITE_2081496"
                     /db_xref="GeneID:11522407"
     mRNA            1560313..1561155
                     /locus_tag="THITE_2081496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656505.1"
                     /db_xref="GeneID:11522407"
     CDS             1560407..1561102
                     /locus_tag="THITE_2081496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656553.1"
                     /db_xref="GeneID:11522407"
                     /db_xref="JGIDB:Thite2_2081496"
                     /translation="MDAAALLKSQGWRGKGFSLHPTDNNIGLAKPLLLSRNTDGRGIG
                     QKTHYTSDQWWLHAFDQKLKGLDTSKKGTVVQTVTQGKLDVIASTQPNGKYTGASGLY
                     ASFVRGGMLEGTIEAGTATGESTDATPVSSEDSDGSVSKTEKQSDTRGEREARRAARR
                     LRKAEKAARKAAEAEAARRAAEKAAKKELKKATRANETKEQRRARRAERRARKEAKRR
                     EREGAAPHKSDQG"
     gene            complement(1561124..>1562558)
                     /locus_tag="THITE_2156116"
                     /db_xref="GeneID:11522408"
     mRNA            complement(join(1561124..1561571,1561632..1561736,
                     1561800..1561888,1561937..1562109,1562167..1562211,
                     1562266..1562487,1562545..>1562558))
                     /locus_tag="THITE_2156116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656506.1"
                     /db_xref="GeneID:11522408"
     CDS             complement(join(1561353..1561571,1561632..1561736,
                     1561800..1561888,1561937..1562109,1562167..1562211,
                     1562266..1562487,1562545..1562558))
                     /locus_tag="THITE_2156116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656554.1"
                     /db_xref="GeneID:11522408"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="JGIDB:Thite2_2156116"
                     /translation="MANSQYEYVKQFEQPDRLLPNTWIVIRIDGRGFTKFANKYRFEK
                     PNDRRALELMNAAAKAVMTELPDITIAYGVSDEYSFVFHKTCSLFDRRSSKLVSTVVS
                     TFTAYYVHFWPTYFPNSPLSPPLPSFDGRAVCYPSVENLLDYMSWRQVDCHINNLYNT
                     TFWALIQQGGIGATEAEERLKGTLASDKNEILFSEFGINYNNEPEIYKKGSVVFRDYE
                     LVEPGTHNPTVEADSLAKPVQQSKSQAEKDKKRRSKARIVVEHVDIIKPDFWERRPWL
                     LSNKPGKIPKEP"
     gene            1562981..1564921
                     /locus_tag="THITE_2121337"
                     /db_xref="GeneID:11522409"
     mRNA            join(1562981..1563448,1563521..1564921)
                     /locus_tag="THITE_2121337"
                     /product="SWD1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656507.1"
                     /db_xref="GeneID:11522409"
     CDS             join(1563090..1563448,1563521..1564565)
                     /locus_tag="THITE_2121337"
                     /note="1| Set1 complex component swd1 [Trichophyton
                     equinum CBS 127. 97] Contains conserved domain
                     WD40[cd00200], WD40 domain"
                     /codon_start=1
                     /product="SWD1-like protein"
                     /protein_id="XP_003656555.1"
                     /db_xref="GeneID:11522409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121337"
                     /translation="MNFLLSDDYLLQDYPENITNTIRSGHSTCVRFNRKGDFLASGRV
                     DGTVVIWDLETMGVARKLRGHSKNITSLSWSRCGRYLLSACQGWKVILWDLQDGKRHR
                     EVRFRAPVYGAELHPWHHYQFAAALFEDQPMLVDITAPAPVCYVLPSVPKRPNTDADA
                     TLKEKQAKEDAKHMTTAIVYTATGDHLLAGTTKGRLNIIDARTREIIYSEKIASGVIT
                     TLRLTESGKELLVNAQDRIIRTFRVPNLSAADLDPDTIQLPLEHKFQDVVNRLSWNHV
                     AFSATGEYVAASTYNNHELYIWERGHGSLVRMLEGPKEEQGVIEWHPHRALLAACGLE
                     TGRINIWSVTSPQRWSALAPDFVEVEENVEYIEREDEFDIHPQEEIQKRRLVQEDEDV
                     DVLTVEDGDGLGNGMDTFRMPILFNLGESDSEEEFVNVSLGTLRRKSPGEQDEDEMTG
                     EERGPGRKPGRGRAKKK"
     gene            1565462..1571176
                     /locus_tag="THITE_2121340"
                     /db_xref="GeneID:11522410"
     mRNA            join(1565462..1566003,1566064..1570934,1570998..1571176)
                     /locus_tag="THITE_2121340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656508.1"
                     /db_xref="GeneID:11522410"
     CDS             join(1565647..1566003,1566064..1570934,1570998..1571025)
                     /locus_tag="THITE_2121340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656556.1"
                     /db_xref="GeneID:11522410"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="JGIDB:Thite2_2121340"
                     /translation="MANLIFAHSSAPIRTIKEIQFGLLSPEEIKGMSVCHVLYPETMD
                     ETRTKPRDGGLNDPLLGSVDRQFKCKTCTENMSECPGHFGHIELARPVYHPGFIRRTK
                     KLLEIVCHNCSRVLADRSDPQYAAAMRIRDPKVRFKRVWDICKSKRRCDNDPPKNAED
                     GDSAGGLLGGHGGCGNIQPVIRQQALTLWGHFETKDEEGAKNKEKKIITPEMALNIFR
                     RMSDQEMVDIGLNISQARPEWMIITVLPVPPPPVRPSISMDGTGTGLRNEDDLTYKLG
                     DIIRANGNVRQAIAEGSPQHIITDFENLLQYHVATYMDNDIAGQPQALQKSGRPVKAI
                     RARLKGKEGRLRGNLMGKRVDFSARTVITGDANISLDEVGVPRSIARTLTYPETVTPY
                     NIAKLTQFVQNGPNEHPGARFIIRSDGTRIDLRHHRRATGIQLEYGWKVERHLIDGDY
                     IIFNRQPSLHKESMMGHRVRVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQTEETRA
                     EVKELCMVPLNIVSPQRNGPLMGIVQDTLAGVYKLCRRDVFLTKEQVMNIMLWVPDWD
                     GIIPLPAIFKPRPRWTGKQIISMIIPKIINIHMNSDQPDKDHPFKDDGLLIQQGELMF
                     GLLSKKSVGATGGGIVHLCYNELGPQGAMDFLNGCQRVVNYWLLHNGHSIGIGDTIPD
                     AKTIELVQKHIDDEKEEVRRLTQQATNNELEPLPGMNIRETFENKVSTALNKARDKAG
                     TTTEKSLKDLNNAVTMARSGSKGSAINISQMTALVGQQIVEGKRIPFGFKYRTLPHFT
                     KDDYSPEARGFVENSYLRGLTPSEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALE
                     DAEAHYDGTVRNSLGDIIQFIYGEDGLDGVAIEKQRVDHMNLSNKLFDKRFRLDVMDE
                     ESSAAALDALEFGREMASDPMVQQLLDQEYEQLLADRKLLREINRRKRGEDNMQLPLN
                     VARIIETAKKLFKVDDSHRSDLTPKDVIPAVRALLDRLVVVRGTDAISKEADYNATLL
                     FKIQLRSRLAFKRLAVEQRINKLAFEHILGELENRWSRSMVAPGEMVGVLAAQSIGEP
                     ATQMTLNTFHFAGVSSKNVTLGVPRLKEILNVAKDIKTPSMVVYLDSENATQEDAKRL
                     RNAVEHTSLRSVTAVTEIYYDPDITSTNIPEDFDMVESYFLIPDSSDQDSIENQSRWI
                     LRLTLDRQKMLDKGLRVEDVAQRIKEEYRKDVAVIFSDNNAEEMVIRIRVIRQDDDKD
                     EDGNKIIEDDVMLKRLEKHLLDHCTLRGVVGIERAFLNKGTKLVERADGSQVANKDAP
                     ECMEWYLDTQGTALREVLTIEGVDTKRTSTNDLYQIVDVFGIEAARAALLQELTQVLA
                     FDGSYVNHRHLALLVDVMTYRGSIAAVTRHGINRADTGALMRCSFEETVEILLEAAAV
                     GELDDCRGISENVMLGQMAPMGTGHFDVLLDPKMLETVISDNSRMGLMPGMTIKGSQL
                     EGAATPYDTGSPMADNGYLGSYSPTMGNFSPIQGGGSDSPSGFGTEYGGGFGSSTVNP
                     YSTSPRATSPFSTSPTSPFGYGGYSPSSPAGYSPTSPLIDAGGRYASSPQFSPSSPSF
                     SPTSPMLRPGSPTSPNYSPTSPSYSPASPAATRHYSPTSPAQFNSPTSPSYSPTSPSY
                     SPASPNLHATSPSYSPASPTWSPTSPDAYSPTSPSFQRSPGQQMSPTSPGYSPTSPSF
                     SPRTPGRGPAGGNGDQYSPTSPTND"
     gene            <1579838..>1581100
                     /locus_tag="THITE_2091721"
                     /db_xref="GeneID:11522411"
     mRNA            join(<1579838..1580075,1581018..>1581100)
                     /locus_tag="THITE_2091721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656509.1"
                     /db_xref="GeneID:11522411"
     CDS             join(1579838..1580075,1581018..1581100)
                     /locus_tag="THITE_2091721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656557.1"
                     /db_xref="GeneID:11522411"
                     /db_xref="JGIDB:Thite2_2091721"
                     /translation="MPRAAHPAANYMSIFAGCVPRPGRAGFSGRCLGTALLSFSGQGN
                     GDPRVTSTSNLPQAVTGTAARHLAVFFCLLEAADAEKAGSLVEQIRCGPGLLSEQSNR
                     LVLL"
     gene            1583407..1584479
                     /locus_tag="THITE_2171257"
                     /db_xref="GeneID:11522412"
     mRNA            1583407..1584479
                     /locus_tag="THITE_2171257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656510.1"
                     /db_xref="GeneID:11522412"
     CDS             1583504..1583842
                     /locus_tag="THITE_2171257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656558.1"
                     /db_xref="GeneID:11522412"
                     /db_xref="JGIDB:Thite2_2171257"
                     /translation="MANPTPEQIRQLSEQAVDFVPENARSRPSTFLSLAPQTSDSYPR
                     SQRIKQPLTAEALAEATKQDGANANAIMRRASSLSSDGSKLRFLKLGPVHWGEHQDDH
                     QADFYEVAVE"
     gene            complement(<1591620..>1592693)
                     /locus_tag="THITE_2091723"
                     /db_xref="GeneID:11522413"
     mRNA            complement(<1591620..>1592693)
                     /locus_tag="THITE_2091723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656511.1"
                     /db_xref="GeneID:11522413"
     CDS             complement(1591620..1592693)
                     /locus_tag="THITE_2091723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656559.1"
                     /db_xref="GeneID:11522413"
                     /db_xref="JGIDB:Thite2_2091723"
                     /translation="MAPGTFEYFFDLPPELREQILSHVCLFPPGVLVGGGTDGRTVSL
                     PIRASPALSTAHAATTSKRHYGGGGGADGETAADGESAELPAGPPVNLFLASPVLYRE
                     AGDLYYGRNVFHLDFTAASWGRRQQRIRVVGATSTTGYATTGSVTESGSRGEGRTGAG
                     MGPGTGTGTGLAAAMRLLTHPATANARRRLRSVSVRVRRLGALMLDVLVPALRDAVLN
                     GALRRVRVDVLEAGVTGAVSLGQERRLRALDHGGNPALRALLVLLTDPDMERAELRVP
                     RWLHAPFWCHFHGGMVSEGGDSAGCAMAGRQGRGWKGGDCGDEFLQVDIHRLVEACAG
                     GGDAAEFRIKKAGFGCQRMAVGP"
     gene            complement(1593267..1595818)
                     /locus_tag="THITE_2121352"
                     /db_xref="GeneID:11522414"
     mRNA            complement(join(1593267..1593610,1593671..1594479,
                     1594609..1594988,1595052..1595217,1595291..1595468,
                     1595585..1595818))
                     /locus_tag="THITE_2121352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656512.1"
                     /db_xref="GeneID:11522414"
     CDS             complement(join(1593342..1593610,1593671..1594479,
                     1594609..1594988,1595052..1595217,1595291..1595468,
                     1595585..1595627))
                     /locus_tag="THITE_2121352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656560.1"
                     /db_xref="GeneID:11522414"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Thite2_2121352"
                     /translation="MADEVYDGAIGIDLGTTYSCVATYEGTNVEIIANEQGSFTTPSF
                     VSFTEEERLIGEAAKNQAAMNPKNTVFDVKRLIGRRFDDPTVKKDMESWPFKVVDDNG
                     NPKVEVEYLGSTHTFSPQEISAMVLSKMKEIAEVKLGKKVEKAVITVPAYFNDNQRQA
                     TKDAGAIAGLNVLRIINEPTAAAIAYGLGSGKSTKERNVLIYDLGGGTFDVSLLNIQG
                     GVFTVKATAGDTHLGGQDFDTNLLDHCKKEFMRKTKKDLSGDSRALRRLRTACERAKR
                     TLSSGTQTTIEIDSLFDGEDFNMQITRARFEDLNAKAFTGTLEPVAQVLKDANIEKSQ
                     VDEIVLVGGSTRIPRIQKLLSEFFDGKKLEKSINPDEAVAYGAAVQAGILSGKATSAD
                     TSDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVADNQQTVQFPVYQG
                     ERVNCEDNTSLGEFTLAPIPPMKAGEPVLEVVFEVDVNGILKVTATEKTSGRSANITI
                     SNSVGKLSASEIESMISDAEKFKSKDEAFSKRFEAKQQLESYISRVEEIISDPTLSLK
                     LKRGQKDKIEQSLSEAMAQLEIEESTAEDLKKKELALKRLVTKAMSSR"
     gene            1596289..1597773
                     /locus_tag="THITE_2081505"
                     /db_xref="GeneID:11522415"
     mRNA            join(1596289..1596778,1596846..1596917,1596976..1597773)
                     /locus_tag="THITE_2081505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656513.1"
                     /db_xref="GeneID:11522415"
     CDS             join(1596584..1596778,1596846..1596917,1596976..1597464)
                     /locus_tag="THITE_2081505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656561.1"
                     /db_xref="GeneID:11522415"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Thite2_2081505"
                     /translation="MSEQVDLTTIPISPEGSNDPNGAAAEAAEDANKTITVFHDKDNF
                     NVKHPLSCRWTLWFTKPASGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKS
                     DYHLFKEGVRPEWEDPQNKHGGKWSFQFKEKRSVNIDELWLHTMLAAIGETLEDEEDG
                     EVMGVVVNVRKAFYRIGVWTRTTGRHIPGRGDADVAGGKGRSAEKGKEILMSIGRRFK
                     NVLKLPPNEMLEFSGHTDSAHSGSTRAKAKMVV"
     gene            complement(1597749..1600384)
                     /locus_tag="THITE_2121359"
                     /db_xref="GeneID:11522416"
     mRNA            complement(join(1597749..1597813,1597901..1599224,
                     1599285..1599586,1599678..1600384))
                     /locus_tag="THITE_2121359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656514.1"
                     /db_xref="GeneID:11522416"
     CDS             complement(join(1598004..1599224,1599285..1599586,
                     1599678..1599996))
                     /locus_tag="THITE_2121359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656562.1"
                     /db_xref="GeneID:11522416"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2121359"
                     /translation="MSSGLALGRSFGNRLPAALRPIRPLCRFPGVRMASTLPRLPVFE
                     AIAGHDPDATVVIHSNSGRRFRYGGLLRDVCKVRNRLYEAAGREDIDGERIAFLVENS
                     YDYVVTLLAILAAKSIAVPLSPAFPAPELQYILNHSEALMLLSSSKFASKAEEVLKTE
                     LDAPPSYLQLTKFHGDDGGTDEKVTLEKSGPGSAGMMLYTSGTTNRPKGVLLPQSVMT
                     AQARSLLQAWEYAPSDHLLHVLPLHHIHGTINAIFTPLFSGSCIEFLFPFNADAVWRR
                     FAAPFLNPDQTYNPETTPYNHRKITFFTAVPTIYSRLLATHKTLPPDVQSAARTAISP
                     CNLRLAISGSAALPTPIKRAWCDLSGGNVLLERFGMTEVGMALSCGLDVADRVDGSVG
                     WPLPGVEARLVDVDTHQVIEPGQERDAHGRERVGEIQLRGPTIFAEYWRNPEATAKEF
                     VDAKDGKGRWFKTGDVAVRRAVDGAGKSSAPSQKDWTRGMMYFILGRRSADIIKSGGE
                     KVSALEVEREMLALPQVAEVAVLAVPSGKWGQKVGAVVILDRENVPEGKWSPLEMRRA
                     LKGRLASYKIPQVLKVVEHIRRNAMGKINKKMLVKEVFQDEFSGDEL"
     gene            <1600730..>1601154
                     /locus_tag="THITE_122938"
                     /db_xref="GeneID:11522417"
     mRNA            join(<1600730..1600771,1600870..>1601154)
                     /locus_tag="THITE_122938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656515.1"
                     /db_xref="GeneID:11522417"
     CDS             join(1600730..1600771,1600870..1601154)
                     /locus_tag="THITE_122938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656563.1"
                     /db_xref="GeneID:11522417"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="JGIDB:Thite2_122938"
                     /translation="MASPTPIEDSIREKLTAALKPTTLEIYNDSHLHAHHAPMQGVTS
                     KETHFRLVITSEAFQSKMQPARHRLVYSLLKDELARDGGIHALQLRTMTPEEEAKRRA
                     QEAGSD"
     gene            complement(1601199..1603957)
                     /locus_tag="THITE_2121364"
                     /db_xref="GeneID:11522418"
     mRNA            complement(1601199..1603957)
                     /locus_tag="THITE_2121364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656516.1"
                     /db_xref="GeneID:11522418"
     CDS             complement(1601463..1603733)
                     /locus_tag="THITE_2121364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656564.1"
                     /db_xref="GeneID:11522418"
                     /db_xref="JGIDB:Thite2_2121364"
                     /translation="MADTKHSPALSAGPSWSPDYCMNRTKIPRRYVQIPSDQRSLLER
                     QDAWSTGGLPNVPSIVLEDVRERFVKKQRSGDRHARNRTPRDEGEGGPRPSQLASPTP
                     LSHVNAPSSQHKVSDSEGVWETIGSTVPPRVFEDIGPGHGQVVKLSDEEEKEIPLQPA
                     SPLPTTGRGAQASSPPPPKHRAHTPVHGEVERGAEVEQPSAGTPLSWSPSPSGHLRAA
                     CRPDAPALAASTAPSRPAPEQQGRPVTNHRLSPTRLSMDFPRSSSFSSEAGLELEVPK
                     AITDVLAPVNRQAVPVLEPTPPSAQVIPCTNTERTSPARMPQAKRRRLMKKPDAVFDS
                     PSPVGRRHALRLSLPNATARCLSRSTSPAVCSSPSASTEPVRLGTKTSPVRLPAASTE
                     QPAIVAPTSQRVDNQRSSDLADSILPPIGLASEVSLKIFRLAYPDYRGSLGDFIRGIL
                     CVLQLQKRRALPEFLYDDFIRVFSVHYLDYIRAVGDDEPPLSAIEWYNENVARPLYIK
                     GILNKSNIEGVLTQYPEKLRDIQQQLETSETSSRGRATSEATGTAREEAQLVKQQATE
                     TGAIRMPPLEDVTRVPSLANYNTVPFQKPIARTEAQSRVQKSYDIVAGPESSVNTQGS
                     DPSHLPNFEANGRREEAVNTASGPMSPQYQVALEIETPQTSQVADINRRMTHAPHSNA
                     LSQHSNADSIPEVATRHRLAPRGAAGSSGEPGGTFRRPRRRTERTENEERARQFKRFL
                     IRRFTQGSAPGGSAAS"
     gene            1604474..1612068
                     /locus_tag="THITE_2121365"
                     /db_xref="GeneID:11522419"
     mRNA            1604474..1612068
                     /locus_tag="THITE_2121365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656517.1"
                     /db_xref="GeneID:11522419"
     CDS             1604620..1611999
                     /locus_tag="THITE_2121365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656565.1"
                     /db_xref="GeneID:11522419"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="JGIDB:Thite2_2121365"
                     /translation="MASNPNGLRQPSIGASVPPSPATSRSRRDSTTSLAGSSHVDREQ
                     LALALDKIHTSASQSDALTTFNDFAPPPASLPSSETKATAGDLVQQGLSGLYTRFKEV
                     VGAVGKGSAQEVDDGNNSQDGASKKSVTTGASSVTSPLLRGESVGKSSTLESATSSDI
                     PPPSWPSAVGAVASELPSPAPQASKASSSTTASATKTPAPSVQSLPKIAKTAAATTSN
                     AALTPVTVQGLMDMDAARAGATRVEDLPGRKAGRRSISKPTDSATNIIPSGNASSDSV
                     TTGDGIVLTNRTRRDDALSVDGSIDAPRSPVQPSAEAHASASSSQLPSADVVRKPAVI
                     DRIASSRGRSHSRSSSTEPGAAEASPIITSAHSSVYHVSFAHNERPQMLRSGFMKIPG
                     TTANEGAPEKVNARLEQMRKQVLSKEFWMADETCKECFLCGTPFTAFRRKHHCRICGC
                     IFDSKCTSNISGQKIGVPGTLRVCKTCLDVINRRYDSGSDDSADESYLPAIFRASQPK
                     ASPVTAKPRTDDETSISERTEQADDTRTAVTPMMAIPATRRVGDNNRHSAILEIDMPQ
                     LSRPSSSRSLKSLSTGRPQSSGHRRHHSKHNLLTRFKTPADDRAPFRMPAGEELGKKS
                     NVNAFHADNIIDPELADYMSDESSEDEQMSSIFATMDGGDVQPASLDPGRSSFGTYLS
                     AGRKHRFRPGEKSVSGFSHVSRGHEEGGGLQNLPVHARPPRRRNLSIASASVHHLRSP
                     RPKSIVVKGASASADTLSIFEGGIEAPGLKRSDSIPDGKASEQGLNPASLQHVKKLFR
                     QLLQDANIPNSAGWERSLIPILDRCADDIDPDVRNGDDMDIRHWVKLKKIPGGKPGDT
                     AYIHGVVFTKNLALKSMPRKIRNPRIVIITFPLEYQRHPEQHFMSLQPVIEQEKEYLR
                     MVVNRILNLEPHVLLVQKSVAGLALQYLSEANVAVAYNVKPSVIEAVARIVDMPVISS
                     MDMLSLGARVGMCESFEVKTFVNSEIRGKKKTYVFISGCPKDRGCTIALRGGSTEILS
                     RMKRITEFMLYVVYNLKLESCLMRDEFVQIPSETDSAALSTSTSFQRTDESPGQWANG
                     APVHPLGRPSILPTRQGTESEDPMRPNDSANATADSEPSSVDPGVQSSPEPARTSISM
                     HELHSHVQVPDDTPAAVFHSDMVEKYKTRVLSASPFVRFRQPYLLVKAREQERRAAYL
                     KRLLEQEQVDEPDEAEKPRQETFQLVKPEMVHGVEQKASRKVMEVLHAVHEAEYDRAL
                     HSYRTQAKQWDAYTHGSLDLFDPYSHQNIVVLYSVTCTATKIPCSEPSLIAIEFYNEH
                     PDPNGSMDQDCTLGQYIEDICEGAELICHSNGCERKMYEHHRTYVHDNARLTIILETS
                     PAWPENFPEKPQDRDGGNGGTGICMWNYCRHCKKHFGLMPMSVSTWKYSFGKYLELSF
                     WSQGLQLNPQAECPHDHQKDHIRFFYYLYRDIAVRVHYDPIDLYEIVVPRTKVTWKVD
                     YDLKLKNDVFTKAEERWNRFMNSVRSRLKSIRIDSVLPEKAEACRAEVERLSKKAQDD
                     QPELIRALQEAYMNSKYYEVIPLNAVIREMLEKVTDWDAAFAAFEAEFLSDKDVRQLT
                     ILQLKKIFTDHESKESLPSTETSTLVGSEADEKTTPATTPPGVSEVEENPSPTLTRDL
                     SQAQEAPPSPSTQPEPSSKEAAVVQADELLERVDPLDLATPRSSTGARIGPPPAVAAR
                     EAVKLLSDQSSVNSAPTSGSTSSLTAKGGVMPPPPAPSQLSLTEKVEQLRREQRTLVN
                     DVNGSVPGAANASSIPQPAVERAPARRVGATASPPMVRAISQPGGTLPRTQSAIGKLL
                     KEQKAQDAGAETPKSSADSVLKGDKKFADRIGLGALKSHRKAGPSGIPRYVHKRESKV
                     STLARHFEQLSREFEKERMKDRKQRAAKMHHTRAFLPRSSTKTIVEVYKDVDQAVQEP
                     GPSDDDQIPDRERGEKQSGETSTATESTPAESQQSKASASEAEPSSPQEAPLQTPQPN
                     QGATQTETESNRQESRAGTDDEGAESDGDSAAITLDDILPDVKEIPEELPKHEKKSLM
                     TMLTNFWAERSASGWPQLEYPINATDHIFFDSDVIIKEDEPSSLVAFALSSEDYTSKL
                     AEIRQRWEVSKQPDADDSSDGLEMKGLQGSNGDAPEAGSATEHDVELEKSLLRPTGMH
                     VKYQFTEGSAKMMCQIFYAEQFDALRRKCGIADRFVESLSRCLKWDSKGGKTKSVFLK
                     TLDDRFILKSLSPSETSSFLRFAPDYFSIMAEALFHDLPSVIAKMFGFFRVFIKNPLT
                     NTDIKLDLLVMENLFYDRYPSRTFDLKGSMRNRKIQSTGEQNEVLLDENMVEYIYESP
                     LFAREHSKRLLRASVFNDTLFLAKQDVMDYSLMVAVDEIRKEIAVGIIDCIRTYTWDK
                     QLESWIKNRGFAGGGRNRPTVTSPREYKSRFREAMAR"
     gene            complement(1612638..1616542)
                     /locus_tag="THITE_2081511"
                     /db_xref="GeneID:11522420"
     mRNA            complement(join(1612638..1612970,1613066..1613925,
                     1614002..1616542))
                     /locus_tag="THITE_2081511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656518.1"
                     /db_xref="GeneID:11522420"
     CDS             complement(join(1612666..1612970,1613066..1613925,
                     1614002..1615629))
                     /locus_tag="THITE_2081511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656566.1"
                     /db_xref="GeneID:11522420"
                     /db_xref="JGIDB:Thite2_2081511"
                     /translation="MMNRTGPDWEVDSWYKDRRQPPLAVRLDTIVKFLAEEDVDRCMH
                     WETKLAEIVSYLEWLAHDDDRHQLQDASAQTRAMFNDAVLKAKAHVLFERHHYEPTPL
                     EITRPPSAPLRSTRLNWMTDTHGWPLPGRNPVPDRSDLLPRPIPPRPSSPVNRMLIDK
                     PDGGASFDKFVADEKEWWQRVPGGDDDADHDNLAYIEAKSFDSFVHGDNIGWIVTDPA
                     TGQTALPDGTSLLPGSPRSWALERGARRAGLQQMLRALPTGQPPELDTPWRRLVLPTP
                     ASTIRAACERADGPQWTPPRLSADQLPAELETMAHTVAYRARLAQIKRMRELARLRVE
                     DEGARDRRWVTLPRNVVNGGPFVWRMLDPDAQAGQDLLRQCRVVMEVLRAALRRVPRP
                     LLEAVVGLAERAASGQFWEEGVPAGLRLADDEWDQVGRGRLPRLLDAEEVEWLKFLAG
                     ECVNSKNWTGRFVPDTPRDKYRLFLIFAARVQKLLHDKNPEGLFSRHDAQVTVEELLQ
                     AVNAGTGNSAVTKCEFHPFDACSWLDRMKESGHVRFHLDPTCYGVVQRPRVEYFPEHR
                     VVWPTEADNRERPSHLGYIADWSSIVPAGHKPDVSESSAIGNFFRSLAFRLGYTIFAL
                     EQAHSSQTSPIQPVPTQHLRSSISKWAHACATMEGADAEPSREELALIRSHIIAEASA
                     NETMLAPGRVHHFFDAEGNPQTTLVRDHNWDWASLPTTSTTTTTTTTTNRQRRPRRQF
                     WSVDRWPLGTGYLSDATERAIADDEHLDPRMTHDPFASDPTDRRYMRPKLQPYREEKV
                     LFRPGPAVYPVGDTRLQRETLEARMTDMVAQAIGLDTNQHTWGDTLARLNPFSRPSSR
                     AEDRRDGGKLPPVNPKAVPKSWDPREETEKLQPEEALTGEEEEADEGEAEDETPSVDV
                     AMTGVGESWMAATGLT"
     gene            <1617052..>1619226
                     /locus_tag="THITE_115062"
                     /db_xref="GeneID:11522421"
     mRNA            join(<1617052..1617217,1617449..1617635,1617693..>1619226)
                     /locus_tag="THITE_115062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656519.1"
                     /db_xref="GeneID:11522421"
     CDS             join(1617052..1617217,1617449..1617635,1617693..1619226)
                     /locus_tag="THITE_115062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656567.1"
                     /db_xref="GeneID:11522421"
                     /db_xref="JGIDB:Thite2_115062"
                     /translation="MATGAQDSDHAPELRAASNQPDGLRSPPGDRARGTRRRSSTLGR
                     AVRNIESFNRNLGSPLWLDGEDLNAIEIADRKIAQRRLWAEHYQGVPDFAQMLQEAIR
                     EREQLDETAEENIKPRSALDSVQDTAVRQRLEHLRFLLEDSQFPPERANIEAAIAGYE
                     SGAIPCSDSYTLIWAGRIVDRCPDFDSFTVDRGARLDRYLAEYGPGWLWHEPPLSGGA
                     GTIRGPTVLAQKGLCLENKPSWRRRTENMGHYRVHMGFRRRKERVMRAAAATTTKRRR
                     RSIPGLTSPATPITPTTAPQQPVPTVPDPDGPRIFFDTLLDSGATLPCLFESDMSKLR
                     ISRTTYAAQSSRMIATADSMVHLRVYELDVGVYASPPSPDDRPAAAAATTTGTTAEDE
                     EEEEEEPDAERELRSCTLPVVAFPGGPHSPNGSNGSGNSFTAATAAAGGGGTAHPDAA
                     PDRLSGLLPFHACYMSSAPGNFKLWLGSERRDVLGAGRLPGQMRFGEVKGAAAGEDAR
                     RKAATGRRAAKTRREEEEEQWWLEQQPRLGTPKRVIFEHDLADGTGRVLRDEEGEGGS
                     VIMMCGPGGTESDQAGSRDPESAGIEVLRVERKSWASQQRRRMPPKKYARQTPKSEPT
                     EEKV"
     gene            complement(1620232..1621907)
                     /locus_tag="THITE_2121368"
                     /db_xref="GeneID:11522422"
     mRNA            complement(join(1620232..1621423,1621507..1621907))
                     /locus_tag="THITE_2121368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656520.1"
                     /db_xref="GeneID:11522422"
     CDS             complement(join(1620335..1621423,1621507..1621698))
                     /locus_tag="THITE_2121368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656568.1"
                     /db_xref="GeneID:11522422"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Thite2_2121368"
                     /translation="MACAGYSTDNTFFVESDEPGQRMTMRDAAKMLARNKQEMIANEL
                     SRLACDEYLEDIMQHMRHMEDETLPDANLIDMQREIQWFMRPYLIDFLIEAHAAFSLL
                     PETLFLTVNLLDRYCSKRVVYKQHYQLVGCAALLIAAKYGDKKDRVPQINELNNMCCG
                     LYDAGMFTQMEMHVLNTLDWCIGHPTVDFFTQLVVAEERDSREVEHMASYICEIALYH
                     RDFVSTKPSVMARASLALARAILGKPEVNDGEWDHSDNVTLLALSQHLHQPSVTLARK
                     YSSQHYSRVSTKLADFLAQQAAIARRGALPSPASEHPLSSESPDVYSTPHKGLGAVPG
                     VADGYMTPPITPDGTCFGHNNTMMKDYQVPPRCPVTPTPQPTSHAPSYQQPHLALQQQ
                     QQQQQQQQQQQQQQQQQHMTGASYFGGTASHMSF"
     gene            complement(<1626363..>1627766)
                     /locus_tag="THITE_115060"
                     /db_xref="GeneID:11522423"
     mRNA            complement(join(<1626363..1626436,1626614..1626717,
                     1626783..1626840,1627083..1627247,1627308..1627346,
                     1627427..1627521,1627735..>1627766))
                     /locus_tag="THITE_115060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656521.1"
                     /db_xref="GeneID:11522423"
     CDS             complement(join(1626363..1626436,1626614..1626717,
                     1626783..1626840,1627083..1627247,1627308..1627346,
                     1627427..1627521,1627735..1627766))
                     /locus_tag="THITE_115060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656569.1"
                     /db_xref="GeneID:11522423"
                     /db_xref="JGIDB:Thite2_115060"
                     /translation="MFSVYSKVIPSLAFRLHQEDALDVFMEQVKETGWIARSRVLFGG
                     GVPLRKAGQRVAGKEASTDVLEGTSVSRPTLQVRGLPAIFKFPGLTDISTDYAFHLIH
                     PAVHSPNRVGSVVESFAGEADGVHDGSGIAYFRPRLHIWSADAAMKESKHPAFTAAKG
                     RRPRSLEYILLRISSEKPSRRSLAGPMP"
     gene            <1633765..>1633920
                     /locus_tag="THITE_2019847"
                     /db_xref="GeneID:11522424"
     mRNA            <1633765..>1633920
                     /locus_tag="THITE_2019847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656522.1"
