GenomeNet

Database: RefSeq
Entry: NC_016472
LinkDB: NC_016472
Original site: NC_016472 
LOCUS       NC_016472           10931058 bp    DNA     linear   CON 27-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 1, complete
            sequence.
ACCESSION   NC_016472
VERSION     NC_016472.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 10931058)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 10931058)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 10931058)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 10931058)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003002.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10931058
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="1"
     gene            <1381..>2142
                     /locus_tag="MYCTH_2114025"
                     /db_xref="GeneID:11512903"
     mRNA            <1381..>2142
                     /locus_tag="MYCTH_2114025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658266.1"
                     /db_xref="GeneID:11512903"
     CDS             1381..2142
                     /locus_tag="MYCTH_2114025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658314.1"
                     /db_xref="GeneID:11512903"
                     /db_xref="JGIDB:Spoth2_2114025"
                     /translation="MDRLKDILLYIWNFRYLPLKYRWSLIKWRRRLLPTRSGLGLRNA
                     LRNARSLKNPPVPHPYLFVLRLLWPFPTWYYPAVLPPPPREIMANPRRVSCQARDLIY
                     LRSMPLWRARDTPQRSFYRLYEALCAADEHMITYETEYFWRQSSPRWATANIPDPQCE
                     DLEQYAVMASLAEVLVKSFMWRLELGLRRHDTAIMNRNVDPPPFVPEVCPSWTAKVPP
                     LTEKLAIDPEEADRYFDSPFHHRNIYTATGSFYTV"
     gene            complement(2744..3343)
                     /locus_tag="MYCTH_2293935"
                     /db_xref="GeneID:11506009"
     mRNA            complement(2744..3343)
                     /locus_tag="MYCTH_2293935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658267.1"
                     /db_xref="GeneID:11506009"
     CDS             complement(2777..2935)
                     /locus_tag="MYCTH_2293935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658315.1"
                     /db_xref="GeneID:11506009"
                     /db_xref="JGIDB:Spoth2_2293935"
                     /translation="MAMTRQSPSQRLVAPIRLISIGGALAVRVCHNREASYDIDCMLD
                     PNIAASSE"
     gene            complement(3344..3817)
                     /locus_tag="MYCTH_2293936"
                     /db_xref="GeneID:11508241"
     mRNA            complement(3344..3817)
                     /locus_tag="MYCTH_2293936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658268.1"
                     /db_xref="GeneID:11508241"
     CDS             complement(3493..3732)
                     /locus_tag="MYCTH_2293936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658316.1"
                     /db_xref="GeneID:11508241"
                     /db_xref="JGIDB:Spoth2_2293936"
                     /translation="MDKVTKLLASNPSTTAYVAGVAVLVLAPQIVAVPALGAIGFGAK
                     GVAAGSCSPSVDFRVSALVGNRLGDELALLTYVPL"
     gene            complement(<5330..>6385)
                     /locus_tag="MYCTH_2051335"
                     /db_xref="GeneID:11513239"
     mRNA            complement(<5330..>6385)
                     /locus_tag="MYCTH_2051335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658269.1"
                     /db_xref="GeneID:11513239"
     CDS             complement(5330..6385)
                     /locus_tag="MYCTH_2051335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658317.1"
                     /db_xref="GeneID:11513239"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2051335"
                     /translation="MAAFLPRGYRSVTEYRFREDQTDAIVRAAAYHRKDYCRSVIWFS
                     PREHVGIRPSIATPFPRTPDTGLGSLCRLPLELLHDVLLHLDIRSLFNFRQVNLSSRQ
                     TVDSLHQYQMVVSHGLNLLCALLRTRLAIGISLLDFYHALCTKACTLCGEFGGFVSLL
                     TWTRCCFACLQGALETQVQTLAGIRKQFHLTKAELGRLRSFKTLPGIYSMEESVHKSR
                     ITVVSVHQAKLVSGQQPHAAAAQAQPANWGRNRKFNFMGACALPYYDRRTGRVEYEMS
                     CAGCQLALEKDIIGSRGEKWAFEARDKVYAQDSFLEHFRWCEQAQILWRSSAEGKSQP
                     AELPEAARRGGFFNNRE"
     gene            <15458..>25533
                     /locus_tag="MYCTH_2121898"
                     /db_xref="GeneID:11511624"
     mRNA            join(<15458..15467,25325..>25533)
                     /locus_tag="MYCTH_2121898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658270.1"
                     /db_xref="GeneID:11511624"
     CDS             join(15458..15467,25325..25533)
                     /locus_tag="MYCTH_2121898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658318.1"
                     /db_xref="GeneID:11511624"
                     /db_xref="JGIDB:Spoth2_2121898"
                     /translation="MSIGTLSPASYTRSSASTRPAPVPINFGRSYTRRSSSPVERIAR
                     LVRDRDDPTFAAVTIILEGEDKEEEVVE"
     gene            41983..44418
                     /locus_tag="MYCTH_2293939"
                     /db_xref="GeneID:11508148"
     mRNA            join(41983..42441,42519..43214,43283..43734,43828..44418)
                     /locus_tag="MYCTH_2293939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658271.1"
                     /db_xref="GeneID:11508148"
     CDS             join(42080..42441,42519..43214,43283..43734,43828..44195)
                     /locus_tag="MYCTH_2293939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658319.1"
                     /db_xref="GeneID:11508148"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2293939"
                     /translation="MKSTVASATALLLALSGSPGAAKPVVDTAYPYTGPDVPVGDWVN
                     PTVKGYGKGFPRLIEPPAVKPASANPSNNINVISLSYLPGGINIHFQTPFGLGEAPSV
                     LWGTRPDRLYRRATGTSHTYDRTPPCSAAAVTQCSQFFHEVQLRHLRPGTRYYYQIQA
                     ANGTTESGVLSFDTARAAGDPTPYSMAVLADMGYTNAGGTYKQVLRTVDDDDVAFVWH
                     GGDLSYADDWFSGILPCADDWPVCYNGTSTHLPGAGPVPDEYKTPLPAGEIPNQGGPL
                     GGDMSVLYESNWDLWQQWMNKITKRVPYMVMPGNHEASCAEFDGPGNVLTAYLNHNKA
                     NATAPRTNLTYYSCPESQRNFTAFQHRFHMPGAETGGVGNFWYSFDYGLVHFIALDGE
                     TDYANSPQKPFARDLKPGETHPTPGETSVTDSGPFGTVKGSYDDNKAYQQYKWLAADL
                     AKVDRRKTPWIIAMSHRPMYSSEVSSYQPRIRAAFEDLLLQHGVDVYLAGHIHWYERL
                     WPMGRNGTIDRKAIVDDHTYMTNPGKSMTHLINGMAGNIESHSTLSEDEILDITAVVD
                     QENYGFNKLTVHNATALTWTFVRGDGGIGDELTLIKKKPGRRGGGDSKHRYGGPGVLF
                     Q"
     gene            45523..47562
                     /locus_tag="MYCTH_2293942"
                     /db_xref="GeneID:11508881"
     mRNA            45523..47562
                     /locus_tag="MYCTH_2293942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658272.1"
                     /db_xref="GeneID:11508881"
     CDS             45970..47508
                     /locus_tag="MYCTH_2293942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658320.1"
                     /db_xref="GeneID:11508881"
                     /db_xref="JGIDB:Spoth2_2293942"
                     /translation="MPSTSSSETAYTTDDSPRSSKTPHTRSSSSASDISYVKEKKPSH
                     SHSPSSASAASDTSVTPLVRDKEKRESYSSVWSDLEAQRGEIDDFSRKRFGFLRYTIL
                     TVYRRLFSLAFIGNAIAFVVLMIKGAAPLDLVNASAVNLAVCGLCRHPLVINALFLTF
                     GAVPRSAPMRLRRLACKIFHLGGVHSGTGVASCVWYIGFAATYTYHFEASPASVAVLV
                     LIWLVLLLLLAIIAVAHPAFRVRHHDWFELTHRFSNWAILALFWVLLFLLANQEPSVS
                     AFLVNLPAFWILILLTAATIHPWLLLRRVPVRAEPLSAHAVRLHFSHAAVRFGQGISV
                     ARHPLADWHSFASFTDQFDTPDTKFSCLVSKAGDWTRQAIADPPTYLWKRGVPTYGFG
                     YVFRMFDRIIVVTTGSGIGPCLSFIEDAHRPAMRVVWQTKSPLKTYGQRTLDLVARMD
                     PDPVVIDTSISGRVDMLPIVLKLYKDFDAQAVCVISNPAMTRSLVYGLETRGIAAYGP
                     IFDS"
     gene            48040..49183
                     /locus_tag="MYCTH_61543"
                     /db_xref="GeneID:11511623"
     mRNA            48040..49183
                     /locus_tag="MYCTH_61543"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658273.1"
                     /db_xref="GeneID:11511623"
     CDS             48156..49091
                     /locus_tag="MYCTH_61543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658321.1"
                     /db_xref="GeneID:11511623"
                     /db_xref="JGIDB:Spoth2_61543"
                     /translation="MTTTGEFRYLDPESISPGTKPWSKVDSAATSFRLASRRRSVANI
                     RDSLRPDQPLRGNFGTDIDVSGFAVYHAPAREKTFTDDAAVRGGYYAEVEALLRAKLP
                     GKVARVEIFDHTIRKHDPASPRQPVQQVHVDQTPAAAEARVRRHLPAAEVDGLLARRF
                     QIINVWRPISHPAADFPLAVVDWRTTKRDDLVPVDLLYPLRNRTIGDANDDRGKEVLP
                     DPATAAGTDGYEVRGETYGVLPSDSHKFYYVKDLTPDEALFIKCFDSWGEGLPGGKKG
                     VAALTPHTAFIDPATPPGTKGRESIEVRCLVFYDE"
     gene            49990..51979
                     /locus_tag="MYCTH_2293944"
                     /db_xref="GeneID:11505784"
     mRNA            49990..51979
                     /locus_tag="MYCTH_2293944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658274.1"
                     /db_xref="GeneID:11505784"
     CDS             50749..51702
                     /locus_tag="MYCTH_2293944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658322.1"
                     /db_xref="GeneID:11505784"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="JGIDB:Spoth2_2293944"
                     /translation="MALQSLLLRSCHSPARLALEGYPLAASATCRTTTPPRDPSCPKR
                     AAVVLDCEMAGTTDGDHAITLSLVDFFTGAALVHALVKPASGIKITNWRTNITGVTPG
                     AMAVAVARGEALRGRDAATARLLDFVDADTVVVGHSVKYDLKVLGLAHNRIVDSAILA
                     AEASGRFGSGEDGNSGGGQKAIKQGVALERLCRELTGVRIRGGGGVAAGPGGRSQHDS
                     LEDVLATREVVIWCLTHPVELRAWAAKNWEVQDGAKGNKGGAKGSKGDRDRTTKHRPE
                     SVEDDFEWDEDDDDDDDGEMLRWEDVIDYDTWPKSPPDWSD"
     gene            <52694..>53820
                     /locus_tag="MYCTH_98562"
                     /db_xref="GeneID:11508884"
     mRNA            join(<52694..52886,52940..>53820)
                     /locus_tag="MYCTH_98562"
                     /product="D-isomer-specific 2-hydroxyacid
                     dehydrogenase-like protein"
                     /transcript_id="XM_003658275.1"
                     /db_xref="GeneID:11508884"
     CDS             join(52694..52886,52940..53820)
                     /locus_tag="MYCTH_98562"
                     /note="D-isomer specific 2-hydroxyacid dehydrogenase-like
                     protein"
                     /codon_start=1
                     /product="D-isomer-specific 2-hydroxyacid
                     dehydrogenase-like protein"
                     /protein_id="XP_003658323.1"
                     /db_xref="GeneID:11508884"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Spoth2_98562"
                     /translation="MSSPIKVAVLDDYQGISEPKFRALDPAKFEVSFFKDTLRPYNHP
                     DTPQEVKDELVARLEPFTVISTMRERTPFTAELIARLPNLKLLLTTGNRNRGLDLDAF
                     QARGIPVAGAVDRNSSVGSESTTEHCVAMILAAARNIAQDDLSVKTGGWQTVPAVALG
                     GKVFGTVGLGRLGTAVGRIMHLAFGMRVVAWSENLTQERADEKAREAGLPVEDARGEK
                     TFKVVSKEELFRTADVVSLQLVLSDRSRGCITAKDLELMKPTAIFVNTSRGPLVVEKD
                     LLEVLEQGKIRAAALDVFDLEPLPLDSRWRTTKWGEDGRSRVLLTPHMGYVEEATLNG
                     WYDMQVENLLRWEKGEELLLRLC"
     gene            <54699..>55825
                     /locus_tag="MYCTH_2105956"
                     /db_xref="GeneID:11505741"
     mRNA            join(<54699..54761,54996..55685,55741..55756,
                     55794..>55825)
                     /locus_tag="MYCTH_2105956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658276.1"
                     /db_xref="GeneID:11505741"
     CDS             join(54699..54761,54996..55685,55741..55756,55794..55825)
                     /locus_tag="MYCTH_2105956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658324.1"
                     /db_xref="GeneID:11505741"
                     /db_xref="JGIDB:Spoth2_2105956"
                     /translation="MRCYHTHAASSPNQNNDRLSQIRRFNPVWLIRRSANGRVMCDVK
                     LHNHVVEADSDFDHTQAAKIAVAKKALSVVQSWPVGCFPPPPSQQTSEPPRSANAPPP
                     RTVGTGGSRAVHGRGRSLLALNQEGGSQTMAPGLGRSAATATELDRGRRENTMTAARG
                     DRGREQVELLEHVRRVMGISVPDTTRDNPEAARAFLEGLAVGARLAGARVSGFSLKSR
                     SRSPLRSSPEAYRARSPLGRSGRLSPPPGHRRRVAAGTVSLRRQSNGG"
     gene            complement(55858..57004)
                     /locus_tag="MYCTH_2293947"
                     /db_xref="GeneID:11505791"
     mRNA            complement(join(55858..56790,56856..57004))
                     /locus_tag="MYCTH_2293947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658277.1"
                     /db_xref="GeneID:11505791"
     CDS             complement(join(56037..56790,56856..56893))
                     /locus_tag="MYCTH_2293947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658325.1"
                     /db_xref="GeneID:11505791"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2293947"
                     /translation="MKIQGRTFVVSGGASGLGRACVRDICAAGGNAVILDMNEELGAS
                     LVSELGPSSAKFLPCDVSDTSSIASAVDSAVAWIKETGKPLGGIIPAAGVGNPGLILD
                     KKLRPVSLESVDFVLSINLRGTIDLVRQFLPHLAGAPPEGSDGERGVVIMVASAAAFE
                     GQMGQVAYAASKGAVAAMTLPMARDLSRFGIRVVTIAPSMFESNMTAQLSDTVRKGLY
                     KAMEFPLRPGQPEEFSSLVRHSIENIMLNGVVIRLDGATRMPSKL"
     gene            57236..58755
                     /locus_tag="MYCTH_2293949"
                     /db_xref="GeneID:11505592"
     mRNA            join(57236..57716,57766..57895,57983..58755)
                     /locus_tag="MYCTH_2293949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658278.1"
                     /db_xref="GeneID:11505592"
     CDS             join(57565..57716,57766..57895,57983..58723)
                     /locus_tag="MYCTH_2293949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658326.1"
                     /db_xref="GeneID:11505592"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2293949"
                     /translation="MSGYELPGMTRPRGSSAASEDSTGTVREQELGSMYDYLAKVILL
                     GPSGTGKSCLLHRFVKNEWRVLSSQTIGVEFASKIIKVGTGARRKRIKLQLWDTAGTE
                     RFRSVSRSYYRGAAGAILVYDITSRASFQGLQPFLNDARALASPNLSLLLVGNKLDLA
                     GDPLVDTGVPPPTPGGSVSSASYASTPVPSSYSSTSTSTIHPGLGAQLKATVAPDGRE
                     VSAVEASRWASTVQIPVAMEVSAFSGEGVDEVFGRLARMILTKIELGEIDPDDPMSGI
                     QYGDAGALWNAGASDGGSIKSTITADDVGVGGRRRRRGRRTGQGLREWEEVFTLTGRR
                     RNRGCC"
     gene            <60083..>62739
                     /locus_tag="MYCTH_90655"
                     /db_xref="GeneID:11512995"
     mRNA            join(<60083..60589,60679..>62739)
                     /locus_tag="MYCTH_90655"
                     /product="glycoside hydrolase family 2 protein"
                     /transcript_id="XM_003658279.1"
                     /db_xref="GeneID:11512995"
     CDS             join(60083..60589,60679..62739)
                     /locus_tag="MYCTH_90655"
                     /note="CAZy_ID 267799"
                     /codon_start=1
                     /product="glycoside hydrolase family 2 protein"
                     /protein_id="XP_003658327.1"
                     /db_xref="GeneID:11512995"
                     /db_xref="InterPro:IPR006102"
                     /db_xref="InterPro:IPR006104"
                     /db_xref="JGIDB:Spoth2_90655"
                     /translation="MAPRVVIPLDQNWEFRQADKPDSKFLPVSHFPTNVHLDLQHHGL
                     IPDPFIGKNELLVQWVGEAQWTYRTVFAAPPVPEGARAVIAFDGLDTFATVVLNGTTI
                     LESDNMFLPHRVEVTSVLKAEGNELVITFDSAYLRGCKLVEQHPNHKWGCWNGDVSRL
                     AVRKAQYHWGWDWGPTLLTCGPWRPVHLEIYESRLSDLYAETVVDKSLKRASVKVTAV
                     AERRADRVRFDIALDGQQVATETAELDATSGEATVSFLIDSPALWYPVRYGKQPLYDI
                     RATLLAGDDEVDTLSKRIGLRRAELIQRPLEGQPGTSFFFEVNNIRIYCGGSDWIPAD
                     NFIPRISRRRYYDWVRLVAEGNQFMIRVWGGGIYEEQAFYDACDELGILVWQDFMFGC
                     GNYPAWPALLESIRREATENVKRLRHHPSIVIWAGNNEDYQYQESEGLTYDYANKDAE
                     SWLKTDFPARYIYEKILADVCADLVPSTPYHPGSPWGAGLNTHDATVGDIHQWNVWHG
                     TQEKWQNLDRLVGRFVSEFGMQAFPAVKTIDAYLPLGRDDPDRYPQSSTVDFHNKAEG
                     HERRIALYLVENLRYAPDPLEHFVYCTQLMQGECLASAYRLWKREWRGPGREYCGGAL
                     VWQTNDCWPVTSWSIVDYYLRPKLAYFTVKREMAPVSIGITRRTHLHPRDRHTRVNVD
                     VKTQIEVWASNLTLEDLTVDCVLKAWDVESGEETFSETVAAALLLRENRSTEIAALDV
                     PVRQKNVGEEGRIVVAAYLVDKEGRQMARYVNWPEPLKYVHLQKPRALRAQLTADYSA
                     VEVSAEVPVKGVALECEDDGVRFDDNLVDIVPGEVVTIGVSGAGKDTKIETRYLDMI"
     gene            complement(62980..64579)
                     /locus_tag="MYCTH_2293953"
                     /db_xref="GeneID:11513405"
     mRNA            complement(join(62980..64255,64328..64579))
                     /locus_tag="MYCTH_2293953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658280.1"
                     /db_xref="GeneID:11513405"
     CDS             complement(join(63125..64255,64328..64339))
                     /locus_tag="MYCTH_2293953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658328.1"
                     /db_xref="GeneID:11513405"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2293953"
                     /translation="MASSNLSFVLNKPNDVSFEERPVPKLQNPHDVLVAVNYTGICGS
                     DVHYWQHGAIGHFVVKDPMVLGHESAGTVVEVGSAVKTLKKGDRIALEPGYPCRRCPA
                     CLSGHYNLCPDMVFAATPPYDGTLTGFWVAPVDFCYKLPDNVSTQEGALIEPLAVAVH
                     IVKQARVQPGQSVVVMGAGPVGLLCAAVARSFGATKVVSVDIVQSKLDFARSYAATHT
                     YASQRVSPEENARKLLAVADLPDGADAVIDASGAEPSIQTSLHVVRMGGTYVQGGMGK
                     SDITFPIMALCLKEVTARGSFRYGSGDYKLAIDLVASGKVDVKALINGVVPFRDAEQA
                     FKKVKEGQVIKILIAGPNEKVDKAIDTTVDENKLKAAPVTGSTGCC"
     gene            complement(66366..66475)
                     /locus_tag="MYCTH_t53"
                     /db_xref="GeneID:11507972"
     tRNA            complement(66366..66475)
                     /locus_tag="MYCTH_t53"
                     /product="tRNA-Leu"
                     /note="Anticodon: CAG"
                     /anticodon=(pos:complement(66439..66441),aa:Leu,seq:cag)
                     /db_xref="GeneID:11507972"
     gene            66644..68746
                     /locus_tag="MYCTH_2293954"
                     /db_xref="GeneID:11513328"
     mRNA            join(66644..66939,67039..68236,68380..68746)
                     /locus_tag="MYCTH_2293954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658281.1"
                     /db_xref="GeneID:11513328"
     CDS             join(66856..66939,67039..68236,68380..68624)
                     /locus_tag="MYCTH_2293954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658329.1"
                     /db_xref="GeneID:11513328"
                     /db_xref="JGIDB:Spoth2_2293954"
                     /translation="MATTTPSPTRSATTRTTRTTRTTTRTYNDAIDALNSLQTPYAAI
                     EARRRAGIRPDATSVREMRAYLARIGYTPRDLDRLNIVHVAGTKGKGSTCAFVDSVLS
                     RYQRRGGSPRRVGLFTSPHLIAVRERIRINSAPISEELFAKYFFDVWDRLEANADVAA
                     DDAAPGSKPIYARYLTLMSFHVFLSEGVDAAVYETGIGGEYDATNVVEHPVASGISTL
                     GIDHVFVLGDTVDKIAWHKAGIMKPGSPAFTVEQVPRAAEVLKARAAEKGVGLRVLDI
                     DPRLAAVKIRPDATFQKKNATLAVALAETALRRLDPSFSPDPDALPREFVDGLEQVVW
                     RGRCEVKVEDHVIWHVDGAHTVDSLKMAARWFVGECAGRAGGGPRVLIFNQQGRAEAV
                     DFLDGLCNTVKDTGRGFEHVIFCTNVTYAATGYKRDFVNHQHNPADIEKMTQQRVFAD
                     RWKKLDPSANVMLIPTIEEAINAARGLASGEHKVQALITGSLHLVGGALGILESADAL
                     "
     gene            complement(<68869..>70596)
                     /locus_tag="MYCTH_2049934"
                     /db_xref="GeneID:11508746"
     mRNA            complement(join(<68869..69822,70156..>70596))
                     /locus_tag="MYCTH_2049934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658282.1"
                     /db_xref="GeneID:11508746"
     CDS             complement(join(68869..69822,70156..70596))
                     /locus_tag="MYCTH_2049934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658330.1"
                     /db_xref="GeneID:11508746"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="JGIDB:Spoth2_2049934"
                     /translation="MAAPSVPDDAYATALSRLAQLQSNRAVTSLFDPAPATAAASAGG
                     AGGGGGGGGGKPADLNALAIPEMLAWLGRAGYTPASLAALPVRFVHVAGTKGKGSVSA
                     LIASVLAQYPGAGRVGLYTSPHVLSVRERIVLDGAPIAPDRFARYGVTATVVTQLGID
                     HVGMLGDTVNKIAWHKSGIFKEGVKAFTRRLPEAQEHQRGVMEVLRRRAREKGAVLVE
                     VPDEEVERWGGVDGARLQGPFQKYNMALAVHAAREHLLRVGVRFEGRFGTDEWLLGDM
                     PPEFVRGLREAALRGRCEVLRDAQQGTIIEWHVDGAHTDDSLAGVGRWFADRAGGDDN
                     DGGGGGSVRVLLFNQQERDPAPLLRALLSGAQSGGRTAFDHAIFTRNEEEEPADGEER
                     DLSTQIRAQETMQEAADGTTTTTVHNAVRPAVEQIRHIAAQAREQGKPCRVLVTGSFH
                     LAGAVLKIIDHAEY"
     gene            complement(70923..73543)
                     /locus_tag="MYCTH_2293957"
                     /db_xref="GeneID:11505520"
     mRNA            complement(join(70923..71278,71371..73257,73356..73543))
                     /locus_tag="MYCTH_2293957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658283.1"
                     /db_xref="GeneID:11505520"
     CDS             complement(join(71234..71278,71371..73257,73356..73475))
                     /locus_tag="MYCTH_2293957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658331.1"
                     /db_xref="GeneID:11505520"
                     /db_xref="JGIDB:Spoth2_2293957"
                     /translation="MLRTSLRSVRALGTRPAAAAAGRQWQVAAARRAVVSGQVQNRFY
                     ADNSKRPDEVKIPASETLTAPSTPAPAPAPPAVEKAPPKPPAPGPAATPATATKTPPP
                     PPPPPTTTMPPPPVPPRKKGFFRRLRNFVLTLTLLSALGFAGGVWYARINDNFHDFFT
                     EYIPYGEQAVLYFEEMDFKKRFPNVAGRVTGRRPEGEQVKIPAQSGASWRVADGRETG
                     GRQSSAVQKVEAAKEPSRKAEPAVVAQAKQETAKQPSAETTTKAAEEKPVPVPTPAPG
                     PTPAPAPEPAAIDPAPAKQSFKAPEVDEPSRWPPASPIDPLAVPDAAEPVVQAMVRML
                     NDIITVINHDGASEKYGATIGKAKGEISKLGQKVRDLRAAVEKEAAQQVKERVDGFDK
                     AANELVSRLEAAMAAQEQQFRREFEAEMERLRKSYDSKVQLIQERERQLAEEKLNNRL
                     LEQAIQLQRQFASDIKRHVEEEREGRLGKLEELKAAVADLERLTAGWNEVVDSNLRTQ
                     QLHVAVEAVRASLEDARHPRPFVKELIALKEIAAQDPVIDAAIASIHPSAYQRGVSTP
                     AELIDRFRRVAAEVRKASLLPEDAGVASHASSYVLSKVLFKKQGLAAGDDVESILTRT
                     QTFLEEGDLDNAAREMNGLTGWSKTLSRDWLAEVRKVLEVRQALDVIQTEARLQSLKA
                     E"
     gene            complement(74188..75379)
                     /locus_tag="MYCTH_2293959"
                     /db_xref="GeneID:11505781"
     mRNA            complement(join(74188..74600,74670..74861,74914..74960,
                     75014..75379))
                     /locus_tag="MYCTH_2293959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658284.1"
                     /db_xref="GeneID:11505781"
     CDS             complement(join(74253..74600,74670..74861,74914..74960,
                     75014..75086))
                     /locus_tag="MYCTH_2293959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658332.1"
                     /db_xref="GeneID:11505781"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2293959"
                     /translation="MATRGPPGARGMSNRFAQFKLVLLGESAVGKSSIVLRFVKDQFD
                     SYRESTIGAAFLTQTISLDENTTVKFEIWDTAGQERYKSLAPMYYRNANCAVVVYDIT
                     QATSLDKAKSWVKELQRQANENIIIALAGNKLDLVTEQPDKRAIETADAEAYAREAGL
                     LFFETSAKTAENVQELFTAIAKKLPLDQVGPRHARPGQRPGVSLAPEGANTQVGGPCA
                     C"
     gene            75651..78578
                     /locus_tag="MYCTH_2293961"
                     /db_xref="GeneID:11505841"