                     /db_xref="GeneID:11522424"
     CDS             <1633765..>1633920
                     /locus_tag="THITE_2019847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656570.1"
                     /db_xref="GeneID:11522424"
                     /db_xref="JGIDB:Thite2_2019847"
                     /translation="QRWIENEKRTTYNTRDSLVVTDPTTNLAVGSLSRGERTGSRVFY
                     HLWSYVID"
     gene            complement(1634452..1634871)
                     /locus_tag="THITE_2121376"
                     /db_xref="GeneID:11522425"
     mRNA            complement(1634452..1634871)
                     /locus_tag="THITE_2121376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656523.1"
                     /db_xref="GeneID:11522425"
     CDS             complement(1634585..1634770)
                     /locus_tag="THITE_2121376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656571.1"
                     /db_xref="GeneID:11522425"
                     /db_xref="JGIDB:Thite2_2121376"
                     /translation="MHDADESTHLFVTVRVLSEAGNGTSAWDIPGPVDNLWARWAYLS
                     AAAGDRMHMCLTHSIGI"
     gene            complement(1635983..1637778)
                     /locus_tag="THITE_2121381"
                     /db_xref="GeneID:11522426"
     mRNA            complement(join(1635983..1636960,1637024..1637778))
                     /locus_tag="THITE_2121381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656524.1"
                     /db_xref="GeneID:11522426"
     CDS             complement(join(1636087..1636960,1637024..1637553))
                     /locus_tag="THITE_2121381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656572.1"
                     /db_xref="GeneID:11522426"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="JGIDB:Thite2_2121381"
                     /translation="MDPNRTEPQPPGGGAHYNEEWAHGLTVQFEQLLRTKRLNELQTR
                     SRQGSPAPRHAASSLNLRAGSAPVSDRPTTSHDSQAPPSYSVARNLPKIPTPPAPDDR
                     ESTRFRNLLISLSATPTMYENPGLLDEALQVIPLDRIYSEAEEESQVLQAQAESMGDG
                     RRPEWGYQDCVIRALLRWFKRSFFTWVNNPQCQICFSPTIAQGMTQPTPEDKAYGALR
                     VELYRCSNASCRAYERFPRYSDVWRLLQTRRGRCGEWANCFSMLCRAVGSRVRWVWNA
                     EDHVWTEVYSEHNKRWIHVDACEEAFDNPRLYTEGWGKKMSYCIAFSIDGATDVTRRY
                     VRKMEYYNERNRCPEEVLLYIMQEIKHLRRANMDKEARFRLEKEDSKEDHELRSYVVA
                     SLADSVTQLVPAADGGIGGSAGRRGASSSGDDTKVPVTSDLPGRQSGSAEWVAARGEN
                     GMRSHTFLPPGQGPPFP"
     gene            complement(1641163..1644220)
                     /locus_tag="THITE_2121383"
                     /db_xref="GeneID:11522427"
     mRNA            complement(join(1641163..1641208,1641282..1642971,
                     1643027..1644220))
                     /locus_tag="THITE_2121383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656525.1"
                     /db_xref="GeneID:11522427"
     CDS             complement(join(1641323..1642971,1643027..1644053))
                     /locus_tag="THITE_2121383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656573.1"
                     /db_xref="GeneID:11522427"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121383"
                     /translation="MDIHRCRFVRYPASAINALAFTHSSLPSVSANKKHLQKHIQVRL
                     ALGRANGDIEIWNPLRGSWHQELVIPGGKNRSVDGLVWVTDPDEEMADGRIIHGRSRL
                     FSIGYTTTITEWDLEKARAKRHASGQHGEIWCLCVQPLPNKAAAAPGTRKLVGGTVDG
                     NLVLYSIEDDDLKFHKTLLRTPSKKTKFVSIAFQSHNVVVVGCSNSTICAYDIRKGVL
                     LRQMTLGTDLSGGSKNIIVWAVKCLPNGDIVSGDSTGQVCIWDGRTYTQAQRIQSHSQ
                     DVLCLSVSADGSKIVSGGMDRRTAIYEPIAGQTGRWSKVFHRRYHQHDVKAMASFESK
                     TMSVVVSGGSDANPVVMPLRAAGREYHRTLPHLPQNPPLQSAPKARLVVSWWGNEIRI
                     WQLLSPAHQLLDDPKAGFSLRNNRKFLAQIMVKGDSHISSAAISEDGTLLVASTATDI
                     KAFQLEFTEGAGAEQLHIRKVDMASSGLAATKIQISPDKQWVSWVEDGSKVMIARVQD
                     TESTAGTSLAISRPYRLRRLRRLVAKHLLLGGLGSYDRNITLMAFSPDSKMLSVADLA
                     GYIDTWVLRVPGEQTNGADGGDDDDGATSESSDDSSDEEQEDDVVGRRWVRNPKANLL
                     PKLTAAPVVLSFSRTPRDAGDYDLLVITTLKQLLIFNPLRGELSEWSRRNTYPKLPEQ
                     FRDTRDHVKGVVWQGPRAWIYGASSLFMLDLSQDFCPEKDALAGKTGQKRGTKRKRDG
                     QEGGAGGRMEKYSLAPQRVRTAVGPDGEKWEDVEMADAEDQKSIGASSGVDDDDDEDV
                     GGGELQRLRDDHSANGNTETAQKEELAKARWWHTYQFRPILGIVPVESGQQDGLTNGD
                     VAEERPAPLEVALVERPLSGDDLPERYFAEGEWER"
     gene            1644571..1646510
                     /locus_tag="THITE_2121387"
                     /db_xref="GeneID:11522428"
     mRNA            join(1644571..1646241,1646302..1646510)
                     /locus_tag="THITE_2121387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656526.1"
                     /db_xref="GeneID:11522428"
     CDS             join(1644926..1646241,1646302..1646440)
                     /locus_tag="THITE_2121387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656574.1"
                     /db_xref="GeneID:11522428"
                     /db_xref="InterPro:IPR015977"
                     /db_xref="JGIDB:Thite2_2121387"
                     /translation="MDFNSSSPYPEGVISFLDTDLYKLTMQCAVLKYYKDVPVTYAFT
                     NRTPEKKLSRQAFLWLEDQVRKLGNISLSAEELQYLKEHCHYLTPAYLDFLSEFRLRP
                     REQVVLKFLPVGDDTGALTDIGDLDVRISGTWADTILYEIPLLALTSEAYFKFMEPDW
                     VYEGQEELAFEKGMRLLEAGCVFSEFGTRRRRDYHTQALVFRGLTRASKEAQKRGFSG
                     KLSGTSNVHLAMRFNIPPVGTVAHEWFMGTAAVIGDYRKATEEALCRWVGCFGEGVLG
                     IALTDTFGTPEFLNSFSKPVRYLEQPAPVSERKPSIADSFIRTASSASSGGRSQKSNK
                     TYADVFTGVRQDSGDPKEFVTLMQNFYNDQGIHDKKVIVFSDSLNIDRCLEYKQVSEK
                     AGFQPTFGVGTFLTNDFVNTKTGKKSTPLNIVIKLSSAAGNPAIKISDNIGKNTGDKA
                     TVEKVKRELGYVEKAWEGGDETARWGHEEDPVKA"
     gene            1652164..1654022
                     /locus_tag="THITE_2121390"
                     /db_xref="GeneID:11522429"
     mRNA            join(1652164..1652286,1652365..1652470,1652569..1652717,
                     1652778..1652834,1652886..1653029,1653086..1653511,
                     1653591..1653617,1653819..1654022)
                     /locus_tag="THITE_2121390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656527.1"
                     /db_xref="GeneID:11522429"
     CDS             join(1652258..1652286,1652365..1652470,1652569..1652717,
                     1652778..1652834,1652886..1653029,1653086..1653511,
                     1653591..1653617,1653819..1653906)
                     /locus_tag="THITE_2121390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656575.1"
                     /db_xref="GeneID:11522429"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_2121390"
                     /translation="MASQPFRTLIPSGAPPLRTYQEVFLENGRWYGTYKRGKYLLPID
                     ETDLERLDVFHKIFLVARKDVLHSAPLHNQESPRILDLGCGTGIWGIDMADKYPNGLH
                     VGLDLNYIQPEFIPANMRFIQQDIEDSWKDLEPGSWDLIHMRALVGSISDWPKVYAEI
                     HRHLKPHYGYFEQVEIDWYPRCDDGSLAPDTTVMQWANELFDAMDRFGRSLRVDSNLT
                     KQRLADVGFVDIEEEVIQLPLNGWPVDAHARHLGRWFNFGLRQALQPLSLAPLSRGNG
                     RTPAEISEMTDKIRAEIYSNSVHAYCTLHVFTARKPRADDHAAHSIAKPASPTRTHLP
                     RARPRQA"
     gene            complement(1656387..1658016)
                     /locus_tag="THITE_2081525"
                     /db_xref="GeneID:11522430"
     mRNA            complement(join(1656387..1657172,1657291..1657375,
                     1657611..1658016))
                     /locus_tag="THITE_2081525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656528.1"
                     /db_xref="GeneID:11522430"
     CDS             complement(join(1656929..1657172,1657291..1657375,
                     1657611..1657893))
                     /locus_tag="THITE_2081525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656576.1"
                     /db_xref="GeneID:11522430"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="JGIDB:Thite2_2081525"
                     /translation="MTFALVMRRSGLVAGRRVARFESTSSTTKQAAEAAKQAAAQSSS
                     TASETTSKAAQGLSRVTSAAGPAIAKTAKGVSSALSRVGGRTGRLIAFVERQTPLVVY
                     YSKVGLELAKLVVKGQNMSPPSISTFQSYFQSLWKQLQHPGTFFSSLLQSVNPQQIRN
                     ISRTQVAAGGVVLAECLGFFTVGEMIGRFKLIGYHGETQAAHH"
     gene            complement(1658313..1660105)
                     /locus_tag="THITE_2121399"
                     /db_xref="GeneID:11522431"
     mRNA            complement(join(1658313..1659628,1659711..1660105))
                     /locus_tag="THITE_2121399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656529.1"
                     /db_xref="GeneID:11522431"
     CDS             complement(join(1658698..1659628,1659711..1659877))
                     /locus_tag="THITE_2121399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656577.1"
                     /db_xref="GeneID:11522431"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2121399"
                     /translation="MNGTIRASKPNIGVFTNPKHDLWVTEATPTLESVQKGEELKEGE
                     VTVAIRSTGICGSDVHFWKHGCIGPMIVGGDHILGHESAGEIIAVHPSVKNLKVGDRV
                     AVEPQVICNTCEPCLTGRYNGCETVDFLSTPPVPGLLRRYVNHPAVWCHKIGDMSYED
                     GAMLEPLSVALAGLHRAGVRLGDPVLVCGAGPIGLITMLCAKAAGACPLVITDIDEGR
                     LRFAKEICPEVITHKVEPLSAEESAKAIVARFGGIEPAVALECTGVESSIAAAIWAVK
                     FGGKVFVIGVGKNEIQIPFMRASVREVDLQFQYRYCNTWPRAIRLVQNGVIDLKRLVT
                     HRFPLEDAIKAFATASDPTTGAIKVQIQSLD"
     gene            1661730..1663143
                     /locus_tag="THITE_2121402"
                     /db_xref="GeneID:11522432"
     mRNA            join(1661730..1662162,1662275..1662338,1662414..1662566,
                     1662673..1663143)
                     /locus_tag="THITE_2121402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656530.1"
                     /db_xref="GeneID:11522432"
     CDS             join(1662277..1662338,1662414..1662566,1662673..1663051)
                     /locus_tag="THITE_2121402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656578.1"
                     /db_xref="GeneID:11522432"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="JGIDB:Thite2_2121402"
                     /translation="MTLFMLLILPLPFAMRRKVFTFISENPIVAKVQYWLKITFIFIL
                     ILFIDSVNRVYRVQIELAAATENTGTAASAIHGHERLEVQARKFYSQRNMYLCGFTLF
                     LSLILNRTYILILEVLRLEEKLKQYEGTDKNTKQAEKLAAAGDAGEIARLKRELELRD
                     QDIATLKKQAAGLHREYDALAEKYARTQDDGSSKKDK"
     gene            complement(<1663627..>1666924)
                     /locus_tag="THITE_2081534"
                     /db_xref="GeneID:11522433"
     mRNA            complement(join(<1663627..1664454,1664513..1665237,
                     1665329..1665347,1665940..1666450,1666613..1666745,
                     1666816..>1666924))
                     /locus_tag="THITE_2081534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656531.1"
                     /db_xref="GeneID:11522433"
     CDS             complement(join(1663627..1664454,1664513..1665237,
                     1665329..1665347,1665940..1666450,1666613..1666745,
                     1666816..1666924))
                     /locus_tag="THITE_2081534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656579.1"
                     /db_xref="GeneID:11522433"
                     /db_xref="InterPro:IPR010856"
                     /db_xref="JGIDB:Thite2_2081534"
                     /translation="MASTATPSPDSISDSEFQDLLRRYPACLAAISESKGAKPGQKTL
                     ASLDKYRYETAPARFGPGNPDVSMGLDDVKALVEWKLRHGKFRPTLMKLVSSNDARSV
                     QEIIHKAVKHYREKSDSAGALDILTQLKGIGPATASLLLAVHDPERIIFFSDEAFYWL
                     CCQGSKSPIKYSQKEYAELSERAQALAKRLGVHAVDVERVAYVLMREPAEHMSTTAAK
                     PPTGSPAVATGKVKTQPGGKRKASGDDSAVETPSHRRRKRPLPISPCVLDRMSRTKRG
                     EMQSFAGPGPIQLTPRFTALKESLTSGNETALNSSWQRLLRDLPLEIDSVSSLGSRAI
                     PAINFLDSANPQQAERFLQDLRKRGVGIIRSVVPRETALAWGQETEQYITQNAQMRPA
                     SPRHSRPLDVYWSASQVKARAHPNLLAAQKFVMSIWKSKHPNARVTTNFPVTYADRMT
                     TRRGTEGGGTPYAHVDGGSVERWEPDGYGRAGTYKEIFEGRWEDYDPWESSTRLAVTS
                     DLYRKAGACSIFRMFQGWLALSTIPPGPGSVRVCPLPRHATAYFLLRPFFSPSSSPTS
                     TTTPTASPCLDRTTTAHNEEWVLTRPQNSILHGAVPSYAQELNPALHPHLELQRSLVP
                     VPQLEPGDYLVWHPDLVHSTSPTLDAGNATTTTTTTTPTTGDTSMDAAAGGFSYMYLP
                     ACPLTQTNALYLARQRKAFLLGQPGPDFGGGRGESEHEGRPGVQDVNDAGGDDGLRAM
                     GLLPWDEEEADTDEEREVLAMANGILFPDLYDWL"
     gene            1667586..1668399
                     /locus_tag="THITE_2121407"
                     /db_xref="GeneID:11522434"
     mRNA            join(1667586..1667811,1667948..1668022,1668094..1668164,
                     1668250..1668399)
                     /locus_tag="THITE_2121407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656532.1"
                     /db_xref="GeneID:11522434"
     CDS             join(1667797..1667811,1667948..1668022,1668094..1668164,
                     1668250..1668328)
                     /locus_tag="THITE_2121407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656580.1"
                     /db_xref="GeneID:11522434"
                     /db_xref="InterPro:IPR015023"
                     /db_xref="JGIDB:Thite2_2121407"
                     /translation="MGGGNGAKAAQKRARNNQKIATKPGSQLKSNAAAMNIICAQCKQ
                     SFLSTSREPQLTLHAVNKHNATLPQCFPDFKPPAK"
     gene            complement(1668481..1670199)
                     /locus_tag="THITE_2121411"
                     /db_xref="GeneID:11522435"
     mRNA            complement(join(1668481..1669233,1669370..1669788,
                     1669865..1670199))
                     /locus_tag="THITE_2121411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656533.1"
                     /db_xref="GeneID:11522435"
     CDS             complement(join(1668626..1669233,1669370..1669788,
                     1669865..1670064))
                     /locus_tag="THITE_2121411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656581.1"
                     /db_xref="GeneID:11522435"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Thite2_2121411"
                     /translation="MSFTSIPILDLALARDPATKPQFLSELRHALMEVGFLYLKNVGI
                     SDELFNKVIEEGRAFFDIPTEEKLKIEMKNAPSFLGYSRLSAEVTAGAIDHREQIDLS
                     TEHPLPGPDAPRYYNLRAPNQWPSPEVLPNFRPVFTEYMKRMGDISIYFTSLIAEAIE
                     LPSDAFNKYFDADQQHKLKIVKYPDVGELGAEGKEGNQGVGPHKDSMLTSYLLQASPH
                     RGLQVQNMHGDWVDCPPVPGTLVVAIGQGLEALTGGVCVSTTHRVLSPPAGAGARYSI
                     PFFQGVSGDAAFDELEAVGVGRVPEHVREERRRVLARNGGRRLDDVEFTFRTGGAART
                     LGEATLRNRVKSHPDVGERWYPDILASLREEQARLAARERKKEKEKEKEQGSAGTGAG
                     GGDVRPSVSSKEVEAH"
     gene            complement(1670702..1673915)
                     /locus_tag="THITE_2121413"
                     /db_xref="GeneID:11522436"
     mRNA            complement(join(1670702..1672581,1672644..1673440,
                     1673504..1673915))
                     /locus_tag="THITE_2121413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656534.1"
                     /db_xref="GeneID:11522436"
     CDS             complement(join(1670798..1672581,1672644..1673440,
                     1673504..1673805))
                     /locus_tag="THITE_2121413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656582.1"
                     /db_xref="GeneID:11522436"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121413"
                     /translation="MDANGDTASLKRKREPKDDVPLSQKKHRRRSISRLEGNDVPKDA
                     ASLKTVAQQVDGDLELPDATSQPPSGPVRERLASWKVSQPMGGRMLDIDPVFSPDEKH
                     LIVTYNTSIQVYSTEDSLLVRRIALPVTRTDDAAGFFSAHIVSSMLSKADPDYIWVSC
                     SDGRIWFINWTSGAGADTPFTVEVKKVLDATVEAVEIGGRTEDVLLVLQRLTWSSAQI
                     VAYDAKALSTRSGKLLHTYGESPQLLRSVSGGRLVFAAAKQALHVGFLKAKKLRSLDD
                     LSYRFHCFDVPDIISCLDVRPVVRLTKNGGLEIQSVDLAVGGARGAIYVYHDLLSKLP
                     REEPGSQKAGVILPKKHHWHRRAVHSVKWSEDGNYLISGGYETTLVLWQVDTGRRDYL
                     PHLSAAIENIVVSPRGSSYAIHLDDNSTMILSTAEMKPTMYVSGIQSLVLGDRPSKES
                     LVRRVWRPVDEIADPVVAAVNPRSPSQMFLCVGNGQQASLGEGTCSTPLVQVFDVASF
                     YGVAKHAIARTNPTDTNITSEGAPITEPTVTKLAFSRDGKWLASVDEWQPPERDANAL
                     LTGSKTPAQVCRERREIYLKFWDVGGDEHSFELVTRINDAHYTEQTEAIFDLASDPTS
                     TRFATIGNDGMVRFWTPRLRKRDGLAATGPSGEPLRSWTCSRAVPLPVYEEQDDTTEV
                     LRNSPRSGAIAFSEDGSVLFAAFGPPSGALVVAIDTETGAFRDVISGMCKGEIRAIQS
                     LSSCLIILSEDLVVYDIVSDELLYSYSLKETSAAAKRLTQLAVNHESRSFALAAPIPN
                     PSQEKMRKGLRSELVVFNVEEDEPQMAQTFSQLIISVCAAPSSSGFIVVDAAAQVWSV
                     TEGTEQAPLLRPLADLGVDGNAPGEEDAASQQLLLEAGELSDEEMPDEEDQDVEMEDD
                     EDTHAAVVAPQRLAEIFNAAPAFAMPPIEDIFYQVAGLFATKPVNA"
     gene            1674053..1674944
                     /locus_tag="THITE_2121415"
                     /db_xref="GeneID:11522437"
     mRNA            join(1674053..1674237,1674305..1674366,1674427..1674513,
                     1674596..1674944)
                     /locus_tag="THITE_2121415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656535.1"
                     /db_xref="GeneID:11522437"
     CDS             join(1674202..1674237,1674305..1674366,1674427..1674513,
                     1674596..1674662)
                     /locus_tag="THITE_2121415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656583.1"
                     /db_xref="GeneID:11522437"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="JGIDB:Thite2_2121415"
                     /translation="MIIPIRCFSCGKVTGDLWEKFVKLIEEEGLSDGDALDQLGCKRY
                     CCRRMVMTHVDLIEKLLKYTPDGRNYKKIEMQTRNQEER"
     gene            1677279..1680981
                     /locus_tag="THITE_2121418"
                     /db_xref="GeneID:11522553"
     mRNA            join(1677279..1677300,1678057..1678093,1678150..1678330,
                     1678399..1678588,1678646..1678744,1678812..1678916,
                     1679011..1679164,1679224..1679623,1679700..1680981)
                     /locus_tag="THITE_2121418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656536.1"
                     /db_xref="GeneID:11522553"
     CDS             join(1678209..1678330,1678399..1678588,1678646..1678744,
                     1678812..1678916,1679011..1679164,1679224..1679623,
                     1679700..1680780)
                     /locus_tag="THITE_2121418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656584.1"
                     /db_xref="GeneID:11522553"
                     /db_xref="JGIDB:Thite2_2121418"
                     /translation="MALEAPLRSSTGSLTSGYSPHTDMSLSTGPESPALPLQYMASSS
                     ADSQSLRPNSYTRPSSAHLMSPSSDIVGPSPVTSNGTETTEIEDEAAENAEEENGNAR
                     QSLTMLRTNIPDHIRRPLSDEVVSVIHAPPSFQNWSGDAASKSTVSNSASGASAEATD
                     ASSPPPSEPSTITSPGQVQPTVDTKVKPVSFGVDAPTPQAQKLEDVIANDTAKLRSST
                     GGSLELIPERHEGDGEDDFDDADPFANPARGQDSEVKALKAALEECWTLCNTLANLSS
                     IHRERVFNSSGTPDAHERAWKSCWKLCKRLYQSRDDISESYGVRTNLDLCRDFCQALF
                     DVRQRKDETADSILRVSFELNNHLYSAQDSRSLPEAFRERTLDFYITLCHRLMKQRSD
                     LAEETDSLLRACWSLAEMLFSLRQNRRDGKAPDEELLGSAVQACWELCDIFREGWTQI
                     RPDRGTPRPNQINFFAAGPPYGLQGMGSHQSDSARSNAGSRASLHSKRESLRSLGDID
                     RPRPHPVVPETPVTEFEDTPVSPDASPQMPNILVLGPSTDSRSDRGGRWSSNASNLSG
                     YTQSSQHTSSTATTTTAVEDINVTRVKALIVKAAMNVGFNRDAAAANGTGAAASLQSF
                     VKSLPTGSFGSLPSHATLLQGYKNLVLNDTSFRPTSSLPPRGKRFTAAEIAKSVGWMT
                     LRSGQYGFLRDLFKLVFGVQPEEAETRKNISITI"
     gene            complement(<1681931..>1683264)
                     /locus_tag="THITE_2131731"
                     /db_xref="GeneID:11522554"
     mRNA            complement(join(<1681931..1682058,1682117..1682208,
                     1682294..>1683264))
                     /locus_tag="THITE_2131731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656537.1"
                     /db_xref="GeneID:11522554"
     CDS             complement(join(1681931..1682058,1682117..1682208,
                     1682294..1683264))
                     /locus_tag="THITE_2131731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656585.1"
                     /db_xref="GeneID:11522554"
                     /db_xref="JGIDB:Thite2_2131731"
                     /translation="MDGNSQTTQRRASDVRPASEERPDSPSVQAQRLEEEKPDSPPYQ
                     AQPLEAVTIGSGASPDQGTESPIQSPTETSPALGGGTQAQALEVVAIRPGATPDQGTE
                     SPVQSAFEEKPDSPPFQLEKAILGPGPSPDQGTESPDQSPTEASLAFDSDSEFMDEPL
                     DRRASALAVILSGTPQEVGEDDEHGVWYLDRHGTCLVGARHRHDKDGGVYFASYSDVL
                     EANISTREEALNDAIDDILGLAYDTTYPINARLLAESQVAALTRAPGSLAKRSQPQGE
                     QSRAGLPFSRRPNSSAPSVPPWEALRHPWVRHPGLLRLPTGAGDARGWTHQMATAGDN
                     NARQTKARRKTMGTRALRLEGSAQDACDTQIQPCWESKELLVLARGSSISSSVNCLRD
                     NGNN"
     gene            complement(1683721..1685082)
                     /locus_tag="THITE_2121426"
                     /db_xref="GeneID:11522555"
     mRNA            complement(join(1683721..1684212,1684272..1685082))
                     /locus_tag="THITE_2121426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656538.1"
                     /db_xref="GeneID:11522555"
     CDS             complement(join(1683901..1684212,1684272..1684703))
                     /locus_tag="THITE_2121426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656586.1"
                     /db_xref="GeneID:11522555"
                     /db_xref="JGIDB:Thite2_2121426"
                     /translation="MTRIWDFESQDYGAFSLEIREPPLTGDSLGHKTWGSSYALAQLL
                     HDFAAGPLAHLFLPGVMSTPEEVLELGSGTGLLGLAAACIWRTSVVLTDLPGIVPNLT
                     HNANINQEVVERRGGRVEVAQLTWGGNEDETDPRFQTLHRYQLIIVADPLYDDDHPAL
                     LTSAIDEQLALSEHARLLVMVPQRDSTTERLLGTLKDELARRRSPLICLEENVVEGQD
                     DWGDEHGDGESEAVGFWWGIFRRSQPSHA"
     gene            complement(1686389..1687592)
                     /locus_tag="THITE_2121431"
                     /db_xref="GeneID:11522556"
     mRNA            complement(join(1686389..1686566,1686653..1687592))
                     /locus_tag="THITE_2121431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656539.1"
                     /db_xref="GeneID:11522556"
     CDS             complement(join(1686563..1686566,1686653..1687359))
                     /locus_tag="THITE_2121431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656587.1"
                     /db_xref="GeneID:11522556"
                     /db_xref="JGIDB:Thite2_2121431"
                     /translation="MDLRGYGLPFHTGYTSYSPERSAGIQPDLRDPYGHERDYSLCNL
                     SLSEDQAPERMPRWTSSPKKHTSRGSDRDTGDKYRESEKLLASPRNQNPGIDIALRNL
                     DHEAGASLRVFRAFVQCFEREIESLQDWAEDYTLDTVWRNKIRNICRDRGEREKFRAA
                     ASRIASCREAVKEAVKNAKALREVWDDKFKLERQVRTAKKALLNSEWVINLAERAASE
                     RLACKQLVIELGEMRCLL"
     gene            1694344..1697162
                     /locus_tag="THITE_2121434"
                     /db_xref="GeneID:11522557"
     mRNA            join(1694344..1694706,1694898..1697162)
                     /locus_tag="THITE_2121434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656540.1"
                     /db_xref="GeneID:11522557"
     CDS             join(1694536..1694706,1694898..1697030)
                     /locus_tag="THITE_2121434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656588.1"
                     /db_xref="GeneID:11522557"
                     /db_xref="JGIDB:Thite2_2121434"
                     /translation="MVLDIPEGGVVLENSAKTMAELPAQAFALTLSGSVIEDMIACVQ
                     SGGEIQLSLGSSPKFLFDDHEIRISKTPDPSGYDLFWASSETPSTVSKLPNPTMSIFR
                     VPKLKAKPKAPKAPGPGAKGSESAAKRVLARSAASPRDSDSQAKMDPATAQLERSLDI
                     LAANKRENSYGPRHVFADQADTNADSSTTVVTGLPSSRTGKVKPPGKRLLEPQAGASP
                     RSLTPSPALSASGSPSFPGSGPTAQERLKQQRFPILHELAVQELSREELLAKWHEGTE
                     EEFNAVLDKVADLDKDTQKWALKKMFWKELDVFEYNYASKEDRQRAINNAIKQYDRSR
                     LGTSDPLWQKLLPKADRGKGICLSRLQAAIAKGPPPPAPKQRAGTADASGAESDSGSL
                     AKGGESMSRSSSQASTGKKKLSASEAQAKRMLSTSKKPVAAVAAKPVAKAMPAKAATK
                     GAGAKGGRVLSKEFVTDSSSSDDEVPLSTSLGKSKAGVVPSSKPAARAAEKPKPAEKT
                     KEAPAAKPKAAAVAKAPPREDKKEKEKDKDNEKEQEKEKEKERERDTIRAQVIAKPIK
                     PPIKRSRDPDDDDSSSSGTPLSKRAKPVVKPPAARSSSGKARTASDASHNGRGTGSGV
                     GAPKPKSVSPVKSSPLASSPPTNASDMEQDRLPPAKVRDREQERETTVRSVSSNTDSG
                     TSASIARKRPPTESLPGNKAKRSRPSQETIEMAARFKQFYARYEQLHHDISKHDNPDP
                     SKVMDLLDMHERLSRMKTEIYAAVEAC"
     gene            complement(1697954..1699630)
                     /locus_tag="THITE_2069898"
                     /db_xref="GeneID:11522558"
     mRNA            complement(join(1697954..1698406,1698472..1698541,
                     1698612..1698638,1698748..1698782,1698861..1698894,
                     1698974..1698996,1699074..1699163,1699366..1699630))
                     /locus_tag="THITE_2069898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656541.1"
                     /db_xref="GeneID:11522558"
     CDS             complement(join(1698342..1698406,1698472..1698541,
                     1698612..1698638,1698748..1698782,1698861..1698894,
                     1698974..1698996,1699074..1699140))
                     /locus_tag="THITE_2069898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656589.1"
                     /db_xref="GeneID:11522558"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="JGIDB:Thite2_2069898"
                     /translation="MPVDEAKPAGSTSPVPRGEKLEAQIKSADMTEDMQQEAIEVAQD
                     AMARFTIEKDIAQHIKRTFDERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILL
                     FKTQ"
     gene            1700318..1707986
                     /locus_tag="THITE_135180"
                     /db_xref="GeneID:11522559"
     mRNA            join(1700318..1700686,1700766..1701590,1701797..1703233,
                     1703446..1703486,1703546..1703745,1704040..1704503,
                     1704583..1704775,1704947..1706978,1707180..1707986)
                     /locus_tag="THITE_135180"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656542.1"
                     /db_xref="GeneID:11522559"
     CDS             join(1700423..1700686,1700766..1701590,1701797..1703233,
                     1703446..1703486,1703546..1703745,1704040..1704503,
                     1704583..1704775,1704947..1706978,1707180..1707744)
                     /locus_tag="THITE_135180"
                     /note="Contains conserved domains pfam01285: TEA/ATTS DNA
                     binding domain family and 4 RRM_1[pfam00076] domains,
                     characteristic of the PABP."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656590.1"
                     /db_xref="GeneID:11522559"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_135180"