     mRNA            join(75651..76136,76222..77972,78104..78578)
                     /locus_tag="MYCTH_2293961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658285.1"
                     /db_xref="GeneID:11505841"
     CDS             join(75929..76136,76222..77972,78104..78274)
                     /locus_tag="MYCTH_2293961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658333.1"
                     /db_xref="GeneID:11505841"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="JGIDB:Spoth2_2293961"
                     /translation="MALPFRDINVQTASDSYIFSSPSSPNAPALSIDRPTGDIRLNDA
                     ALLAGKRVTRVTSIAGILGMIQLRLDKYIIVITKAKPVGRLRGQMVYKIVATELLPLR
                     ERQVHDPDEDRFLALLRNFIKSGPMYFSYAVDLTNSFQRQAEHDNSVPLWKRADDRFF
                     WNRFIQSDLINFRNLGSRGQPAPQPGIDPYILPVIFGMLEIHPTTFKGTPLTLALITR
                     RSRHRAGTRYFTRGLDDQGHAANYNETEQILVLNDSAAGLGGGFAGSSSGPGGLQRGG
                     AAGKEMQILSYVQTRGSVPAYWAEVNMLKYTPKLQVRAIEAALPAARAHFEEQIRIYG
                     DNYLVNLVNQKGREMRIKQAYEQVVDMLVSSPQEHAQADRRTEEKFRTIEKGGGGPAR
                     SPFDRLHYIYFDFHAETKGLQMHRAQLLIDRMRDALVAQQYFRAAEAPGSRIDGRLEV
                     RSLQTSVVRSNCMDCLDRTNVVQSMLARWTLDRMLIDLGLLPRGSRFADEDDAFELLF
                     RNMWADNADVVSKAYSGTGAMKTDLTRLGKRTKGGALQDGNVALTRYWKNNFLDGPRQ
                     DAFDLFLGAYQVPAGGIGSAFIFADRRPVWIQSVPYIAAFGFFFVLVALYTPRLPDAA
                     VWPLRLFTIFWAAVALWGVHFILSNGMLYVNWPKLNPRPWATEGYHETINRVRKDRIL
                     GPLVARHERGLSTARYINAEEGKKRIE"
     gene            complement(78900..82989)
                     /locus_tag="MYCTH_2293962"
                     /db_xref="GeneID:11505844"
     mRNA            complement(78900..82989)
                     /locus_tag="MYCTH_2293962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658286.1"
                     /db_xref="GeneID:11505844"
     CDS             complement(78910..82659)
                     /locus_tag="MYCTH_2293962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658334.1"
                     /db_xref="GeneID:11505844"
                     /db_xref="JGIDB:Spoth2_2293962"
                     /translation="MTDGNASPSSNLPPQRPTRHSSSPYREANAPDSSVLTATTSSAA
                     DAETHDQQPPTSTSTSTSANRALVENRLSGTYRAHKHRSSGGFLLADPLNRQGSTRHR
                     DTEKYPAEKRQRISVEQHASAGAQHGQRVPQSTVASSSRQGPAFEAPRPSVPPDEGSG
                     LLTTMTKRNGSLAGNATIESSPQTGMAQLDVESAQIVSMALNLSESRRLASRRNISQP
                     APPRLAPFPDSTPGGSLRYHLQQQRKMSRTASPKPDRSPRIGAGGRFTPLQPAFDPGA
                     GFRYHFSTSTLARAQKAKEYLELMAQYRRLLELVPPLEPRPAARPWSPTPPVSPNNSA
                     PVSRASTNNDPEPKIGRPYNPLQYVRNRKVRARERRTLDGEALGFNDVMKVSEWVDEV
                     AKWVATGQARQPGNPALPPFAGAQTAELQASPPAANARAPTSKPKRPRVDWVIDPADL
                     LADLYWLELDDNKKLVEDRHWRRVFPQGPEPPRPASHDDALRLTTPNSAKGSLDAHAL
                     GERATPDPPSSSTTTRHEHEHVLEAARDRAQQKFRALRGSHHRHTSSFTNRDLLRLRR
                     GSLSESSDTDSDRRRRAKGAPTNAVRSVLEKQMEEMIAREQREAESHPLYDHEARRLR
                     PAASMTPEREPQPPASRDASQRRPADTHPELSETEVSGFGLKPLPLPRSPEQATGRTS
                     LDVPRAGRASADDDYTSQPNSPGLRPSPDIGRVPALGMDLSPMSSRAGSPHRNPLTRV
                     KSIFRDRSKERSTEPPGEDIAATLTTPADSGMGGMPESASAVSGHHQRRPSRSPNGER
                     PLGHRPHKSLGNVKLRGEDGGISLRSLLRGPRIDTVLRSGVSKVSEMLWRKEGDDSSS
                     TSSSDSEAESRGRSRGPRPVRSFSLEQDPKRLLDAPQQLVPDYKLPQRQLQHPPARPI
                     SRRSSRFELLKPPRIDVQQASPSTSPPPVQVRTTHEASVGSAAAAAAAATAAAAAAAA
                     ADSQGGRDGTRAASANLNAALALPHRPVSPSSRQWSITDRSSASGPAAVSRREIARLR
                     ALVLSSGVHAAEMDRRAKARKLLPSPTISRTAAAAAPNHANPAGSSSSLTWTEIANLA
                     PDAATRQRLLTTPLAQADLYPVAARTLAGSVQASTAQLQAATSRFATETGPALTHRVE
                     SLRSKVAEELTDLAQLAIDAADEANHDLVTSQRLKVKMVGDAMDKMLRRRRRRFRWVR
                     RAGWLVVEWVLVGCMWYVWFLVMIVRVALGIGKGVVRGVRWLLWL"
     gene            complement(83562..85486)
                     /locus_tag="MYCTH_2293963"
                     /db_xref="GeneID:11505679"
     mRNA            complement(83562..85486)
                     /locus_tag="MYCTH_2293963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658287.1"
                     /db_xref="GeneID:11505679"
     CDS             complement(83714..85258)
                     /locus_tag="MYCTH_2293963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658335.1"
                     /db_xref="GeneID:11505679"
                     /db_xref="InterPro:IPR005373"
                     /db_xref="JGIDB:Spoth2_2293963"
                     /translation="MSLFSAQLHPGRALGFLVLGASLHDVLTRLKAEPQRFPKLDLTY
                     NPADPVREPVILGLPANGIRMRFDGPEQRLRLVEVIDFTRNHIFLKPANDKERDLVRP
                     PTQDPPAADAAPGPTFRHIYQRFLGPTYDGEYIADAETYVLSYPGVAFAFPMKKKDYS
                     DAKDVVSLLSSTAVPNSMAVFSGDSWAQARDTMWTEVLPSLKTFAPLAKGKDVYPDEI
                     SLVKIHGGGKLQLFRKWTNNSFWILLGETTPQQLVAELGPPDAIYRKNDQRMYIHKLR
                     AASNNTMARPTNGNELRRQDELTDTDQSSHPASDDYDSQDEAVEDDIVANVSGECFYN
                     YFYLGFDVLVSMPTAPSRPPPSQDGSAYAADAAAPKPAATDRLVATKVVLHGNVPGSY
                     PFNRHRRCRWEISYLSPSPDSPATTSETPFPEIEERLRRAWRSIYSSEAEAQQKQRGM
                     VLNRGWGDSPGSSCELLGGWEESGGTNPGVGKGRGEDSTTTLFGFPGLVFEVLKNGWV
                     SAVTVF"
     gene            85819..89977
                     /locus_tag="MYCTH_2293965"
                     /db_xref="GeneID:11508711"
     mRNA            join(85819..86472,86545..88716,88830..89977)
                     /locus_tag="MYCTH_2293965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658288.1"
                     /db_xref="GeneID:11508711"
     CDS             join(86143..86472,86545..88716,88830..89690)
                     /locus_tag="MYCTH_2293965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658336.1"
                     /db_xref="GeneID:11508711"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Spoth2_2293965"
                     /translation="MVRAASPAESIASVATSTAGAKRKERDFDPDDGEATNINVVVRC
                     RGRNEREVKENSAVVVRTEATKGKLVQLSMGPNAVSDKTYNFDRVFSQAADQSMIFEE
                     VVKPVLDEMLSGYNCTIFAYGQTGTGKTYTMSGDLTESMGMLSDNAGIIPRVLQALFN
                     KLELEEREHSVRCSFIELYNEELRDLLSSDDSAKLKIYDDTSRKGHSTTMVQGMEERF
                     ILNAGEGLKWLREGSVKRQVAATKCNDLSSRSHTVFTITVYAKQKTENGKTESGEDYL
                     MLGKLNLVDLAGSENIQRSGAENKRAAEAGLINKSLLTLGRVINALVDRSPHIPYRES
                     KLTRLLQDSLGGRTKTCIIATISPAKSNLEETISTLDYAFRAKNIRNKPQLNALTNKK
                     TLLRDYAIEIERLKAELIATRQRNGVYLSNEMYEELTVQNESRRILTEEQGAKIETLE
                     TNLKNKLQELLSVTSNFMGLKKEHEGTLARFDETKELLEQTEMVLARTRQALAEESHL
                     RKAHETTEEQLALLGGDLISTLERTVGDIDGLRAKDERRVDLHTLNRSTWEASQARVA
                     DITELVEGRIEEFRQGQEEHISSVSQRMQAFVKEELEKLSSTQTFLDENLARFAESRA
                     QLVRQQERSREEMDTVLEEIKVVRDNVKQRVGESLQAIAAAAERIAGDVLTELSTFHD
                     QLHASYSSLGKDFKSAFEELLRHMRAQKAESDRLRHELEEATHAMVESNESVATRIQE
                     VLDEERAQAAAERQALLAQIARLVNSQAEQQESRLADRAAQIQDAILDSNKTLKESVG
                     EYSAGMNAWAERDSKALEEASTSRDALKTRLKDDWTTASKHSTSIQSTTKSVHAETVR
                     VVEEQMQDLDAQMRDLDDFVSRAKAQNASHQERHAESVQNLDTAVEQSFSNISGHFKE
                     TFDRVQHLGEEMDAEAQSLGEALEPLEEEVCRPLAELREEVRNTELREYEPTGQTPEK
                     TEYSYPTNLPRTGPHEALLAALRESPTPKASPAVLPDQDSTPVRSPSRPVGAETPCSG
                     GLREVDPNLGSGTKASSILFDSAASILSPPPPSSDAAMPLPLLKSAANTRTRSSRLSK
                     RAAGLAVGDGAENLPPPPALRSSTRRKSPRLH"
     gene            complement(90316..90430)
                     /locus_tag="MYCTH_t52"
                     /db_xref="GeneID:11505698"
     tRNA            complement(90316..90430)
                     /locus_tag="MYCTH_t52"
                     /product="tRNA-Leu"
                     /note="Anticodon: AAG"
                     /anticodon=(pos:complement(90394..90396),aa:Leu,seq:aag)
                     /db_xref="GeneID:11505698"
     gene            91091..92113
                     /locus_tag="MYCTH_2293966"
                     /db_xref="GeneID:11505941"
     mRNA            91091..92113
                     /locus_tag="MYCTH_2293966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658289.1"
                     /db_xref="GeneID:11505941"
     CDS             91282..92088
                     /locus_tag="MYCTH_2293966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658337.1"
                     /db_xref="GeneID:11505941"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_2293966"
                     /translation="MSAHPDLTGFSALSFDCYGTLIDWESGLAADLQPLIDALPSSHP
                     FRSDPSLAVRRFNDHSEHLWATQPKLAYDANLTESFRRLAREEGVAADGLDDGAAARR
                     IGDGPGRWPAFGDTVDALRRLGRHYKLVVLSNVDEANIARARAGPLAGARFDAVYTAE
                     AIGSYKPSLDNFRYLFEHVRRDLGVDKDRGGLLHVARSLTADHVPAKQVGLRSVWIAR
                     GGDKPEGYGTGGDYEKLKAEGKLGFEWLFQTLGDFADEVDRQFAEKAAAK"
     gene            complement(92327..94810)
                     /locus_tag="MYCTH_2293968"
                     /db_xref="GeneID:11513225"
     mRNA            complement(join(92327..94151,94280..94810))
                     /locus_tag="MYCTH_2293968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658290.1"
                     /db_xref="GeneID:11513225"
     CDS             complement(join(92403..94151,94280..94603))
                     /locus_tag="MYCTH_2293968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658338.1"
                     /db_xref="GeneID:11513225"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2293968"
                     /translation="MSQPVQPKHGYGSAEPEISHQYWDRDAGPDDGDGDALSHTSLDS
                     DELHETRPNRWRGHPSTWKTWTESDRRTWAALENARRGDLSAHLFNAFALRRGFRVGP
                     EFEVPEDGDAAGDRGAGWDIGKYWTAWPMKANEVPDGGLLPRTADLNEPFTYRREQRR
                     PFAGCNLEDEISATILRHAKERFRARGLQAQPASAEHVVQSIEKTDTTATEGETDASG
                     VGDTTGNDERTDKAARRTARRARRAASPTFTPVISADDERSYRLLRPVTRQIMSKLDD
                     TLMILHNQRMAGLGNTSDSSVCGGDVDNDKDETDAEAVPERRPRARSKSPSAPAPRSR
                     GGRPRKVHVPLEGETEQEMLIRVARQSKRKLPTFSSGPESEGEGIRRRSRSRSLGSAR
                     RSTSASSRASSRRSSVSSEANREKLLSRWGLRDWRDVLGAAALAGFSPTVIARAAQRC
                     STLFREEMAMHTLHERSAASENAGMETAVYVPGLALVSSGDEDESEEELAQLRTVSRQ
                     SSVRGPSSSPEPAQPRSRSGTPASLVCPHPQCPRAVEPFPKKSNLQRHLKTVHGNREP
                     DLTTEPEQTEAEAPPPPPRHCRRRSGTPGASHLCPYPHCPRAVEGFTKRKNLTRHLQA
                     VHGKRGVPLTEDEEDSADEMDGGVHVDRFLRPIKIRKGWRGDDIQQRSSRVGKKARAG
                     SEELDSFL"
     gene            complement(94982..97258)
                     /locus_tag="MYCTH_2293969"
                     /db_xref="GeneID:11513255"
     mRNA            complement(94982..97258)
                     /locus_tag="MYCTH_2293969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658291.1"
                     /db_xref="GeneID:11513255"
     CDS             complement(95061..97145)
                     /locus_tag="MYCTH_2293969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658339.1"
                     /db_xref="GeneID:11513255"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="JGIDB:Spoth2_2293969"
                     /translation="MGKLKKKGKAGQAKNYMTRTQAVKKLQLSLPDFRKLCIWKGIYP
                     REPSNRKKVSKSATASTTFYYTKDIQYLLHEPLLQKFREQKVLEKKISRALGRGDVSD
                     AARLERNAARSEKTGKPRYTLNHIIRERYPTFVDALRDLDDCLSMLFLFANLPSTTAV
                     PAKMISRCERLCLEFEHYLIASHSLRKSFLSIKGIYYQATIQGEDILWLVPYKFNQRV
                     VGDIDFRIMGTFVEFYMTLLGFVNYRLYTSIGLKYPPKFDQLKDDQGAELGAFALEGA
                     NIATKDETKAITNGESEHGQPDPKVQAEVDKIVRQLRHESDEKATAEGAAEGAAEGAE
                     GEGEGEGEGDDKPSDAIDKFEPVAPGGDVLPQPSYSSSDPSRLFSKFTFFLSRETPRQ
                     PLEFILRAFGCKRIGWDAVLGEGAFTHDESDPSITHQIVDRPVVRAVASEGGDGEDNQ
                     TSQKVGPNQRYPGRVYVQPQWVWDSINDEELKSPELYAPGASLPPHLSPFVKPTQGQY
                     DPTRPLEEQQTEGEAIDAELEDANEEGDGSDVENDMDVASDGEEEEEDEEEEEDEGDQ