                     /translation="MQSSKRMETTTMESSRIFVKNLPPTISEAEFRKHFSAQGREVTD
                     VKLIPHRRIGFVGYKSHDDAARAVKYFNKSFIRMSRIAVDLAKPIADSIPRQTPKATP
                     GNGIATTSSPGAGAPRVEHVEEENAKKRKRADLDEADPKLQEYLEVMGHRTKKPRDKG
                     TLNGGLESDLTTAVPPAVFEAGESDEEYEEIPARRSKQPVQGNPARLDATAAPVTDGE
                     NPAAAPRVESAPRVESARETTHVSADATDEDWLRSRTSRLLDLVDPDDPGFSARPPPP
                     APAPVPASAPGPAASSAAEPQESPCDGGASDSNEPSGAAHAHTLAEVGEDAAKLVEKT
                     ARLFLRNLSYTVTEDDIREHFGKFGVLEEVNLPLDAHGRGKGFAMIRYEQPAAALAAF
                     QTDGSTFQGRIIHILPAAAKREHKLDEFAISNLPLKKQRLLKKKAEAASSTFNWNSLY
                     MSQDAVNTAVAERLGVSKHELLDPTDASAAVKQAIAETTVIQEAKTYFAAHGVNIEAF
                     KSQQRGDTCILVKNIRNASIEEVRSLFEEHGSVLRVLMPPSGTIAIVQFSQPAACRAA
                     FAKKAYSRFKDSVLFLEKGPKGLFVDNAAPAEDRPAGVQKPSVADLLARDDAEDQLET
                     TSLFVRNLNFSTTSEGLAKAFQPLDGFVSAKVKTKTDPKRPGQVLSMGFGFCAFKSKE
                     QAQAALKVMDGYVLDGHKLVVRASHRGHDAAEERRREDLAKKAAAQRTKIVIKNLPFE
                     ASKKDVRNLFSEYGKLVALRLPKKFNHTSRGFAFAEFATPREALNALTALKDTHLLGR
                     RLVLDFAEADEVDPEEQIKAMEKKIRGQVNKVTLQQLTGEGRRKPRTPTPMRLIGSCP
                     AAVLRRSAPTRRGCAGFPWGRGGHLARFGCPCVPVGSSLDTSRRAGPTKPGWLRPDSA
                     AALGAGSEAMKLPGRLPVLPPQCYSPSPDHGLDGSRRGTSSSRQPLQESTGNIQHPPM
                     VWYAQPWEALSSIPPSMPAPPVLRTQSLGPGYGAATAYASASTGTSARTQQRHDLRLQ
                     SRRRAQGVNPLMPLLTQAFQNYRKKQAGKSDQKWPEVLEGPFLDGEPMGRKKYTMRQT
                     QYGRNMLIGEYLWIAYCQSLPPGAEPDPQMARGRKMVSSHIQVLRKFFPNHRCFHFFF
                     GQGPDDKDGDSIETASLKNNPVLIALSEGRLPDERPNYEYLAQVLALDEQVQFRPKRC
                     WIFVSHEDVVVGEDRTGHLRATGARLGEAEYPHLGRNLERETWAKEEQQFFKGALLHE
                     FTKELQQVESSSVRELSKQWESAFPALHQRLKAITSTTTDARCDILHMHATLELKEKR
                     RFPSGSNLSSWVEINLEQPRLLNHRWKVETRLVRPPELGCSHDGSAPEVVYEPAKREF
                     TIPYQHRPGCDGRGQCDCLAQRCRREGVVVPFPVPFPAEVWAQTLTNCAEYPAHPFSD
                     SKRHDRERDRAVKAEEDDGEAPRSRRRSKQPTQMDLVPKIAMMQEIWSCPPPSSPLED
                     GSSGSGSQRWTRRAVILWTFATIHRIDDGKLITAPGGKTDWRFLTILDPASEYHQRRA
                     IISGRRSSAEEYQESSSSNTGASRPASRDAIVSPRPTYQPHLSASMSENFSAAWDSAA
                     GLGSLTGPAPQAAYGAHFMSQTIPSHGTAAQGGYGLLDSFSSHSGLATPPPSASLASS
                     FAQTFDTASTSSDIVPSYMATTAGIDAGSHALGDTLSVATDPFLAHVGVTYGETHDGI
                     HGWPGHAGGLDPSHHAWPSAYPGVSAAHAHSETMSWAGSQPPSTSSRRGSEQQQQQQQ
                     HSYHYQTYQTHPERPQQPWTCSSTTNTATSDDHDPSGNGSDRSREWEDIDIPSLPGTG
                     AGATVEDEGCSAPSPALDRHQQQQHNRHHHVAHTLHHHHHHPQQQQQQQHLPQHNHNH
                     FGVDVNASMLSGGGSSRDGGAETFPAPRVPEGAGAGLKRARAESDDDDDDGNNGAVVG
                     GGFADADGDEDESGDEEGLVGRMPVAKRARTEGMEGVGGGYRLGRARC"
     gene            1710035..1711928
                     /locus_tag="THITE_2121448"
                     /db_xref="GeneID:11522560"
     mRNA            join(1710035..1711803,1711881..1711928)
                     /locus_tag="THITE_2121448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656543.1"
                     /db_xref="GeneID:11522560"
     CDS             1710200..1711708
                     /locus_tag="THITE_2121448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656591.1"
                     /db_xref="GeneID:11522560"
                     /db_xref="JGIDB:Thite2_2121448"
                     /translation="MRSALGSTHGLWAGWLLAALSGIATAHSWPEQTVRLAPNGTMVG
                     KPGFDRAHVDRALPTQDVYQLPPPGGRTVILPDDKIVKPAKWQLTNSSYSDKFPMLQV
                     APGDFVAILYTENGHVTRADMTNPTKPVNRGTVYLYGTTNNDLSNTNLLDVHLKWTAD
                     GKGGDGKGKLLATRHFDDGQCHEAVPVTGDPEGISTYRKQFISKADTLICQSDLQIPL
                     DMAVGQTLTVIWVWDWPTMNVQGVAVPPASYQSNSSTAQGNASQPYVAMPELYTGVLD
                     YKIVDPCSESLGEVKGPTCKNQNGKFVVQFASQAATTRGIVEQMLNPFLVKVPQAGFQ
                     IASATADPSNNIPLHPLIGVMSSHAFPLPSSVLTPQMDLFQATAMTATATATATAAAT
                     TAATTPPSESSSSTPTATSAGTSGQGGDAGGAVAVITVSVTVPVTMVTVTVTAGPAQS
                     SSADAGAGTTTETKTETETATFFSSSSSSPPPTVTQFLPSSRLVRVRGGAYR"
     gene            complement(<1712600..>1713570)
                     /locus_tag="THITE_2091753"
                     /db_xref="GeneID:11522561"
     mRNA            complement(join(<1712600..1712800,1712890..1713027,
                     1713132..1713277,1713349..1713374,1713533..>1713570))
                     /locus_tag="THITE_2091753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656544.1"
                     /db_xref="GeneID:11522561"
     CDS             complement(join(1712600..1712800,1712890..1713027,
                     1713132..1713277,1713349..1713374,1713533..1713570))
                     /locus_tag="THITE_2091753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656592.1"
                     /db_xref="GeneID:11522561"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Thite2_2091753"
                     /translation="MAPTVLPESGNPLVFFDITLGGEPLGRITFELFKNVVPRTAENF
                     RQFCTGESKNHLGRPQGYKGSKFHRIIPNFMCQGGDFLNGDGTGSTCIYGTKSFADEN
                     FTLKHDQPGLLSMANAGPNTNGSQFFITTVPTPFLDGKHVVFGRVVDGMDVVRKMEHT
                     KTGYRGKDVPNLDVVIAQCGEL"
     gene            complement(1714040..1716573)
                     /locus_tag="THITE_2121449"
                     /db_xref="GeneID:11522562"
     mRNA            complement(join(1714040..1714288,1714356..1716236,
                     1716305..1716573))
                     /locus_tag="THITE_2121449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656545.1"
                     /db_xref="GeneID:11522562"
     CDS             complement(join(1714201..1714288,1714356..1716236,
                     1716305..1716462))
                     /locus_tag="THITE_2121449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656593.1"
                     /db_xref="GeneID:11522562"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="JGIDB:Thite2_2121449"
                     /translation="MESRDTAKRSPEEANGGPSESLNASNGEPALKRIKLDNQPRPRV
                     KGVAPIKEEYLIVSNGQALNPSAEGEALDDDVAEGRTAPDTQEAEQGAGQGGKRKKQK
                     GQNKEREFGTFSDAQRLCNSVAWTPEFSPRPCKHGDRCNALHDIRKYLKEGRRPDLST
                     FGGKCPVWEKYGRCPSGWRCLFVRSHMDEVKHDDGRSELVLVGDASKQSPEEDGEAGE
                     VRPGVVNMVPAAVKIDLSRRRVKLEKSDQYLEWLAKDTELYREHYHKQKNDVDDSKDY
                     RAQYVEPPFKPSEKRRVYFGRETPVLAPLTTQGNLPFRRLCVELGAQLTYSEMALGLP
                     LLQGQKADWTLMRAHEIEVTPPRFNPCGPVIQGYDNSKDLKFGAQIAANVPWIAIKAT
                     EALSRFLPHLRLIDLNCGCPVDMVYKSGAGSALLDAPSKLERMVRGMNTVSGEVPVTV
                     KIRMGVKDDRFTAHKLVERLALGSEDMRGVVGAPGCAAVTLHGRTRQQRYTKAADWGY
                     IAECAALIKQYNEKSDELADTIREAEENTLPSSGRMYFIGNGDCYSHVDYFDHLDNAK
                     VDSVMIGRGALVKPWIFEEIEKGQYLDKSASERLTYIEKFVRYGMEAWGSDELGLNYT
                     RRFLLEFLSFFNRYVPVGLLEYLPPNLNDRPPAYRGRNDLETLLASKNYKDWIKISEM
                     FLGPAPPGFKFQPKHKSNSYDIEAEG"
     gene            1717878..1719874
                     /locus_tag="THITE_2121452"
                     /db_xref="GeneID:11522563"
     mRNA            1717878..1719874
                     /locus_tag="THITE_2121452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656546.1"
                     /db_xref="GeneID:11522563"
     CDS             1718029..1719708
                     /locus_tag="THITE_2121452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656594.1"
                     /db_xref="GeneID:11522563"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Thite2_2121452"
                     /translation="MADQARAAGRDRQPQPQPSQNIKVVRSQKIATASLSPTDTRPPA
                     SSELYDDAAEAGDRAPPIPRSHTPGHLSSRSQDRRNRPADIAIRHRSQSSAAAINSTP
                     SSSSGRAPSLSSSASSFSIPTTKTPAPISTRQPSIAEEADGTTAPSGERHDSSTGSGS
                     KGPAPPRPTAMRSTSAIAGRSAPGAAGPAGAVARIGTGRGAPAKGAEVYTPFPPLADP
                     KTAPDVPPAPSSGMYWSRAPVSGAPHTALRAHTTTLVGSNVFIFGGCDARACFNELYV
                     LDADAFYWSTPHVVGDVPVPLRAMTCTAVGKKLVVFGGGDGPAYYNDVYVLDTVNFRW
                     SRPRILGDRAPSKRRAHTACLYKNGIYVFGGGDGVRALNDIWRLDVSDVTKMSWKLIS
                     PPADGRSPGGGAGKDDRPKARGYHTANMVGSKLIIYGGSDGGECFNDVWVYDVETHVW
                     KAVHIPVTFRRLSHTATIVGSYLFVIGGHDGNEYSNDVLLLNLVTMTWDKRKVYGLPP
                     SGRGYHGTVLHDSRLLVIGGFDGSEVFGDVWLLELAVHAYYSQISHFTIEV"
     gene            complement(1719974..1721432)
                     /locus_tag="THITE_130959"
                     /db_xref="GeneID:11522564"
     mRNA            complement(join(1719974..1720377,1720450..1721432))
                     /locus_tag="THITE_130959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656547.1"
                     /db_xref="GeneID:11522564"
     CDS             complement(join(1720304..1720377,1720450..1721089))
                     /locus_tag="THITE_130959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656595.1"
                     /db_xref="GeneID:11522564"
                     /db_xref="JGIDB:Thite2_130959"
                     /translation="MKVLSKEEEQEHFGVVMRGGLIGGTVGLALGLAGVVGASRRYPA
                     FRSLTLPFRSFLVSSAGTFGAIVLAERYSINYQRSHDQMNNYLEATHRAAEQERRAHT
                     TEWQRLMEWGRENRYSIVFASWLASMGVALALVGRNKYLTRSQKLVQARVYAQGLTLA
                     VLIATAAFETADAKAGRGRWETVMVVDPNDPTHQHMIEKKIHKEDYEGQDLWKQMVAA
                     EERRLEEQKRQQEAAAKAE"
     gene            1724972..1727751
                     /locus_tag="THITE_2121456"
                     /db_xref="GeneID:11522565"
     mRNA            join(1724972..1725369,1725468..1725693,1725888..1727000,
                     1727067..1727247,1727312..1727751)
                     /locus_tag="THITE_2121456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656548.1"
                     /db_xref="GeneID:11522565"
     CDS             join(1725494..1725693,1725888..1727000,1727067..1727247,
                     1727312..1727452)
                     /locus_tag="THITE_2121456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656596.1"
                     /db_xref="GeneID:11522565"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2121456"
                     /translation="MTTGPDFGSAAGRSRQDSFVSAGAKPISMTNPNREHANRGRRES
                     MAGSLMGGMSWGGVSVGSFIREDMMMTGTSPYINNQPSSFHSSSYIPRLEAAFMRDFT
                     CCDRTWLTLHDLLQHYEEVHVPSGTPADALGAMQSNLHGSAAASRAGSATPSAGRAQQ
                     PSQSLQGFSQQPQVGPGMGVSGIGQMMRQQRQQQGSASSQRANSLSHVNDELDAVGEM
                     ELDETVGPMDMDDNTRTIQQTRQLFGQQQRPQLHLNSSGLPHQALRTSQPPTPAAVSF
                     GFQNNPTVSSVNTPTLTTQQGPPQRAQFGQDGNGDEDDDLSGMPMKRHLGNMNLGGSQ
                     LGGLAFGALGTIDDPAKRLFSPGGASQMTSQQRALDQQVQLQQQLQQHLQAMNLDLSQ
                     FPPGTDPALILQQMAALMMPPAEEHKPFRCPVIGCEKAYKNQNGLKYHKTHGHSTQQL
                     HENGDGTFSIVNPETSTPYPGTLGMEKQKPFKCDVCGKRYKNLNGLKYHKQHSPMCDP
                     ELRAQHQNLLSTMMQNPATFLALQQGLPNINEDKML"
     gene            complement(1728376..1730875)
                     /locus_tag="THITE_2121459"
                     /db_xref="GeneID:11522566"
     mRNA            complement(join(1728376..1730289,1730352..1730875))
                     /locus_tag="THITE_2121459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656549.1"
                     /db_xref="GeneID:11522566"
     CDS             complement(join(1728428..1730289,1730352..1730784))
                     /locus_tag="THITE_2121459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656597.1"
                     /db_xref="GeneID:11522566"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Thite2_2121459"
                     /translation="MAQSAQSAQNPSTPAAPVVNPSIFGGSGQVTAHTTPQASVSSLA
                     STLTPASAGSSNNTYIMPNSPLKNRAPMDGYRPKVTRTLGQRPACLVNASVTYCGNNQ
                     IYAFGGFDQYTDEVYNHVLRLDLVSHQWTLVDNYGDIPGVRMGHTATLYKGDKLLVFG
                     GENEHRTYLSDLIIFDLKTAHWTQPQVSGPIPKGRARHAAVLHEDKLFIVGGITGHDN
                     YVLDDICYLDLKTFTWSRSWRFVGRFDHSAYIWGDRVWVFGGLSEDMDKVSDLWWLDL
                     KGNPAFESPPQIGSLDRAVLARNASSPRPPYQTAQSSVVGSSGYAANSRTPQVNTPSF
                     HLKAYAPPAPGAISALKFVSGTNVPSQMQGIHFHVYSSGTLLDFVTPAATITSRECSL
                     SALDLGTLRWQKLAEGREIFKSGYRWHYCTMNEDGTKAWLLGCPTEAGAIDLGANGLE
                     EYLSDIMEIDLRRYGFLGSNLASEARTDLARPLRTCSVEPPSKGLGADLAKLFNQPPE
                     TGSGTDFIVTALSRDYDEDEIMGSALLHNGDADEGSQTWLAPDAPTSPPIHVHRLILQ
                     ARWPHFARLWASQMAEFHTKKMHIPEPYSVVKAFLYYLYTDRIDPTDDDADGAMADLS
                     DVAGLLVMSNIYNLPHLRLLCVNRLSKELDVDHACIIWYCAGLANEEWLRKRAASFCM
                     THWGRVVRTAGFQRLPRAALVELSQEVDMEGRVVGGDELDLFIDGRFGDAASAASRRK
                     ESVSSSQTQMLGTEDDEDDGMEMS"
     gene            1731556..1733929
                     /locus_tag="THITE_2121461"
                     /db_xref="GeneID:11522567"
     mRNA            1731556..1733929
                     /locus_tag="THITE_2121461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656550.1"
                     /db_xref="GeneID:11522567"
     CDS             1731656..1733581
                     /locus_tag="THITE_2121461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656598.1"
                     /db_xref="GeneID:11522567"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2121461"
                     /translation="MATASVSTPIKSHAGLFSTRTAGGRMPLTPSPRQRSSTANANSS
                     PFTPEKTANDGQRVPSKSVYSGNLAAHFAKSKSHRDSPKSNIARVVSTPRKALELGIS
                     DFTLTGTGAHVKTPPSNKSKRTTVVRQKSSKTTLAYNADRFIPNRAASSAIANVGSGK
                     IDMHEKRSRAVHCEGSSVLSSATEDAIAALEGLNINEEETASYSRPSPNTVAYQDSLA
                     NACGVNLKTRILEFKPAPPESSKPIDLRQQYNRPLKPANASSAQFRRRIATAPERVLD
                     APGLIDDYYLNLLDWSSCNQVAIGLERNVYVWSADEGTVSCLLETSPDTYVSSVKWSG
                     DGAYVGVGLGTGEVQIWDVAEGVKIRSMFGHDTRVGVMGWSKHILSTGARSGLVFNHD
                     VRVAEHKVAELVSHTSEVCGLEWRSDGAQLATGGNDNLVSIWDARSLAVPKFTKTNHK
                     AAVKAIAWCPWNMNLLATGGGSYDRHIHFWNTTSGARVNSIDTGSQVTSLRWSPHYRE
                     IVSSSGFPDNSLSIWSYPTLVRNIEIPAHESRVLHSCLSPDGQMLATAGERSPAFVSF
                     SISLVKRHRIITNTPRSCGRELEVLEDLREEAGSGLWRWRCRRIGKGRHDQADDHSLE
                     LPTAPGKTPAASRVSES"
     gene            complement(1733930..1737623)
                     /locus_tag="THITE_2121463"
                     /db_xref="GeneID:11522568"
     mRNA            complement(join(1733930..1735909,1735960..1736506,
                     1736566..1736708,1736764..1737623))
                     /locus_tag="THITE_2121463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656551.1"
                     /db_xref="GeneID:11522568"
     CDS             complement(join(1734279..1735909,1735960..1736506,
                     1736566..1736708,1736764..1737253))
                     /locus_tag="THITE_2121463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656599.1"
                     /db_xref="GeneID:11522568"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Thite2_2121463"
                     /translation="MFKRSPPGKSYAYASKSDQVHEDDDDQADGADTDSQETVIGATA
                     SEPRPLPVRRDTPGDVSEISPLLATTPPESQGGYGASHGISHGSDLEGQKPPTRRSWL
                     ASMADSFRRMEGWASRIASTIVHPSHWDRHALWEAVFVAPVACLPAVVVGLLLNILDA
                     LSYGMILFPLGSPIFASLGSAGISMFYVSCIISQFTFSAGSIFKGGIGSELIEVVPFF
                     HNMAATIADAVGEDKPEAVIATTITSYALSAILTGAVFYLMGRFRFGYLVGFIPRHIL
                     IGCIGGVGLFLVATGFEVTARLEGSFNYDLDTLHRLTRADTLALWIIPLALAVILFTA
                     QSRITSKYFLPLYILAIPAVFYASTAAFNLLDPQKLRDGGWVFEGPPAGEPWWYFYTL
                     YKFELVQWGAIVQCVPAMLALTFFGVLHVPINVPALALNTGEDHANLDHELKLHGYSN
                     LLAGMAGSIQNYLVYSNSLFFMRSGGNTRLAGVELASFTFLVMLTGPSLIGFIPVMMV
                     GVLIFDLGFELLVEAVWQPRKKLKLAEYLTVLAIVLVMGTYDFVVGIGVGILLAFASL
                     TFQTSRVSAIRATYSGEVVGSTVRRNPTQQHYLRQVGRQISIIKLSGYLFFGTIVGVE
                     DRIRALIADDEFSRRPIKFLILDLWLVTGVDYSAAEVFNTISRLLNGKRIELVISGID
                     PEHGLGRTLRTVGLGAEGIEVKLMQELNSALEYCENELLKTLYLNQQESASARTASTA
                     NLDVPQPPCAHQARDLLASSPRRDHLREAARLSLKQVDARLSTRWQSFTQPVRLMLQI
                     FHDVSDKNEDFWFRAAPYFRRAAYPAGTVLFRRGERAEGFYLVEAGVLRAEYDLPQGW
                     LFESIVASTTCGELPFFSETNRTATCVVERDCVVWLMDAEGWARLQKEEADVAQELLR
                     ISLKMTSERMSVITSYTLTMAG"
     gene            1738016..1740093
                     /locus_tag="THITE_2121465"
                     /db_xref="GeneID:11522569"
     mRNA            join(1738016..1738262,1738785..1739758,1739817..1740093)
                     /locus_tag="THITE_2121465"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656552.1"
                     /db_xref="GeneID:11522569"
     CDS             join(1738143..1738262,1738785..1739758,1739817..1739901)
                     /locus_tag="THITE_2121465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656600.1"
                     /db_xref="GeneID:11522569"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="JGIDB:Thite2_2121465"
                     /translation="MSNAAVGPVYDSIITEVINSVRVDFEENGVDEGVLEDLKKRWQA
                     KLSQMKVAQFPWDPKPEPPPASAAGTGTQAATVPQTSAPATNNYTHSTLSPQGPAQSL
                     SLPGQLAPNAGGMALKQEPGLVNADPVIKQEPGLPSMPSMHPGYNPAATARGTAAQRA
                     AQALENQFGQRAAASINAIHSGMASQMNAGAQPQQSTRPGQAPQPMNAQQQYRQDVAA
                     AMQQRLQQVPHTGAPNGLPASQVDGPSDAACGSGPRPTMGRTEIDEHLHAQLAARAKQ
                     MEGGGLMLPLKDATKDRSVPTTRPSKGGLAQHDGAEDGIKSEEDEDKDAINSDLDDSD
                     EDKDDEEDDDESMGHMMLCMYDKVQRVKNKWKCILKDGVLTVNGKEYVFHKATGEYEW
                     "
     gene            complement(1741243..1743082)
                     /locus_tag="THITE_2121469"
                     /db_xref="GeneID:11522570"
     mRNA            complement(join(1741243..1742249,1742322..1742846,
                     1742918..1743082))
                     /locus_tag="THITE_2121469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656553.1"
                     /db_xref="GeneID:11522570"
     CDS             complement(join(1741480..1742249,1742322..1742846,
                     1742918..1742963))
                     /locus_tag="THITE_2121469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656601.1"
                     /db_xref="GeneID:11522570"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="JGIDB:Thite2_2121469"
                     /translation="MASPPKPWERQGAASAPAPAPAPAPASAPASASAPAPAPAMPAA
                     TANATTTTATTTTSSTTPAIPARPPSLTTTVNQNAAAYGRPYGTTPYNAYGTAYSSPY
                     GSPYARYGGYGGYGAGMYGSYGGGYYGGMYGGLPGAMPNDPNNPESLTQRFSMSTQAT
                     FQMLEGIVAAFGGFAQMLESTYMATHSSFFAMVSVAEQFGNLRDTLGSVLGIFTLMRW
                     IRTLIAKLTGRPPPADAKALTPAAFARFEGRQSPLPEGGPPRPSRKPLLFFLLAAFGL
                     PYVMSKIIRSMAANAEEEERRRQLVAQQQSLDPNNLEFCRVLYDFSPAAQGQAVVQGV
                     DLEVRKGDLVAVMSKSDPLGNPSEWWKCRARDGRIGYLPSTFLEVLRKPGQPIAAIKD
                     TAASESSRANSLTSTISTSGVQTPASVPAKPPALPHTKLGDVTVESFQKSQFCS"
     gene            complement(<1744098..>1745864)
                     /locus_tag="THITE_2091763"
                     /db_xref="GeneID:11522571"
     mRNA            complement(join(<1744098..1744130,1744210..1744614,
                     1744673..1744713,1744776..1744788,1744879..1744950,
                     1745013..1745030,1745102..1745167,1745223..1745352,
                     1745413..1745467,1745537..1745593,1745646..1745761,
                     1745824..>1745864))
                     /locus_tag="THITE_2091763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656554.1"
                     /db_xref="GeneID:11522571"
     CDS             complement(join(1744098..1744130,1744210..1744614,
                     1744673..1744713,1744776..1744788,1744879..1744950,
                     1745013..1745030,1745102..1745167,1745223..1745352,
                     1745413..1745467,1745537..1745593,1745646..1745761,
                     1745824..1745864))
                     /locus_tag="THITE_2091763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656602.1"
                     /db_xref="GeneID:11522571"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Thite2_2091763"
                     /translation="MTRNTHGTRQIPIRAATVFEPGEPIIGINLGTTYLCVGAMKVDK
                     AEILVNDQGNRITPSYVAFAKNGEHLIDAAKNQYTSNPRTTFCYVKRLIGRSFSDEGV
                     QADLKHTPFKVAAGQGGKPVDKLDVGGDTRQKEASGGLNPDEAVFVGAAIQAGIIGGV
                     KATERVLLMDVNPLTLGIETAGGVMIPTVVSVTGVLYFGLMSDLAVLIKVYEGERTLI
                     KDNNLLGKFELTGIPPAPRGTPQIGALFSLDVNRILQVSAQDKGTGRRDSISTDNDGG
                     LLAEDEIARMIAEVEKFADEDKGARERVEARNAFEYCVSSLKNELEDEKGLGRKIEGD
                     EKETPREAVKEATA"
     gene            complement(1746602..>1748598)
                     /locus_tag="THITE_135170"
                     /db_xref="GeneID:11522572"
     mRNA            complement(join(1746602..1747999,1748083..1748280,
                     1748353..>1748598))
                     /locus_tag="THITE_135170"
                     /product="eburicol 14a-demethylase"
                     /transcript_id="XM_003656555.1"
                     /db_xref="GeneID:11522572"
     CDS             complement(join(1746842..1747999,1748083..1748280,
                     1748353..1748598))
                     /locus_tag="THITE_135170"
                     /codon_start=1
                     /product="eburicol 14a-demethylase"
                     /protein_id="XP_003656603.1"
                     /db_xref="GeneID:11522572"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_135170"
                     /translation="MGLALDIGGPLAEGFSRLGLASQIGVAFASFLFLSVLLNVLKQV
                     LFRNPNEPPVVFHWFPFVGSTITYGMDPPRFFKENRKKYGDCFTFILLGKKTTVYVGP
                     KGNDFILNGKIRDVCAEEIYHPLTTPVFGKDVVYDCPNSKLMEQKKFMKVALTTEAFR
                     SYVPIISDEVTSYFKRCPDFKGKSGVVNICPKMAQITIFTASHALQGKEIRDKFDETL
                     ADLYHDLDMGFTPINFMLHWAPLPWNKRRDHAQRTVAKIYMDTIKARRARGETGAQDI
                     MYHLMNSTYKNGVKVPDHEVAHMMIALLMAGQHSSSSTSSWIMLRLASRPDIMEELYQ
                     EQIKNLGPDLPPLTYEDLAKLPLNQAIVKETLRLHAPIHSIMRAVKQPMPVPGTKYVI
                     PPNHVLLAAPGVSATDEQYFPQPMLWEPHRWEKDSPLAPSIVRNAPDNGEEEEEKIDY
                     GYGLVSKGTASPYLPFGAGRHRCIGEQFANVQLQTIVAMTVRLFRFRNVDGQEGVVGT
                     DYASLFSRPLEPANIVWERRDAAQA"
     gene            complement(1749312..>1751533)
                     /locus_tag="THITE_2156149"
                     /db_xref="GeneID:11522573"
     mRNA            complement(1749312..>1751533)
                     /locus_tag="THITE_2156149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656556.1"
                     /db_xref="GeneID:11522573"
     CDS             complement(1749689..1751533)
                     /locus_tag="THITE_2156149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656604.1"
                     /db_xref="GeneID:11522573"
                     /db_xref="JGIDB:Thite2_2156149"
                     /translation="MPPALGPSRSSHTKVVISPPRINLRRAASYNHDRGPLSSTSARF
                     SFNHLVFSPPPSPGLPSLSPPAKKPRRRLFGTVRPLRVVRYTIRLLSIVVVFYVALVV
                     LTWLFGEPSPAVPEPPKPAEQEDEIDMVSQKRPPDFPTPIVVTDNRGRAKWTVSIPPG
                     SDFPLTMGEYAEMCAKCRQVAARAQHLRSHGHGLHQVSLGLGSDSPDPNFVDVQEAEK
                     AGYLAREEAQGNPATGSEVGKPVCKTSLTFVLESSDAGLGKTLMMLWVAYGLAEKEGR
                     AFFIDDARWAYGKYTAIFQQPPLPRCSPPPNHERLPCPRHARHLVASAATMNEFFGSL
                     TKSADPPSESHDRALRKTQYNLARKGYEALFRLNEEDASYVDARVRELMAKRIVPKSR
                     GQQNGLAVGVHVRRGDRHPLEYQYRRSYMPLHLYSEAARELIEARLNHSGPFGGEDRA
                     AKEHSLVVLASDDPMVYESAELAGASRAQERIKLASKQAIQRASPDRSVLHKFVDETF
                     GWEGGFFAAMFWNLGVSAAHEAGRPDADGARAAASPSAETYRLRSLVGRAYMMDLAVL
                     ADASDAIVCTVSAVGCRLLAVMMGWESAMEEGNWVNIDGGYGWMGLEW"
     gene            complement(<1755848..>1758865)
                     /locus_tag="THITE_2131752"
                     /db_xref="GeneID:11522574"
     mRNA            complement(join(<1755848..1758033,1758094..>1758865))
                     /locus_tag="THITE_2131752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656557.1"
                     /db_xref="GeneID:11522574"
     CDS             complement(join(1755848..1758033,1758094..1758865))
                     /locus_tag="THITE_2131752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656605.1"
                     /db_xref="GeneID:11522574"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Thite2_2131752"
                     /translation="MSTALPRPSRPSNAPPTIALPALPVPKTRKSTGGLAAPSSKSTP
                     ATPRSGLRAPSASLLPPASPAPTSALPQPRPVSGVNAAGRTIRKAVSINAFPQPPRPD
                     GQIASLPPSPLSTSVPSRKLRTPTTPTYQSSNGTPSLLNGTGEGKSVSRQGATRNSDG
                     LNSVVSPPQSRSSSAQDSYSTSATQYDDVNDMAPPRSEGAAGGKRTSKSDGKGNVIVS
                     VRVRPDPTGNDNKPGGEWLVDGRKSLISYRGKEGGDYYYDNVFTTHDDNAKVYDHSAK
                     RLVRRVMEGYHGTVFAYGMTGTGKTFSMQGTASSPGVIPLAITDIFSYIRETPSREFL
                     LRVSYLEIYNEKIHDLLSMPTGNGVGAAQQQEEIKLREDSKRGVYATPLKEEIVQSPT
                     QLLRVIARGDQARRTASTQFNARSSRSHAVVQIVVESRERVPGGSGDSKRSGLLPGGV
                     RVSTLSLIDLAGSEKAAESKERRQEGSHINKSLLTLGTVIAKLSEHKDKDGKPADKDG
                     KHLPYRDSKLTRLLQGALSGNSLVSILCTISISSAGSPAMSNTHTNETLNTLKFASRA
                     KNNIVSHAKRAEEALGPGGDGGARVLLERYRMEIMELRKELEAQAKANGRREAEEERA
                     REKEAEMRHEEQMLEMQLARTALKERIDHLNRLILSSKSIGVNASGSFSALGMHPRYS
                     QTSVRSSVATSNGGKLGLERTGSMTSSASTIGRKPSSHHSSGVADAAPAVEDDDSVGE
                     YGDGTASLAAQNRALQADLADKNRYIQTLEKRLLQARRASSSRTSIGLSASKGIMVGE
                     DHSVAALLKEKDAEIAELRARLDDKDRMLAALRSAARSRDNAGRVDSRAEVRTSQILD
                     SDPGPAPTGSPPAAPVGLGLGGSGGSLLRQVSTLRKRTKSVDEMSRMLDEMIQDRVES
                     GQLIRGSRGSVRIAPEPQPLPLRERKDASPPSPPPASAPPPASPPIQLQLLARQRASF
                     AAAEPQKSMALEA"
     gene            complement(<1763167..1763984)
                     /locus_tag="THITE_2121477"
                     /db_xref="GeneID:11522575"
     mRNA            complement(<1763167..1763984)
                     /locus_tag="THITE_2121477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656558.1"
                     /db_xref="GeneID:11522575"
     CDS             complement(<1763400..1763868)
                     /locus_tag="THITE_2121477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656606.1"
                     /db_xref="GeneID:11522575"
                     /db_xref="JGIDB:Thite2_2121477"
                     /translation="MVSLETVARAPAGSVAAVGGAGAVHAVGGTGARSMDRAGAGASS
                     GGGFSVAVPGTGVFLKLASAALEHLAELLQKTQYREMPESDLREKWDGGVVGDSEVAQ
                     AKKARGEFTGAVPGRTKKWKEFQGLAFDWVLREAVGAGLVEIFETGCVGRGVRL"
     gene            complement(1766315..1767737)
                     /locus_tag="THITE_2121480"
                     /db_xref="GeneID:11522576"
     mRNA            complement(join(1766315..1766437,1766505..1767028,
                     1767095..1767737))
                     /locus_tag="THITE_2121480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656559.1"
                     /db_xref="GeneID:11522576"
     CDS             complement(join(1766344..1766437,1766505..1767028,
                     1767095..1767127))
                     /locus_tag="THITE_2121480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656607.1"
                     /db_xref="GeneID:11522576"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="JGIDB:Thite2_2121480"
                     /translation="MPMYGDLGNKLVQHAKRTQNLAHLPAYQTELVRAVTREVRDLDR
                     DTKNLLEPFQGSFDPSADQATACTLLVNHLAMRRNKRCLLAYHRTRTDKLEELVWNGV
                     DVLDLAGQQAGGANGAGVADGGAGGSSSLSPQEEDYFRQYGDLLAAYKGQWTDIDLTG
                     SLEPPRDLFIDVRVLKDAGEIQTEYGAINLTKNSQFYVRQGDVDRLIAQGYLMKLG"
     gene            1768380..1771324
                     /locus_tag="THITE_2121482"
                     /db_xref="GeneID:11522577"
     mRNA            1768380..1771324
                     /locus_tag="THITE_2121482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656560.1"
                     /db_xref="GeneID:11522577"
     CDS             1768538..1770934
                     /locus_tag="THITE_2121482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656608.1"
                     /db_xref="GeneID:11522577"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="JGIDB:Thite2_2121482"
                     /translation="MYNRGQLVSTAARRLAAGSRGALRQRQSPRIIGATTTTWLAPPA
                     VGCFHLYPAVAARLYSNGRPHPPGGNFRMNLGGEPEKPALEEYGIDLTAKAKAGKLDP
                     VIGRSAEIQRTIQILSRRTKNNPVLIGSAGVGKTAVLEGLALEIVRGAVPESIKNKRV
                     IALDLGSLIAGAKFRGDFEERLKKVLTEVQKANGEVILFIDELHTLLGLGKAEGSIDA
                     SNLLKPALSRGELQCCGATTLAEYRQIEKDVALARRFQPILVSEPSVQDTISILRGIK
                     DKYEVHHGVRITDGALVAAATYSNRYITDRFLPDKAIDLMDEAASSLRLQQESKPEDI
                     LRLDQKIMTIQIELESLRKEKDVASKERREKLEADLKACQEEVKGLTEKWEQEKAEID
                     AIKRTQAELDRARIELDQAQREGNFAKASELRFGTIPALEKKLPKDGDKPADEGTLIH
                     DSVTADDIANVVSRITGIPVSKLTSGHTERLIHMEDILRESVRGQDEALKAVADAVRM
                     QRAGLSGENRPLASFFFLGPTGVGKTELCKKLAGFLFSTESAVVRFDMSEFQEKHTIS
                     RLIGAPSGYVGYEDAGQLTEAVRRKPYAVLLFDEFEKAHRDISALLLQVLDEGYLTDA
                     QGHKVDFRNTIIVLTSNLGADILVGADPIHPYKETEDGDIHPSVKRAVMDVVASQYPP
                     EFLNRIDSFIIFKRLSLQALRDIVNIRLKELQQRLDDRRITLVAPDDVRQWLAERGYD
                     PKFGARPLNRLITTQIGNGLADKIIRGELKTGETAVIELNADKSGLVVRSQQTAEQQA
                     "
     gene            complement(1771687..1773826)
                     /locus_tag="THITE_2171273"
                     /db_xref="GeneID:11522578"
     mRNA            complement(join(1771687..1772567,1772629..1772694,
                     1772759..1773003,1773101..1773307,1773745..1773826))
                     /locus_tag="THITE_2171273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656561.1"
                     /db_xref="GeneID:11522578"
     CDS             complement(join(1772481..1772567,1772629..1772694,
                     1772759..1773003,1773101..1773257))
                     /locus_tag="THITE_2171273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656609.1"
                     /db_xref="GeneID:11522578"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="JGIDB:Thite2_2171273"
                     /translation="MGIGGSKLLGWLSLLMKQKEMRILMVGLDAAGKTTILYKLKLGE
                     VVTTIPTIGFNVETVEYRNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDR
                     VPEAREELQRMLNEDELRDALLLVFANKQDLPNAMSVAEITDKLGLHSLRQRTWYIQS
                     TCATSGDGLFEGLDWLATEIKKNN"
     gene            1774132..1775571
                     /locus_tag="THITE_2121489"
                     /db_xref="GeneID:11522579"
     mRNA            join(1774132..1774508,1774596..1774991,1775073..1775571)
                     /locus_tag="THITE_2121489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656562.1"
                     /db_xref="GeneID:11522579"
     CDS             join(1774308..1774508,1774596..1774991,1775073..1775090)
                     /locus_tag="THITE_2121489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656610.1"
                     /db_xref="GeneID:11522579"
                     /db_xref="InterPro:IPR000348"
                     /db_xref="JGIDB:Thite2_2121489"
                     /translation="MLLQAAAKLLFSASLLLGSAAAHNIQLPAHGRECFHENLHHGDK
                     MTVTFQVGDREFGSAGNLDIDFWITNPIGQYEFNERSVSNGDFSFDAKHDGKYIYCFG
                     NEHWGASSKEVSFNVHGVVYVSEADVPQDPLEAEVRKLSELLERVKDEQSYIVVRERT
                     HRNTAESTNSRVKWWNLFVIGVVIGESIFQVWWLRRFFEVKRVV"
     gene            complement(1775571..1778788)
                     /locus_tag="THITE_2121491"
                     /db_xref="GeneID:11522580"
     mRNA            complement(join(1775571..1778412,1778478..1778788))
                     /locus_tag="THITE_2121491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656563.1"
                     /db_xref="GeneID:11522580"
     CDS             complement(1775677..1778382)
                     /locus_tag="THITE_2121491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656611.1"
                     /db_xref="GeneID:11522580"
                     /db_xref="JGIDB:Thite2_2121491"
                     /translation="MGLLSFGLFRPGSAKGPKLPLYKEVPSSSRRRTARPPRSPTKER
                     YSDSEDTSDESGDGDTTDSSTSSSPSSRSSRRTSSSVSSAAALMPLKKRPATAARRPP
                     VRRYLYRLPNRVIRYLCIAMMSTIVIFIFILVRASQLENRRIAEGKVDKKPVIPPPWE
                     EFEFLTRYYGGVRSVVPLADNTPQYPRLEEEGPYNVTQPQPQQQQQEEEEEKEGSERR
                     EAEPPAVDQASVEVKPVPPSKAFTDYPTAGLPKTADGVYECFLDSQNTIRVPPIRYIE
                     GRPNGFPDNILGSYELLSLPEDVCFERYGRYGPYGYGYSIRTGGLGIGEHGEREGAEA
                     VWETVKQVDWRGIDWAAAQRQCYKANANRYKPLEVRGARPRGFYIGDGLEVPRLATRD
                     SAEKVQSAGEKTQASIGRTAVVLRCWDEFVWREEDIANLRALISELSLASGGRYDVHL
                     LVQVRNDGRNPVWADDDTYRSRINETVPEEFRGIVTLWSETQMLAVYQGVVDLWTRGP
                     DLPVHGSYRGLQMAMQYFAYNHPEYDYFWQWEMDIRYTGHYHDLLSKLELWAKDQPRK
                     GLWERNARYYVPHVHGTWEDFRQMSRVQTEHGTVGADNVWSSVPGSKIVGSGADRPSS
                     SASQMSRGEQSIWGPERPLDENDWFEYESDPVPPTTYERDKYTWGVGEEADLLTLSPI
                     FDPEGTTWGLADDITGYNETGGIGKPPRRAQIITASRMSRRLLLTMHRETAFKKHHAF
                     PEMWPATVALHHGLKAVFAPHPVFVDRAWPPAYLARVLNGGRNGASGGARTAVYGDRE
                     HNTRGLTWFYNAGFPGNLYRRWLGLRVNNDGGEEFETTVDQAGDDRTVGTMRGGEGRM
                     CLPPMLLHPVKEVDLPVEREEQEEEQQQQQADEKKGETLVLDPGA"
     gene            complement(1780319..1783303)
                     /locus_tag="THITE_61645"
                     /db_xref="GeneID:11522581"
     mRNA            complement(join(1780319..1781092,1781216..1782439,
                     1782503..1782831,1782907..1782980,1783060..1783114,
                     1783230..1783303))
                     /locus_tag="THITE_61645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656564.1"
                     /db_xref="GeneID:11522581"
     CDS             complement(join(1780873..1781092,1781216..1782439,
                     1782503..1782831,1782907..1782980,1783060..1783114,
                     1783230..1783274))
                     /locus_tag="THITE_61645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656612.1"
                     /db_xref="GeneID:11522581"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="JGIDB:Thite2_61645"
                     /translation="MASSMAWRRLAAAPALSRAFRNPTRAFSTTRPVARVIANGPLRA
                     KEASPFVSNKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVA
                     AQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPF
                     SRTEDGKIYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIE
                     YFAIDLIMQDGECRGVLAYNQEDGTLHRFFANNTVLATGGYGRAYFSCTSAHTCTGDG
                     MAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTA
                     KDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHLPAEILAERLPGISETAGIFAG
                     VDVRKQPIPVLPTVHYNMGGIPTRYTGEVLTVDEQGNDKVVPGLFACGEAACVSVHGA
                     NRLGANSLLDLVVFGRAVSHTIRDKFTPGAPLKPVEADAGAQSIETLDKIRTSNGPKS
                     TAEIRLAMQKTMQREVSVFRTQESLDEGVRQITEVDKMFSQVGIKDRSMIWNSDLVET
                     LELRNLLTCATQTAVSAANRKESRGAHAREDYPERDDENWMKHTLSWQKTPHGPVELK
                     YRRVISTTLDENECKPVPPFKRVY"
     gene            complement(1783835..1787701)
                     /locus_tag="THITE_2121496"
                     /db_xref="GeneID:11522582"
     mRNA            complement(join(1783835..1784847,1784932..1785775,
                     1785838..1786091,1786157..1786245,1786303..1786600,
                     1786666..1786974,1787055..1787284,1787359..1787701))
                     /locus_tag="THITE_2121496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656565.1"
                     /db_xref="GeneID:11522582"
     CDS             complement(join(1784185..1784847,1784932..1785775,
                     1785838..1786091,1786157..1786245,1786303..1786600,
                     1786666..1786974,1787055..1787284,1787359..1787506))
                     /locus_tag="THITE_2121496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656613.1"
                     /db_xref="GeneID:11522582"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Thite2_2121496"
                     /translation="MVFDNTPKVPSNAVNATRNELQAGGPTEMPVLTVSAPAAKQNLT
                     GKQEHYLKRELISEQVKWEISELNSPTALRRFGAPFKSPLGEVSPLDSELPILRYIFV
                     HHVREFPFLDKAKEKEFWQDKLQVFLESFASKNISSSEDRLEETKRRKLAVKAKKLVE
                     LMMVSGIPTSSGFEERIRFSELEIVDANAIDTGVLSTLPEGNYLNGWDVNVAGVRIIS
                     VKRKIRHHPHAEFMLRVKRKNGPVHFVGRRYGDFARLYKRLRTELPGKVLPPLPHKNK
                     SNSTVPSFIGAYGDEHSETSSISSASTQLPRSPVANGSGHLNDGAQRLLSVKDRRSPD
                     RLSPRNSVDGGPSAHTTLSPKPQESVLLRRENQRISLRAFLRSLLHNPQIASTKAIDE
                     FLTANPITLSDEDIEDITRRKHLDEKRVEEQKRFYEVARKRAAELDVYMEQFRQDIVE
                     RNGLTMLFKEIREKETIQDLSLQYQKFAEWLRIEVAATIYHLFLAEDNSPELFAQAKR
                     IHSLIPYTLMKNVIRVANPAAVMSSILDIFLAQPFGTRSLMQRIFSMTLNDGIKAFQR
                     SIDALADKIGDPVFVEKLKAFTDAEEPIKQAIREEAASDDIDILVVILRSELVGPPLQ
                     PQQIERLYNAYVAFNNAVENVDEELRQGAQLFSYLKQLMKLYIRQRDKAMMLSLIEEP
                     VTLQLFRDLFTIFYEPLVRVYKSANVYNSITDFAHFVDDLIQVVERCREQDLSADPNQ
                     TVQAFIDLCQRHEHNFYKFVHEVHTHDDGLFTQLMGWIENILEFLRHGPANGSLDINA
                     LFEGATSSGIIDREKAIVEIDRLIAWQEARKKWHHDKTRQKMAAEGVPADGGGGGEAL
                     PGALAFRSSDFGLDQEDLAEMGFDDDSEEEAEAEADDELDPIDAERKRRARRQDRLRR
                     NAGEPAKPEVSEVHKLKENFLVMLRMVLAE"
     gene            complement(1788331..1788958)
                     /locus_tag="THITE_2121499"
                     /db_xref="GeneID:11522583"
     mRNA            complement(1788331..1788958)
                     /locus_tag="THITE_2121499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656566.1"
                     /db_xref="GeneID:11522583"
     CDS             complement(1788677..1788874)
                     /locus_tag="THITE_2121499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656614.1"
                     /db_xref="GeneID:11522583"
                     /db_xref="JGIDB:Thite2_2121499"
                     /translation="MFHSTSAVCLTGNAQSEGLGNLETPSDFHGSRGWMDHTKPNIIR
                     ELPGALGLICATCAILARFDS"
     gene            complement(1788960..1790510)
                     /locus_tag="THITE_2121500"
                     /db_xref="GeneID:11522584"
     mRNA            complement(join(1788960..1789884,1789964..1790510))
                     /locus_tag="THITE_2121500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656567.1"
                     /db_xref="GeneID:11522584"
     CDS             complement(join(1789218..1789884,1789964..1790349))
                     /locus_tag="THITE_2121500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656615.1"
                     /db_xref="GeneID:11522584"
                     /db_xref="JGIDB:Thite2_2121500"
                     /translation="MSQNGGDAPKVSSPSRPRHQITRSISEISSPIRLHRHHSYRVNR
                     EPERDARTPAPQSAIPAVQARRSFEWSRSEGVTPNLTPNASRRTSIFYASADEVMPPA
                     VRPPKDSRVASGNGLAKDQQRAVARVSGLQRSLAELESFTSSTTKQLDDTYYSLLEKL
                     GALRSTVAALKELADRSRQLSGSFSAEAEELDADIRSQLDAFGQFEDQQKRIESLQGR
                     IHAGRKRIRSLSERVDAVSERIESWERADREWQEKTRKRLMALWIVTSVVVFLVLALF
                     VGSQHTSEGLEEATTRIASDGLNTLEVVAGAKADLLWNSRATESEGTSSLLNVTEPPG
                     TSSSHTTDMLTVFDEL"
     gene            complement(1790831..1791682)
                     /locus_tag="THITE_2121503"
                     /db_xref="GeneID:11522585"
     mRNA            complement(1790831..1791682)
                     /locus_tag="THITE_2121503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656568.1"
                     /db_xref="GeneID:11522585"
     CDS             complement(1791030..1791491)
                     /locus_tag="THITE_2121503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656616.1"
                     /db_xref="GeneID:11522585"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="JGIDB:Thite2_2121503"
                     /translation="MSATTAEGAAAQEAAAAKPLGMRKNGNLRLEVRDLRFVVLMRAP
                     GKQWHAPKKAFRPGSGLTSYKQRAQARVAQAATKAKEKEMKEEKEAERQVRIGSRARE
                     GDETLIIVLAEADTSAQGEAGCQGRERTVRAVGGEDAQEEAGAVETQGEAQ"
     gene            1793904..1797726
                     /locus_tag="THITE_2171277"
                     /db_xref="GeneID:11522586"
     mRNA            join(1793904..1794124,1794237..1797726)
                     /locus_tag="THITE_2171277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656569.1"
                     /db_xref="GeneID:11522586"
     CDS             1794430..1797279
                     /locus_tag="THITE_2171277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656617.1"
                     /db_xref="GeneID:11522586"
                     /db_xref="JGIDB:Thite2_2171277"
                     /translation="MAATAGPDMMIEPPSPDCLEQGAALQLPGTPGMSDLAAPRTRPA
                     GSQASPRSNPPPPNPPFVFPARPSSSSAPSSFSRATGRRPRSAIEVSQSGAEDGKGPS
                     RSPALPAFSFNPAASLPPTPGFDNVFLSPQQSPSAPNSPRLAPNRPAGLGHRRGGSEF
                     VGGSIRDGEAITVTNVSPTKSESGMGSPLLQPTTPRRGHAHRRSAAISSHDLSSIIVP
                     HSNSGPKGSTTPASPAVSERHSVPGIPGPGKPTGTGSEMPSPAPEPLASRSIDPSPTV
                     VPPEQTPKGAVRNRVGFSDTLEYIPRPLSLVSTDTSSTATVRPGHSVSGSISSVISLS
                     NVDRGPTSTPRPIDSRPSTAGAVMERTQSAQEDEPALRSPRRRGSIPLLGSLPPAIPL
                     NPATPSPTRSAKKWAFFSLDPFVSSSPTRSHPESPLSAISRSCVAERRSTERDNCTGA
                     QEPTESSDAPKPAAKKRGKKQKKVKTWAGSILSRKGKHRHGKHKRRAPTPPPPRHFEL
                     VKDGDDGETMHMSLEPEPPAPTFAATQSSGNGDWETWTFPKPVAVPDEDASYPMIDLD
                     AALGPFNTPLPRNPEWEAAQRAGGLVKKQLHSAAGMSRFSGPGMHYYHRRAESAPELV
                     PFEGGRFGFRRFGSSSTMADVFEEDEEEEEESAGSSNGPSTPAVGTSVAEKSEAATHS
                     EVEPRKACQDHGPTGSSTSSLAEAVQRKPCEAGEVSSSARSASEQPGCLACDDTVLTE
                     PVPPFLAEESLPGDANSGSATPSPRHVSRPKDLAPVELSPLNLPTASLGPVSPWSMTQ
                     SSAFPSPRSPMSYDAQCISTAPSSVAEDNFQSLLLGEPGPEVRISVDDVPSLTSSNST
                     MTRESLFAQLPQARHPPLGEHPRPASFTSTAFGRRRSSLASLSRLVNSSHGERSKLSI
                     EVPMDSEPDKKAKSSKTKRLSRMMQFWKSKETNKA"
     gene            <1798133..>1798820
                     /locus_tag="THITE_27406"
                     /db_xref="GeneID:11522587"
     mRNA            join(<1798133..1798310,1798522..>1798820)
                     /locus_tag="THITE_27406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656570.1"
                     /db_xref="GeneID:11522587"
     CDS             join(1798133..1798310,1798522..>1798820)
                     /locus_tag="THITE_27406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656618.1"
                     /db_xref="GeneID:11522587"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_27406"
                     /translation="MSAASSRNAIRRLLKELDTWKHSEAAGEQGIERLGPVSDDELLT
                     WEAVINGRGIGNGYENGRWLLRIAVPPAYPLQPPQIAFATPVVHANVHPRTGEICLDL
                     LKDAWTPAYSVLECVRAVRMLLAAPAVDSPLNVDVAALLRAGDVLGARRLVELWVEE"
     gene            complement(1799602..1800881)
                     /locus_tag="THITE_2121506"
                     /db_xref="GeneID:11522588"
     mRNA            complement(1799602..1800881)
                     /locus_tag="THITE_2121506"
                     /product="glycosyltransferase family 62 protein"
                     /transcript_id="XM_003656571.1"
                     /db_xref="GeneID:11522588"
     CDS             complement(1799629..1800756)
                     /locus_tag="THITE_2121506"
                     /note="CAZy_ID 269970"
                     /codon_start=1
                     /product="glycosyltransferase family 62 protein"
                     /protein_id="XP_003656619.1"
                     /db_xref="GeneID:11522588"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="JGIDB:Thite2_2121506"
                     /translation="MARPMGSVRLKKTNPVTLAVGAALCIFIIYFLIGSSAPDFSASR
                     KATAASHPLSPPTSPFRKPTGGGKPKPPPVARYNLNNVTITPNPLENRENILLLTPMA
                     RFYPEYWDNLLRLSYPHELITLGFILPRTKEGNAATTELQKRITKTQKYGPEKDRFKS
                     IIILREDFEPPLTSQDEAERHKMANQKIRRAAMARSRNSLLFSTLGPSTSWVLWLDAD
                     VVETPPDIIQDLARHDKPIIVPNCFQRFWNDEKKEMDERPYDFNNWQDSPTALDLAKE
                     MGPDDILLEGYSEMATFRALMAYMHKEDGLLHEEVPLDGVGGAALLVKADVHRDGAMF
                     PPFAFYHLIETEGFAKMAKRLGWQPIGLPNYKVAYPLALTI"
     gene            1801498..1803432
                     /locus_tag="THITE_2121510"
                     /db_xref="GeneID:11522589"
     mRNA            join(1801498..1801707,1801766..1801835,1801898..1802408,
                     1802656..1803432)
                     /locus_tag="THITE_2121510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656572.1"
                     /db_xref="GeneID:11522589"
     CDS             join(1801657..1801707,1801766..1801835,1801898..1802408,
                     1802656..1803211)
                     /locus_tag="THITE_2121510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656620.1"
                     /db_xref="GeneID:11522589"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="JGIDB:Thite2_2121510"
                     /translation="MSITPIITFKAGMCDVDQSSKPFKVKALPTPGYIYLYSEDDLVH
                     FCWRPRSAPLDEPELDLVMVPTDGHFVPYDTRSPAHPSSKTNGRIFVLKFASSSQRHL
                     FWLQSKPQGRSGDPAWLSPRDRKIGDIVDRLLQGEEVDVNRELASVRNNDDDSRRDAD
                     DDATMEDVVGHGNQHSHRRGGDRGAGPDATGGDFRQEGEDAREGGADGARARASNDAA
                     TVVQNFLNSLKGTPGLGAASQGESKAYPLLNDLLEPATTIPMLDAADDAYVDTLLGFL
                     PPTLLVMAQQGDNADAIEREPGAEAVEAAKQAMSSGQKRALLKKVLRSPQFTQSLASL
                     TVALRDGGLPSIAEALRIPVRGGGLIPGGSVPLGGGEAVEAFVEGMKLKVQKDRGSDP
                     GQS"
     gene            1803433..1805518
                     /locus_tag="THITE_2121511"
                     /db_xref="GeneID:11522590"
     mRNA            join(1803433..1803947,1804146..1805311,1805433..1805518)
                     /locus_tag="THITE_2121511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656573.1"
                     /db_xref="GeneID:11522590"
     CDS             join(1803654..1803947,1804146..1805180)
                     /locus_tag="THITE_2121511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656621.1"
                     /db_xref="GeneID:11522590"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2121511"
                     /translation="MAAEAEYWSFPTNPEEFDKDDRISYSKLDNKYIAVQDDGTEYEF
                     DPELRRWIPMIDEALIEEQQKGYIMPSADADNDSDRRPPPHGKKRKMDNTDNLEDNNN
                     NNNHNSRDRSSKNARRQHGNRGPPQPKQNTAVYVTGIPLDATVEEVAELFSRKCGVIA
                     EEIDSGRPRIKMYTDAEGNFKGDALIVFFKPQSVDMAIMLLDDTDFRFPPPGAPSQPK
                     MRVMAADSSYKKTKYDSGGGGDSSSSSHQNNTPSATSTKPGESSRPPGDGRRSDQDKA
                     KIIRKTQKLSAKLADWSDDEPSALHDPADRNSSSAAPKGGRWDRVVILRHMFTPEELR
                     ADPAALLDIKEDVREECEKLGPVTNVVLYDEEEEGIVSVRFRTREAAEACLRVMHGRA
                     FGGRIIEAFFATGRERFRKSKGDGSSGGGGGGSGGGGEKEHGSEEEREED"
     gene            complement(1805439..1807885)
                     /locus_tag="THITE_2121512"
                     /db_xref="GeneID:11522810"
     mRNA            complement(join(1805439..1805921,1805987..1807469,
                     1807543..1807885))
                     /locus_tag="THITE_2121512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656574.1"
                     /db_xref="GeneID:11522810"
     CDS             complement(join(1805766..1805921,1805987..1807469,
                     1807543..1807691))
                     /locus_tag="THITE_2121512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656622.1"
                     /db_xref="GeneID:11522810"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR013982"
                     /db_xref="JGIDB:Thite2_2121512"
                     /translation="MAEHQRIAIVSVYDKTGLLDLAKGLVNHNVRILASGGTARMIRE
                     SGFPVEDISAITKAPEMLAGRVKTLHPAVHAGILARNLASDEKDLAEQNIDKVDYVIC
                     NLYPFKDTVAKVNVTVPEAVEEIDIGGVTLIRAAAKNHARVTILSDPRDYAEFLKELE
                     AGEIKESSRKMYALKAFEHTADYDAAIADFFRKQYAADGLQYLPLRYGANPHQKPASA
                     YVKEGHLPFKVLGGSPGYINLLDALNSWQLVKELKKALGKPAAASFKHVSPAGAAIGE
                     PLDADERKVYMVDDIAGIETSGLAQAYARARGADRMSSFGDMIGLSDIVDVPTASIIS
                     KEVSDGVIAPGYDPAALEMLKKKKGGKYLVLQMDPEYEPGKIETRTVYGVSLTQGRND
                     VSFSPDSFKNIITPKNAGPLPESALRDLTVATIALKYTQSNSVCYAARGQVIGLGAGQ
                     QSRIHCTRLAGDKADNWWMRFHPRVLGIKWKKGTKRPDKSNAIDLLVSGELPKSGTER
                     ENFEALFEEVPPAFTEEERQEWMSKLTDVVVSSDAFFPFTDNVYRAARSGVKYITAPG
                     GSQNDVPVFETAEKLGITFVEQNIRLFHH"
     gene            complement(1808733..1811759)
                     /locus_tag="THITE_2121514"
                     /db_xref="GeneID:11522811"
     mRNA            complement(1808733..1811759)
                     /locus_tag="THITE_2121514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656575.1"
                     /db_xref="GeneID:11522811"
     CDS             complement(1809163..1811319)
                     /locus_tag="THITE_2121514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656623.1"
                     /db_xref="GeneID:11522811"
                     /db_xref="InterPro:IPR008313"
                     /db_xref="JGIDB:Thite2_2121514"
                     /translation="MGPSFVPGSRRGRLLGIALLLAVFVLHLANRAPLSAGGGEPFDL
                     HKDPPKVPKKSQIAEPHHEHAAQEAAVEAEPAEQILYVPPTAETVTADVDNGINGPGF
                     EPSATAPTTTGGETVTETVITTSETPSPTQSECPKFEKLQQMRPGPLSEGRRKFPYVR
                     PSPECRTFTLPALEDLIERMRKVIRDPDLFRLFENSYPNTLDTMVKWRGYATKKNETT
                     GEQTLTDEELAYVITGDIDAMWLRDSASQIYSYLPLLEASTKVDSLASLWRGVINSHS
                     RYIIISPYCHAFQPPPESGIPPTHNAAYAQNSPNPPYDPQLVFDCKWELDSLASFLQI
                     STAYYERTGDLEFFGRYSWVDAVQAAVDASAAMRLGTYDDDGRVLPSAWTFTGWTNRG
                     TETLTNDGLGNPVKQNGMVRSAFRPSDDACIFQLLTPSNMMFAAYLERASAIMEGLAE
                     RGLSSKAANLTTEMRKLAAGIRVGIARDAVVTHRDFGEIFAYEVDGYGSANLMDDANV
                     PSLLAMPLWNFTSGGGGGSSKQQTAKPAKHVPRRDDDDDDNDTTTTATTATTATSSPS
                     PDADEPEPAHDYAQIYQNTRRFILSPSNPYFAKGPVLSAVGGPHLGPGKGWPMAAAVA
                     GLTAFSPLAGFGPATLAERDAAVGAQLFAVLNSTAGTGVVHETVHAWHEYAFTRPWFG
                     WANGLFGELVLRIARDEEERGLLGSDKGLLGRLWQD"
     gene            complement(1811760..1814480)
                     /locus_tag="THITE_2121515"
                     /db_xref="GeneID:11522812"
     mRNA            complement(1811760..1814480)
                     /locus_tag="THITE_2121515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656576.1"
                     /db_xref="GeneID:11522812"
     CDS             complement(1812103..1814385)
                     /locus_tag="THITE_2121515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656624.1"
                     /db_xref="GeneID:11522812"
                     /db_xref="JGIDB:Thite2_2121515"
                     /translation="MTLRGSLVEECEATSQRRPLRLDARGSRDRAVAEFASQAEKLSH
                     LHPAAGQDDGIAVEARFVTPRDPVVVTSDGNRLPPVPLHEAHRLNILRKEVEEHEAAT
                     APSGEGSVGRNGEEKEADSVTERVLNAAAADEARNGTRKPSDGSLRDTMPPTHTNPLF
                     PPLPLYGPPSLLRDVQCLVFRISSFFLSLAFLSVIVLGALFTSIPPSLRRTWLRATLR
                     NPDLNRPFYDEEMARKRRRREKEREWTRRQSPSSACGSEEASSADSDGFTPTEGGPDP
                     IVCDPAYYARRVGLDMETFEVQTEDGFIIDLWHVYDPREYQPLPPEARAHGGPEAFKP
                     PKRRGAPTATDRSNNSSGGSKPKFPVLLMHGLLQSSGAYCVNDDDSLAFYLCKSGFDV
                     WLGNNRCGFRPRHALLGYSDPRMWCWNIRQMGVFDLPALASRVLYETGFARLGLICHS
                     QGTTQALVALAKEQRPDLGEKLTVFCALAPAAYAGPLIGKMYFKFMRAITPAMFRLMF
                     GIHAFIPFMMTMHALLHPRVYGWLGYKVFSFLFNWTDKRWDRGLRDRMFQFAPVYVSA
                     ESMRWWLGRECFARHKCILATKEEWRAEEREDSDEHDQSQSGMLAAAARDMEQRREEV
                     ESSEQTAAAEPHKKKPRGSTAWYNHQAPPFALWVCGNDALVDGDKLLRRFERGREPHV
                     KVVHSKVIPEYEHLDVIWAMDAPEQVFREVREVLWKTCDVRDACRVPRGCGEVEPWVR
                     PPDVVEGDELQSSSSEELSP"
     gene            1815276..1820144
                     /locus_tag="THITE_2121518"
                     /db_xref="GeneID:11522813"
     mRNA            join(1815276..1815560,1815644..1819025,1819106..1820144)
                     /locus_tag="THITE_2121518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656577.1"
                     /db_xref="GeneID:11522813"
     CDS             join(1815392..1815560,1815644..1819025,1819106..1819859)
                     /locus_tag="THITE_2121518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656625.1"
                     /db_xref="GeneID:11522813"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Thite2_2121518"
                     /translation="MPASDASGGVRRKRLRRRRQDKPPLSARLLLDDHVKTDVGVVSE
                     DLFAELFPHLHDAPDDDQPSPAHIAIAPSTPSHSPESTDWAIVSVTPSPALAPSTIQF
                     SPSSLALQTFALNLKRVAPSQLTSRSRSGIDVLVLDVVAIELDTVFVSLEGELAKRLE
                     NGEGNFFREHPPGGGRGKAAQAASTPEGRLTAALRTALSTLKVVHTGDLFPLPLAPHP
                     VTHVPPNPGRIMLCEPVAQGILGPNTKIVVSRGRIHSKHSASPATIPQSRGSSAAAAE
                     DDEDTSNDQFFSAAEEGIRTDTTTEETDATTATESEFEEPDLEEDALSDDSIDDIISL
                     QAPTLPSTLTSGIGTPTTIGRGRKTNVMSGAASVFSSFTATTARPDRPRGRLFKAQGL
                     MQPVPPEVLHPKPAPVDDEEARIYVDTKDLSRIGCFSGDWVRVEASPVPPANGFGPFG
                     LGSFVEQDPDELNWRPARVYGLPEGYSSRPVARVASSKHDGRRMSFFESQVQRSSSPT
                     VYLSPVMLANLDSPPYLRLSPIRRGTHPRGKPSASSVSLHPPFAREVILQHVRTPVPV
                     ERDVQTAVMAGLKFYFERRLRVVKTGDLIAVPIDTQLGRALQETTASGDESAVDDVLG
                     MIANGRPGRTPQYDEVAWFKVSHVQSMKQDAAAEEDEAEEDPWGSVACVDISMAHLEQ
                     TGSVTSRVPGTTSNSWPYYLGIKKLPKQAKGTPSRLMAEPERQYISPLRRRLRELMAA
                     ATSKPALHLKMPPVAILLVSTQRSIGKATTATQACMDIGLHTFTVDAYDIVNDSGAGG
                     SDVKTAGFLTSRAERAMSCGPDCCALLIRHIEALTADRMVSTLKEILAEARVLIATTT
                     EVEKVPDGIRALFTHELEMSAPDEGEREGILRSILDDRGVGLDPEVDLGSIALKTAAL