                     DKKQDGDFGGFSEGEEEEASEYEEEEEEATLQRQRELEAEISGKAVQGGKKVDPKTKA
                     KLEAKKALERKKKQEAEELERAKGMLSKKKRKLFEQMQYSNNKKSAEDMKLRQKRRKL
                     EKEKKAAASAAA"
     gene            97422..99286
                     /locus_tag="MYCTH_2293970"
                     /db_xref="GeneID:11512940"
     mRNA            join(97422..97668,97745..98012,98095..99286)
                     /locus_tag="MYCTH_2293970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658292.1"
                     /db_xref="GeneID:11512940"
     CDS             join(97515..97668,97745..98012,98095..98950)
                     /locus_tag="MYCTH_2293970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658340.1"
                     /db_xref="GeneID:11512940"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="JGIDB:Spoth2_2293970"
                     /translation="MDGAKATPGQTAALYAGAAALRLAIFTLLPALPDLLTGRVEIST
                     PVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPLFSLLPSYANFPIFTYLLYTAVD
                     LLSARALWTIADSGEAGSSALFTSPRRAKRWSGFVIAAVFLFNPFTVATCLGRSTSVF
                     TTCAILHAIARAVSGAPFGAMAALSFASYLSMYPLLLLPPLILLGYDRQRPERATKSA
                     LTFAAICAATVAGILAILFQMSYLVTGSWEFLPSTYGVQLTLSDLTPNVGLWWYFFIE
                     MFDSFRSFFLAVFWLHLSSYVGGLTVRIRRQPLVVLTLLLGILSIFKPYPSISDTALF
                     FALVPLYRHVFPLMRYTFLSVAVILYATCLGPAFYHLWIYAGSGNANFFYAITLVWNL
                     GLSLLVCDLMFAVLRDEWEVERPEMAGKEVRQI"
     gene            99301..100752
                     /locus_tag="MYCTH_2293973"
                     /db_xref="GeneID:11505544"
     mRNA            join(99301..99608,99697..100752)
                     /locus_tag="MYCTH_2293973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658293.1"
                     /db_xref="GeneID:11505544"
     CDS             join(99371..99608,99697..100469)
                     /locus_tag="MYCTH_2293973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658341.1"
                     /db_xref="GeneID:11505544"
                     /db_xref="JGIDB:Spoth2_2293973"
                     /translation="MAPIRRYLRITKYSVLECRIYLDNPALAQSWLLNPRDPVLPKVI
                     ESVRPLVLPKLREEQERERSRKKNKKRSIKDVVVQDDFEVSIFLTETDTRHSLLYKRK
                     LFRDKIQTRLTSNSSKLMGASRDVPIDVEDQFPQGAAAVPNLRQEEDDQDAIDLADIP
                     LANEAAANDVEVTTRRPKRRRRRGGGAGEGTREGSDASDGEMVVVGDSDFSADELPEG
                     SRESEESAYDEDEDSAADRRPPKRRKEKAAALGGDTAERDDKKKLAMDISYEGFAIYG
                     RVLCLVVKRRGDGAAKGGTSAVSSGNRALPSRPGGQAMMENWIASTQAPDAAAEEDTD
                     TL"
     gene            109683..111931
                     /locus_tag="MYCTH_2293977"
                     /db_xref="GeneID:11509001"
     mRNA            join(109683..110324,110423..111931)
                     /locus_tag="MYCTH_2293977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658294.1"
                     /db_xref="GeneID:11509001"
     CDS             join(110177..110324,110423..111612)
                     /locus_tag="MYCTH_2293977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658342.1"
                     /db_xref="GeneID:11509001"
                     /db_xref="JGIDB:Spoth2_2293977"
                     /translation="MAVQLHVWGPAFGLPSIDAECLAAIAYLAQTLGSADYQLIQSSP
                     SAVPTQHLPTLYDSRTSTWIGGFTSITAHLHTHPPPTFQSAPQPTDGSSSTTTTTTTT
                     TTAASATADGTAYTAFLSAHAAPLLALSLYVSSANYGAATRPAYSAVLPLPLPWTEPP
                     AVRAAMARRAAHLGLSSLDADAAAERARAEERRAAADGWVAVPPHATAGRAAGGGGGG
                     GGGGGKGGGVAAVLTPEQKSRIRLEEAAREVLDVLAEVDWAAGGGGRQVAAEVRCLAF
                     GYLALMLLPDVPRPWLREIMEGRYPALCTFVRDFRARVFPQGGKLLPWADGGAQASAS
                     ASASASAVALRFVRAVMAEVPLVGEWWSRWWTARKKREVLASKGAKPAPSNDLLLLLG
                     AGLGLTVVGAGVFFYRGLPPFGEAVQVWRKPVVGLSSFGAAGAMFSGALYGLD"
     gene            112143..115528
                     /locus_tag="MYCTH_2293982"
                     /db_xref="GeneID:11512938"
     mRNA            join(112143..112302,112399..112601,112762..115528)
                     /locus_tag="MYCTH_2293982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658295.1"
                     /db_xref="GeneID:11512938"
     CDS             join(112253..112302,112399..112601,112762..115436)
                     /locus_tag="MYCTH_2293982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658343.1"
                     /db_xref="GeneID:11512938"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR010663"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="JGIDB:Spoth2_2293982"
                     /translation="MSKSWASTLRLPKSTFPPRPLPQNRDQYIRRCADDLYKWQAANR
                     PADDEFVLHDGPPYANGSLHAGHALNKILKDMILRVKIQQGRRVSYVPGWDCHGLPIE
                     LKAVDVAAGKSMSPGAIRKAARKLAAKTVTEQMKAFRTYGVMADWDARWTTMDMAYEV
                     RQLRLFQRMARRGLVYRRYKPVYWSPSSGTALAEAELEYNEAHVSKAAYVRFPVVGGH
                     EGLPGLDRLEGRLYAVIWTTTPWTLPANRAIAVHDELTYHLVRAGQDAFLVAENCLER
                     VAKVLPGAPEVEVLATVKGCELTRLRYVNVLRGRSAEPQPFMHGDFVTDGSGSGLVHC
                     APGHGFDDYLACLPRGIPVSAPVDGDGRFTDEAFPDQPDRLRGISVLDGGSSAVLEIL
                     GDDVLDVHDYRHKYPYDWRTKQPIIIRATAQWFADVGTIKDAALAAIGKVRFVPDNAK
                     NRLEAFVKGRSEWCISRQRAWGVPIPALYEPDGNAVMTDEVIDHIISVIQERGTDAWW
                     TDAPDDPAWIPEALRGRGQYSRGRDTMDVWFDSGTSWTMMGDKQADLYLEGSDQHRGW
                     FQSSLLTRVAAAADADHDGGSDGGRRTTGSTTTDTLGLSPFKTLITHGFTLDKDGKKM
                     SKSLGNIISADQVMDGSLLPPLKPKKKSGNAGPVKDALGPDALRLWVASSDYTRDIVL
                     GEPVLKTIHQALLKYRTTIKMLTGSMHRSARTAPLTAVDEIALLQLGDVMDEVGRHYD
                     AHEFNKAFGALNRWLANDLSAFYLEALKDRLYCADGGGVLEPIFVGFLRMLAPVAPLL
                     VEEAWEHRPQWLKDDDPDALHPLRQLYRAPLIDPARLTRDPAELREAVPVLMAAHAAI
                     KAASEPARADKVLGSSLQCHVVLEVPEGGRALRILRAHEAELPAMFVVSSVELNGAVG
                     EEEKEEGWKYCQQFELDGQQCKAWVLPPRQAKCPRCWRYVAPSEDELCGRCEEVVGQS
                     VVQ"
     gene            <115898..>118225
                     /locus_tag="MYCTH_31411"
                     /db_xref="GeneID:11508765"
     mRNA            join(<115898..116323,116381..117421,117602..>118225)
                     /locus_tag="MYCTH_31411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658296.1"
                     /db_xref="GeneID:11508765"
     CDS             join(115898..116323,116381..117421,117602..>118225)
                     /locus_tag="MYCTH_31411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658344.1"
                     /db_xref="GeneID:11508765"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_31411"
                     /translation="MDILKVLSRGIKPSQKNKAQVPGAAVQQLPSAGALPHPQLFHDP
                     VSTRGKKRKRRRDTQDEQAGNDDEEEDLSDVDYFAPKKPATEAAPADADAEQDAPKKR
                     KVKLLDEDECRQILRSHRLKFTVLSGGRQAEAKAEAGAEVKEEEKMSKKKKEAEDKKS
                     EEKKEDHKKQIFPQPLTSFGELRHVYDVSQQVAANISAQGFRVPTEVQMGSLPLLLRP
                     ATALKKSTGANLPDVADGVDFLAVAPTGSGKTITFLIPAIDGVLRRRAEQQRSNDEHV
                     LEAVVVAPTRELATQIVSEGRKLAIGTGVRVVLMKRNLRLAVEDAAAAAEGPKNNKDE
                     EKESESEEDSESESESESESESESESESEDEESKGPDREHRRANDRVKPPARVDILVT
                     TPKILLNFLSGKLDKSGARKVLPTVRSLILDEADVLLDPIFRKQTMAIWRACTHRDVS
                     LTCWSATMASSIEALVIKQLSRRASRQGGSGAPRPLIRLALHDELKYDIPIEAGGSAR
                     VAVLHSSMTDAARSRIMARFRAGEVWVLITTDVLARGVDFAGVNGVVNYDVPTSAAAY
                     VHRAGRTGRAGREGGVAVTFYTKDDIPFVKSVANVIAASEKQAGKAGTDAAAVQKWLL
                     DALPDVAKEDRRKLKVRGVESRRTGGKASITTKSSWERRREHKRAQAIEASKRRKRQR
                     REEEKRGGGGGGGGG"
     gene            complement(118578..120483)
                     /locus_tag="MYCTH_2293986"
                     /db_xref="GeneID:11509170"
     mRNA            complement(join(118578..119146,119244..119531,
                     119605..120483))
                     /locus_tag="MYCTH_2293986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658297.1"
                     /db_xref="GeneID:11509170"
     CDS             complement(join(118612..119146,119244..119531,
                     119605..120149))
                     /locus_tag="MYCTH_2293986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658345.1"
                     /db_xref="GeneID:11509170"
                     /db_xref="JGIDB:Spoth2_2293986"
                     /translation="MCFGSKKDVGDGEAPRPAQNQQQQDAPEHKIASVPPQYHPQQQQ
                     SQFQQPAGPPPSHRPPASSGGEDYAPPPGPPPGQRHGDGYGPPPGPPPGQRPAEAPLV
                     PSNRPGDDFAPPPGPPPSHRAQQGGDDFAPPPGPPPGHGASGAEDYAPPPGPPPSHLN
                     NLSYVAPPPGPPPADNKPQHAWEAVVPDTSLFPPPPSFFSGFDRSPANNATEAEAEAG
                     EQWCAQHPLIAPITLDDHAVAALNAHNPRLMQPDVYRGTLTCTAPGVWEGRTNSQATD
                     STIIAYPPLYSVMLHSPLAPSNAARRKTIYYEVQLTQANPRRDICLAMGFTALPYPSF
                     RMPGWHRGSLAVHGDDGHKFINDRWGGKSFTTPFAPGERLGIGMTFWDAGGGRVEADV
                     FFTRQGREVGRWNLHEETDAEQDLPVTGLEGYHDLSCAIGTCGETGFQVIFDPARWLH
                     RPAGY"
     gene            complement(120967..123723)
                     /locus_tag="MYCTH_75421"
                     /db_xref="GeneID:11508459"
     mRNA            complement(join(120967..122464,122521..122598,
                     122661..122732,122790..122916,123062..123723))
                     /locus_tag="MYCTH_75421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658298.1"
                     /db_xref="GeneID:11508459"
     CDS             complement(join(121112..122464,122521..122598,
                     122661..122732,122790..122916,123062..123657))
                     /locus_tag="MYCTH_75421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658346.1"
                     /db_xref="GeneID:11508459"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="JGIDB:Spoth2_75421"
                     /translation="MKEASSPQPKSHGGTHRSSRRPDSNPFPVSGPSSGLQPTKTSNG
                     SPAAASLNGAPGDVGPGLASAQSAPATGTHDRSSGRPVSTPPVARSGSVIGADAETQS
                     KDQNEKKPILERFWVTVKSILVSSKINVLLVFVPVGIAVAQFHNLSPAIIFAMNAVAI
                     VPLAGLLSFATESVAHRLGDSLGALLNVTFGNAVELIIFSIALVKNEIRIVQASLLGS
                     ILANLLLILGMSFFLGGLRFREQIYNSTVTQMSACLLSLSVISLVLPTAFHASFRNND
                     LADRQSLKVSRGTSVILLLVYILYLLFQLISHSYLYESTPQHIIDEEATPGPAANWLD
                     SSSSDSSSSGDSDSSDSDHSRNTMSKRMRRVMHRRRRSSAVSSETGELSHASPTTPSV
                     DDPNAEDASSHPRVLHQQSSSGASEETEDRRGHGKRHRRRLPRRKHRKHRHRHISESP
                     EAVVEENNNAAASAHEPRRIDFAPDTTIQQQTTPGEPRTRSPLQGLRSMSFRPVVSSL
                     APSVFTQPPETSMPAIPAGPVPRVRYGIRRTNSLPDRLNQYYRPPGAMMPSQIPLAHR
                     PMVAITEEKHAVHMSRTAAVILLLASTALVAVCAEFMVDSINGLVETSNVNEVFIGLI
                     ILPIVGNAAEHVTAITVAMKNKMDLSIGVAVGSSIQIALFITPLVVIIGWAMNREMSL
                     YFTLFETVCLFVSTFITNFLVLDGRSNYLEGALLMSTYVIIAVASFFYPEVKDASAWG
                     A"
     gene            complement(125930..132084)
                     /locus_tag="MYCTH_2293995"
                     /db_xref="GeneID:11509019"
     mRNA            complement(join(125930..127538,127769..127978,
                     128064..129483,129601..132084))
                     /locus_tag="MYCTH_2293995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658299.1"
                     /db_xref="GeneID:11509019"
     CDS             complement(join(126164..127538,127769..127978,
                     128064..129483,129601..131926))
                     /locus_tag="MYCTH_2293995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658347.1"
                     /db_xref="GeneID:11509019"
                     /db_xref="JGIDB:Spoth2_2293995"
                     /translation="MSAPYWGQLPPPDAGQTRARRLSDDQAQDPLPGRRQSLDAPAQA
                     SRLNRISVQTTKSDATTDSTRSPLTSPTASSFHGHGLTPRPPSLPYGTDQYPPELIEK
                     RRRRRSRAQEQDAEYASLTRPPPPAAPDAPRPPPPSSQYPYPYASGAQPSSPPQGPFL
                     ARGTGRQDSQKENEGRRNQKNQPSDHARNMHEESIKLAPQRVATDPAPGRMSPLPNGR
                     QRRPSAAEQSLQRSTRRTSTTSSSAARPKTFADVRSPLQRLELTLDGISKGDKRARVE