                     VAGDLVDVVDRALVAQRSRLEQLSAKATKEDRVVTVRDVQVAGGPEASGLTKQDFEVA
                     VEAARKNFADAIGAPKIPNVTWDDVGGLNYVKEAVKETIQLPLERPELFAKGMKKRSG
                     ILFYGPPGTGKTLLAKAIATEYSLNFFSVKGPELLNMYIGESEANVRRVFQRARDARP
                     CVVFFDELDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSGGEDTAGGVFVIGATNRP
                     DLLDPALLRPGRFDKMLYLGVSDTHDKQLKILEALTRKFALDPSVSLRAIAERLPFTY
                     TGADLYALCSDAMLKAVTRQAQRVDARVRALNANAADQPQHGRAPISTAAFFDHYATP
                     ADLAVTVTEQDFADAQRELVPSVSAGELAHYERVRAVFEGGQRRGQGDGEEKEKEEEM
                     AFAGAPPPPPQAARLGLAAGRRSASGASARSVSGKGKGKAPVGGTSSGGGGRGKGKAV
                     ALEGFDDDDSGDDSESGRLGGSVRDKGKGKEVAPPIAAAAAPFGDGTGSGDEGLYD"
     gene            complement(1820082..1821461)
                     /locus_tag="THITE_2069968"
                     /db_xref="GeneID:11522814"
     mRNA            complement(join(1820082..1821104,1821162..1821461))
                     /locus_tag="THITE_2069968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656578.1"
                     /db_xref="GeneID:11522814"
     CDS             complement(join(1820199..1821104,1821162..1821428))
                     /locus_tag="THITE_2069968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656626.1"
                     /db_xref="GeneID:11522814"
                     /db_xref="JGIDB:Thite2_2069968"
                     /translation="MASESSEPKSYSTDPALYIYTSLTAGSSHIVTATSRLETILRAN
                     RVPFKAIDIATDEKARMLWGRRAGKDANGRQRKLPGLVQMGMVLGDLVEIEEWNEYGE
                     LKDHVTFYYDEFTQPSIHQAPKAPPAAAPKPAAASASVPAAAPGPAAPPAPPAPAPAP
                     KATAAGKASAAVSKAAAEVTLPVRSIAEEAAAKAKQVHLQSLRDKVYGKGNTSATTTA
                     TSSTDKDKPTSSTTTSESSKTISSTTTTSSSSTTSSSTPTTTTTTPAAAATPATSTST
                     AAGLQSPTTAGWRPGAQAPTIQSPTSTSWKPTDVDAPVTELHGAPVAQASAAEIAAVE
                     KAEAIKEKEDEEEEDEEEEEEGSEEEEDSDEDDDDDESDKDEGKGKVGQGVKAKEK"
     gene            <1822472..>1823134
                     /locus_tag="THITE_115005"
                     /db_xref="GeneID:11522815"
     mRNA            <1822472..>1823134
                     /locus_tag="THITE_115005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656579.1"
                     /db_xref="GeneID:11522815"
     CDS             1822472..1823134
                     /locus_tag="THITE_115005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656627.1"
                     /db_xref="GeneID:11522815"
                     /db_xref="JGIDB:Thite2_115005"
                     /translation="MCLIGLLLAFRSRKELSRHEHRPSSRHSHRHSHRHSHSHSDSQK
                     HRHSSERRHRSSSHRRSEHPRREESRSRRHEKDERKDAALLTEDALARLCLSLEKGLL
                     EEQRRWRDQELLDRQERQRLGLEPSPPPPPPPQRPPSEEAPPYSLRDENARQPTPVPA
                     PAPEYQADAAAAGSPERRSRDPPAPAYRYCCPNCLCTAPRVSSTVKRPTVPELDGGRS
                     RE"
     gene            1824439..1825556
                     /locus_tag="THITE_2171281"
                     /db_xref="GeneID:11522816"
     mRNA            1824439..1825556
                     /locus_tag="THITE_2171281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656580.1"
                     /db_xref="GeneID:11522816"
     CDS             1824721..1825152
                     /locus_tag="THITE_2171281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656628.1"
                     /db_xref="GeneID:11522816"
                     /db_xref="JGIDB:Thite2_2171281"
                     /translation="MQFKSIVAVLATGLSFVAAVEPDSTTTSTQTLTKTVTITQCNPT
                     VTNCPARTSTTTTTTTSWSFPLYNSTSSVGPTASAPFIPSSSAPVVAPTVIPSSAGGQ
                     APSANPTAPGSTAIPTGGAGSLFVQPALLLGAIGAGVALLA"
     gene            1829487..1831558
                     /locus_tag="THITE_2121523"
                     /db_xref="GeneID:11522817"
     mRNA            join(1829487..1830417,1830477..1830831,1830889..1831558)
                     /locus_tag="THITE_2121523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656581.1"
                     /db_xref="GeneID:11522817"
     CDS             1831063..1831542
                     /locus_tag="THITE_2121523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656629.1"
                     /db_xref="GeneID:11522817"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2121523"
                     /translation="MAGPSSSSASAGTPRRHPHTLAPRIQIPEEDECPVCHRELPSRS
                     LANFESLREAHINDCIAAHSRYGSGGSGSASASSPGGPDMLPPRPPRRTGMFPYTATE
                     KDCVDSAECSICLEEFEVGVAMARLECLCRFHRACINAWWERHPGRCPIHQHDGFGY"
     gene            complement(1831881..1833196)
                     /locus_tag="THITE_2121525"
                     /db_xref="GeneID:11522818"
     mRNA            complement(join(1831881..1832194,1832276..1832357,
                     1832486..1833196))
                     /locus_tag="THITE_2121525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656582.1"
                     /db_xref="GeneID:11522818"
     CDS             complement(join(1832120..1832194,1832276..1832357,
                     1832486..1832886))
                     /locus_tag="THITE_2121525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656630.1"
                     /db_xref="GeneID:11522818"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Thite2_2121525"
                     /translation="MTTAPPPILSSTSPSDVSTTCAAHNLTPAEFHALREQATAAKAR
                     AYCPYSNFRVGAALLPAVGKDGKGGGGGIDAIVCGANVENASYPVTTCAERVAVGRAV
                     VDGLHAGGGFRAVAVATDTDAPDSPCGMCRQCLREFCDVKIPIIMFDKNGNFSVLRLG
                     ELLPLSFGPQALGVPEPSKSLAAQP"
     gene            complement(1833202..1834760)
                     /locus_tag="THITE_2121526"
                     /db_xref="GeneID:11522819"
     mRNA            complement(join(1833202..1833913,1833979..1834760))
                     /locus_tag="THITE_2121526"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656583.1"
                     /db_xref="GeneID:11522819"
     CDS             complement(join(1833333..1833913,1833979..1834414))
                     /locus_tag="THITE_2121526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656631.1"
                     /db_xref="GeneID:11522819"
                     /db_xref="JGIDB:Thite2_2121526"
                     /translation="MVRAIGLRALTLLLATFPPWPWAEAACYYPSGRLAPNDAPCRDD
                     TPNATCCGQGYACLSNNICQATGEELQKPGATEFVRGSCTDKQWRSSSCPLFCIQDGV
                     DLLDGGNGIFKCPNTTEDLYFCIDALSATEASCDKKQNVLFFPGTPTVITTIGVSPRT
                     TSSSTTSSSTSEAVSSSTSTPAASTSTSQASSTSASPTESQSAGSQVSQAPADAPSNN
                     GPGSSSNIGPIVGGVVGGTAAVILAGVGGWLLARKRTSTGAGAGSDRNGAQAEVEPKV
                     AVDSTVPYHAAHAAIHEVPGSMWPSQMQQAHAQQRSYERREPTLAELPAGRVSLSYLP
                     QLPE"
     gene            <1834859..>1836697
                     /locus_tag="THITE_2131778"
                     /db_xref="GeneID:11522820"
     mRNA            <1834859..>1836697
                     /locus_tag="THITE_2131778"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003656584.1"
                     /db_xref="GeneID:11522820"
     CDS             1834859..1836697
                     /locus_tag="THITE_2131778"
                     /note="CAZy_ID 269972"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003656632.1"
                     /db_xref="GeneID:11522820"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_2131778"
                     /translation="MLFARKTGPATLIPGVAILFAVYFLYLWRNGDRLAVATPRPAVD
                     DWQPRGQAAFWRNVPVHYPPSSIRPLATGTPVRYPPIQATAFPAQPQDARRQAVKQVF
                     AKCWRSYRELAWGADELTPVSGGRRDPFGGWAATLVDSLDTLWIMDMKAEFAEAVAAA
                     EAINFTHSTLDQVNVFETNIRFLGGFLSAFDLSGDARLLRKAVEVGDMLYKAFDTTTR
                     MPITRWDIRAAARGERQAAPASVLLAEIGSLSLEFTRLSMLTGDARWFDAAQRIADAM
                     AAQQDSTALPGLWPLTADAAQTRPVFDAGSLFTLGAMADSAYEYLPKMAALLGGRLPG
                     YQAMYEKAADAAARHNLFRPLTPTDADILVAGIVHVGEDGSTELEPQAQHLACFLGGM
                     FALGGRLFGREKDMDVAQRLVDGCIWSYKALPHGVMPETFYLAPCPSPGGDCRWDEAA
                     WKREVVRRAGKDKKETDDDDDDANNDDDPTGTAAADAIIAEERLPPGITAITDRRYVL
                     RPEAAESVFVLYRATGRAELLEAAWAMFEAIDAATTTPLANSAVHDVTEAADADGKPQ
                     AADAMESFWMAETLKYFYLVFSEPGLVSLDEFVFNTEAHPFRRLVR"
     gene            complement(1837095..1841553)
                     /locus_tag="THITE_2121528"
                     /db_xref="GeneID:11522821"
     mRNA            complement(join(1837095..1837165,1837235..1837419,
                     1837481..1841553))
                     /locus_tag="THITE_2121528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656585.1"
                     /db_xref="GeneID:11522821"
     CDS             complement(join(1837139..1837165,1837235..1837419,
                     1837481..1841276))
                     /locus_tag="THITE_2121528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656633.1"
                     /db_xref="GeneID:11522821"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_2121528"
                     /translation="MGASSVESVDKLAHAPAAVDDEKTPGTTAADGPAKDVKDVKDVK
                     ARPEREATPADYFRVFTYATKWDFVLMAAAAIASMGAGTTLPLMNVVFGRLVGNFTSY
                     TAPGGGQSADEFSSQLNRMSLYIFALFIARFGLNYINKFCFRLIGIRMSAAIRLHYIR
                     SLFSQTVHVLDSMPSGAAASTITSTANTLQLGISEKLGTFLEFLATIVTAIVVAFTYS
                     WSLTLVTASVILFISIVLSILLPFIIKGQTRLTKADAKGTSVATEAFSTIRMITSCGA
                     EARVSQRYAQWVKKAKQAAQFSSPFLATQFGLIFFGLYGAFALAFWYGTKSHVEGRVD
                     SVGTVLVVLTSVMLMVVSLERISTPLIAVSKAMVAAAEFFAVIDAPKPAMGTLRDPDV
                     TADQDIVFEDVHFAYPSRPSKKVLNGLNLRIAANLNTAIVGPSGSGKSTIVGLIEGWY
                     TLHDQYLIAKAVEKDKKKDKGGKGKEKKKKKKNAGAETDDEEDEEATVPLDAEETGPP
                     VELKGSISTCGKQLGEIDIKWWRSQIGLVQQEPFLFNDTIFNNVAAGLIGTQWENESD
                     DVKRQLVKEACAESFADEFIDRLPDGYDTQVGDSGAKLSGGQRQRIAIARSIIKKPKI
                     LILDEATSAIDVRGERIVQAALERASKGRTTITIAHRLSTIKNADRICVLQNGRVVEE
                     GTHDSLLENELGVYYGLVHAQKLSLGDDTDGEHLQEEDIGAILAREKSAAKSLTASAK
                     QDAKWKDRNLLNGFGKLLSEQRSRFPFYAIALVGAMGAAAAVPLQAYLFAHVVSVFQS
                     PSKDEILKDSAFWSKMWAVLAAGVGASYCLTTLVATSLEGYISAAYRQEYFESILFQP
                     TSYFDKDDNATGQLTARLSSDPQALKELLGINLMMVLIGIFSLIGALAISFAYGWKLA
                     LVALCVTVPIGVVASYFRVRYELQFNAMNEAVFQESSKFGAEAIGAFRTVSALVMEES
                     ICDRYQRLLRGHVVAAFMKARWTTLIFAFADSVSLGCQALIFWYGGQLLLNGEYDTVA
                     FLVTYMAVIQGAESAGQWMSFGPNAAQAAAAANRILQARETRIRDDISRAERIPDTDG
                     GVKIELKDIHFKYPTRDVSIFKGLNITIEKGQFAALVGASGSGKTSIVSLLERFYDVS
                     KGQILFNGKDISEINVYEYRKLLSLVAQEPSLFHGTIRENVLLGIEDPASVTDEQLHQ
                     CCKDANIHDFIVSLPDGYNTNIGSRGVSLSGGQKQRLSIARALIRNPRVLLLDEATSS
                     LDSESEKLVQAAFERVAKGRTTIAVAHRLATIQGADIIYVLGEGKVLEKGTHAELLKQ
                     KGVYWHMCHNQALDR"
     gene            <1842961..>1845616
                     /locus_tag="THITE_2097172"
                     /db_xref="GeneID:11522822"
     mRNA            join(<1842961..1842992,1843061..1843083,1843152..1843211,
                     1843265..1843312,1843376..1843387,1843453..1843481,
                     1843540..1843603,1843663..1843772,1843831..1843841,
                     1843936..1843948,1844020..1844055,1844115..1844346,
                     1844397..1844573,1844652..1844813,1844874..1844895,
                     1844951..1845176,1845228..1845320,1845380..>1845616)
                     /locus_tag="THITE_2097172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656586.1"
                     /db_xref="GeneID:11522822"
     CDS             join(1842961..1842992,1843061..1843083,1843152..1843211,
                     1843265..1843312,1843376..1843387,1843453..1843481,
                     1843540..1843603,1843663..1843772,1843831..1843841,
                     1843936..1843948,1844020..1844055,1844115..1844346,
                     1844397..1844573,1844652..1844813,1844874..1844895,
                     1844951..1845176,1845228..1845320,1845380..1845616)
                     /locus_tag="THITE_2097172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656634.1"
                     /db_xref="GeneID:11522822"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="JGIDB:Thite2_2097172"
                     /translation="MAPKAPKFEIKTPKGTRDWSGADMVLREKIFKTITDVFKRHGGI
                     SIDTPVFELKEILAGKYGEDSKLIYDLADQGGELCSLRYDLTVPFARYLAMNKDITQI
                     KRYHIAKVYRRDQPAVKKGRMREFYQCDFDIAGVYDPMIPDAEIIRIINEVFEGLGWH
                     GKYTIKLNSRKILDGLFQVCGVPDHLIRPISSAVDKLDKMPWADVRKEMVEEKGLAPE
                     VADKIGQYVLLKGQRDLLEKLQQDPALAANPSMQQGFSDLDLLFTYLEAFGALHTVSF
                     DLSLARGLDYYTGVIYEVVTEGSAPAVPASEEAKEKVSKKKGGKPGDPDEDRSDDPTL
                     GIGSVAAGGRYDNLVGMFSGKTQVPCVGISFGIDRIFSITQAAQKKKERKNEVDVFVM
                     AFGGKDFNGLLKERSQVCARLWDAGIKAEFLYKVKPKLQNQFKAAEAGGVPFALILGE
                     DELAQGKAKIKEMGLPEDHPLKEGELISLDNLIEEVQVRLARKQQLDSIALQAEGLKV
                     VDGIKGEEVKAAAEAGQTAE"
     gene            1854704..1856798
                     /locus_tag="THITE_2121535"
                     /db_xref="GeneID:11522823"
     mRNA            join(1854704..1854737,1855146..1856798)
                     /locus_tag="THITE_2121535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656587.1"
                     /db_xref="GeneID:11522823"
     CDS             1855290..1856597
                     /locus_tag="THITE_2121535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656635.1"
                     /db_xref="GeneID:11522823"
                     /db_xref="JGIDB:Thite2_2121535"
                     /translation="MGGLIPLVLASSNRTSVIANPQSSLRRQSAAGSTSPTSPASPTF
                     AARAGFPKRLPVSTTVSEPAPPCTPAEWRKIIAEVKRKYFSKGYRACSARCLEVLDGI
                     KDASQVEPVYLIYLHFYAATSMEICARPLPPTSALRANLLQQARTHFNQAASLINSAE
                     ESVLRKFRPGSVSSSRGSSCHSPSGSISSRAWTPDTRLSSPTNSVCSFDDLTAKRPLS
                     PSRRVKKVSFSLPKEQSLQPVAAEPVIRPDSPTLGFDDAFFPAAAPATQQALPDKPAP
                     SPKFQEIELPLQPIPEHEDESESGPRAAVNGPEEQDDQNAYLAARAVHRYCEHLSSLR
                     AQLARHSTSLDQLLSSSASASSGPNGPSPSEPASMSPSLMTTTITANENAKPSSSNHG
                     AGRASAPDLRARIERLRSIGWQRKRFDPARYEALCDAVMAELA"
     gene            complement(1857733..1859626)
                     /locus_tag="THITE_2121540"
                     /db_xref="GeneID:11522824"
     mRNA            complement(join(1857733..1858241,1858333..1858718,
                     1858787..1858943,1859016..1859223,1859286..1859337,
                     1859461..1859626))
                     /locus_tag="THITE_2121540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656588.1"
                     /db_xref="GeneID:11522824"
     CDS             complement(join(1857843..1858241,1858333..1858718,
                     1858787..1858943,1859016..1859223,1859286..1859337,
                     1859461..1859467))
                     /locus_tag="THITE_2121540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656636.1"
                     /db_xref="GeneID:11522824"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2121540"
                     /translation="MSFTNMLNRLHGQPESYEKKAKYRFGRTLGAGTYGIVREAEGPD
                     GPVAIKVILKKVVRGNERMVLDELEMLQRLDHPHIVKFVDWFESKDKYYIVTELATGG
                     ELFDRISQQGRFTEKDASQTIKQVLDAVNYLHQNNVVHRDLKPENLLYLTKAPDSDLV
                     LADFGIAKTLHSKDEVLRTMAGSFGYAAPEVMMKMGHGKPVDMWSLGIITYTLLCGYP
                     PFRSEVLQDLIDECNACNVVFHERYWKDVSNDAKDFILKLLRANPAERWTSERALAHP
                     WLSGKNATDHNLLPEIRAYLARARLRRGIEMVKLANRIEALKMQEEDPDNSDMPKDAT
                     LAADQSRHFNPSDANNGGEDSGTAGGKRKLSKTIKGAIFREVVLAKVREMKEQEETQK
                     ITEEAAKKVS"
     gene            1861160..1862169
                     /locus_tag="THITE_2121543"
                     /db_xref="GeneID:11522825"
     mRNA            join(1861160..1861554,1861609..1861759,1861843..1862169)
                     /locus_tag="THITE_2121543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656589.1"
                     /db_xref="GeneID:11522825"
     CDS             join(1861507..1861554,1861609..1861759,1861843..1862111)
                     /locus_tag="THITE_2121543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656637.1"
                     /db_xref="GeneID:11522825"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2121543"
                     /translation="MAGHFAAKRLSKELSKIRSSLPPGIELVSADNFEEWLLDIRVLD
                     NNPLYQNETYRLKFRFASSYPIEPPEVVFVKLPDRPIPIHPHIYSNGIICLDLLGQQG
                     WSPVQNVESVCMSLQSMLTGNSKNERPPGDEEFVRGNRLRPKDIEFYYHDNDV"
     gene            1862578..1865335
                     /locus_tag="THITE_2121546"
                     /db_xref="GeneID:11522826"
     mRNA            join(1862578..1862840,1862941..1863136,1863370..1864980,
                     1865066..1865335)
                     /locus_tag="THITE_2121546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656590.1"
                     /db_xref="GeneID:11522826"
     CDS             join(1862763..1862840,1862941..1863136,1863370..1864980,
                     1865066..1865193)
                     /locus_tag="THITE_2121546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656638.1"
                     /db_xref="GeneID:11522826"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="JGIDB:Thite2_2121546"
                     /translation="MAPRAAFDTEQVRDRARKDLLHLLEGVRGKKNLVIEKELAGPLG
                     VVVKASTLRDYGVDNFFFLENKNTDTSQRNVVFIARGESARNAHAIADQVIRLQRESQ
                     SPHEFHIFWVPRRTLLSDKVLEEAGVLGDTNVSELPLFFFPLEKDVLSLELNDSFRDL
                     YLAKDPTPVFLLARALMGIQQRHGLFPRIIGKGDNAKRVADLLSRMRQELLAGEDAGE
                     TDGAGLGPSTTIENVIIIDREVDFVTPLLTQLTYEGLLDEVFGIRNNQTDVDATIVGA
                     PAQPSGPGTSAAAPVSNGPSRKRKIQLDGSDALFAQLRDANFAIVGGLLNKVARRLQS
                     DYESRHNSKTAAELKEFVQKLPGYQAEQQSVKIHTGMAEEIIKYTRTESFNKLLEVQQ
                     NLAAGADPSSQFDAIEELIARDTPLPQVLRLLCIYSCISGGIKAKELDHFRRLILQGY
                     GYQHLLTLHNLERLQMLLSRTSPLASMIPMTGSAGAQGTKTNYTYLRKQLRLIVDEVN
                     EHDPNDIAYVYSGYAPLSIRLVQCVLQKQYLVSITKGAGATNAPGPAAGGAQGWRGFD
                     DAVKHVRGQTFDEIQKGEDKAVKARALLSGGTGDKKTVFVVFVGGITFTEIAALRFLA
                     RQEEARRNIVICTTSIISGNRMMDAAIEKETFEKSTPQAPPPPPAR"
     gene            1866003..1870077
                     /locus_tag="THITE_2121549"
                     /db_xref="GeneID:11522827"
     mRNA            join(1866003..1866574,1866750..1870077)
                     /locus_tag="THITE_2121549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656591.1"
                     /db_xref="GeneID:11522827"
     CDS             join(1866504..1866574,1866750..1869858)
                     /locus_tag="THITE_2121549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656639.1"
                     /db_xref="GeneID:11522827"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="JGIDB:Thite2_2121549"
                     /translation="MDAMVVDDPESAAPAGLAQEEKAITPAPSSPPPPPAPAPVSIPP
                     PNGTSTKETPCLSSSLSSLSEHSDLSSIRSESSKATTPVDADSSREAPVPSTAIPTQP
                     MDSPRRKWDVRPKVSIPPDLPLQEYALQCVMAAEASRLNPYSLHQEEYLMLRDHISHA
                     QVTTYLNIRNGILRLWVRNPQIPVTREEAIGCAKDARWFDLASVCFDWLVRRGYINFG
                     CVEARPSRQDSHSASPKGKRRTVVVIGAGMAGLGCARQLEGLFAQYAKNFRRMGEEPP
                     RVIVLEGRNRIGGRVYSRALQTRPKQIPDQFQGKRFTAEMGGMIITGFDRGNPLNILV
                     RGQLGLAYHLLRPDTTLYDSNGKAVDLRRDQLVEKLHNDCLDRVSEYKYKPPASKLIE
                     GNRDLIDEGKDSSAETHKTIRQAEESAAAQPYAPPVSQQNIAPQVNLVPVSTDRATGK
                     IHTEPGMPGAVKAAQKAKLMGWTLKHGVSEDADLDVESAAKEPGATFGSVMDRVIGQY
                     RDLVDLTAQDFRLMNWHVANLEYSNATNYHQLSLQGWDIDAGNEWEGSHSMVVGGYQS
                     VPRGLMHLPTPLDVRQRSPVNKITYTANSPSGPAVVSCEDGSTVEADYVVCTIPLGVL
                     KHGNVRFEPPLPSWKSEAIDRLGFGVLNKVILVFKEPFWEEDRDIFGVLRTPTNRNSV
                     DQKDYASRRGRFFQWFNVSKTSGLPVLLALMAGDAGFDTEQTCNDDLVTEAIEILRSV
                     YGARVPYPVEAVVTRWASDKFARGSYSSAGPDMKADDYDTMARPVGNLFFAGEHTSGT
                     HPATVHGAYLSGLRAASEIIDALLGPIPIPTPLILPKDSASASSSSSSLKRKASALYP
                     EQPTTKDPARARREAYEAALWDHIVAQLGPRPLAPAKPALNAYIFYSKAHHDDARARL
                     EAARRPGKGRPSANEVRIMSAKMWRDAPEDVRRPYIEMAEEQKRAYADALAAFRTAAE
                     DWDRRAAALREAYEREHPLEKEAPQPNNNAASEEGADGAPRRRSRLRVESYAEVDSDD
                     DDDDEDLDEAESEPAARGRGRVQRVETAR"
     gene            complement(1870345..1872050)
                     /locus_tag="THITE_2081645"
                     /db_xref="GeneID:11522828"
     mRNA            complement(join(1870345..1870742,1870817..1870950,
                     1871014..1871591,1871856..1872050))
                     /locus_tag="THITE_2081645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656592.1"
                     /db_xref="GeneID:11522828"
     CDS             complement(join(1870614..1870742,1870817..1870950,
                     1871014..1871591,1871856..1871911))
                     /locus_tag="THITE_2081645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656640.1"
                     /db_xref="GeneID:11522828"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="JGIDB:Thite2_2081645"
                     /translation="MLSRAARPALKAGAAVSSRAAAPTATFATLREIEGRLKSIRNIE
                     KITNTMKIVASTKLTRAQRAMTDSRKYGETSNEVYKSAETKPLEGEGKKKLLVVCSSD
                     KGLCGGIHSGLSRYIRQRAQEDPNFDLVILGEKCRSQLQRTNAKNIVLNFAGVGKDIP
                     TFAEAQAVADQIALLPGDYSDIEIIYNRFINATSYEPSSIPAFNEQAFAASPNFAAFE
                     VDEELLSNFREYALANSLYWALSEGHACEISARRNAMDNASKNAGEMINKYQILFNRT
                     RQAVITGELVEIITGATASENM"
     gene            1872595..1876337
                     /locus_tag="THITE_2121555"
                     /db_xref="GeneID:11522829"
     mRNA            join(1872595..1872844,1873044..1873261,1873332..1874942,
                     1875002..1875566,1875659..1875694,1875762..1876337)
                     /locus_tag="THITE_2121555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656593.1"
                     /db_xref="GeneID:11522829"
     CDS             join(1872793..1872844,1873044..1873261,1873332..1874942,
                     1875002..1875566,1875659..1875694,1875762..1875808)
                     /locus_tag="THITE_2121555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656641.1"
                     /db_xref="GeneID:11522829"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="JGIDB:Thite2_2121555"
                     /translation="MPSDSSDDDVPLARASHASAPTISPSTDREMDKSASKARPAPPG
                     ASIRHGPVEDRMDIDSHGHAKRKSRSSASQAVQYKEESDSEDAAPLAKRQKSTHKKVE
                     SDSDDEPIARRNGVKLPPSIKETATLESSDDGQPLGTKIAQRKASIEKAASKEAKALR
                     ADAKAKKATPKKAVKEESDDEPLAKPKKRQSNGVPAAKKVNGVKKEESDSEAPIAKKA
                     KKAPAPAAKKGKAAPADKAAKDESKENSEGEEEEEEYRWWDAPKKEDDSIKWTTLEHN
                     GVLFPPPYEPLPKHVKLYYDGQPVDLHVEAEEVATFFGSMLHSTQNVENPVFQKNFFN
                     DFKDILNKTGGAKDMNGNPVDIKEFKKLDFTKIFEHYKALSDAKKARPAAEKKAEKAA
                     KEKAEAPYMYCRWDGRKEKVGNFRVEPPGLFRGRGEHPKTGMVKKRVMPEQVTINIGK
                     DAKVPDPPPGHKWKAVQHDNKATWLAMWQENVNGNYKYVMLAANSTVKGQADFKKFEK
                     ARELKKHIDRIRADYTRELKSEVMADRQRATAMYLIDKFALRAGNEKDTENEAETVGC
                     CSLKYEHVTLREPNTVIFDFLGKDSIRFYNEFVVDRQVFKNLKMFKKPPKEEGDDIFD
                     RLTTSQLNKHLSSYMPGLTAKVFRTYNASWTMSQLLQKLKVENRTMAEKIKLYNDCNR
                     EVAILCNHKRTVGASHEAQMEKLGDRIKGLKYQKWRTKMMMLDLDPKLKKKKGAEFFE
                     LDPDLDEAWIQQHQQFLVEELKTKIQKKFEKDNEKLSAEGGKPLPDKELKERLKAATE
                     LEAKFKRENETKKVEAEGQQGGRPGHVQNQLYRPASHRRLLKQV"
     gene            complement(1876785..1878376)
                     /locus_tag="THITE_2121558"
                     /db_xref="GeneID:11522830"
     mRNA            complement(join(1876785..1877020,1877186..1878112,
                     1878177..1878376))
                     /locus_tag="THITE_2121558"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003656594.1"
                     /db_xref="GeneID:11522830"
     CDS             complement(join(1876944..1877020,1877186..1878112,
                     1878177..1878282))
                     /locus_tag="THITE_2121558"
                     /note="CAZy_ID 269973"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003656642.1"
                     /db_xref="GeneID:11522830"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Thite2_2121558"
                     /translation="MHFARGWRIAAATTAALLIRTATAQTYSSCNPLSSTSCPADTAL
                     GMTINVDFTQGAVNSFVASGGTPTYGKDGVTFTVAKHGDAPQLTSVFYIMFGRVEVTM
                     KAAPGAGIVSSLVLLSDDLDEIDMEWLGADDSEVQTNYFSKGQTTTYNRGQFNPAANN
                     QAEFITYTIDWTSDRIIWYVGGTVVRTLTFADADGQFPQTPMQIKFGAWAGGDPSNPP
                     GTIQWARGPTDYSKGPFSMTVRSAVITDYSTGKKYTYGDTSGTWQSIQSDGGKINGNL
                     GSAGAITATASAAAATDSVSPTIPPGGIIGGSSTAGGSGAASQTVGTIPDGWVMTSSG
                     KIVPVGSSTVNTPTPIHHLGAVVLLVAVLAGNLWR"
     gene            1879027..1879874
                     /locus_tag="THITE_2121560"
                     /db_xref="GeneID:11522831"
     mRNA            join(1879027..1879747,1879816..1879874)
                     /locus_tag="THITE_2121560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656595.1"
                     /db_xref="GeneID:11522831"
     CDS             join(1879409..1879747,1879816..1879821)
                     /locus_tag="THITE_2121560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656643.1"
                     /db_xref="GeneID:11522831"
                     /db_xref="JGIDB:Thite2_2121560"
                     /translation="MAYNELDRGHPGLAGILLANVGIFLGSRASSWVCGHPGQRGHLP
                     GLAGILGLRASSWPTRASSWVCGHPGQRGHLPGLAGILGSRASSWVCGHPGQRGHLPG
                     FAGILANAGIFI"
     gene            complement(1880366..1881562)
                     /locus_tag="THITE_2121561"
                     /db_xref="GeneID:11522832"
     mRNA            complement(join(1880366..1881038,1881102..1881562))
                     /locus_tag="THITE_2121561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656596.1"
                     /db_xref="GeneID:11522832"
     CDS             complement(join(1880667..1881038,1881102..1881110))
                     /locus_tag="THITE_2121561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656644.1"
                     /db_xref="GeneID:11522832"
                     /db_xref="JGIDB:Thite2_2121561"
                     /translation="MDFQFVTQLLVQHGAEEHAGKNFVFRPSPGLMLFSCLVFGCCVS
                     SFSHRRQNQDPFQFLIYIVLLGAAGAAGYGARAHAHLILLGYLPFATCAAMIISILGH
                     AIYRRLKHAEAPRQEDEEKARLLG"
     gene            1882175..1883280
                     /locus_tag="THITE_2121564"
                     /db_xref="GeneID:11522833"
     mRNA            join(1882175..1882405,1882455..1882520,1882577..1883280)
                     /locus_tag="THITE_2121564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656597.1"
                     /db_xref="GeneID:11522833"