                     AAERAARERAAAKEAAAQHHHPDGNHQQARARERRPSVAAGDAPTTTPIAPTRPAHHA
                     AAKDGPLSQNPPDPTTGGSTAGPAPKASPPDSRIPVPVQSSGLPQRNLSFRDRAARND
                     MKIPNGLESLPSEEAAAPPAGPNGRTPPRSGSNKLKKNPPADAWPNRISESDEIYKTW
                     ETAARSPQAAGGPAKAVPPGAANPPGHYPSDRAFRNAPTADSNSLDDDFAEEFMLYSS
                     AGKLTMAPGQRKADQVLGRAPTQTAATSGDAPTAVSFRAMSPPPASSDPAAYPRAAPP
                     ADNLGPGAPTESGGQNDANGTRHHHHHHMSDMVYHARDKFQPGQGVFKPTTFLDEWKK
                     GTVGVLSGNLLDLDQAQPPAVEKNTAWWEGPQTRRRSDSLSSRPKKAEAFEGEYDEKS
                     NGTRTPNQQAVYPSIREVQSGDHLLLSTSDFGGGLPFEPQHLAPRRAKARAKRWDGLR
                     PFSPSPSANDSQDSLGCFSLSSNDAAFSRIALPYSSPTRFKPPLYLKCGPLLRFCGIR
                     RERVPARSARAGAVIDREIWRGSIMIVTTDADSSYDIAPILRLFVQPIELLPPPPREV
                     RGDLAPEYIDPIAGHPKLGRKGETLYVRPVDHLEEAKDLSRDETDDGLFEKSRSPPDV
                     PLPEGVVDPPGSFAARRKRAEIDGEKVGKYKDIRGFRLHAERGYTFWRFNIEIELREK
                     QQRIAYRINRGPSTGFWVPAKGQSMNIMFYSCNGFSLSADPNQFSGPDPMWRDVLNAH
                     QSQPFHLMIGGGDQIYNDRCMQDTTVFKEWLMIKNPLHKHNAPFTPEMQDELERFYLE
                     RYAMWFSQGLFGMANAQIPMVNMWDDHDIIDGFGSYPHHFMNSPVFSGLGNVAFKYYM
                     LFQHQSVVAETEKTEPSWLLGVRPGPYINELSRSLFMFLGGKVALLAVDARTERTREE
                     VVREDTWKKIMDRCYAEIDKGEIEHLLVLLGVPIAYPRLVWLENILTSRVMDPVKALA
                     KLGMFGGLLNRFDGGVEVLDDLDDHWTAKSHKQERSIVIEDLQDLAADKSVRVTILSG
                     DVHLAAVGQFYSNPKLGLAKHKDFRYIPNVISSAIVNTPPPDLLADVLNKRNKVHHFD
                     KETDEDMIPLFAHGVDGKPRNNKHLLPHRNWCAIREYVPGHTPPSSPGQSTYDVASLG
                     SVPGTPGGEVRRSSSIFRRLTRSKTIGPDGRPKDRSRPPVSGGLLRSLSRRAGAASAD
                     EVGRSGPPKQGLLTRTLSSASVSGRFGGLFRRRSTSERARDDGGINGTWGPDTDDEDP
                     RFQQQQQQQQEQQEQHQFEQYGRPGGSAGPGAVNLRGGLASHPGGYNNEYDQTDESHS
                     SVRAPYPHPGDDDYDDDDDYRPPVPPKPIMTGGAGAGPAAQPGSRQPQAQEQDGDFVP
                     RPFHRAPTTLSVNQRKALGGRLPEDHFAVNLEGALEVTLNVEISPRDPGGSTVPYRLV
                     VPRLWYEYEAEETEDGLHPEGAEREGPEAGEAAGEKKAGIKRLLSLKKRG"
     gene            134410..137687
                     /locus_tag="MYCTH_2293998"
                     /db_xref="GeneID:11508860"
     mRNA            join(134410..136434,136534..137687)
                     /locus_tag="MYCTH_2293998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658300.1"
                     /db_xref="GeneID:11508860"
     CDS             join(134711..136434,136534..137488)
                     /locus_tag="MYCTH_2293998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658348.1"
                     /db_xref="GeneID:11508860"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="JGIDB:Spoth2_2293998"
                     /translation="MKIWSGAALLGLAALATASHILPRDWEANDYYVLHLDADTSPQE
                     VARSLGLSHEGPLGELRDHHVFVAKRAEHDVVKRELARRRKKRSLGLGGRDVLDGVLF
                     SQKQRLRKPWEKRVVPRLFGPLPRRSVDEPVESLVQRQTEVARKLDIKDPIFHEQWHL
                     FNTVQAGHDVNVTDVWLQGVTGKNATVAIVDDGLDMYSDDLRDNYYALGSYDFNDKAD
                     EPRPRLANDNHGTRCAGEVAAGRNNACGVGVAYDSNIAGLRILSKLISDADEAVALNY
                     DFQHNQIYSCSWGPPDDGKSMDAPGILIRRAMLNAVQNGRGGLGSIYVFASGNGAHNE
                     DNCNFDGYTNSIYSITVGALDRKGQHPYYSESCSAGLVVTYSSGSGDAIHTTDVGQNT
                     CTSSHGGTSAAAPLAAGIFALVLQVRPDLSWRDMQYLAMDTAVPVNVDTGDYQDTTIG
                     KKFSHTYGYGKLDSYAIVEAAKKWKKVKPQAWFYSPWIHVNQPIPQGDKGVVVEFEVT
                     KEMLEEANLDRLEHVTVTMNVEHGRRGDLSVDLISPNKIVSHLSVTRKNDDSDKGYND
                     WTFMSVAHWGESGVGTWTIVVKDTEINQYTGKFIDWHLKLWGETRDASKAQLLPMPTE
                     EDDDDHDVIATTTATAATTTVSKPEATGSVPADATDQPNRPVNSKPTDTSPAETSSSS
                     SSSSSSAETDKTNTWLPSFLPTFGVSAATQAWIYGSLVLIVLFCAGLGIYLYLARRKR
                     LRNKTRTDYEFELLDDDDDDDEEAAALTRGGGGGEKGVVGGGGGGGGKRGRRTRGGEL
                     YDAFAGESDEDSDDNDFAGGGGGGGGGGYRDRSDSRSRSRSDGSGSPIGISEKLPGRR
                     DSLSGEEEHHVVGDDDDDDEDGTGNDQARPLQGGAR"
     gene            complement(138231..140139)
                     /locus_tag="MYCTH_2293999"
                     /db_xref="GeneID:11506018"
     mRNA            complement(join(138231..139628,139695..140139))
                     /locus_tag="MYCTH_2293999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658301.1"
                     /db_xref="GeneID:11506018"
     CDS             complement(join(138423..139628,139695..139940))
                     /locus_tag="MYCTH_2293999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658349.1"
                     /db_xref="GeneID:11506018"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2293999"
                     /translation="MAVLDQDNFSNISWHSEQNPDAAGPSTSASSHDRSHEARTGDGR
                     HVGHGHLGHEILECVVSDPHKENDGTKDAYVSYLITTNTTFPTFQRPTTTVRRRFTDF
                     VFLYKVLTREYQGCAVPPLPDKQRMEYVRGDRFGPDFTARRAYSLQRFLSRLALHPTL
                     RRASILHTFLESPDWNATMRSRAGRRASAGAGGDPGQNQSGSGSGSGSGGVFDSFADS
                     FMNAFTKVHKPDRRFVEVKEKADKLDEDLIHVEKVVARVARREADLETDLRDLAEQFQ
                     KLITLEPGVEAAVHAFAASVEDTSSGLKKLKEHTDQDYLSSLRDMVAYSGALKNLLKA
                     REQKQLDYEQLTEYLNRSTADRDMLASGHGYTSGPFGSGALGGAGGFIRSKIEDVRGV
                     DHEQARRDRQRKLELRIDELTREVENARLEADQFADQVVREVESFEWIKKVEFKRQFG
                     GLVDAHIEFYDGVINVWEQYVREMEREGVVLPA"
     gene            complement(140582..143112)
                     /locus_tag="MYCTH_2294001"
                     /db_xref="GeneID:11508558"
     mRNA            complement(join(140582..142552,142614..143112))
                     /locus_tag="MYCTH_2294001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658302.1"
                     /db_xref="GeneID:11508558"
     CDS             complement(join(140946..142552,142614..142674))
                     /locus_tag="MYCTH_2294001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658350.1"
                     /db_xref="GeneID:11508558"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="JGIDB:Spoth2_2294001"
                     /translation="MSASTRVARRALVVNPFSGTGRALPRSALPAASIYLARNAQNLG
                     PASALLIPIRTLTTSSTTTHGPPGVPPPGFNPEEAKKPLPREPASATKPTAKVPEKAK
                     TEVKTEEAKQASADSDASLTPLAAEKEDAVDKSEGKKEEKKLTLGQKIKKEAQHYWDG
                     TKLLAAEVKISSRLALKMAAGYELTRRENRQLKRTVQDLARLVPFSVFVIVPFAELLL
                     PVALKMFPNMLPSTYEGQKSKDKKASTLRATRKEVSDFLRQTLKETGLPLTQATAQKE
                     EFTNFFRKVRSTGEKPTAEDVIKVCKVFKDDVTLDNLSRPQLVSMCRYLNLNTFGTDM
                     MLRYQIRHRMRQIKRDDRAISYEGVDSLSVAELQVACASRGIKSYGVSPARLREDLQT
                     WLDLRLRDGVPSTLLVLSNAYMYGQTQTEEGMSSQIEALTGVLSSIPEELFHEIELEV
                     HNAEGAATNKQRLEVLKEQQELIDEELEQNQENQATGFATPRDTENIDDKEERHAHAE
                     ADPTIEKAQVGEAVDAEKDMLDAARIEQQQQQQQQQREAAQPKSGDK"
     gene            143953..145056
                     /locus_tag="MYCTH_2294003"
                     /db_xref="GeneID:11508341"
     mRNA            join(143953..144242,144322..145056)
                     /locus_tag="MYCTH_2294003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658303.1"
                     /db_xref="GeneID:11508341"
     CDS             join(144086..144242,144322..144959)
                     /locus_tag="MYCTH_2294003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658351.1"
                     /db_xref="GeneID:11508341"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="JGIDB:Spoth2_2294003"
                     /translation="MRLRRAARVILFGAPGVGKGTQSERLLRRFPQLSSISSGDLLRH
                     NVKQRTPLGIKVESTMKAGGLVPDDIILRLISNELNQRGWIHWGHPSGNVMTLSSSAV
                     DAEMAAFVSSPAHARGYGQPRVNEDPSASFLLDGFPRTAAQADRLDEIVPINLAVSIK
                     TPFEVIMERISGRWVHEPSGRVYNTTFNAPKVPGRDDVTGEPLVRRADDSEEVYRARW
                     NKFQETSEPLLEHYARKGVLWEVEGTTSDEITPKLFREFERRFVEV"
     gene            complement(145878..146279)
                     /locus_tag="MYCTH_2294005"
                     /db_xref="GeneID:11508118"
     mRNA            complement(145878..146279)
                     /locus_tag="MYCTH_2294005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658304.1"
                     /db_xref="GeneID:11508118"
     CDS             complement(145975..146166)
                     /locus_tag="MYCTH_2294005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658352.1"
                     /db_xref="GeneID:11508118"
                     /db_xref="JGIDB:Spoth2_2294005"
                     /translation="MTDTGPRNILADGHDKHSLGRSCEETLQPSSCSGNSQFMVLSSW
                     EGPGGNEYLKHALTVGMEL"
     gene            146286..148489
                     /locus_tag="MYCTH_2294006"
                     /db_xref="GeneID:11505879"
     mRNA            146286..148489
                     /locus_tag="MYCTH_2294006"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003658305.1"
                     /db_xref="GeneID:11505879"
     CDS             146433..148319
                     /locus_tag="MYCTH_2294006"
                     /note="CAZy_ID 267897"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003658353.1"
                     /db_xref="GeneID:11505879"
                     /db_xref="JGIDB:Spoth2_2294006"
                     /translation="MLLTWTVVVALAMAVRAMSPRSYPPSLLRDGLSTRAGGPSIPDD
                     IVFRDMWMALSDLQETYFERWLGTWPDGIDWTRAVMGTHVAATLRTISDELRLSEPTQ
                     DAGCVTRKEDVVGGYFADVIAYYFAEDTFAIRNQAYDDMLWVVLAWLESIRFIDEHSR
                     VVASGSSCSTESGAWPGAETWYGSRWIPAFAHRARIFWELAAKGWDTKLCGGGMIWNP
                     RLMPYKNAITNQLFISASISMYLHFPGDTNSSPFSAGVGSALAGGVGTADWPPHDPIY
                     GKAARDAHDWLASSNMTNAQGLYADGFHVSGQSTGSNNTRCDDRDEMVYTYNQGVLLS
                     GLMGLYRATGQERYLREGHTLIRNVISATGYDLEQDKPVDPIHPDRVPPWRGLGRVGV
                     LEEACDASGTCSQDAQTFKGIWMHHFAAFCAPAALRFTGSDSLGSQRPQPHGEAGAGA
                     GAGTIRARHERECRRYIPWLRHNVRAATGTRDENGLFGMWWTAGLLTLTSGEAIEAAG
                     DLHPLPPGGDGGEVVDYRNTGVPLDPKWTRAAGDGWSPAVPVPDAKRTGQAPLGHGQG
                     VVVGGGSGSGEVKRAGSEKRAEALEESGAYDPNLRGRGRTVETQGGGLAVLRALWVVS
                     RLEG"
     gene            148578..149803
                     /locus_tag="MYCTH_2294008"
                     /db_xref="GeneID:11513129"
     mRNA            join(148578..149246,149431..149803)
                     /locus_tag="MYCTH_2294008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658306.1"
                     /db_xref="GeneID:11513129"
     CDS             join(148926..149246,149431..149676)
                     /locus_tag="MYCTH_2294008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658354.1"
                     /db_xref="GeneID:11513129"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294008"
                     /translation="MASEAMDLDEPVRQGRGDGSASNNIIINNNNNNNNNNSSSNDVS
                     SAKLAAMQTATKATAVRSIEGWIVMVTNVHEEADEEAIHDKFGEFGEIRNVHLNLDRR
                     TGYVKGYALIEYTTLEEARAAIDGANNTDLLGQTVKVDFAFVRPPPGKATNNTRPGGG
                     GGGAARGSNRGARSGRSRSRSPGAGRDD"
     gene            complement(<150455..>151505)
                     /locus_tag="MYCTH_2121938"
                     /db_xref="GeneID:11511622"
     mRNA            complement(join(<150455..150870,151038..151220,
                     151315..151338,151442..>151505))
                     /locus_tag="MYCTH_2121938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658307.1"
                     /db_xref="GeneID:11511622"
     CDS             complement(join(150455..150870,151038..151220,
                     151315..151338,151442..151505))
                     /locus_tag="MYCTH_2121938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658355.1"
                     /db_xref="GeneID:11511622"
                     /db_xref="JGIDB:Spoth2_2121938"
                     /translation="MDKLLGKVVDKVVGDDDERPHGLHQGGGNLTHGGSYPAGGGYAH
                     PGDDDLRGAASVAAKEAPEDEDFFANAIAKLLDNKKHESDDDIDEQGAVESHRQFFGF
                     GDSSSSSSSSSHNQPASTSSLGSAAAVQALKLFTSSSSSSSSSEPQHGQSQNAFVGLA