     CDS             join(1882263..1882405,1882455..1882520,1882577..1883189)
                     /locus_tag="THITE_2121564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656645.1"
                     /db_xref="GeneID:11522833"
                     /db_xref="JGIDB:Thite2_2121564"
                     /translation="MEQPPLGWRHGRGQELRDALKVMACGLMIGSGILFPLASIQGLW
                     FRAITLSIFILSTVCFHVLHSKPFRRFGSFTCAVALIILLGAVLSAGSSRNELIPWLP
                     VFIASLSLIMAAAHELALRIRPHPPSFAAMDEFSGVSIDSWSARSAIDTWSERSAGTP
                     PALREPPPLHESNRLNSLYFDLHGPPSRASHRTGTHTTEISLASVAAQCRPHWDAQTQ
                     SFFRVPDGSLPEDDDVPDAMEEPHAGNTSRGDDHEPDVESDQESAEPSHPLLGPH"
     gene            1884172..1886723
                     /locus_tag="THITE_2121569"
                     /db_xref="GeneID:11522834"
     mRNA            join(1884172..1884807,1884949..1884982,1885042..1886189,
                     1886271..1886723)
                     /locus_tag="THITE_2121569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656598.1"
                     /db_xref="GeneID:11522834"
     CDS             join(1884466..1884807,1884949..1884982,1885042..1886189,
                     1886271..1886525)
                     /locus_tag="THITE_2121569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656646.1"
                     /db_xref="GeneID:11522834"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Thite2_2121569"
                     /translation="MRSALRTGTGPIRRTPLSTPTRLHAGVHGLGVRLARGPPIASLN
                     ASPSSCFHSKSADRSEALGSAAKLPDAKTVPPATPRERITIADIKERRAKAGRLVAPT
                     AAYSDADMFKAPSTGKPKAKRWDHHLTKESTLREPCKLKQAAKYLKQPGLISLGGGLP
                     CPEYFPIASLDLRIPVPPHFSESATASLGEDAHIGKYDASLSTPAAPEYDLSIALNYG
                     QANGSAQLTRFVTEHTELVGAPPYADWRTSLTVGSTGALEQALRMLCDGPGRRDALLT
                     EEFSFSTALETAAPLGVALVGVPMDDQGLLPESMDAILSRWDPAERGGARKPHVLYTV
                     PSGQNPTGATQSERRRREIYEVARRHDVFILEDEPYYYLQMQQPGTEPPRSVDEFLDG
                     LIPTYLSMDVDGRVLRMDSFSKVVVPGSRLGWITASEQIVERFIRHAEVANQGPSGFS
                     QVILHKLLDERWGHEGYLRWLMHLRMEYTKRRDVIVKACEEFLPRELVSWNPPQAGMF
                     HWLKVNHELHPHASTKSILEMEEEIFNRCIAKGVLVARGSWFRAEQNAPPSGLYFRTT
                     FAAATPENMTEAIRRLGEAVRESFKM"
     gene            complement(<1887004..>1888978)
                     /locus_tag="THITE_2057357"
                     /db_xref="GeneID:11522835"
     mRNA            complement(join(<1887004..1887460,1887578..1888072,
                     1888143..1888293,1888371..1888730,1888798..>1888978))
                     /locus_tag="THITE_2057357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656599.1"
                     /db_xref="GeneID:11522835"
     CDS             complement(join(1887004..1887460,1887578..1888072,
                     1888143..1888293,1888371..1888730,1888798..1888978))
                     /locus_tag="THITE_2057357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656647.1"
                     /db_xref="GeneID:11522835"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2057357"
                     /translation="MGLVEALVEHVSVKSALVLAPGLLLAYMLFAVVVRPAWKEMKLA
                     RMPGARAPKIKSVAPFGVDFLYNGVRAAMANQNLAFWKKMFSEVRALTAEGCIAGRHI
                     VFTIDHENIKAILATQFGDYGKGEPFHREWKAFLGDSIFTTDGALWHDSRQLLRPQFI
                     KDRVSDLHVFESHIQTLFRAIANGGALNGEHQAVDIEAGNGRPVDISDLFFRYTLDAA
                     TDFLLGHDVKSLSNPRQEFAEAFAEVQRIQSLVSRAGALNMLIPRHTFRQGMKVINNF
                     INQYIERTLRLSPDELAGKTKSDAGYTFLHALAGYTRDRQVLRDQLIAVLLAGRDTTA
                     CTLSWTIYELARHPDVLAKLRAEILSVVGPTRPPTYDDLKSMKYLQNVMNETLRLYPV
                     VPFNVRLALKDTTLPRGGGPDGTQPIKVLKDTPIAYSTLVMQRRADLYPAPSADFAPV
                     DAFSPERWQRWQPRPWQYIPFNGGPRICIGQQFALTEMAYVLTRLFQRYGRLDSHMPP
                     GEPTLRADIVLQPGDGVRVAFWEAAGGLGLGQGQGQGEK"
     gene            complement(1890446..1893050)
                     /locus_tag="THITE_2121574"
                     /db_xref="GeneID:11522836"
     mRNA            complement(join(1890446..1891228,1891346..1892512,
                     1892609..1893050))
                     /locus_tag="THITE_2121574"
                     /product="glycoside hydrolase family 20 protein"
                     /transcript_id="XM_003656600.1"
                     /db_xref="GeneID:11522836"
     CDS             complement(join(1890803..1891228,1891346..1892512,
                     1892609..1892758))
                     /locus_tag="THITE_2121574"
                     /note="CAZy_ID 269807"
                     /codon_start=1
                     /product="glycoside hydrolase family 20 protein"
                     /protein_id="XP_003656648.1"
                     /db_xref="GeneID:11522836"
                     /db_xref="InterPro:IPR015882"
                     /db_xref="InterPro:IPR015883"
                     /db_xref="JGIDB:Thite2_2121574"
                     /translation="MLSSAFSSLSLFLLALSPVAAVWPAPQKYSNGSSVLYLHQNIKV
                     TYNGEFLPYTAGYAPQKLSSKEVVQAGVSRTLSAIFGSKFVPWKLHKPGSQFEPDLRK
                     GQKWLNTLQIVQTGKDQASTFKPLAGEVDESYNLTVSDSGDVKLTAVSSIGVLRGLET
                     FSQLFYQHSAGPFWYTPYAPVSIQDAPKFPHRGVMIDTARNFFPVPDILRTIDAMAWN
                     KLNRLHVHVTDSQSWPLVIPSMPELAAKGAYHPSQTYSPEDVATIQQYGAERGVEVYF
                     EIDMPGHIGVVSLSHPDLIVAYDQLPYYWWCNEPPCGAFKLNSTAVDAFVEKLFDDLL
                     PRLAPYAAYFHTGGDELNKNDSMLDDGVRSNSSEVLQPLLQKFIDAQHARVRKAGLTP
                     MTWEEIPLDWNITLGKDTVVQSWLGGDSVKKLTGMGLQVIDSDYNFLYLDCGRGQWIN
                     FGNGAAFDVGYPFNDWCGPTKSWRLIYSHDPTANLTPEEAKLVLGGEVAVWSETIDPV
                     NFDSLVWPRASAAGEVLWSGRTDASGQNRSQLEAAPRLNEFRERMVLRGVGASPVQMT
                     FCTQGSPEECNWPA"
     gene            1894768..1896550
                     /locus_tag="THITE_2121575"
                     /db_xref="GeneID:11522837"
     mRNA            join(1894768..1895254,1895319..1896550)
                     /locus_tag="THITE_2121575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656601.1"
                     /db_xref="GeneID:11522837"
     CDS             join(1894848..1895254,1895319..1896519)
                     /locus_tag="THITE_2121575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656649.1"
                     /db_xref="GeneID:11522837"
                     /db_xref="JGIDB:Thite2_2121575"
                     /translation="MSVEVTLGTPLAEALNSAIQGKIAELGWAGPGGEGAALSEYFLL
                     MLANGKTESDIAAPEVAGDLLGLAADDPTPAAFAKWLFAQIGILSAQLGGGANNSAQA
                     EDAAMEGVKDDAMDGAMDTTMDSTSDSPAAGLNAPTGPKAMRTGNVRGGREKRMVGQI
                     NRALDRTQDSILHRVRAQSGNERIGRGPPAGPRMGVGRQPRTSNARAANFAARLGDFA
                     GMPAAPPGMNGMGAMNPMGPMNPMNGAAYGHPDIYAMMEQQNRMLQQMQQQLMMQQQQ
                     QQQQQQQNGMGHRGGHGHGKHQFGGRPGPFRRGGAHHQHNGHAEQSQQQLPQQQGAEA
                     GQPDAASPGDVEMTGAKREPANPEETVCRFNLRCQNKDCKFAHQSPAAPPGITIDVSD
                     VCSFGAACKNRKCVGRHPSPAAKVAHQSEQDCKFFPNCANPHCPFRHPTMPACRNGGE
                     CKVPNCKFTHIKTPCKYRPCTNRSCPFMHEEGQRGTFQDKVWTADGASKEHVSERKFV
                     NEGAPEDVVLPGSGEPASEAGAAEVVM"
     gene            1897107..1899541
                     /locus_tag="THITE_2121578"
                     /db_xref="GeneID:11522838"
     mRNA            join(1897107..1897731,1897850..1898515,1898606..1899541)
                     /locus_tag="THITE_2121578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656602.1"
                     /db_xref="GeneID:11522838"
     CDS             join(1897291..1897731,1897850..1898515,1898606..1899532)
                     /locus_tag="THITE_2121578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656650.1"
                     /db_xref="GeneID:11522838"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="JGIDB:Thite2_2121578"
                     /translation="MYATRPRCLAHAAGRAGAKRRFPRGSFSFGRSSPDADAGNASAS
                     AATRRRYATAANKGQPPRSIAVLGGGLTGLTTAWHLTRALPHARITLYEASDRLGGWI
                     DTSTVNLRNRYGQEGPVHFERAARMVRPQTGGRVPRWDDLLFFDMVAHLNLTDQLMHA
                     SAEDSGTTAYIYYPNRLVPIPRISRAGPLRTLDSILDLVPALFQPVFRDVIPSALHNA
                     RTTGDPYTADILEGRSDVSVGDYFAYRFGRTGLVDKVFSAVTHGMTGGDVWKQSLASG
                     SWADYLPRNDGEPVTRVRVRRADYALMNQLVRDKAVFDLATEHLDSGSLWFRNGMSTL
                     TNALADALRKNPNVTIKMGDPVTSVRYLDNFDRVFITTKQNKKPVPYEKVVSTIYAKH
                     LAALTDDHLPSLASSTAVSIMIVHLWYPDLRVHSPNTGFGYLLPQAVPHEANPECVLG
                     VIFDSDREFPTTKLFSLTNLGADGVEGTKMTVLMGGHYWDGLPESFIPDPAAAADMAR
                     AAVQRHLRLSDRVARSAYAAAQLCRDCIPQLLVGHAARMRAAHAELQWTFRGRLAVAG
                     QSYQPSGVLTMLRAGRDIAMQIAHSSSSSSSSGTAQRPPPLRGEEEEGEEEAAYADAA
                     AADGYDDDWPVGDTGLERFTRQPTWLSVEKRLLPLRFKSGAYVDEDGNIQPGD"
     gene            complement(1900126..1903933)
                     /locus_tag="THITE_2121580"
                     /db_xref="GeneID:11522839"
     mRNA            complement(join(1900126..1901922,1901979..1903186,
                     1903243..1903933))
                     /locus_tag="THITE_2121580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656603.1"
                     /db_xref="GeneID:11522839"
     CDS             complement(join(1900338..1901922,1901979..1903186,
                     1903243..1903785))
                     /locus_tag="THITE_2121580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656651.1"
                     /db_xref="GeneID:11522839"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="JGIDB:Thite2_2121580"
                     /translation="MADSGPQGAASDKVEGLPDELRHITTDILPLSLLLTRLAEYSHA
                     KLQEIITELAAKPLPQALANGNVNGTANGNGILHNVPIEDTSPESLDKKTMLLNFTKD
                     LHSRWVKALVITEWSRNAEEVGKLIDIRTYLAEKLELYHKTFWNLVQVKREMLFARVP
                     SPDLKTALEVLSNGAVHWMPDFGYLEPPPLTEEEKLHWTHEIEMHLHARLQLQEFDTM
                     PDPFKKYRIGNGKVTFTVPGEFEVDLTIGHEDFSTQFWFLDFRPIYSPAPPELSQQLR
                     QIIEARVNNALAADGLTGCYKYLHEFTLTAKITEFTRQALELSSTGRWADTLRVERLN
                     RALGIQYWRNCQHSRVSQSWILLGVRSAEGPNEDPDAQASSSRLMLSWFRDGKEVKEV
                     GIAFDVDTISTEDLLMAVIAKHIEHLLCPIYQTLVAKPRYAQRQGRLSLNIEKDPQRS
                     RLSMQLVGELDATVSVSPWTGDFLLSPEYPSMLETQKKFRTLANPAEEGASVLEQLRW
                     SYTVQHLRCLPSVADWVILRAAPAPFDEVKSMVYSLSPSIREAFHAVWVRNAKWGPQW
                     FAALSMSLAGDHCWLVEISVEGQGSSGRRINTFRRLPSSPSDLLLPDMLFQKLAKYGP
                     GIMAEIQSLRHGRQEHVAHAAQQQPANSSSSAASYQTNMLIIVARASELLPPSRIGSL
                     DGTRPLWAQEYIPVTYKGLAPEPPPAIGSGDPLQRQAGPLRILVEARVAVTNRARFEF
                     VKSRLDRDVRYDPRIGQFTLRFRPEANTSVIPMLRERIQALDRLFDFVEAVHRAGKHA
                     VLESVTLHELVFTYGAHTAEAPPPPANSQDQGEQRSWKVRLNLSGARGVDVRLEQGNP
                     HLRVIDYLRSIANSPKSKSLPAWLSLTLPLFRALERLQDSWDLPSANKQGECFILHKS
                     LDWVALRFALAGPKSRRLQLDIKARERKGQLMWQVSRPSTDANANNENDEFTKVLAPK
                     VWSVSGQGFQGLSTGAAANWDQGIENLLALISDTLLSMVGTPPQPQQQQAPPAGQAQE
                     QLPAPPPGPAGRFPQQVQPSQQPLQHLQHLQQQQQHHRPPPPPPQQHVPQPGMHGQAQ
                     HQGQVQGPRAGMGQNNASVVVID"
     gene            complement(1905658..1907989)
                     /locus_tag="THITE_2121584"
                     /db_xref="GeneID:11522840"
     mRNA            complement(join(1905658..1906937,1907003..1907347,
                     1907405..1907425,1907493..1907562,1907763..1907989))
                     /locus_tag="THITE_2121584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656604.1"
                     /db_xref="GeneID:11522840"
     CDS             complement(join(1905951..1906937,1907003..1907347,
                     1907405..1907425,1907493..1907562,1907763..1907794))
                     /locus_tag="THITE_2121584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656652.1"
                     /db_xref="GeneID:11522840"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="JGIDB:Thite2_2121584"
                     /translation="MMASDLHSAGAIELKDNTVIVVLGASGDLAKKKTFPALFGLYRN
                     QFLPKDIKIVGYARTKMDHDEYIRRIRSYIKTPTKDIEQQLNDFCSLCTYVSGQYDRD
                     ESFLQLNKHLEDLEKGRPETNRLFYMALPPSVFTIVSQHLKKCCYPTRGIARVIVEKP
                     FGKDLASSRELQKSLEPDWKEEELFRIDHYLGKEMVKNILILRFGNSFLGATWNRHHI
                     DNVQITFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPVSFSAEDIRDEK
                     VRVLRAIPAIEPKNVIIGQYGKSLDGSKPSYKEDDTVPKDSRCPTFCALVVYIKNERW
                     DGVPFIMKAGKALNEQKTEIRVQFKDVTSGIFKDIPRNELVMRIQPNESVYIKMNSKL
                     PGLTMQTVVTELDLTYRRRFSDLKIPEAYESLILDCLKGDHSNFVRDDELDASWRIFT
                     PLLHYLDDNKEIIPMEYPYGKRDSVVSRCRCYGN"
     gene            1909975..1911115
                     /locus_tag="THITE_163916"
                     /db_xref="GeneID:11522841"
     mRNA            join(1909975..1910135,1910259..1910268,1910417..1910512,
                     1910571..1910671,1910733..1911115)
                     /locus_tag="THITE_163916"
                     /product="60S ribosomal protein L33"
                     /transcript_id="XM_003656605.1"
                     /db_xref="GeneID:11522841"
     CDS             join(1910111..1910135,1910259..1910268,1910417..1910512,
                     1910571..1910671,1910733..1910830)
                     /locus_tag="THITE_163916"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="XP_003656653.1"
                     /db_xref="GeneID:11522841"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="JGIDB:Thite2_163916"
                     /translation="MPSEAGHRLYVKGRHLSYQRGRRNTHPKTSLIKIEGVDDTAAAN
                     FYLGKRVAYVYRAQKEVRGTKIRVIWGKVTRPHGNSGVVRAKFTNPLPARSFGASVRI
                     MLYPSSI"
     gene            <1913005..>1914282
                     /locus_tag="THITE_122853"
                     /db_xref="GeneID:11522842"
     mRNA            join(<1913005..1913023,1913077..1913157,1913222..1913341,
                     1913516..>1914282)
                     /locus_tag="THITE_122853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656606.1"
                     /db_xref="GeneID:11522842"
     CDS             join(1913005..1913023,1913077..1913157,1913222..1913341,
                     1913516..1914282)
                     /locus_tag="THITE_122853"
                     /note="Contains conserved domain DUF2406[pfam10295]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656654.1"
                     /db_xref="GeneID:11522842"
                     /db_xref="JGIDB:Thite2_122853"
                     /translation="MQEAEPSEVAATVKSSLASLRSMQHKDAYGNPILEPDLSNPTRS
                     RWERPLDTIRSFEAAIDGGYSNRRSIIRADGSGGQFAYDGYYGSRPPSMMYANRPDGS
                     QQDLRFGVAGQRDSYYDQQPWYGGHGPSAPNGRRGWPRMPFEPPSGPSARQQQNPHDY
                     PIPSYPRPYESVTTASGSGSSGEPASYQTDPTSSDNNSVERVQSTPRRLPEPVNDYGI
                     GFSQSSTYQPPAFSVGIPGPSMNGGMNGGMNGGMNGGMNGGGASINDSYPNGAANYGA
                     PAPPVPHKDPGSVLRKPQGSGLMQQQQPPPPQRPAQPEKRKSWFARRFSRHG"
     gene            complement(1914396..1915332)
                     /locus_tag="THITE_2121595"
                     /db_xref="GeneID:11522843"
     mRNA            complement(join(1914396..1914661,1914865..1914956,
                     1915023..1915332))
                     /locus_tag="THITE_2121595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656607.1"
                     /db_xref="GeneID:11522843"
     CDS             complement(join(1914510..1914661,1914865..1914956,
                     1915023..1915135))
                     /locus_tag="THITE_2121595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656655.1"
                     /db_xref="GeneID:11522843"
                     /db_xref="JGIDB:Thite2_2121595"
                     /translation="MATRRIISQEKTLLEKDDTIGASPAANEKSNISPAVPTSVIMKL
                     LAFTLGMIVIPIGSYFLTVNTLFRGNSTYAGALAAIMANAVLIGYIFVAMAEDQSEQQ
                     QRKGGKTGPGEGKKDR"
     gene            <1915794..>1918820
                     /locus_tag="THITE_122851"
                     /db_xref="GeneID:11522844"
     mRNA            join(<1915794..1916237,1916355..>1918820)
                     /locus_tag="THITE_122851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656608.1"
                     /db_xref="GeneID:11522844"
     CDS             join(1915794..1916237,1916355..1918820)
                     /locus_tag="THITE_122851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656656.1"
                     /db_xref="GeneID:11522844"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Thite2_122851"
                     /translation="MEFSSPATGHRLLDLEDDDDELSVVAESPYFTQPTQVVERPHSK
                     PSAAAGSSPRSIVEVPASSPFRPQALQQRAGRLANLMAPAGTTFRAPARRPLPIPKSA
                     PKREFIMISDDELDAPIYAGGDSSDDDKQPSRGDIRPSSFRRREPNGSESASATSIST
                     PEKSYVLQKDWVSLSSSSSEESFESLRQPPPPKPTRRRLVQGRRPRASSPSSPALKSS
                     QGRNSPPPRRVIDLVSSDDEDDGYRQPRAPSHRASSSPAEGEEGDPFDERVLNYLNTC
                     NVMQFVAIANIKEESAKVMVSRQPFGSLEEAQKVTMSQKKRGKKSAKLSIGDEIVSAI
                     KSYARSLDAIDHVIAICESQAESIKETTSKWNLDQTGQLRTESRSDDGKPMTPMSMED
                     SAKLVDVPLRQPRLMEGCVMKPFQIYGLNWLYLLYKNQFGGILADDMGLGKTCQVIAL
                     MCAIVEDWEMNGHSKGDRPWPNIIFVPPSTLANWEAEFKRFAPNIKVTLYQGSQSARD
                     QIADEISDDPWNHQVVLTSYSQLSRNEDILNLRRLHPMVLVFDEGHKMKNPKAKLYRD
                     LLRVTANWRLVLSGTPVQNNLMEMIALLRFVEPNVFQDSFESLEALFNQRLSLTAVSK
                     GALLHSERVGRARTILEPFILQRRKEQVLKDLPPKTTRIVTCKMDPVQESMYRDYERR
                     FRKTDSHEPAPRVKEGRDNDTNNVWVQLRKSAIHPQLFRRFYKDRDVEKMAEILMKKV
                     PQAELRQPRLDHLTNELKALSDFELHLWCRDYKCIKSYDLPDGSWMDCAKVKALLELI
                     REYQANGDRALVFTRFAKVIEILGECLASEGIEYLSLQGNTDVSYRQELINEFNADES
                     IPVFLLTTGSGGTGINLTAANKVIIFDQSDNPQDDIQAENRAHRLGQTRPVEVVRLIS
                     EGTIEELVNKACEKKLELANKVTGWSSVEMTSGEMESAVKSELLRQAAATPPSGD"
     gene            1920044..1922262
                     /locus_tag="THITE_2121598"
                     /db_xref="GeneID:11522845"
     mRNA            join(1920044..1920235,1920322..1921401,1921490..1922262)
                     /locus_tag="THITE_2121598"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656609.1"
                     /db_xref="GeneID:11522845"
     CDS             join(1920173..1920235,1920322..1921401,1921490..1922215)
                     /locus_tag="THITE_2121598"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656657.1"
                     /db_xref="GeneID:11522845"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Thite2_2121598"
                     /translation="MLSFLAAAWHLFCDVLQFWGHKSRTYLFSPSPVEVWSRALREAT
                     TYEEWREAAVKLDSLLGLDIWRNDPTSSDYDYRLIVERLRLISEAQKAGDVHALVNAL
                     RTGLVRNLGNITSPKLFNCCFSGTKVLIEDYVAHYVDAIEELAGLPPPAFGGELLEGG
                     TFPTPEYEDGEISGVDPLDVTTIVSDERPRARRPREGGMAKAVMSAQHKLDFIHDTSQ
                     AFGRSALVLQGGAIFGLCHLGVVKALLLRGVLPRIIVGTATGAMMAALVGVHPEDELI
                     RILNDDGIDVSAFASKGNDPEKHNERVRQSVWTQWATLLRRIRRFKREGYFLDVKVLE
                     ECVRANIGDLTFEEAYNRSRRVLNITVVTAGQRGIPTLLNYVTAPNVLVWTAAVASNA
                     SSSTFYGHRQTKILCKDAHGNITPWAPTDTDDFRHWTSGSYTDRNAPLQRVAGLFNVN
                     HYIVSQARPYLIPFLQSDMHGPSAIGRRNRLTAVKVFAMRMLGLEVRHRLRQLDQLRL
                     LPPSIRRFLVDEHLPGPSMTLVPQISLRDFPRLVETPTRETLAYWTLRGERSVWPAVA
                     ALRVRCAIEMELDRALQAVRRLKASDLRRRASEMSALREQLDAEANRGEKNRQGQL"
     gene            1928027..1929638
                     /locus_tag="THITE_2097186"
                     /db_xref="GeneID:11522846"
     mRNA            1928027..1929638
                     /locus_tag="THITE_2097186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656610.1"
                     /db_xref="GeneID:11522846"
     CDS             1928177..1929055
                     /locus_tag="THITE_2097186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656658.1"
                     /db_xref="GeneID:11522846"
                     /db_xref="JGIDB:Thite2_2097186"
                     /translation="MLKPAACQKGARRPLPTAAATANMRSPMTPAAGHPTQDDGWILV
                     RRIPTGGYTKTRSPQHNDDNMSSRQVANASASNRPTASVFDFSEESIENITYFDAPAP
                     SATAPAHKPHTPESSGDSSTQRASTEDTLTDLDLPLPTAALPPNPVPLPPGGSLEPAR
                     PQLTQSNMDFHQRELAQRYQGSIAGWVAAAGTGPRLAYHRCPPPPPSSSAAAAATEPY
                     SSMLATAGASAGTRSGSSSVAAGAGTDWLLVSHLPAAAAADDEVAAAGAWCEVALGPL
                     VRRFSVLTFDADELIF"
     gene            1929962..1931841
                     /locus_tag="THITE_73074"
                     /db_xref="GeneID:11522847"
     mRNA            join(1929962..1930397,1930507..1931841)
                     /locus_tag="THITE_73074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656611.1"
                     /db_xref="GeneID:11522847"
     CDS             join(1930248..1930397,1930507..1931658)
                     /locus_tag="THITE_73074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656659.1"
                     /db_xref="GeneID:11522847"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Thite2_73074"
                     /translation="MPSTFGLRRLLGLVLSATCVTIATCHDHWVDIWACMPQQVEPYN
                     LPNPPYNGTDGVFQNTTIRQTVYITQDASTIRLQFSNALGASDLPITAATVALPVNDA
                     AGASAIRTETLQHLTFSGSPSFQVPNGALVVSDPIHFPVKAQSVLTITVYLAAGQSGF
                     GITGHPGSRTTSWLSQGNLVAAADLNSTAVGTNVQSIDKWFLISAVQAWLPAEYVSLA
                     VVGDSITDGRGSTTNHNDRWPDQLLARLRSNPLLRGISVANMAAGGNRVLADGLGPNA
                     LGRVERDVLAHPGARYALVYEGVNDIGTAASERAAQAAVGDRLIAAYEQIVARLHAAG
                     LAAFGATITPMSGPGQVYGTPEREAERQRVNKWIRTSGRFDAVVDFDAVVRDPKNDTM
                     LRAEYNSGDWLHLNPAGYKAMAEAVDLRLFLWFAGGSSAMV"
     gene            complement(1934091..1937309)
                     /locus_tag="THITE_2070023"
                     /db_xref="GeneID:11522848"
     mRNA            complement(join(1934091..1934723,1934789..1935423,
                     1935479..1935643,1935701..1935839,1935898..1936174,
                     1936234..1936346,1936406..1936555,1936623..1936712,
                     1936781..1937309))
                     /locus_tag="THITE_2070023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656612.1"
                     /db_xref="GeneID:11522848"
     CDS             complement(join(1934345..1934723,1934789..1935423,
                     1935479..1935643,1935701..1935839,1935898..1936174,
                     1936234..1936346,1936406..1936555,1936623..1936712,
                     1936781..1937181))
                     /locus_tag="THITE_2070023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656660.1"
                     /db_xref="GeneID:11522848"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="JGIDB:Thite2_2070023"
                     /translation="MGPKLAEKKRKSRESDSESDDELANGLSDGVLSLSEDEGDYSPS
                     DDDDESGSEATEESEGEDENEVEDKDDILSDDVPSDVDGKAEIDKLVAQQGELEITEP
                     GVDPRRKEEEEGEGENYRIEKDANGGIRYVYDEIDPVYDSDDTDAQVPVNTIGNIPLS
                     FYDSYPHIGYDINGKKIMRPATGDALQSLLDSIEVPEGWTGLTDINTGNPLNLSQEEL
                     ELVRRVQMGLIPDDLEDPYPDTVEYFTSIEEKMPLSSAPEPKRRFVPSKNEAKQIMKL
                     VRAIREGRILPYKPPEEREREEEEKEEVHFDLWQDEEPQPPNPMHIPAPKLPPPGYDL
                     SYNPPEEYLPTKEEKEEWENADPEDREKDYLPQKYDALRKVPAWGNLVKERFERCMDL
                     YLAPRVRKNRLNIDPNSLLPKLPSPSELKPFPTVVQTIFRGHEGRVRSVAIDPTGVAL
                     ATGGDDGTVRVWELLTGREVWSAKLSSDESVSTVRWRPTKDSFILAAAAGEDIFLMVP
                     THASVTPALYQASRDVLAAGFGYATNGQQQVAPTGKEPPAKWARPGTKLEDEGVLLRI
                     TVRSTVSVISWHRRGDHFTTVSPAGQRSSVAIHTLSKHLTQIPFRKHSGIAQTAAFHP
                     LRPQLFVATQRTIRCYDLQKLELVKVLQPGAKWISSCDIHPGGDNLIVGSYDKRLLWH
                     DLDLSSRPHKTMRFHGAAVRQVRYHKGGLPLFADASDDGSLQIFHGKVPNDHLEPPTI
                     VPVKMLKGHRVVNKLGVLDVDWHPHHPWCVSAGADGTARLWM"
     gene            1937914..1940011
                     /locus_tag="THITE_2121610"
                     /db_xref="GeneID:11522770"
     mRNA            1937914..1940011
                     /locus_tag="THITE_2121610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656613.1"
                     /db_xref="GeneID:11522770"
     CDS             1938474..1939694
                     /locus_tag="THITE_2121610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656661.1"
                     /db_xref="GeneID:11522770"
                     /db_xref="JGIDB:Thite2_2121610"
                     /translation="MGRPRKQRPAEAADSQPTVSVPTEAPKKEAETAPFVIPDFQFDG
                     TIGMDLDLSFLDVNNTDVNFLELVDPNSQVLPAPDHTYADQGGAGFKEAAVPNPPIPT
                     GGFWRLGENLDTINFDEPIGAPAAPPPAPEITAEEVAQIFAYDIAETLPSLSPPSSNS
                     PSTQASPSESDNSRPCGCLPSLYLALDSLQTLPSEVGEAMRVARTATKAAHDAILCPV
                     CSEIPTDPVCKPPMRAFQSMMMLGALLPSVSHAYMRILSMVDAEAAAADAERRKICFS
                     LSRYGGLWGSMARLDLVKCGASERLEGAMLEPILWRLTVRAMLKMDVYGVNCLTPGVP
                     DEDIQQPGLKDIITMMEERSRRRHEQLDALVASGAVDKLPAEYVPLSSNGDKPTCLRI
                     IDIAKRSMDDLIIP"
     gene            complement(1940395..1942209)
                     /locus_tag="THITE_2121614"
                     /db_xref="GeneID:11522771"
     mRNA            complement(join(1940395..1940700,1940873..1941366,
                     1941477..1941589,1941669..1942209))
                     /locus_tag="THITE_2121614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656614.1"
                     /db_xref="GeneID:11522771"
     CDS             complement(join(1940563..1940700,1940873..1941366,
                     1941477..1941589,1941669..1941829))
                     /locus_tag="THITE_2121614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656662.1"
                     /db_xref="GeneID:11522771"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="JGIDB:Thite2_2121614"
                     /translation="MAQMRGPGSYGIGAPNPFGGPVEDRTEQSPLDAIRQQTSKIEDL
                     LDTLSEPIKPYLPAIGRFLIVVTFIEDALRIITQWSDQLLYLHDYRHIPSGLTHLFLI
                     ANVIAMTTCSTLVIIRKHSEYAVGGLIGVVVTQALGYGLIFDLNFFLRNLSVMGGLLM
                     VLSDSWVRKTKAFAGLPQIEEKDRKMYFQLAGRVLLIFLFIGFVFSGEWSLWRILVSL
                     MGFVACVMVVVGFKAKFSATLLVVILSVFNVLVNNFWTLHEHHPHKDFAKYDFFQILS
                     IVGGLLLLVNSGPGQFSIDEKKKVY"
     gene            complement(1943690..1945681)
                     /locus_tag="THITE_2121617"
                     /db_xref="GeneID:11522772"
     mRNA            complement(join(1943690..1943971,1944099..1944904,
                     1944973..1945109,1945193..1945247,1945307..1945681))
                     /locus_tag="THITE_2121617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656615.1"
                     /db_xref="GeneID:11522772"
     CDS             complement(join(1943851..1943971,1944099..1944904,
                     1944973..1945109,1945193..1945247,1945307..1945471))
                     /locus_tag="THITE_2121617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656663.1"
                     /db_xref="GeneID:11522772"
                     /db_xref="JGIDB:Thite2_2121617"
                     /translation="MLASQALAVLAAFAATVAAQDDPTITTPPADSTSTASATTSSSS