                     MAQAAKLFDAQAAQGKVEPGADKQSVVMKAGELALKMYLKSHGGAQQQEGGGGAAAAG
                     LLNLAGKFLK"
     gene            complement(152283..154424)
                     /locus_tag="MYCTH_2294022"
                     /db_xref="GeneID:11508771"
     mRNA            complement(join(152283..153766,153834..154128,
                     154335..154424))
                     /locus_tag="MYCTH_2294022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658308.1"
                     /db_xref="GeneID:11508771"
     CDS             complement(join(152573..153766,153834..153917))
                     /locus_tag="MYCTH_2294022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658356.1"
                     /db_xref="GeneID:11508771"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Spoth2_2294022"
                     /translation="MSLRRSLSSGHMGYGMPMGMGSETSTLQMNPDQSDALFPLDTSF
                     LYPFDGTTSMSLDPGGPLPASFDTGPDPDSSDALVAATGRAPYSPDDAAAGTNAPREP
                     LGPSNQGNQSNQNMLTEFTKRRNWPARVVEELQDLLHILDANGRIKHVSPSAERLTGY
                     KPSELGDLFMRDLLHPDDVGVFTSEFNESIASGVPLRVFYRMRKKDGSYGVFEAVGHA
                     HIAAAKFAPNPNNQTPFCQAVFMMSRPYPTKNAALLDSFLEHKMENERLKRKIAELQK
                     EEQEEAEEAGRSWQQSQETVSPEGSLRFGPTSFSPGDASTTSRERRTSMDSGAAENLP
                     GTRRASIGTTHADTIEMLTGLRYQEGERSRGITTGNPSAALIAGDVGIAVPMDRDQRS
                     GDKKKKLKMAEEYVCTDCGKSSRASQSSIGSRP"
     gene            complement(155783..158234)
                     /locus_tag="MYCTH_2141262"
                     /db_xref="GeneID:11513240"
     mRNA            complement(join(155783..156042,156165..156245,
                     156351..156445,156528..157799,157893..158234))
                     /locus_tag="MYCTH_2141262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658309.1"
                     /db_xref="GeneID:11513240"
     CDS             complement(join(155950..156042,156165..156245,
                     156351..156445,156528..157799,157893..158205))
                     /locus_tag="MYCTH_2141262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658357.1"
                     /db_xref="GeneID:11513240"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_2141262"
                     /translation="MSRLAGRMPKGLGQSLAARSAVAAAAAAAAAAGAGRPACLALRT
                     VPVRLSSTENSKQPRPSGASFQGQISNSIMQRLQRERAELERVARTRPESSMTRNFSL
                     TFVIFFVGSVCWVLGYQYPRDADPSSTLPLNATRPPTYNLNPAHLEAAWADFVEIVGQ
                     ENVSTLEDDIKQHATSEWSSHRSDPAHKPFCVVYPATTEQVAAIMKVCHTRRIPVVGY
                     SGGTSLEGHYTPTRGGICVDFGRMDKIVALHKDDLDVVVQPGIGWEDLNEQLAEHNLF
                     FPPDPGPGARIGGMIGTGCSGTNAYRYGTMRDWVLSLTVVLADGTVIKTRQRPRKSSA
                     GYDLTRLFIGSEGTLGLVTEATLKLCVKPAAASVAVASFPSIRHAADCVARVVRDGVG
                     VAAVEILDDDQMRFINAAGTTTRKWPEAPTLFFKFAGAPAGVKEQIDLVRLMAKRAGG
                     QSFDFARDESEQAELWSARKDALFGTMAQRRPGDHVWTGDVAVPVSRLPDIIEETKRD
                     LKASGLTSSIVGHVGDGNFHIILLYNDAERKLAEDCVHRMVKRAVEMEGTVTGEHGVG
                     LVKRDYLPHELGETTVDAMRKIKAAFDPLCLLNCDKVVRVQKPARGEVAEW"
     gene            complement(<158890..>161189)
                     /locus_tag="MYCTH_2053489"
                     /db_xref="GeneID:11511598"
     mRNA            complement(join(<158890..159459,159694..160822,
                     161074..>161189))
                     /locus_tag="MYCTH_2053489"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658310.1"
                     /db_xref="GeneID:11511598"
     CDS             complement(join(158890..159459,159694..160822,
                     161074..161189))
                     /locus_tag="MYCTH_2053489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658358.1"
                     /db_xref="GeneID:11511598"
                     /db_xref="JGIDB:Spoth2_2053489"
                     /translation="MGYSWEQHRQTCYRLYVEENRPLDEVVQYMREHHDFTPSRRAFQ
                     GAFARWGFPNKLNPAYKNERLVARVKELWERNLSQKEMLSLLAEEGYKVGEREVARIR
                     ARNGWLMRGRSGLTAIGTLGRQRTESSEGGADVQDGGGGGGGVPGGASTEGNQDQTNY
                     WDYGASGLGPADAQVQEETLNAMRDARREYRKRVLEAEAHERWVTKKRRRHTRPYGGL
                     PADPPGPPRFPSETTLSEAKEILQMDRSAYMATREKFYDLCQTAGVYKKTLVGPERWE
                     ALKDQLVRESMHLRAVMWDRADMEKKKLAIEIICCDVTKRIRTEATAVKVADAKVMLG
                     LNPEEGRSVRKQLYNILASEKFTSMLEEGLEYFEELKQRWIAESPELSRSIAAGTADP
                     DYQRKVKAINVLCRDAVRRYRSDRSSRQVPAEPAAGADRQVADGPLGSSTSAAAETQN
                     PLLAMQSHGNATAQRGQTSQQGPPPPQQQQQQQQQQQQQQAGQQQQGTPPRASSSGIA
                     AFFRLSPAAQLMFPGVHAQWIAPLSERTMAELRGAALQKTPGGLCYKIEGVVKDGKGG
                     ELPLPVSDEVELETYLQHVQSEGPGAPTFHVHVVPGGW"
     gene            complement(162922..164845)
                     /locus_tag="MYCTH_2294026"
                     /db_xref="GeneID:11508354"
     mRNA            complement(162922..164845)
                     /locus_tag="MYCTH_2294026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658311.1"
                     /db_xref="GeneID:11508354"
     CDS             complement(163078..164583)
                     /locus_tag="MYCTH_2294026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658359.1"
                     /db_xref="GeneID:11508354"
                     /db_xref="JGIDB:Spoth2_2294026"
                     /translation="MTSFSAGQLGVSANKITKARGKMVKPILKKLAQSDKKNSLDLDR
                     GWDEQQVEQLDAGPWDGGSGYAGQARDAVGFGFASGPGLGAGADGVAGIGGGSAAIRG
                     NFKYQHGRSGSQTSAGSGPRATFVHPFAQTPRTSTPPLSYANSLASFDNGRDCSPTIT
                     ENEDDDGFETGIGAHPLAHAAHAHASQPPSAAASTSQSNLGRPSFGSQRTASFPETPA
                     SNPPSLRIHTGGRSFSGTTATSSRLAHGSFPSPSHSDAQIDSHTLSVSFSGTLDSPTG
                     SLGAGSTINSPQQSSQLSPLRTSLDMAGFPRLRSHSEIDTATRIENIRAARRKFEERE
                     REKEEKYDREMIRKRERRDNKEASRIEKGEAPSRPSMHRRKTPTGLSTVSEPAGRSSG
                     VFDRSLAFLGPSGSSSSSGTVLGIGRRRHTDIPTSSAAESEKQMGFAARRYESTSLVP
                     QTPPSFGVTVDDVHFEPAPPRRGSGAKRKTQGYWQGFLLWLRTKLLRMSTR"
     gene            175137..177353
                     /locus_tag="MYCTH_2294033"
                     /db_xref="GeneID:11505822"
     mRNA            join(175137..175464,175541..176422,176565..176859,
                     176922..177353)
                     /locus_tag="MYCTH_2294033"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003658312.1"
                     /db_xref="GeneID:11505822"
     CDS             join(175379..175464,175541..176422,176565..176859,
                     176922..177164)
                     /locus_tag="MYCTH_2294033"
                     /note="CAZy_ID 267982"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003658360.1"
                     /db_xref="GeneID:11505822"
                     /db_xref="JGIDB:Spoth2_2294033"
                     /translation="MATLMDLMFPRLDFLWSTRFWAIFHTVLWLWRYVRLIVHCISHW
                     AYKSKEPNWENPRYTSQDVTVVIPTIHNRPEELRPSLESILACKPAKLVLVTTWNKHE
                     ALSRVAATLRMPDPASPVEIEVLHVDKANKRLQVCKALEDDHVRTSITVMADDDVEWP
                     STLMPWLLAPFEDDRMGGVGTCQRVKRVVDGDIMTRIFNWLGAAYIERRNFEISATHN
                     IDGGTSCMSGRTGAYRTEILKSYSFLDNFKNEKWGRYILNADDDNFVTRWLVAHQWET
                     WIQYNSECEIETTLENSTKFLYQCSRWARSNWRSNWTSLVRERYVWTQQPWCTYALHL
                     TTFTSLAFVVDPLLLFSCWWGTENWEPRNRHILLWAEIAFMFGFTKVVKLVGLFRKNP
                     RDIVFLPVSIVFGYFHGLIKLWALFTLKKTSWGSREDGDEHNTFRLQEKPRPSQSMAT
                     PPYGPDLPKAIKYPRLSQPRRVAACSEKRKPIGCMSPAEAPYQQTAKLPVH"
     gene            <181649..>182377
                     /locus_tag="MYCTH_2121946"
                     /db_xref="GeneID:11511616"
     mRNA            join(<181649..181892,182085..182149,182264..>182377)
                     /locus_tag="MYCTH_2121946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658313.1"
                     /db_xref="GeneID:11511616"
     CDS             join(181649..181892,182085..182149,182264..182377)
                     /locus_tag="MYCTH_2121946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658361.1"
                     /db_xref="GeneID:11511616"
                     /db_xref="JGIDB:Spoth2_2121946"
                     /translation="MPDVAPAGAKSSRHAMGCMRCHLIKHVGGLSDAALPAAAPWPRQ
                     AKCTPAPAPTAVRSWLEEESCSFMTNEGEWRAVVHGEGNDQGEKNAGRKRQVTNDEAY
                     TVGMGKRARHENHRRDTTLPPSRAPAGSIGTLLPSVTE"
     gene            complement(187532..189841)
                     /locus_tag="MYCTH_2294035"
                     /db_xref="GeneID:11505890"
     mRNA            complement(187532..189841)
                     /locus_tag="MYCTH_2294035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658314.1"
                     /db_xref="GeneID:11505890"
     CDS             complement(187820..189343)
                     /locus_tag="MYCTH_2294035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658362.1"
                     /db_xref="GeneID:11505890"
                     /db_xref="JGIDB:Spoth2_2294035"
                     /translation="MSGVPNRRPPLVASRSAPDIFRRPMDPAPAPLVYINGWHGVGKE
                     TVAECLTLLLGKDKSLLIDVRSVGRETTGGGDNRYGDAGRMSRHNYHRRDEHCPPLLT
                     PEHPRYHSFDLDPDADTLGPLPSSPSFSYFSSAPPVYSSATSSSGSISSDTTLATPTS
                     PASAARPAIKTTATSPVPISVTDLMPASATVISPSKNHVSFCPVAFPTMMTKPLNTTT
                     TTTPTTTTNTTNTTNITTSPLLPSLPLTSETAALPTEEALPVPTPCSTENLAALLASP
                     ANRRRIAILPACAPDTPAGRAALRTFEAAAARAGRPFAGVVLRCGEGPRRPRRGTMPA
                     RMSSTTSMPTAAAAGGGYGGGGGRGGRGGRGGRGGRGGRGGRGSSPPPPPPAGGEAVS
                     GTEGRREDDDGSGDGGRMRSRSSPSPGADASAGAGAGPGLVEKEECRAHRHAPELARP
                     AGPGLTVDVTYVPAFEAALQIVEFVKGLEAEREAELYKDGGGGARETGGLGGERLVA"
     gene            complement(190257..191987)
                     /locus_tag="MYCTH_2294036"
                     /db_xref="GeneID:11506085"
     mRNA            complement(190257..191987)
                     /locus_tag="MYCTH_2294036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658315.1"
                     /db_xref="GeneID:11506085"
     CDS             complement(190347..191375)
                     /locus_tag="MYCTH_2294036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658363.1"
                     /db_xref="GeneID:11506085"
                     /db_xref="JGIDB:Spoth2_2294036"
                     /translation="MPSNSGMETQTRARPELPPVLTGRGDQELSCPRTMPDSATNPLY
                     SASLTLPSPLYPASPSYDHIMRAHERALVDRLGRLDHRGRRGSQQSPTTARLLSPISE
                     QQALSARHPSTTSSPLPRSPAPSPRSPGFLQSPETQTIASQTREILLKGVPGQLSQQT
                     LTSASAADGHRQSLAPALANGRRNSQQAREALRNWGHLYLDNGAIADCFVAAVALRRH
                     SDNFLTDQATAVTEQPSGGGSKVTIRALVKPCAPNRKPFLLRREFDMDSLRATIPEPS
                     PVSAGSQRSSTEITNRWPLPTGRRRSSTGESARSTLGVGKSPVRNTYTMPIRERFQGC
                     YDYLMDKH"
     gene            192231..194298
                     /locus_tag="MYCTH_2294037"
                     /db_xref="GeneID:11508645"
     mRNA            join(192231..192580,192655..194298)
                     /locus_tag="MYCTH_2294037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658316.1"
                     /db_xref="GeneID:11508645"
     CDS             join(192437..192580,192655..194046)
                     /locus_tag="MYCTH_2294037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658364.1"
                     /db_xref="GeneID:11508645"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="JGIDB:Spoth2_2294037"
                     /translation="MASLANNLANDLAEAGQAPSYKQLKEDFVSNLTGGSVAEIAQVC
                     AVAPVVSLLWSVLQTRQDFFKQYSALPFAVDFLLNVGALLLSVTLYSSVPLLLNILLL
                     LPAALVYLGFADSPSARRKKPQLPPNAQSKTSPGLPGVVSTKPFLTHYRGNMLVVTCI
                     CILAVDFRLFPRRFAKVETWGTSLMDMGVGSFVFSAGIVASRAVLKERADGKATPLGT
                     RLMRSLRHSVPLLALGVVRLLSVKGLDYAEHVTEYGVHWNFFFTLGFLPPFVALFQAA
                     LRLVPSYAGLALLLGISYQAALEGTGLKAYVLTAPRTDLLSMNREGIFSFWGYLAIFL
                     AGQDMGMLVLPRTLSPRGGIWTTRSKRTTLVVNLAGWSAVWMILYLLCTNYKYGAGLT