                     GPATISIAVGAVGFVFTPHEATANVGDIIRFTFYPGGHRVARAAFGWPCIPYEYATIN
                     KPGFNTGEFDPKVVSNDLPYHDVRVNDTEPIFFYCYAPTSCVDHKMIGVINPNSTETY
                     DDQLAFAQNVTFQLGPGDPFPTESAIPTPTPGGSSSPSSPASPAASSSSSSSSGGGSS
                     LSAGAIAGIAIGSAAVLLLAAVLIYLCGRRGGFDKAYRKSALAAAAGPLSSPAAAMGE
                     AKYAGADAASLGLTPNPNPKSPGQTTVASFDGTATLRNSVAHHTPPPPPPPAAAAATA
                     GVAGAGAGAAGAGYGLFGPGASFPGYGFGAGQGQGQGQGQSHDLRAFGRDSLYMSPQS
                     SPPPTGPYTHYIPPPAAELPSADAPAPTRSPPPGY"
     gene            complement(1946780..1948917)
                     /locus_tag="THITE_2121621"
                     /db_xref="GeneID:11522773"
     mRNA            complement(join(1946780..1948463,1948559..1948917))
                     /locus_tag="THITE_2121621"
                     /product="glycosyltransferase family 57 protein"
                     /transcript_id="XM_003656616.1"
                     /db_xref="GeneID:11522773"
     CDS             complement(join(1946917..1948463,1948559..1948805))
                     /locus_tag="THITE_2121621"
                     /note="CAZy_ID 269855"
                     /codon_start=1
                     /product="glycosyltransferase family 57 protein"
                     /protein_id="XP_003656664.1"
                     /db_xref="GeneID:11522773"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="JGIDB:Thite2_2121621"
                     /translation="MAGPSPSPHKPRRKAKRSADPTSSFGNSGSVRPVETLVRAPAFP
                     LAAFLWPARGTVSQWELLPLILMAAGLFRWAAGLWGYSGFERPPMFGDYEAQRHWMEV
                     TTQLPISQWYFHDLEWWGLDYPPLTAYHSWLCGKIGSLIDPSWFALFSSRGSHDPALK
                     VFMRATVIVSEYLIYVPAVVIFVRRYSRLSGLTNWSAAVALVAILMQPATILIDHVHF
                     QYNTVMLGFVVASMSSMLAGRNLWAAVFFVAALGFKQMALYYAFSVFTYLLGNCIFPR
                     VNIPRFVAIAAVTAASFAILLLPLVVGALYDVRRGIDSRPDIDGPRPPLPLFQGLAVY
                     LDTEAFYYPVVEQLVQMVHRIFPFARGLFEDKVANFWCALNVVIKLKKYPAPLLQRGA
                     LLATLASILPPNLVLFLRPRKDLLPLAFAATAWGFFLFSYQVHEKSVLLPLMPMTLLL
                     AGSHGLSKSTRAWVGFANILGCWTMFPLLQRVDLAMPYTVLTLLWAYLLGLPPTSLGV
                     YLQETGNTWSHWATVFIHGSFYLAMAFWHVLALVLSPPPDKPDLWVVANVGVGAAGFS
                     LCYLWCLWRLLNESEILPRSWFRRKEKAKVQ"
     gene            <1949319..>1950881
                     /locus_tag="THITE_2091827"
                     /db_xref="GeneID:11522774"
     mRNA            join(<1949319..1950554,1950621..>1950881)
                     /locus_tag="THITE_2091827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656617.1"
                     /db_xref="GeneID:11522774"
     CDS             join(1949319..1950554,1950621..1950881)
                     /locus_tag="THITE_2091827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656665.1"
                     /db_xref="GeneID:11522774"
                     /db_xref="JGIDB:Thite2_2091827"
                     /translation="MPYPFVLPTTSSFSFSSCLVCESHPSLPLQASTHRGVVRDSLKR
                     YKRLPPASQAPALSDVAGALQSYLPYLFAIDAGLSNKTIHSEEISVILQTAPLIEWRP
                     TLSGSLLPGREPPRIKIHSLEYELFFALAALANTHTLQSRAALQPLYQTTTAPVGTAE
                     RQTALSTATRHLLDAASIYTYLSARADCLPQQQGQTPAALPSPDLHPSTLRAQRALAL
                     AEATLLAVLKDDPYPAAVARARNPHDTEWMYKAPDLPRVRAHLFARLCLAAAEHAAQA
                     QAAAGALGGRRGSGSGSGSGSAGSAVADGFLRYLEDLRRASRARACRFFGIDAELGGQ
                     TGTAIAWLRAGLAELGVERKGDGGKGGGGLKGLRKEWNERREDKKVERGLDWGADGGR
                     LEETRVIEMLEAKWTKQNDTMLTQPIPPIGPLLAQMPSGREIHTIPPFQPPQLSPEVL
                     EEMRAPPDRSDEFGNYPSSDEETTVDPSPVGASSGRSADYRTGTPGYF"
     gene            complement(1950875..1952663)
                     /locus_tag="THITE_2121623"
                     /db_xref="GeneID:11522775"
     mRNA            complement(join(1950875..1952137,1952193..1952663))
                     /locus_tag="THITE_2121623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656618.1"
                     /db_xref="GeneID:11522775"
     CDS             complement(join(1951151..1952137,1952193..1952450))
                     /locus_tag="THITE_2121623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656666.1"
                     /db_xref="GeneID:11522775"
                     /db_xref="JGIDB:Thite2_2121623"
                     /translation="MSDSEEPVDIPDEGGDDLFGDEGDDAISEIENAASDRQVASDQE
                     DDERESRRYSHDEDEEPREFREKLVAEVPLYRHRIPRSMDGSLHSLRVPDFIKFNPME
                     YKADEWQPSKWELDNASAENPVPSIRFRRDPKTGRMQSNANMYRWSDGSVTLAIGDEH
                     FEIQSKPLAPPPDKPYREVQDAHYYVAAAHLTTNSLLIVGHLTEQYTVRPNEELADHA
                     LERLKADLAGAKKDRAADMIIVTNEDPELLKKQAELAEKERLKLQRRRETAAARADGA
                     AGRYKGGALSVGDLEGRRGAVGAGRKRGAPGGANKKKHRRPEYDSDDELPKGRRRADN
                     YDMEDGFVVDSAEESEAVEEDEDEEEILDDEEEEDEAPRPKRQRTAEPDEDAEGEEDA
                     PVHTETSRGRRRRVIEDDEDEE"
     gene            1952837..1954934
                     /locus_tag="THITE_61555"
                     /db_xref="GeneID:11522776"
     mRNA            join(1952837..1953008,1953622..1954013,1954066..1954177,
                     1954238..1954934)
                     /locus_tag="THITE_61555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656619.1"
                     /db_xref="GeneID:11522776"
     CDS             join(1952986..1953008,1953622..1954013,1954066..1954177,
                     1954238..1954772)
                     /locus_tag="THITE_61555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656667.1"
                     /db_xref="GeneID:11522776"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="JGIDB:Thite2_61555"
                     /translation="MSNLFSGINARFRGQRSPNSPGTSSPSPEQQAQAQAQAQAAASA
                     PANAPQGSQPSPSSNLAVKLPPLPTSPSLAETIGMDQASGMMQTAEEILASYHLPAVK
                     PLWLNANYAKHIVKGNFMTLSAKPKTVEMGEWIAHQVVEHWRMLITFIRLVHDKEEDG
                     STICNARRCPKMSAGANHSFTWLNSRLQPVEIAAHEYLTLVQRYITGKIDDTNIFPTD
                     PAGVSYADNPAFCTPLPESGQDWIGKRSGFPQNFMETCQTIFRQMFRVYAHLYWSHFE
                     DMFCLNLEKSMNSCFSHFILTSTTLNLLKKTDLEPMQPLIDLWAALGTFPQGSKAFEI
                     ANLQVGQLLVQKAGGPPAN"
     gene            complement(1954946..1956087)
                     /locus_tag="THITE_2121627"
                     /db_xref="GeneID:11522777"
     mRNA            complement(join(1954946..1955258,1955349..1955664,
                     1955871..1956087))
                     /locus_tag="THITE_2121627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656620.1"
                     /db_xref="GeneID:11522777"
     CDS             complement(join(1955119..1955258,1955349..1955664,
                     1955871..1955912))
                     /locus_tag="THITE_2121627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656668.1"
                     /db_xref="GeneID:11522777"
                     /db_xref="JGIDB:Thite2_2121627"
                     /translation="MAGFPKLIPAFTVHVVIAPPQPISPTLKAAHFLSEGGKIVSEPG
                     YAISLNAAIEHGADYIRTFPDGRHVRLDVDSTARDAGTGALVRFRYTGKISTLGAAGR
                     VLRGEAQAPETTPFGEAFSVVEFETGSEALAALHEKVYVGSGRFILEPGKPVTVEYKV
                     SEVSA"
     gene            <1957242..>1959811
                     /locus_tag="THITE_46638"
                     /db_xref="GeneID:11522778"
     mRNA            join(<1957242..1957513,1957577..1959454,1959535..>1959811)
                     /locus_tag="THITE_46638"
                     /product="cora-like Mg2+ transporter protein"
                     /note="Has EST support"
                     /transcript_id="XM_003656621.1"
                     /db_xref="GeneID:11522778"
     CDS             join(1957242..1957513,1957577..1959454,1959535..1959811)
                     /locus_tag="THITE_46638"
                     /note="Contains conserved domains CorA[COG0598], Mg2+ and
                     Co2+ transporter and PHA03307[PHA03307], transcriptional
                     regulator ICP4. 1| CorA-like Mg2+ transporter [Glomerella
                     graminicola M1. 001]. Contains conserved domains
                     CorA[COG0598], Mg2+ and Co2+ transporter and
                     PHA03307[PHA03307], transcriptional regulator ICP4"
                     /codon_start=1
                     /product="cora-like Mg2+ transporter protein"
                     /protein_id="XP_003656669.1"
                     /db_xref="GeneID:11522778"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="JGIDB:Thite2_46638"
                     /translation="MGQQPLRASSPRSPQPPKPPSSSGHGRRRKNHRAGKKARSRRKS
                     FALPPDEIAQDVANSSGLDEGNRGFYLQPGRNLSNTSFESEALLDHRDQQYFLRPRRP
                     SMTTTSASFPAPQPATRLRAMARIDDSDEEDEGAPLLSAPAFQRSETITGYGSNDAPG
                     NNGPPSRRESSGATSSKRHSVSPEAFNVNYPPSVPGTPSFRPAERMSMSFGDVLLRDE
                     LENGQRSPRESGDERGNHGAFMPTSLDRRKTIALQAQEDVCFPQEGLYDIGDDELRHR
                     RSASRMRPRRRRGKWPDLSILDQWSRFEKEGRSEERRAKSITEPQLINGRLRPVNGRW
                     LRSTAEKETPYRFTYFNEEFESTIHSQTISELLQPGGTFKELFIPDPPLLLDESDDEE
                     EEEEQEMDLHRVLGGQVGDPRIPSVQPSLATTTQGFAGRKTSANSEGTEVGSGERSPS
                     RLRSPEPTKSSLNEKPAKPPRYGDRPVWWLDVHSPTEAEMKVLSKAFAIHPLTAEDIM
                     MQEQREKVELFRHYYFVNYRTFDQDQTSENFLEPVNMYVVVFREGVLSFHFSVTPHPA
                     NVRRRIRQLRDYLILSSDWISYAIIDDITDAFGPLIQSIENEVDDIDYAILQMHSGED
                     QITREKKITEKPESAEVNSAEAGRDMLRRVGDCRKKVMSLYRLLSNKADVIKGFAKRC
                     NERWEVAPRSDIGLYLGDIQDHIVTMTGNLSHYEKILARSHNNYLAQINIRMNERQEQ
                     TADVLGKLTVLGTIVLPMNIITGLWGMNVWVPGQGYEGDLKWFIAITLGLLVFGLACY
                     LIAKRVYKIV"
     gene            complement(1960261..1961891)
                     /locus_tag="THITE_2121633"
                     /db_xref="GeneID:11522779"
     mRNA            complement(join(1960261..1961158,1961249..1961367,
                     1961448..1961573,1961635..1961891))
                     /locus_tag="THITE_2121633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656622.1"
                     /db_xref="GeneID:11522779"
     CDS             complement(join(1960457..1961158,1961249..1961367,
                     1961448..1961573,1961635..1961686))
                     /locus_tag="THITE_2121633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656670.1"
                     /db_xref="GeneID:11522779"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2121633"
                     /translation="MSTRQPSRVVFVGNIPYGLTEEQITELFSGAGRVLNFRLVYDRE
                     TGRPKGFGFAEFPDYDSAASAVRNLNDHEVMGRKLRVDFSNETVSDDDNRDRDGATGA
                     GASSTYANPSTTNGNSAAAGPGAGGFSSSTSTTLPPLPQGKDLPPGVTCTDAISRTLN
                     TLPPAQLLDILQQMKTLATSDPARATELLAQAPQLSYAVFQALLIMGLVTPEAITSVL
                     EPPTAATAAAATAAGGVGMGLGVGVGTGTPPVVAPVAGAAAGGYAPPLSAAAPAPVPV
                     PPAPAAAQAPPPVAQDPEALMRAVMELPQETIDQLPETERQQIMALRASYAAQTRR"
     gene            1962318..1963645
                     /locus_tag="THITE_2121637"
                     /db_xref="GeneID:11522780"
     mRNA            join(1962318..1962682,1962751..1963106,1963164..1963645)
                     /locus_tag="THITE_2121637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656623.1"
                     /db_xref="GeneID:11522780"
     CDS             join(1962427..1962682,1962751..1963106,1963164..1963484)
                     /locus_tag="THITE_2121637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656671.1"
                     /db_xref="GeneID:11522780"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="JGIDB:Thite2_2121637"
                     /translation="MSNRNPFEEYANRLRAAARTSGGRFPGGSGGLPGGPRNVGGAVA
                     GLLLLGGGALLFQNALFNVDGGHRAIKYRRISGVSKDIYGEGTHFVIPWFETPIIYDV
                     RAKPRNVSSLTGTKDLQMVNITCRVLSKPKIEALPQIYRTLGQDYDERVLPSIVNEVL
                     KSVVAQFNASQLITQREMVAKLVRDNLSRRAARFNILLDDVSLTHLAFSPEFTAAVEA
                     KQVAQQEAQRAAFIVDKARQEKQAMVVKAQGEARSAELIGEAIKKNKAYVELKKLENA
                     RAIAALLQEAGGKNRLLLDSEGLGLNVFEDLEKK"
     gene            <1964161..>1964725
                     /locus_tag="THITE_2147178"
                     /db_xref="GeneID:11522781"
     mRNA            join(<1964161..1964250,1964399..1964481,1964641..>1964725)
                     /locus_tag="THITE_2147178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656624.1"
                     /db_xref="GeneID:11522781"
     CDS             join(1964161..1964250,1964399..1964481,1964641..1964725)
                     /locus_tag="THITE_2147178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656672.1"
                     /db_xref="GeneID:11522781"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Thite2_2147178"
                     /translation="MTDTPLLATQPRVRTLTGKEIELNVEGSDQVSKIKELVEEKEGI
                     PPAQQRLIYGGKQMVDDKTADDYSLEGGATLHLVLALRGGL"
     gene            complement(<1965474..>1966472)
                     /locus_tag="THITE_2131815"
                     /db_xref="GeneID:11522782"
     mRNA            complement(<1965474..>1966472)
                     /locus_tag="THITE_2131815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656625.1"
                     /db_xref="GeneID:11522782"
     CDS             complement(1965474..1966472)
                     /locus_tag="THITE_2131815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656673.1"
                     /db_xref="GeneID:11522782"
                     /db_xref="JGIDB:Thite2_2131815"
                     /translation="MALSVVMQHVTAITDLGNMAPQYTRQILRAVKSAEHLRTLELNS
                     DDIYDETAEHWKRLINRDFPILSARHNLTPKDPRSWHKVYAAYKKLDDEEVAVATAKL
                     SQSLATKQEEQDSRRSTIVSANQLPRPRKRNLLAEPPGKQNWFKKARKDLIRDATYRK
                     HVAFGGADSRIKNPSKAVTTEARKRRQPEPAAPVIRAPRPMAAKNRLKRTIIDSDDLV
                     DAMENQNDQILDDDDLFGDDLFGDHLIGKPEDKPATSTSAPAKSKSSLPSVSAPKQLP
                     GPRRPQLLYAAPASNSVVRRVSVPSSAGPAAAAAAAARSPPAPEPDSPPRKRLRPS"
     gene            <1967603..>1968850
                     /locus_tag="THITE_2081698"
                     /db_xref="GeneID:11522783"
     mRNA            join(<1967603..1968631,1968704..>1968850)
                     /locus_tag="THITE_2081698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656626.1"
                     /db_xref="GeneID:11522783"
     CDS             join(1967603..1968631,1968704..1968850)
                     /locus_tag="THITE_2081698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656674.1"
                     /db_xref="GeneID:11522783"
                     /db_xref="JGIDB:Thite2_2081698"
                     /translation="MASWGLLDDKEENELHKSRLLNVEEKPFKRITKRLNTLHSLTAA
                     RARQAPTPPPETNGISPHQQPDGASPATGGSGSDAAAAFSPADLAQLREDITLDFAAF
                     DSSIARLQFLLTANERERERYAAERRRILAASQAVRDSTAALRAQLEAARATLAQRRA
                     FDELADAITSNPALRPRAEQAANLRKLQDEIAELEAEREAYGATWHERREQFARIMDE
                     SMRLRRLIRDEKEEVERREGMDDDNEAGGTPRPSGVASRGSTPRPEGGLAPKGGAESG
                     DVGGTPRPVSTTGGRTPARESPAPGQEGASFAIKRATDVGTSFSQMGSQMGSQMGSRE
                     GSVEMETKSGEQEEGEDVDMVEVKDDRSEPDSPLTPVPADDTPQIVVDGEGDTMDTT"
     gene            complement(<1968962..>1969402)
                     /locus_tag="THITE_2147180"
                     /db_xref="GeneID:11522784"
     mRNA            complement(join(<1968962..1969156,1969223..>1969402))
                     /locus_tag="THITE_2147180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656627.1"
                     /db_xref="GeneID:11522784"
     CDS             complement(join(1968962..1969156,1969223..1969402))
                     /locus_tag="THITE_2147180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656675.1"
                     /db_xref="GeneID:11522784"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="JGIDB:Thite2_2147180"
                     /translation="MAPPTPLAIATQAVNRLVKEESYYHKEQANQEKRIKKLEEDIEN
                     NSPDLDSNAEYILKQEKTALDETKAVFGPLRKRIADAVEKLEEQIAISESDGTGSEEE
                     LKKAKEALASGQKLAAEEQEEI"
     gene            1971183..1974795
                     /locus_tag="THITE_127365"
                     /db_xref="GeneID:11522785"
     mRNA            join(1971183..1971485,1971598..1974379,1974438..1974795)
                     /locus_tag="THITE_127365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656628.1"
                     /db_xref="GeneID:11522785"
     CDS             join(1971368..1971485,1971598..1974379,1974438..1974531)
                     /locus_tag="THITE_127365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656676.1"
                     /db_xref="GeneID:11522785"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Thite2_127365"
                     /translation="MENAFAKPIDEVLGTLGVDVTTGLNDEQVARLQAKYGKNAIAEE
                     PPTPLWELILEQFKDQLVIILLGSAAISFVLALFEEEGGWSAFVDPVVILTILILNAV
                     VGVSQESSAEKAIAALQEYSANEANVVRNGQIHRIKAEELVPGDIVDVSIGARIPADC
                     RLVSIQSNSFAVDQAILTGESESVGKDPRAVVSDEKAVLQDQVNMLFSGTTVVTGHAK
                     AVVVLTGSKTAIGDIHESITAQISEATPLKQKLNDFGDQLAKVITVICVLVWLINIPH
                     FSDPSHGNWTKGAIYYLKIAVSLGVAAIPEGLAVVITTCLALGTRKMAAKNAVVRSLP
                     SVETLGSCSVICSDKTGTLTTNQMSVSKIVYLNSDGTDLEEFDVEGTTFEPKGDIKFQ
                     GKVVADLAQESTTVLQMTEVAALCNEARLDYHPHSGTYSNVGEPTEGALRVMVEKIGP
                     RAPSDCHPQDRVHYASSWYEKQYSRLATYEFSRDRKSMSVLVQNGSEQKLFVKGAPES
                     IIERCTHVLLGRNGKKLALNRKLAELLLKEVVEYGNRGLRVIALASRDQVNDDPLLHK
                     AKSTAEYAALEQNLTLLGLVGMLDPPRPEVPAAIQKCKEAGIRVIVVTGDNRNTAETI
                     CRQIGVFGPNEDLTGKSFTGREFDNLSPSEQLEAAKNASLFSRVEPTHKSKLVDLLQS
                     LGEVVAMTGDGVNDAPALKKADIGVAMGSGTDVSKLAADMVLADDNFATIGVAIEEGR
                     SIYNNTQQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSF
                     NPPDHDIMKRQPRKRDEALIGGWLFLRYLVIGTYVGLATVAGYAWWFMFYSEGPQISF
                     YQLSHFHRCAAEFPEIGCEMFTNDMAKAGSTVSLSILVVIEMFNAMNALSSSESLLTL
                     PVWENMMLVYAIGLSMALHFALLYIPFLQTLFSILPLNWAEWKAVLVISAPVIFIDEV
                     FKFVERGFLDRSTARGLPKGKKKEL"
     gene            complement(<1974798..>1975489)
                     /locus_tag="THITE_2147182"
                     /db_xref="GeneID:11522786"
     mRNA            complement(join(<1974798..1974941,1975055..>1975489))
                     /locus_tag="THITE_2147182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656629.1"
                     /db_xref="GeneID:11522786"
     CDS             complement(join(1974798..1974941,1975055..1975489))
                     /locus_tag="THITE_2147182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656677.1"
                     /db_xref="GeneID:11522786"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Thite2_2147182"
                     /translation="MAGKDCVAIACDLRLGLQALTVSNNFPKIFQYGDHVFLGLTGLA
                     TDVATVADLFRYKVNLYRLREERHIAPRTFANLVSSSLYERRFGPFFVSPVVAGLDPK
                     TGQPFICGFDSIGCIDFAKDFIVSGTASDQLFGMCESLWEPDLGPDELFETISQALLN
                     AVDRDALSGWGAHVYIIEKDKVTKRLLKGRQD"
     gene            1976473..1978313
                     /locus_tag="THITE_2121647"
                     /db_xref="GeneID:11522787"
     mRNA            join(1976473..1976756,1976817..1978313)
                     /locus_tag="THITE_2121647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656630.1"
                     /db_xref="GeneID:11522787"
     CDS             join(1976620..1976756,1976817..1978170)
                     /locus_tag="THITE_2121647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656678.1"
                     /db_xref="GeneID:11522787"
                     /db_xref="JGIDB:Thite2_2121647"
                     /translation="MAAHVEVVSTDLRRVKVKVTPGTHLVDVLGEACKKLNLKSDKYE
                     LKHKQKLVDLTGPFRTSGLGPGAKLELVHKSKSASVVSIALDINGRRYTKKLPSDMTL
                     WKVMRQFESTETGLNITGRAVPVGTNTGQLYYEAPVVNIMGREYSAMEDLQKTLSQCG
                     ISSGSIALRVSFRLSERTLSDAMQEISKYLTDVEPEQPRPERNEESAVAPALAAEEQK
                     TEDVSMDETPAPEAIPQPGAEAAVPAPPKDAGTAAPTDVDGPAAPTADPLQPTGVFSA
                     PTSSTPAAARSHEDDSVYEPTIAHAQLRQQHLQQQSQNTRLKSDAELAAEAAEEAAKL
                     AAITKVEVKIRFPDQTSAVWTVTPDQTGAFLYQAVRGVMAHPAQPFKLILPGPKTVIR
                     EDDRKLIAGYRLKGREMLHLLWDDSVAAAARREPFLKGSVASRAREVVVPEIPQGSTD
                     EEEEEGGAAAGPSRPAQLERGKGGGSGLDPDAMKKKLGKFLGLRKK"
     gene            1979257..1980624
                     /locus_tag="THITE_2121649"
                     /db_xref="GeneID:11522788"
     mRNA            join(1979257..1979893,1979956..1980195,1980247..1980624)
                     /locus_tag="THITE_2121649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656631.1"
                     /db_xref="GeneID:11522788"
     CDS             join(1979520..1979893,1979956..1980106)
                     /locus_tag="THITE_2121649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656679.1"
                     /db_xref="GeneID:11522788"
                     /db_xref="JGIDB:Thite2_2121649"
                     /translation="MKLHAILALAAAAHLGAALPTYTIPLAMSKALAENEDCTLPEGF
                     EVQNFQIWTPAPGNNRTSVINFGYRDNSTSIVTACHFNQTSVNVGPAGLTPRYACDNK
                     IVEFIWQNGTLTLVEKACPQSNMPRGFEAAGAVTPDLTCSASAKNSTVGEGKFCVSRT
                     DLVANFTSLEPTPN"
     gene            1980626..1982518
                     /locus_tag="THITE_2121650"
                     /db_xref="GeneID:11522789"
     mRNA            1980626..1982518
                     /locus_tag="THITE_2121650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656632.1"
                     /db_xref="GeneID:11522789"
     CDS             1980791..1982227
                     /locus_tag="THITE_2121650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656680.1"
                     /db_xref="GeneID:11522789"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="JGIDB:Thite2_2121650"
                     /translation="MRALDKLLFLSILLPSASTHAEPIPAPPAPAPPPPHFSNQPQPQ
                     PQHPLLPSTHPLPTPPRPPPPPPPPAGVALHQGQGGDVGGGEVASAVASAVSPRRPRR
                     SLFAALERAARLVDIAYCVGTTGLAPPFACASRCRDFPSLRLLRTWNTGPLLTDSCGY
                     IAVDHGDGGGAGVGAGSGAGGWGRTGEVEREGREGKEIVVAFRGTYSITNTIVDLSTV
                     PQEYVPYPGDGNGDGDGDGAGTKCENCTVHMGFMASWRNAREVVVPTLKAARAKYPGY
                     RVHLLGHSLGGAVAALAALELRLGLGWEDVLVTTFGEPRVGNGQLAAYIDRAFGLADR
                     DGEDLPYRRVTHVGDPVPLLPLTEWGYRAHAGEVYISKPSLPPGPEDLRICRGASDPE
                     CMAGAETEDWLSWILGSVRLLAVDVKSGWFPARFQLWQLFFAHRDYFWRLGLCVPGGD
                     PADWGREKYNLTLGVGVAEPDETVMGDL"
     gene            1984348..1986207
                     /locus_tag="THITE_2070056"
                     /db_xref="GeneID:11522790"
     mRNA            join(1984348..1984490,1984647..1984654,1984727..1985080,
                     1985158..1985245,1985323..1986207)
                     /locus_tag="THITE_2070056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656633.1"
                     /db_xref="GeneID:11522790"
     CDS             join(1984479..1984490,1984647..1984654,1984727..1985080,
                     1985158..1985245,1985323..1985673)
                     /locus_tag="THITE_2070056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656681.1"
                     /db_xref="GeneID:11522790"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="JGIDB:Thite2_2070056"
                     /translation="MANERESKTFLARLCEQAERYDEMVTYMKDVAKLDGELSVDERN
                     LLSVAYKNVVGTRRASWRIISSIEQKEESKGSDKHVATIREYRHKIEGELEKVCQDVL
                     EVLDESLIPHAATGESKVFYHKMKGDYHRYLAEFASGEKRKVAATAAHEAYKSATDVA
                     QTELTPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDS
                     TLIMQLLRDNLTLWTSSDNGEPEPAAAEAPKEEKAAEKEADGKADEPAPEQQ"
     gene            complement(1987204..1988555)
                     /locus_tag="THITE_2121655"
                     /db_xref="GeneID:11522791"
     mRNA            complement(join(1987204..1987792,1987874..1988555))
                     /locus_tag="THITE_2121655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656634.1"
                     /db_xref="GeneID:11522791"
     CDS             complement(join(1987392..1987792,1987874..1988444))
                     /locus_tag="THITE_2121655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656682.1"
                     /db_xref="GeneID:11522791"
                     /db_xref="JGIDB:Thite2_2121655"
                     /translation="MERSGNASPLSVPAPCSPPAPLALSESMAQTTPCSDTTHSSVRP
                     ALYSDSPKPQVVERENPDPPQDEPQAQGQAPARQRQQQPPQAPEEAPEVPAPPRSPQC
                     TSSPTDWLATRQQLLPRRNQGNKADWIRGWSEAVGMHGTETYCACSETVETSRGRKGK
                     TADLAGNIRAILQRTTSPSNSKPATPSEPEGSRGFGKRVSELLMRVRPSLHGQRKNAH
                     KRDAEIRKMAWPVEYQPRWATTGQGHKRLLVRPPSQPLPATSPAPVQKSQSMDLFPGR
                     TRGRIDTGSISSDTSDSGAPRGGLSRSMSRLQRAAALLQRATTRPKD"
     gene            complement(1990014..1994493)
                     /locus_tag="THITE_2121658"
                     /db_xref="GeneID:11522792"
     mRNA            complement(join(1990014..1991453,1991512..1991731,
                     1991785..1992320,1992376..1993680,1993735..1994493))
                     /locus_tag="THITE_2121658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656635.1"
                     /db_xref="GeneID:11522792"
     CDS             complement(join(1990106..1991453,1991512..1991731,
                     1991785..1992320,1992376..1993680,1993735..1994378))
                     /locus_tag="THITE_2121658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656683.1"
                     /db_xref="GeneID:11522792"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Thite2_2121658"
                     /translation="MDYSYNAPSTALWPGQPPSPEKSSQILIREYPHRAIAITSGSHA
                     LILRHSAATREAIANGSLASYSSARPGSAAPDNIASKCMVEFSPTSDRLLADYRPLTP
                     RPIYGTLGLISIGRDVFLCVITQASRVATVRPGETVEKIEAVQFFCLNSAEYDEVVAL
                     DPYEADSDAASGYGQGLGRREMPEEHPCQDLQKLLSNGTFYYSTDFDVTNRMQDRPAD
                     AANFDIDNFDESFLWNSYMIRPLVQFRSRLQRQEREALDASRILTSAIRGFCRSWAIP
                     QTSAPLSSARTGLPSYLTVISRLSCKRAGTRFNSRGIDDDGNVANFVETETTYWSPSG
                     VVFSYVQVRGSVPVFWEQAAGLLPNQQKITITRSADGTQPAFDKHFSDLEQAYGAVHV
                     INLLSATKPGEYELTTLYRLGIQNCPLSRPGGGKESRDHALLRETEYDFHAETKGPQG
                     YVAANEIRRYIEDSADGFAYYLAQESEDAGHLNGGGSNGHKNRRYVVVLQQEGVFRTN
                     CLDCLDRTNLIQTILSQMAVEAFLGHRGERATSDFWSRHANLWADNGDSLSKIYAGTG
                     ALKSSFTRTGKMSLAGAIADVRKSATRLYYNNFADKARQITIDTLLGRIVNQASVILF
                     DPISDYVTGELQRRSSEFSSSEKIHILVGTFNLNGRTDGINEDLSSWLWPSELGSIQP
                     EIIAVGFQEIVELNPQQIMNSDPRRKQLWEKAIKRTLDQHYSREGDEKYVLLRSGQLV
                     GAALCIFVKASVLHNIKNVEGSVKKTGLSGMAGNKGAVAIRLDYANTPICFVTAHLAA
                     GFANYEERNRDYATIDQGLRFQRNRGIDDHDSVLWFGDFNYRIGLRLEDAKELVKRRN
                     LERLFENDQLNLQMVAGLAFPFYSEARITFMPTYKFDIGTDEYDSSEKARIPAWTDRI
                     LRKGSNLRQLAYNSAPLRFSDHRPVYAVFECTVNIVNEKLRDKIGREIYERRKAEVGG
                     DTANLAANESEDEDLIDYDAIEPGLPPASSDRQKWWLDNGKMARSSISPPKPENSASQ