                     VSRRLANLPYILWVVAFNSTLVLAFCLVDVFLFPGFYRAQDVKSEREAYETATSRVLR
                     AYNRNGLPIFLLANLLTGLVNMTVPTLDVGRLGTMGILLGYMAILTSVAVGLDMRDIT
                     IKL"
     gene            197934..201666
                     /locus_tag="MYCTH_2294039"
                     /db_xref="GeneID:11505532"
     mRNA            join(197934..198837,198905..199498,199572..201666)
                     /locus_tag="MYCTH_2294039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658317.1"
                     /db_xref="GeneID:11505532"
     CDS             join(198124..198837,198905..199498,199572..201584)
                     /locus_tag="MYCTH_2294039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658365.1"
                     /db_xref="GeneID:11505532"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2294039"
                     /translation="MSSRAAAVASPVSFSAASATGSPDLQFADRGRNMPAAVPPRTSS
                     SRRAQPSERPADPHRRTYADSSRDANGRIESPDQGSRSRRNQPPHDQYGTNGTNGTSG
                     TRDPRQNPSSTAQPRSPPPNNSHSTNGPSRETSEILNSILISQPEVDIEREKQRMALA
                     QPQHQSTDDQEQDDDAAPPPVVATADPADETRRGGRSRHDHSRREKQTKFGEFILGNT
                     IGEGEFGKVKLGWKQEGGVQVAIKLIKKDQVGNNPTRMAKIMREVAILKQLTHPNIVR
                     LHKMEESDRHYGIVLEYASGGELFDYILNHRYLKDNAARRLFAQLVSGVGYLHKKGIV
                     HRDLKLENLLLDRNRNIIITDFGFANTFDPNEELTEEEEMNLTDREFVKRMGLDKIKP
                     NGTRKGDLMQTSCGSPCYAAPELVVSDSLYTGRKVDVWSCGVILYAMLAGYLPFDDDP
                     ANPEGDNINLLYKYIVNTPLTFPEYVTPHARDLLRRILVPNPRKRADLFEVARHSWLS
                     EYAHVVEFITSSTTSPKDIQNTTVPPEDDDIPTLARSASVRESSRKTTVSPAFGGLLS
                     KQGTIDSDAEAAAYAKQQRDNKRRTVQVEYVAPSTATQRGEPSGTQASTSRAGAASGT
                     RGDADIADAGSLLSSPKEKPLPPQSISTGADPYGKTPVASRKPPSTHQNANSAAAAPA
                     AAAGPPPAIRTGREGPSPSTVPGSSTNRPPTEGSLQSAGSRGPGAGKRSSYSQPVPPE
                     VADTNAQGRIQQPQRSGSSYGIPTSTSQPQTREFGRPSISQPSKFARLSGFPSETTGA
                     GISSAQGGEVKGHKRSSTMGEIGGKLFGRSGSLFGGRGRKRAEQQAGGEKGKKYPPIS
                     MNNTLAGGDESRQSVDSKRSRRSFSIGLGKKTSGSLAGSQKSHEKHARRFSFIPASFS
                     LKAIGIGKEDTNPQLDSQQDLPIQEPPTAGDDQHGHYGEQDIGEDQHVEASTLDGMYA
                     QLHEPRMSADLYGRYQQYDSNGFGQPSASQGYIPATMLSGDSDASVDNVRRPAGSAPQ
                     LPPLSHLGQEAGYDARRVAGGTKTGRGVLQKNKRFVDAWETDAYARGHDHSGSSGPAR
                     KVMDFFRRRGKARAGEMS"
     gene            complement(207354..209877)
                     /locus_tag="MYCTH_2072958"
                     /db_xref="GeneID:11511609"
     mRNA            complement(join(207354..209606,209693..209741,
                     209834..209877))
                     /locus_tag="MYCTH_2072958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658318.1"
                     /db_xref="GeneID:11511609"
     CDS             complement(join(207828..209606,209693..209741,
                     209834..209841))
                     /locus_tag="MYCTH_2072958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658366.1"
                     /db_xref="GeneID:11511609"
                     /db_xref="JGIDB:Spoth2_2072958"
                     /translation="MDYSAWPELLPTVLARIEKIAHTEFPIPAIPPTSNQPARPPSPR
                     FLAPLPSSDPFEATNQAETSSSQGTNKENVGPSSPAASRGASSATASSRPAQQQPAAP
                     AALPKPIADMLDEILTVLRTDFSQYPPHTIQRLAELVLRPRQHYRHLVPYLHALDRVV
                     HVTSGANIYPLPPALPDVGAMSLLANGAGGSGTGDLSNATVAASTLGSDEALGGALLT
                     PIPWLVGTANGSDSDEDSDAGGSSPLSTTGNPAEQLQLQQQQQQQQQQQQQQQQQQQQ
                     QQRQNGHLDGRVRTESTETIEGPNGIGSIETVSISVNGIPSTGAGAGVALVTQRSVTQ
                     GELLRQEQRAGLVPLTQLNRQQHRASIQAQHGPGGTAAEDATMTEGADEDEDDEEEEV
                     PHARGPQEIGPADTGPQSAATASYIAGAGGISPMDVQGIDVAAAVGRRVQSPPSQQER
                     GNRASGSPEGSEIVPRSPKREAGEHLEPESPAKRRKEGEQPPASASKGQGRDQWGAAE
                     QQQQQQQQHSGQGTGRTLSDEPEPEAKVDPNRDAEGDVLLSDAGDGARKEEPLAATGD
                     TTTTDGASRRADGPAAAAPEAGGGKPSTAKRGDPESGTEKKQAGG"
     gene            212645..215157
                     /locus_tag="MYCTH_2313252"
                     /db_xref="GeneID:11512886"
     mRNA            join(212645..213199,213267..213738,213802..215157)
                     /locus_tag="MYCTH_2313252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658319.1"
                     /db_xref="GeneID:11512886"
     CDS             join(213066..213199,213267..213738,213802..214296)
                     /locus_tag="MYCTH_2313252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658367.1"
                     /db_xref="GeneID:11512886"
                     /db_xref="JGIDB:Spoth2_2313252"
                     /translation="MASAVPPSSARKTRLFSSEFLASKWAKLFFFIVGLQALICVAFE
                     SYVFGRFQFSLEYQHDSEIDDTLKSQYRTIPTFLTLFIFGFLYILVLTWDALRLKNTI
                     QIIGLCVANLAIFIYAILQIDQIDKSIARLLEAGALKPDEEDRNVWALCKPFLITVPA
                     VVGVVTIIMGGLAYQLYREFAWDILKQIGADYRMKKRFLHYQIYIALLKFDFFFFLGF
                     TVQFLVIVNGLNNVELGLHIAAIPITIAILLCAAFFTQRENRLGVCFVILLYFGGLAY
                     FFFKLVRIYQPGHSQDYFAVRRSLTAFAVLTIILIILTITNGFICMQNFGNGLKAHLT
                     KPSGLDMEKEGDAGSYQLNDKAPTLPSRMTID"
     gene            complement(216132..218073)
                     /locus_tag="MYCTH_2294048"
                     /db_xref="GeneID:11513228"
     mRNA            complement(join(216132..217399,217474..217607,
                     217675..218073))
                     /locus_tag="MYCTH_2294048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658320.1"
                     /db_xref="GeneID:11513228"
     CDS             complement(join(216287..217399,217474..217607,
                     217675..217813))
                     /locus_tag="MYCTH_2294048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658368.1"
                     /db_xref="GeneID:11513228"
                     /db_xref="JGIDB:Spoth2_2294048"
                     /translation="MEAKQKLESLLDELSNAKNFPRLSAAVQDVDQVIQLLSDARDQI
                     AGAMDPHIASLTMTMLQNPVKFAFEKVNNDLKAASSAHKKVGKLLDKYFPLKQLPTEN
                     DTMGDHLPLINRAIAMHLLREGQFSVASTFISEVQGGSPQTRSTGFDEPMDEDDEDDD
                     DDDDDDDDEETGEGDGQEQGKDSHRANATGSPAAHADEYDLSSLHSQELQDKFAQMYT
                     ILQHIKAKNLLPAIEWARANSAELEARGSNLEFELSKLQYVWLFEGPAVNNLPDDEHN
                     GRAGALAYARQHFGRFQARHLREIQQLASAMVFAPNLRDSPYHNTFAISDAFTDLATS
                     FTREFCSLLGLSAESPLYLAVTAGALALPRLMKYMLATRSKGTEWTSADELPFETPLP
                     ESMLFHSIFVCPVSKEQTTEDNPPMVIPCGHMLAEETLKKLAKGTKGTRFKCPYCPSE
                     ASIKDARRVIL"
     gene            218709..222098
                     /locus_tag="MYCTH_2294051"
                     /db_xref="GeneID:11509165"
     mRNA            join(218709..219061,219138..222098)
                     /locus_tag="MYCTH_2294051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658321.1"
                     /db_xref="GeneID:11509165"
     CDS             join(218847..219061,219138..221646)
                     /locus_tag="MYCTH_2294051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658369.1"
                     /db_xref="GeneID:11509165"
                     /db_xref="JGIDB:Spoth2_2294051"
                     /translation="MSLRIPFPTAVDPRVHREEELTLARKASYQRSARSAVPETPDDA
                     AMGSVPAPPPPPNTNRRRIVLPDPVAFRFLEEDPSVSVVERRHVLPGYELYLVEQWAC
                     SRQSPTLVIAAYTGDPRHSVVVGVLEVPADEREWSPRLRVYYKAIHQYHARPKETEVG
                     ELMVTNLSSFPSALTVIPVPEGDIRKHRREFIVNENLKRLGCAGRSGLTLAEPTSATQ
                     AKFMQMYKTSDRIPFYQAVIELVKLCQVALFLFGMLDQEYIDGLLCDITETAINDWWT
                     AIGSEHFNIEPTDGILGPTTVAALLGTLLGARNRLSYWGAPVSKDAFDVESMKKGIGS
                     FQKSMRMERTRRLDRQTLLKLHSVTAKAAAGDGGWGVQKAVKSTVAEIGGKRGELVIG
                     MVGGRDKANIGDVETLDLNKVISLVSGERPKWLWHGKPRRTLQGDEQDHAPSAFGREL
                     RDEKGLQGGGRRTHSAPMEEEGGELRRNEDSSASFSPLQATHSLPVAAETAGGDRDAL
                     RRTVFKSVAGKVNDARSGLGRIRDAVGGGLRGHVSRPSKDDTPDTAASGYSSPSIATL
                     AQSSAAVTSPVAVGKAFSWKVRPEDYLPILKDKEGGGPASAGPPLGANESGGRLAAAN
                     GDQPFAEPYRTLDDKERLELALVGIGKEVRSTNASAAGSVVADGDLEGPVLAIERNSD
                     GLLLSLQRRHSIDCLASLRPHPHEARYPHRLSFSAAEDAVLSWEDLVSLTTDPKPDSN
                     DLASLRSQAELSFNLYARLQQIQAGLAPWTSSKLASVTALDHSLEEQQTELQALHDAV
                     NEAYERARHTSNELVVDERARLAETVKDIDMLAAKLEYEIGALVSRVNEVEDGVAQFE
                     AQVEDVERRAEELKEVLETESWLHWLVRTITGIGTGPNITSGVPPRMEGTR"
     gene            complement(<222288..>222738)
                     /locus_tag="MYCTH_2121955"
                     /db_xref="GeneID:11513353"
     mRNA            complement(join(<222288..222465,222641..>222738))
                     /locus_tag="MYCTH_2121955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658322.1"
                     /db_xref="GeneID:11513353"
     CDS             complement(join(222288..222465,222641..222738))
                     /locus_tag="MYCTH_2121955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658370.1"
                     /db_xref="GeneID:11513353"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Spoth2_2121955"
                     /translation="MSFLGFGRPQPTSAEKIAAVENELKVIAEMHSRMLKVCSAKCID
                     KTYREGELSKGEAVCLDRCSAKFFEAHTAISEQLQKEGAARGFGAGM"
     gene            223170..225704
                     /locus_tag="MYCTH_2294054"
                     /db_xref="GeneID:11508805"
     mRNA            223170..225704
                     /locus_tag="MYCTH_2294054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658323.1"
                     /db_xref="GeneID:11508805"
     CDS             223510..225285
                     /locus_tag="MYCTH_2294054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658371.1"
                     /db_xref="GeneID:11508805"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2294054"
                     /translation="MRPTPSLQFLRPYTWKPAGPPNPAYLRFFHLARQQELEQANALK
                     YPRLRHHGPPMRIPDFRKKYDGIQQGDVADEEVTLHGRVESIRRAGSKLVFIDLRGEF
                     ERVQGICNLGKLLDGTTVGRLKELAKLLSRGDIISVRGRATRTPTGELTIQATHLPEL
                     LTPSLVPLPTKLIDEESRKQHRHIDMLVNRRTTDILRLRSYVIKYLRDFLHERDFVEF
                     QTPILAGDAGGANARPFTVSAKAVSRDLSLRIAPELWLKRLVIGGVDRVFEIGPAFRN
                     EGIDQTHNPEFTICEFYHAYANLQDLIRLTEDLIRGVAAHCQGLIATKLTSLPPIDLT
                     PFERPFQQAEFIPTLESALGFTFPDLTSPTALADLQSLLRKHNVSLEPSDESDSSDSS
                     GSSHPSADTLPQLLDRLAAAYIEPLSAGGPLFVTHHPVCLSPLAKSFTCPRTGQAVSA
                     RTELFVAGRELANMYEEENDPFAQRSKFVDQALAKLAPTQQVRSPTAAADEEAVVIDE
                     SYVQALGSGLPPTGGWGCGVERLVMLFGGTRRIGDCLSFGTLKNVVGLSAATGKGGHG
                     PGQEEQEESGHKDKGDGSSSPAAGH"
     gene            complement(<226659..>228911)
                     /locus_tag="MYCTH_2054076"
                     /db_xref="GeneID:11508238"
     mRNA            complement(join(<226659..228421,228481..228673,
                     228744..>228911))
                     /locus_tag="MYCTH_2054076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658324.1"
                     /db_xref="GeneID:11508238"
     CDS             complement(join(226659..228421,228481..228673,
                     228744..>228911))
                     /locus_tag="MYCTH_2054076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658372.1"
                     /db_xref="GeneID:11508238"
                     /db_xref="JGIDB:Spoth2_2054076"
                     /translation="DAGTINPANDQSVVIRLLQVTELAQRVLNFISPSIGDITALAMT
                     CKRAAALTRASYDFWDFNLGSFPTDDYVEKRDGRDRVLQGDGVRSTTLIIAPASDEPK
                     NQEKPYMADFKNMLRLCKCVAITEIPSTFSSIIIDRLQFFDLALFEMMVNTMPNLKVV
                     TITRCPMLDVTKLRPLLELIKRHPLRSGTGKGSRDPPDDSWTHKAAQSPPPLVPATQV
                     DAPQGWGESPERGAKAYIRLDFFPFFFHGPPSGPRLGSYGVTHNEPTFNTPKAVFALI
                     LQCQDLAKEVGLDLLSDSSSFWSFIRQLPGPDVLWALKAREAVITRERELAEGKKTRK
                     EIENDFADDLTAALTGDNQKHPKVPPAMMRYLPSSFETKGKYWRQQERCGMCRFTYPV