                     TILNPKRPTNPHVPTDEPDWVSVPRSESRLSSFSSMSTSPYEHVNHSMLLSSSVSSSA
                     PRKPLPPYDPSALPAKIGRLQINEDAKGTQVDGGAPPPPPPRRQTSMTPGSVASSPAV
                     SIQQKRGQVNKAPPAPPVGPKPAVSPETAAKQKSPPPVAKKPAHLTTPASPANSVSAS
                     LMPNAKAHDPNASRPELPRRSTASVHNSISNLSSSLPTLPARNGVISREEAPPPELPR
                     RSDATTGSPAQNHHRMAAAGGIPLVGLAAPQERKPQLPPRKPTIPAPATQGPKQAPPP
                     PGPKKPQVVDLLGDDGALEMGGWEALKPSS"
     gene            <1995888..1998550
                     /locus_tag="THITE_2070058"
                     /db_xref="GeneID:11522793"
     mRNA            join(<1995888..1995959,1996038..1996253,1996311..1996414,
                     1996821..1998023,1998086..1998550)
                     /locus_tag="THITE_2070058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656636.1"
                     /db_xref="GeneID:11522793"
     CDS             join(1995888..1995959,1996038..1996253,1996311..1996414,
                     1996821..1998023,1998086..1998254)
                     /locus_tag="THITE_2070058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656684.1"
                     /db_xref="GeneID:11522793"
                     /db_xref="JGIDB:Thite2_2070058"
                     /translation="MADFTTFGGTDEENAEVKRLNAEVEADPDNFENWEKLIRACESL
                     EGGLNRNSSPQALATLRDAYDRFLLKFPLLFGYWKKYADLEFNISGPESAEMVYERGC
                     ASITNSVDLWTEYCSFKMETTHTPHLVRELFERAASHIGLDFLSHPFWDKYLECETRH
                     EAPDKVFAILKRVIHIPMHQYARYFERFRQMAHTRPLEELVSADIVARYRAEVIAEAA
                     QFGVQKPELEIERDIRAKIDASFYQVFQRTQLETNKRWTFEAEIKRPYFHVTELEHQQ
                     LANWRKYLDFEEAEGNYQRIVFLYERCLVTCALYDEFWFRYARWMEAQENKEEEVRNI
                     YLRATTLFVPISRPGIRLQFAYFEEMCGRIDVARDIHAAVLTKLPDCVEAIVSWANLQ
                     RRQSGLNAAIEVYKAQIDSPIVDIFTKAALVTEWAYLLWKVKGSVDEARTAFVKNVEW
                     YADSRHFWQKWLEFELEQPTNAELETEHSERVKTVITEMRAKSRLSPGIKQELGLMYM
                     NYLQQRGGKQAMKEFLAIDRELFGPQSVSQITKAKQSKDSSGVPELDEATRLKAEKRF
                     YAYYELHMDPNPNAQGPASFE"
     gene            1999577..2001412
                     /locus_tag="THITE_2171300"
                     /db_xref="GeneID:11522794"
     mRNA            join(1999577..2000301,2000395..2000768,2000848..2001412)
                     /locus_tag="THITE_2171300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656637.1"
                     /db_xref="GeneID:11522794"
     CDS             join(1999815..2000301,2000395..2000768,2000848..2001060)
                     /locus_tag="THITE_2171300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656685.1"
                     /db_xref="GeneID:11522794"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="JGIDB:Thite2_2171300"
                     /translation="MATATRTFTRALRTSARPAFAAAPRVAFRQSGRRFYSSEPPAKQ
                     GSSTWLWLAGAAAVGGGGAWFYLNNQQSSATPKAFTPKFEDYQAVYNEIANRLEEKDD
                     YDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPESDHGANAGLKVARDFLEP
                     VKAKFPWITYSDLWILAGVCAIQEMLGPKIPYRPGRQDKDVSACTPDGRLPDGAQGQD
                     HLRNIFYRMGFNDQEIVALSGAHALGRCHPDRSGFSGPWTFSPTVLTNDYYKLLLDEK
                     WQWKKWNGPKQYEDKKTKSLMMLPADMALVQDKKFKEWVQKYAADNDLFFRDFAAVIV
                     KLFELGVPFKEDQERWVFKTVNA"
     gene            2001759..2003128
                     /locus_tag="THITE_2121674"
                     /db_xref="GeneID:11522795"
     mRNA            join(2001759..2001928,2002000..2003128)
                     /locus_tag="THITE_2121674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656638.1"
                     /db_xref="GeneID:11522795"
     CDS             2002028..2003041
                     /locus_tag="THITE_2121674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656686.1"
                     /db_xref="GeneID:11522795"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="JGIDB:Thite2_2121674"
                     /translation="MAPARTPVLRHLLSCQTRTLRASNQRRWAQVHDVRFLATTQQPR
                     SVLERYRDKLDRKAREEGHADIDSLKAAYADKIKALRQDAVAAPLTTTTGPAPSSQPE
                     AASQQQQQPPPVAAAASHPAPPKSTSSASPTGIKPLSEILDLQKAAALPLEELTAIWR
                     LRHAANPNSLCAVIPAATFATMNALARAHPQFVLPVPHPQQGGAEMHFLQWTWDAPTR
                     SATVLFTRLAEYKARGEFAAPHTTATHYYGDELATSAAAAAGGGKGGVVLMQGAVVAD
                     RGVKVEEARWLVMCLQRFYGGWDGVESRERAEERRRLLEWFGKGDARFSVEKLMEEAE
                     RMG"
     gene            complement(2003136..2005253)
                     /locus_tag="THITE_2121676"
                     /db_xref="GeneID:11522796"
     mRNA            complement(join(2003136..2003564,2003642..2003816,
                     2003884..2004792,2004849..2005253))
                     /locus_tag="THITE_2121676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656639.1"
                     /db_xref="GeneID:11522796"
     CDS             complement(join(2003230..2003564,2003642..2003816,
                     2003884..2004792,2004849..2005097))
                     /locus_tag="THITE_2121676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656687.1"
                     /db_xref="GeneID:11522796"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2121676"
                     /translation="MPYPSTFPPLDIPDGIDLWSFLFGHKHRDFPVTKEILTCAETGR
                     SYSWADVRSASIEFGKGLKALWGWKKGDVLALYTPNSIDTPIVTLGALWAGGVVSPAN
                     PLYTTDELAFQLRDSGAKGLVTQPAYLGTALAAAHKAGLPPERVVVLGPRRDPRGRTR
                     HFASIRSTSYTGRYAKAKIAPRRDLAFLVYSSGTTGLPKGVGLSHRNMVANLLQASYV
                     EGSQWRSRGGPDGAGDRQLAVLPFFHIYGLTCGVLMALYEGWQLVVLERFDMEKALRA
                     IEKYRVTFAYVPPPVVLAFSKHPAVDAYDLSSLKVLHSGAAPLTRELTEAVWNRLKVP
                     VKQGFGLSETSAVVCCQTVDEWAKFMGSVGKLMPNMTAKIVGEDGKEVPEGESGELWL
                     KGPNVFAGYFNRPELTKEAFSPDGFFKTGDVFRRDKHGNFYCVDRLKELIKYNGYPVP
                     PAELEGVLLGHEDVADACVIGVEDRANATEVPRAYVVLRPGVAAGDAKAEQLAEWVAA
                     RVAPHKKLRGGVRFVDHVPKSPSGKVLRRVMRAQAKQQEQRALGAKL"
     gene            2005922..2006999
                     /locus_tag="THITE_2121678"
                     /db_xref="GeneID:11522797"
     mRNA            join(2005922..2006431,2006492..2006999)
                     /locus_tag="THITE_2121678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656640.1"
                     /db_xref="GeneID:11522797"
     CDS             join(2006255..2006431,2006492..2006851)
                     /locus_tag="THITE_2121678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656688.1"
                     /db_xref="GeneID:11522797"
                     /db_xref="JGIDB:Thite2_2121678"
                     /translation="MYLKGALLFSLLASSLAAPTANGDRKVKRGVLTVQDYSQFQVSD
                     GVAGNALAEVNAKFPIDQSDLASVDPQDLAIIKAARETAEAAETDEGGFNDAIKAAGG
                     TSTAAGKALQNGKIKNKVLKLQLEVLALQIEAAQGGSNNTAKIAEEQKKLDTNIKLDQ
                     AAAGQPSQSVDFQGSDQP"
     gene            2011671..2015084
                     /locus_tag="THITE_2121681"
                     /db_xref="GeneID:11522798"
     mRNA            join(2011671..2012971,2013045..2013064,2013131..2013245,
                     2013305..2013324,2013375..2013499,2013555..2015084)
                     /locus_tag="THITE_2121681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656641.1"
                     /db_xref="GeneID:11522798"
     CDS             join(2011999..2012971,2013045..2013064,2013131..2013245,
                     2013305..2013324,2013375..2013499,2013555..2015001)
                     /locus_tag="THITE_2121681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656689.1"
                     /db_xref="GeneID:11522798"
                     /db_xref="JGIDB:Thite2_2121681"
                     /translation="MHLGHHSASRMGCHESTPDSCYSSSSAGGDPQYPPSAGPVPASF
                     AYPISPEESKEGIATPDHLPYREDTQVPTPANFQPYPGNDEAYAPGTHARPPPSDVLR
                     DVLYDQSMAHPSRLPEASGLAALGFYDDANLDFDAFDFDILDHWNLDAPQSEADQTAA
                     NAQDPAGVAAMRSALVKIWTESPWRWSPQKTDNCYNEQPNLPLPSSDAHRVQLHSNRP
                     AVDRVVKDKLLGSCRDKILAIVLSTCREKLMENRVAASFPSADTMDSWINLFLAAHHC
                     QVSSWIHYGSLSLNSQCPEWLAMAAAAGAVLTPVPAFRKFGLALQEAVRVAIPERFET
                     NNENIAELDKVQALVLVQDIGLWSGNRRKMEIAECHLSIPIAMMRYRGKFGRSAYPDI
                     VIYPSDEGSVLEEKWKKWYQLESWKRLVFHAYLRDAQVSMTQFNNPSMSYAELTLPLP
                     CSKELWFARSAEEFKIRYLESAAGDAKCPIPSLGDLLRDINALSANQHRLDVQFAISI
                     YLHGFWSLIWEYRQLSSIYRPSFTTTTTTPTASTNTNNQHNTTTLLLDSRRADLQNQL
                     KTFQLATREPSMTTTMLSAQESMLLHLLLLNLHLALPDLQLLFSGKEAAAAAAAAAAD
                     GADEHQHARRAYFVQPQQQQPQQQQQDQKTPAAASAATAANVREALWHAGQVFRMARL
                     FPRGHLKDFWAVAVCHAALAVWACGVGLVGGLEGGGCQLQQHQQQQQHQYHQQQQHHQ
                     QGGRDGGGGAGAGAGGTDPLVFLDGEASPAVQAWIAYGQGRPAVRSVRDGDGDDDSAA
                     AAAAAAADNGGGGGGGSGGGGGGLCRSGGGVGVDGGAGRVAATATATACLVEEDPRTC
                     MEVAQGILRANFVGVWESLPPLNENILVVLRQLEKAAAAVGWG"
     gene            complement(<2015799..>2016146)
                     /locus_tag="THITE_32255"
                     /db_xref="GeneID:11522799"
     mRNA            complement(<2015799..>2016146)
                     /locus_tag="THITE_32255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656642.1"
                     /db_xref="GeneID:11522799"
     CDS             complement(<2015799..2016146)
                     /locus_tag="THITE_32255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656690.1"
                     /db_xref="GeneID:11522799"
                     /db_xref="JGIDB:Thite2_32255"
                     /translation="MLVEQPLSAKTRSRTARPPQIHTHKNHDTYNGVLRLPQMIHVHV
                     SSRPQDRSRNSTTASPTDSRQTYSYYTITLHYPHNRACEIYRSRDEVHLLRRKLSFIM
                     SRKPRRNSKPATDG"
     gene            2017951..2019917
                     /locus_tag="THITE_2121683"
                     /db_xref="GeneID:11522800"
     mRNA            join(2017951..2018430,2018495..2019917)
                     /locus_tag="THITE_2121683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656643.1"
                     /db_xref="GeneID:11522800"
     CDS             join(2018122..2018430,2018495..2019868)
                     /locus_tag="THITE_2121683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656691.1"
                     /db_xref="GeneID:11522800"
                     /db_xref="JGIDB:Thite2_2121683"
                     /translation="MALQAAYKQFLAAPSSSALAENASLHYVTTTSSFAGATEIIKHL
                     ASVRNKIKKQKEDALFAVEDQHALAIELDTTLEFVSSGGPYLPGLDDNFLADRTVHLA
                     VTHVVTFNGEGKITAIRQSWDQGALLKQVEVIGRTGQNWPIRDSKAQISLIAKCVAGD
                     GTGVAPTEALPTRSRSSTNAMRDPHASLDLFAPRDELESIPAAVISPYAGRRPRQRSF
                     TEILGDEPVEEPGSPSNGRERSQSPSKAVAPKVGAGKNFQPMRLFDMDENDLAAETHE
                     PKPSTERLMRVDPKKYQHFDFDDGSETPAAAAAPAPKPAPDRKSKHESNWSFEDFVTP
                     VKPVASRGIHRARDVRHWGADNEVLENTPAPRPAVSKPRRDAEAHFELVDDGPESEGP
                     RHAGRPPRGAQHNEGLHLYDNRLHVEEGTVPSPEPPALGNITNLKDRGRDFEAHFNFT
                     DESPHHAGANDPPPKVSEDRKKAVRMMESNWAPYDESPASRKENDDPNHHPKRAADDH
                     RGIAIAGDGMGGKKGSARGWLAGDADDADQLPVPARKGGRGPPAKSDNFWDF"
     gene            complement(2020550..2022515)
                     /locus_tag="THITE_2121684"
                     /db_xref="GeneID:11522801"
     mRNA            complement(join(2020550..2021906,2021963..2022172,
                     2022231..2022515))
                     /locus_tag="THITE_2121684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656644.1"
                     /db_xref="GeneID:11522801"
     CDS             complement(join(2020721..2021906,2021963..2022172,
                     2022231..2022361))
                     /locus_tag="THITE_2121684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656692.1"
                     /db_xref="GeneID:11522801"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Thite2_2121684"
                     /translation="MGCMLYCTIQALGELAVTFPVAGSFSAYSTRFLDPAWGFAMGWN
                     YALQWLVTLPLEIIAASITVGYWNSNLDRSIFITIFLATIVVINLFGVKGYGEAEFVF
                     ALFKVMAVIGFILLGIVINIGGFPNEGYIGGRFWHDPGAFNNGFKGLCAVFVTAAFAF
                     TGTELVGLAAAETVNPRKSLPTAIKQVFWRITLFYIVALTLIGLLVPHNHPRLLGAKS
                     AADASASPFVIAIESAGIAVLPGIMNGVILVAVISVGNSAVFGSSRTLAALADQGQAP
                     SILGYVDRRGRPLVAILAASAVGLLGYLADLHQESDVLNWLLAVSALSSIFTWGSICL
                     AHIRFRRAWAAKGRSLHALAFRSQVGVPGSWVGLTMNVLVLLAQFWTAAWPVPQPSSS
                     SSSTTTTTTGGGTTVPLDSARDVAENFFLQYLCAPIVLACYVGYKAWFRTHIVRVADM
                     DVDTGRRDFGYHHYHHHHALSALRRRERKDEEEEAEEEEEERLRRGWPMWKRVYRFLC
                     "
     gene            complement(<2024336..>2026863)
                     /locus_tag="THITE_2057638"
                     /db_xref="GeneID:11522802"
     mRNA            complement(join(<2024336..2025849,2026194..>2026863))
                     /locus_tag="THITE_2057638"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003656645.1"
                     /db_xref="GeneID:11522802"
     CDS             complement(join(2024336..2025849,2026194..2026863))
                     /locus_tag="THITE_2057638"
                     /note="CAZy_ID 269974"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003656693.1"
                     /db_xref="GeneID:11522802"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_2057638"
                     /translation="MNVRDPFNIRTGSLNRPPIATWKSNRSYNSPSNNPFPAPLHQII
                     RTAATATQSAAADLRDKAGEVVQSAQQVLAGAAAAALDTGGDHTDAVAEPQQERKQKH
                     RTGAPYQLDRRQQQPQPRPDIDLEKQALPRKNKDKDKEKDKEKDMSFGVPRNVPSFTN
                     PQRQNEDRLWAAATASSRQRATGGGVLGGVQSLFSPHHHGRASATALPMYKDKPYMYP
                     PGGAGGYDEFHPESRNGRRMAPKGLGWIIIDSLDTLMLMNLTSRLTHAREWLSKSLTW
                     DQDQDVNTFETTIRMLGGLLSAHYLSTEFPDLAPISDDDPGTPGEDLYLEKAKDLADR
                     LMAAFTSPSGIPYASVNLGQYKGIPSHTDNGASSTAETTTLQLEFKYLAKLTGEKEFW
                     DKAERVMQVVDDNGARDGLVPIYISAVTGKFQGENIRLGSRGDSYYEYLIKQYLQTNK
                     KEPVYREMWQEALQGVRKHLVTYTEPSRFTIIGERPSGLGGDLLPKMDHLVCFMPGTI
                     ALAVTGGLTEKEAKKLPTWTKQDEADMQLARELMHTCWGMYKYMATGLAAEITYFKIA
                     RPPLPESAPHEAPAEFDPAPDAAWRRDYEVKPLDSHNLQRPETVESLFYMWRITGDPK
                     YRDWGWDMFKSFMNHTAVDGGGGFTSLANANTVPPATRDNMESFWLAETLKYFYLLFS
                     PDDLLPLDKVVFNTEAHPLPRFDMGPLFSTGWKRKPRDAEGKIIE"
     gene            complement(2027850..2028981)
                     /locus_tag="THITE_2121688"
                     /db_xref="GeneID:11522803"
     mRNA            complement(2027850..2028981)
                     /locus_tag="THITE_2121688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656646.1"
                     /db_xref="GeneID:11522803"
     CDS             complement(2027907..2028839)
                     /locus_tag="THITE_2121688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656694.1"
                     /db_xref="GeneID:11522803"
                     /db_xref="JGIDB:Thite2_2121688"
                     /translation="MHQQGANRVGAEQVNGPSACSPSFLTRQTGARLGARKATTRWAS
                     LDAAFDLNLGRAGRTYEDPSFDRRQKPDWALCSVDRKSPLSDGSFRYDNLLPGDSKLS
                     NKWHSSWYQRSDLHPGYLQVWKDPVRQILSYCRHNRCRYGFLITDAELVVMRVTPMPT
                     AESSVTTRQASQAEALAAHYRHISTSTTMSSLSSSLRDMSLDSSSSYRPNDLAEDGYI
                     VEYTAPSLGEIVDSRTLRFSWVCSTWLGLPALALTHLNSATRALTRAGRCLMEHSSTT
                     LRAWHWRRRSSWSIRTRRLKEGHVGLRPQTDSLS"
     gene            2029580..2030915
                     /locus_tag="THITE_2121689"
                     /db_xref="GeneID:11522804"
     mRNA            2029580..2030915
                     /locus_tag="THITE_2121689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656647.1"
                     /db_xref="GeneID:11522804"
     CDS             2029832..2030638
                     /locus_tag="THITE_2121689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656695.1"
                     /db_xref="GeneID:11522804"
                     /db_xref="JGIDB:Thite2_2121689"
                     /translation="MTKAAAAGRQIYIHPRPTTLSHARNNLRAFSDEAVTRPQPPGFI
                     PVNSNVQLVDCLGWTEFKGSEINAQFKRARVFDRECKVDGETYPAIVYQFVADDSVPE
                     VNTILDQLDFFHATGFVTVMFKGDNWAGKGMLVDFSDIVSYHTGFLWWRPSHYAALAV
                     GFREVVEDAARNGLLGPRPKVIERSRTPPHLRRHATRARTSTRDIPPPPPPPPRIPLP
                     EGDFESRGEELLEDKPSEPKPAVPLDARPIPQSSPSSMGEARWGGSRCPG"
     gene            complement(2032177..2033236)
                     /locus_tag="THITE_2121694"
                     /db_xref="GeneID:11522805"
     mRNA            complement(join(2032177..2032755,2032813..2033236))
                     /locus_tag="THITE_2121694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656648.1"
                     /db_xref="GeneID:11522805"
     CDS             complement(join(2032429..2032755,2032813..2033097))
                     /locus_tag="THITE_2121694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656696.1"
                     /db_xref="GeneID:11522805"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2121694"
                     /translation="MATRSAPPPGLPAKVASVPPNQTLYVTNLPSAKIQKEDLRTALY
                     MLFSTYGSVLDVVALKTMKMRGQAHIVYKDIQTATQAMRSLDGFEFLGRPMKISYAKS
                     KSNIIAKLDGTFKIPAASSAARVEVTDLQQSIFNAPVPGSSTTGAPPAAPGLPSKPPG
                     GADHAAADAGTPESRGVKRPREEEEPEEESDQDVAMEEESDEE"
     gene            2033463..2053780
                     /locus_tag="THITE_2171303"
                     /db_xref="GeneID:11522806"
     mRNA            join(2033463..2033751,2033826..2034653,2034703..2034942,
                     2053758..2053780)
                     /locus_tag="THITE_2171303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656649.1"
                     /db_xref="GeneID:11522806"
     CDS             join(2033529..2033751,2033826..2034653,2034703..2034743)
                     /locus_tag="THITE_2171303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656697.1"
                     /db_xref="GeneID:11522806"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2171303"
                     /translation="MAAPEVHHLFHNPIADHSFSADRKTLAIARDTTVELYGRVGNAF
                     KLKDELKGHDKTVTSVDIAPNSGRIVSCSQDRNALVWEPTPQGYKPTLVLLRINRAAT
                     FVRWSPSETKFAVGSGDRLIAVCYFEQENDWWVSKHLKKPIRSTVTTVGWHPNSVLLA
                     AGSTDAHARVFSSFIKGVDARPEPTAWGERLPFNTVCGEYMNNSAGWIHSVAFSPSGD
                     ALAYAAHDSSITVVYPSAPEQPPKAVISINTQLLPFMSLIWNGESEIIAAGHDCEAFR
                     FRGGINGWQLTGALEAKGRPGLGDQREESALNMFRQMDLKGKVKDDTQLKTVHQNTIT
                     MIRPYETSGASVRKFSSSGVDGRVVIWTL"
     gene            complement(<2055634..>2056349)
                     /locus_tag="THITE_2131842"
                     /db_xref="GeneID:11522807"
     mRNA            complement(join(<2055634..2056088,2056184..>2056349))
                     /locus_tag="THITE_2131842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656650.1"
                     /db_xref="GeneID:11522807"
     CDS             complement(join(2055634..2056088,2056184..2056349))
                     /locus_tag="THITE_2131842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656698.1"
                     /db_xref="GeneID:11522807"
                     /db_xref="JGIDB:Thite2_2131842"
                     /translation="MCSPSWTRVGPERRKPVTWHAFVARGTYATAFQRGDYRKHFADD
                     VLIVEKHGRICQHIKSKRNLVLLVVSARMNFHNFAGPAVVRNLAKENPELVTQVVVVL
                     TRPDQALSVRESKDLLSARLKLADLYINRWHVHEDSQPRTASLRTPGAEGQAVERPFR
                     QQPRVAERGAPPIGHWRPQSNPSRCLRRHMQNALHDLISEDEARIG"
     gene            2056971..2058275
                     /locus_tag="THITE_2171307"
                     /db_xref="GeneID:11522808"
     mRNA            2056971..2058275
                     /locus_tag="THITE_2171307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656651.1"
                     /db_xref="GeneID:11522808"
     CDS             2057043..2057384
                     /locus_tag="THITE_2171307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656699.1"
                     /db_xref="GeneID:11522808"
                     /db_xref="JGIDB:Thite2_2171307"
                     /translation="MTEFRDPKSNQNTRWRRKRQAENKLAVSSLTATARIEDATPMEV
                     GGVSSYPRRRRRKRGRCPAEVKETDPNNDRIWNSWTGRHCAESFPSRNALFQLRHLKA
                     QCPRKHPWSEG"
     gene            <2072233..>2073695
                     /locus_tag="THITE_122814"
                     /db_xref="GeneID:11522809"
     mRNA            join(<2072233..2072262,2072307..2072465,2072539..2072608,
                     2072684..2073624,2073660..>2073695)
                     /locus_tag="THITE_122814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656652.1"
                     /db_xref="GeneID:11522809"
     CDS             join(2072233..2072262,2072307..2072465,2072539..2072608,
                     2072684..2073624,2073660..2073695)
                     /locus_tag="THITE_122814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656700.1"
                     /db_xref="GeneID:11522809"
                     /db_xref="InterPro:IPR007312"
                     /db_xref="JGIDB:Thite2_122814"
                     /translation="MKNLFLGAGVPLTTRPPESTIEPSLSSIYAAQATAVPLSPVSNV
                     AGKAFDRIIQIWLENTDYNASAADSNMQWIASQGILLTNYFAVTHPSEPNYAAAVGGD
                     TFGMDNDDFNSFPANISTVVDLLDTKGISWGAYQEDIPYAGFQGFNFSNQKTFANDYV
                     RKHNPLALYQSITNNATRRAQIKSFVNLTSDIEAKKLPQWSFVTPNMTNDGHDTNITF
                     AAAWARAFLEPLLKNDYVMNKTLLILSFDENEDYPTPNRVYTVLLGGAIDSSLRGTTD
                     DTFYNHYSIISTVSANWDLPSLGRWDCGANVLALVANKTGYRNADVPLDGLYFNASYP
                     GPVSDALFTPGWWPAPNTLAKCASGRGVLQSVVDTWGKQSGTFNYTNVYPYDAVSGVA
                     TGGTLVTGRLWLRLRLRLR"
     gene            <2074967..>2077387
                     /locus_tag="THITE_2091867"
                     /db_xref="GeneID:11522515"
     mRNA            join(<2074967..2075345,2075428..2075905,2075964..2076045,
                     2076127..2076254,2076323..2076938,2077076..>2077387)
                     /locus_tag="THITE_2091867"
                     /product="multicopper like protein"
                     /transcript_id="XM_003656653.1"
                     /db_xref="GeneID:11522515"
     CDS             join(2074967..2075345,2075428..2075905,2075964..2076045,
                     2076127..2076254,2076323..2076938,2077076..2077387)
                     /locus_tag="THITE_2091867"
                     /note="Extracellular Laccase - like Multicopper - like
                     protein"
                     /codon_start=1
                     /product="multicopper like protein"
                     /protein_id="XP_003656701.1"
                     /db_xref="GeneID:11522515"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="JGIDB:Thite2_2091867"
                     /translation="MSDPQLSPPKEGATAAATAAAKSTSRRPSLLLIVGGLVTFVVVA
                     LALGLGLGLGLTHRGGSSASSLLPPASSSSPLPGSGAAPNASLEDWRLDPSHYVLDMA
                     WDINAPPTTRHYDFVITEGRGWPDGVVRDMLFINGKFPGPLIEANMGDRLVINVTNKL
                     TANATTIHWHGLYQNGTNWFDGTTGITQCGIPPGQSLVYNFTLEQFGTYWYHSHYSTQ
                     YLDGILGPLIIHAPAEADARKLYDSDRVVLIQDWYHDVSQVNLETYLAPDNENTEPIP
                     DNGLINGIGYFNCSSYDADSGYTCYDNSTYSVLSLEPNTRTRLRFINTGAFTEFDVSV
                     DNHTLSVIEADATLVKPVTVHRFPIHVAQRYSVVVETNQSTSTNYWLRGAMITSCFTG
                     NNPVLDTTTKAVISYSGNSTVVPSEDASVDWTDAIPIHCIDLDASTLVPTIPDPPPAA
                     TKMWRLDFSFGIGAYQLDRAKFNGTSWSVLDNTTTLIQAVDGLAAGQAQGSSSSSSSS
                     SASKWAVDGPVSAFGSNQFVVGLSANGSIDVVDILLYSLDEGSHPFHLHGHTFWILQT
                     GAGPFNWTAYQTTLYPSGGAASPLTANALRRDTFTLQPYSWTLLRFVADNAGLWAFHC
                     HIAWHLEAGLMMQFLSRPDVLARTAVPDDVRGLCTAAGGK"
     gene            complement(2077627..2079256)
                     /locus_tag="THITE_2121711"
                     /db_xref="GeneID:11522516"
     mRNA            complement(join(2077627..2078109,2078481..2078604,
                     2078857..2079256))
                     /locus_tag="THITE_2121711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656654.1"
                     /db_xref="GeneID:11522516"
     CDS             complement(join(2078050..2078109,2078481..2078604,
                     2078857..2079020))
                     /locus_tag="THITE_2121711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656702.1"
                     /db_xref="GeneID:11522516"
                     /db_xref="InterPro:IPR015301"
                     /db_xref="JGIDB:Thite2_2121711"
                     /translation="MTRGDVNHIKVHYKGDDEDFVVFLDSVDDYRRWCEDKSVPLAQV
                     VSSFKVFTTHRHGAQGLLEGASKAMLENEFGTSKEDEAVRKILERGSLQEFEMSERQG
                     RKNDSNGSYLNTR"
     gene            complement(2080304..2082862)
                     /locus_tag="THITE_2121715"
                     /db_xref="GeneID:11522517"
     mRNA            complement(join(2080304..2081315,2081369..2081602,
                     2081660..2081891,2081948..2082166,2082223..2082423,
                     2082493..2082862))
                     /locus_tag="THITE_2121715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656655.1"
                     /db_xref="GeneID:11522517"
     CDS             complement(join(2080345..2081315,2081369..2081602,
                     2081660..2081891,2081948..2082166,2082223..2082423,
                     2082493..2082852))
                     /locus_tag="THITE_2121715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003656703.1"
                     /db_xref="GeneID:11522517"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="JGIDB:Thite2_2121715"
                     /translation="MILWEFVLTGIQVYVTILAFLPSSPASLRSSVNRNLADIVELHE
                     EILRELHRIVPRSEYTQAVLPAQRSRSNPPRGGHHRWRSLDAVPEGRDRVSSMPGVSR
                     MAIEPQGAAEVAKIFLKRVNRFFIYEEYGAKYELMIKDVAAAHRMMPGWPSYQKGLEI
                     LASSLASADNSRDEGRKSLTIGDLLVKPIQRVCKYPLLFSELLKHTPVIDCPHAHMDI
                     ETTLVRLREATAEINRATNDSRTKSVLEKTWILQDRLAFPYQLDAASKNRIRSFGHIR
                     LCGALHVCWQTKEGVDGQYMIALLYREWLCLATAGRVGQIYTIRACIAVANISLEDVD
                     NGRGLQCHTAPHSWKIVFLCDHQLYELVLTACSAKEELEWCTRLRTGQQAADPDGQEQ
                     MQSDIFSFLSLNIKSLGTVFRKPGTIARRMSIHRATTLGPKSPLCQVILKNTSAVKDP
                     PAPGYGSRINRSQSLLTTNSRIPVLAPSRDERARLEALLSDVWTRDVLPFPGITARSR
                     SDHLVRTSASSMMRKFSGSITNGFNRRSASLASLQLKEKVGLGLDGEATSPSERRRTA
                     SIGTLYPQHAQERSAPLADPAERRASSPPRPRRAPVTLESDRSRTVRRRDTYASCITL
                     DGRAVDGKGDDGDDGDGGKGGDCDDDASPLRSPSASIMLRKSSGNSPSRASFQRSARS
                     EMAPSSVLDERCRPLGEPRGRNQARPSHSHKLSDRLAKARAKHREVVVQGIRSWFR"
     gene            2084741..2086037
                     /locus_tag="THITE_2121720"
                     /db_xref="GeneID:11522518"
     mRNA            join(2084741..2085112,2085178..2085250,2085304..2085647,
                     2085710..2086037)
                     /locus_tag="THITE_2121720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003656656.1"
                     /db_xref="GeneI