                     SLFPLRRDACWSCKMTLFVLNMEDSHLRLWQETALKHWRIGLDPASDKLDQLLANGPV
                     ALSKAFYEVQYADWTWEYFLNFAPEPDLGPEGKANGNASVDDWATGTEQKVPYCPPTP
                     RSLDPTRASLARWRWAHSPATKAFDYREGGPQRAHPCMFPLSPSNVQDCDFGAEEKEH
                     FNRRWVWSWLSENLLIRVLIETRRETRARGGHLERPDVDESNHRHPFIQKQLDRARRD
                     PAWRAVVRDRERRLQNKQDKTVYMDQLAHVEDCLHSMSTLARKPFNIDKPIPDPALDR
                     AAYKKLLEEESRLPGYGFRRNGEWQ"
     gene            237169..239503
                     /locus_tag="MYCTH_2294062"
                     /db_xref="GeneID:11508260"
     mRNA            join(237169..237722,237791..237986,238047..238747,
                     238805..239159,239213..239503)
                     /locus_tag="MYCTH_2294062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658325.1"
                     /db_xref="GeneID:11508260"
     CDS             join(237424..237722,237791..237986,238047..238747,
                     238805..239159,239213..239443)
                     /locus_tag="MYCTH_2294062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658373.1"
                     /db_xref="GeneID:11508260"
                     /db_xref="JGIDB:Spoth2_2294062"
                     /translation="MADTQKPAEVPQETPATEPAAETKPAEATAAAAETEAAPAAEAA
                     QAAATETPAAAATTETEAAAAPAEEAKKDEEAKKEEPKPVEEGHLEHKGQGANFPKNF
                     LYTKQLFWFGSEPVDLKSIASFKADKVTDVAHHVTAWAAETGKGLLFYSEKGDKAAPH
                     GAIHLADASEPAVDGPNKFHFTAKGHKHTFKASSTAERDNWVAQLKTKIAEAKELAAT
                     VTESETYKKTLESLKPAPTKKEEKAPAAETVAAEPATTTTEEAAPAAEAPAAEAAKEE
                     PRKEEDKAEKEEPKRRSASRKRASIFGNLLGKKEEKKAAETEAKPVEEAPAAETSAAA
                     ESSEAPAAEAATEAAAEPATEAAATTEAAAEAKPEEQTEEAKEGEKKEEKKETTEARP
                     AHAKRTSIFSNLSFGKKKTAAPAEAPAKEAPATTEAVAETAPVIPAVETTEPLSAEVS
                     APANAPAETTEGAPATNGETKKEVKSEKRKSSLPFAFGKKKDAASSDEEAEKPKSPSA
                     FSKLRATIKGKGKAEKPEKTEETPAAPAAETEAGEAKAEAKAEEPAAEEAAKPAEAET
                     TAAAPAAAEEETPAKPLESTPAVTAAA"
     gene            complement(240434..245092)
                     /locus_tag="MYCTH_2294065"
                     /db_xref="GeneID:11513224"
     mRNA            complement(join(240434..240937,241056..245092))
                     /locus_tag="MYCTH_2294065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658326.1"
                     /db_xref="GeneID:11513224"
     CDS             complement(join(240839..240937,241056..244877))
                     /locus_tag="MYCTH_2294065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658374.1"
                     /db_xref="GeneID:11513224"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="JGIDB:Spoth2_2294065"
                     /translation="MMGGNEPGDGVTTLRLPKSQVSVASPAGSSVTSRSWSSTELPSL
                     SLSLDGWPQPSVVQLLQGIGAIELLEEDERPTFIVYLDDPRNAQPGPLNILYANVVLR
                     TAPGLLELLQHVSEQSQPDPEFSEFRAWAVSSVHEKSSPNAPVPSVTYAGLLWTCSTL
                     RKRFRIIRGYQNTLFNTPTSSPSQTREVQQPSPTPDLASNGPWAGRTPELPRESSDYF
                     GQVGRTQLRSRSEPPSRAESAADTVVRPLDDLALSSPPLRTTFDWTRIPLDDPNLPAH
                     YLFARSIDWAATSLGPIELWPFELRIMSSMVLGSPHPAALYWGRDHVAIYNEAYVSLA
                     GQKHPRLMGSRYQDAWPEIWDEVKPVFDAAWESGYATMKNDDTLFISRNGFTEETFFN
                     WAMIPLVGGDGTVVAIYNPAFENTRRRIVERRMLTLREIGIRTAQARDVKGFWAQLQK
                     GLEFNELDAPFALLYSIGEDGGIEISSLHPGSLAHPPQIVLEGSIGVPDGHPCAVTAI
                     DLQTSDEGFAPYMRECLTNSASPIVLSEADGTLPAELIQGLSWAGYGDPCRTIVVFPV
                     HPTTGGDGVVVGFIVLGTNPRRPFDADYQLFVSLLSRQLVTSLASVVLFEEEIRRGQK
                     AARLAALDHQELSLQLHLRTLEAVESEYRFTRMAELGPVGLFIADGHGKINYCNEMCS
                     RISGLPRNASTFAAWMQSIRDEDRHGTELAWRRVVEEKTAVTHEFRFEGSRELIDGHL
                     VDVWVLMSAYPERDELGELKSIFGCITDISQQKWAESVQKRRRDEAVELKRQQENFID
                     ITSHEMRNPLNAILQSADEISSGLSRFRQAGASARAPGAIDALVDSCVEAASIVSLCA
                     NHQKRIVDDILTLSKLDSNLLLVTPVDVQPITVVQDVLKMFEIELGSHKIDGHMNIEQ
                     SYQDLTVDWVKLDPSRLRQVLINLMTNAIKFTQGRPTRSIVISLGASKDALKDSFSYI
                     PSRKPTREDFTDEADWADGEKVNLHFAVTDTGPGLDENEKRILFQRFGQASPRTHVQY
                     GGSGLGLFICRTLTELQGGQIAVQSEKGQGSTFAFYIKGRKSDHPPDTSRLRTPSPNE
                     DLPLPSPIQSVPKQETPSPVPPATPTTEAAQHPLPPFPLPQSPKPQPETRRLDVLVVE
                     DNLVNQKVLKRQLELAGSNTYVANHGGEALAALRRSRFWSETAAAPAEDTATESSPPT
                     PEPEAVGDSNSHNISVILMDLEMPVMDGISCTREIRRLERQGAITQHVPIIAVTAYAR
                     PEQVENAKAAGVDGVISKPFRISELIPEIEELALKYGDMAPKPC"
     gene            245158..246054
                     /locus_tag="MYCTH_2294067"
                     /db_xref="GeneID:11511599"
     mRNA            245158..246054
                     /locus_tag="MYCTH_2294067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658327.1"
                     /db_xref="GeneID:11511599"
     CDS             245236..245523
                     /locus_tag="MYCTH_2294067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658375.1"
                     /db_xref="GeneID:11511599"
                     /db_xref="JGIDB:Spoth2_2294067"
                     /translation="MLTIIGSHPPAVSSSLSEASLSAVVVGGGGGGGGGLGLVPKRHA
                     SIINHNNERTTGASHRRLSPFLPVIRRCGAGTGLILTYTTRYRGQKRQRWR"
     gene            248665..250789
                     /locus_tag="MYCTH_2085599"
                     /db_xref="GeneID:11508171"
     mRNA            join(248665..249374,249467..249763,249875..250789)
                     /locus_tag="MYCTH_2085599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658328.1"
                     /db_xref="GeneID:11508171"
     CDS             join(249124..249374,249467..249763,249875..250136)
                     /locus_tag="MYCTH_2085599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658376.1"
                     /db_xref="GeneID:11508171"
                     /db_xref="JGIDB:Spoth2_2085599"
                     /translation="MAFTYRILRRPWRAKAPLYWGMVPELAGIVPLLVLFGLQQPDGF
                     RSLFWRIGFENKQNSNPNMILYAYANYQPLPTVPFVWSKTLTNYNVAISILSLFILLA
                     KMIATIMKVFYPIFGTIISLVLVVLYTVSIYGQAGPDYADPRYPSPTPWHLRIGCSLA
                     EPYGAAKTCRMVQATLGVTVYLLTVYLCQLGFAIWAMLPNKELDMYDSDAEDDDDDGH
                     PAKAKNKAAASVVQLQPAPAPAPAPAADKTPFTPRTQAFHALERKLPLRNS"
     gene            complement(251431..252877)
                     /locus_tag="MYCTH_2294074"
                     /db_xref="GeneID:11505629"
     mRNA            complement(join(251431..251890,251946..252576,
                     252635..252877))
                     /locus_tag="MYCTH_2294074"
                     /product="glycoside hydrolase family 79 protein"
                     /transcript_id="XM_003658329.1"
                     /db_xref="GeneID:11505629"
     CDS             complement(join(251569..251890,251946..252576,
                     252635..252794))
                     /locus_tag="MYCTH_2294074"
                     /note="CAZy_ID 270142"
                     /codon_start=1
                     /product="glycoside hydrolase family 79 protein"
                     /protein_id="XP_003658377.1"
                     /db_xref="GeneID:11505629"
                     /db_xref="JGIDB:Spoth2_2294074"
                     /translation="MFPSMKQVALLCALAGLVLAAPEYPVPGSAESNDVFDGYVSYSI
                     EFASFPDFAGNKTHPNTFSDVLLDNLGQLQGHKPYIRVGGNTQDYALYNQSLPYALNG
                     TTNPSRAVDYPTTVIIGPSYFESYDTWKDVKFSHGFNLGLGGNRSSGWQALLDTVPLA
                     CKALGNGKLYVWEYGNEPDLFSTSAQGPVRPANWSEATYVSQWHNGTRQIKALVQEHC
                     PETLESGNHGYMAPSFAGVNNYLKEPAAWAAGLDGDQDIKLFSTHNYISGATSPGVTL
                     QGTLMNHAVTKRAVDVHITEYNKILSQSSDPVPPLVFGETNSLYNQGRPGLSNTFGAA
                     LWGVDFNLYSASVGFKRVHMHMGTNFRVCVVSLFSL"
     gene            254127..256071
                     /locus_tag="MYCTH_2294077"
                     /db_xref="GeneID:11508880"
     mRNA            join(254127..254354,254423..254513,254602..256071)
                     /locus_tag="MYCTH_2294077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658330.1"
                     /db_xref="GeneID:11508880"
     CDS             join(254343..254354,254423..254513,254602..255986)
                     /locus_tag="MYCTH_2294077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658378.1"
                     /db_xref="GeneID:11508880"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Spoth2_2294077"
                     /translation="MAPKLRDPSLFKQDVCYVNGEWVKARSAKTFEVHDPATGQLIGT
                     CPEFDAQDTEKAIAAAAAAFEEFRHKTGRERSKLLRKWYDLVVENADDLATLISWENG
                     KPTADAKGEVTYAANFFEWFSEEAPRIYGDTIPSSVPGNRVFTIKEPVGVCGLITPWN
                     FPAAMITRKVGPALAVGCTVVCKAPGETPYTPLALAELAHRAGIPKGVVNVITALGNT
                     PEVGEVLTTNPTVRKVSFTGSTPVGKLLMKQCSGTLKKLSLELGGNAPFIVFDDADVD
                     QAVAGAVASKFRSSGQTCVCANRIFVQRGIYDEFATKFAAKVATFSVGNPFDTGVTHG
                     PLIHSRAIDKVEQHVRDAQQKGARVLLGGHRLPDLGANFYQPTVLVDMTTDMAMASEE
                     TFGPVAGLFPFDTEEEVVRIANSTPVGLAGYFFSRDLERVHRVAEHLEVGMVGVNTGL
                     ISDPAAPFGGVKESGFGREGSMYGIGEYQVTKMVTYGGMGKKLQS"
     gene            complement(<258394..>259574)
                     /locus_tag="MYCTH_2051419"
                     /db_xref="GeneID:11511626"
     mRNA            complement(join(<258394..258786,258842..259050,
                     259125..259414,259477..>259574))
                     /locus_tag="MYCTH_2051419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658331.1"
                     /db_xref="GeneID:11511626"
     CDS             complement(join(258394..258786,258842..259050,
                     259125..259414,259477..259574))
                     /locus_tag="MYCTH_2051419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658379.1"
                     /db_xref="GeneID:11511626"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2051419"
                     /translation="MASLFKVGTALRGRLSTYSIVKELHRAADEGAVNQNNEKCIVKS
                     IRGHWRLQNEADILKRYQDQTPFLRPLLDEIVEPSDPPSIVLKHLDSDLLTESNRKRL
                     SRPEIKQVAKCVLQALHVLHRDGLVHTDIKLDNIFVNYGQNQRFSTIQLGDCGGVVSE
                     NSDFAKEGHLIGAGFTRSPEATFQLPWGTATDIWSFGNAILSLLYGGDYHLFNPGIEG
                     FKPDDNEYELTVLKRMYKFFGPFPQSYDDFHDRETITIINYINNLGPPEKPFHRVTTR
                     EVPPADNKFIRRIMKLDPRDRPTTEQLLADEWFTEESEDTRDPVPEKPQAADA"
     gene            259914..261007
                     /locus_tag="MYCTH_2294085"
                     /db_xref="GeneID:11505795"
     mRNA            join(259914..260690,260768..261007)
                     /locus_tag="MYCTH_2294085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658332.1"
                     /db_xref="GeneID:11505795"
     CDS             join(260485..260690,260768..260876)
                     /locus_tag="MYCTH_2294085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658380.1"
                     /db_xref="GeneID:11505795"
                     /db_xref="JGIDB:Spoth2_2294085"
                     /translation="MSFNRVIAKKFLGTVLTSSGKLINISAATETDTWRRPDWAAEKV
                     KPDLEEAVPANEHVLPPDTVEVCAREGVHSSASDKRSHITAVAYNGTGKAQTVHLATQ
                     KK"
     gene            complement(<261008..261785)
                     /locus_tag="MYCTH_2294086"
                     /db_xref="GeneID:11508869"
     mRNA            complement(<261008..261785)
                     /locus_tag="MYCTH_2294086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658333.1"
                     /db_xref="GeneID:11508869"
     CDS             complement(<261111..261534)
                     /locus_tag="MYCTH_2294086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658381.1"
                     /db_xref="GeneID:11508869"
                     /db_xref="JGIDB:Spoth2_2294086"
                     /translation="MAGTGKSTIALTIAREYSDKKRLGASFFSRGGGDLASTRKFAAT
                     VAVQLAETSPELCRHIADAAASSRRIHGLGLYDQWEKLVLQPLAQLDREALPHPLVVV
                     VDALDECDNNDDVSLLIRCLAAAVTVEHVNLKVFVTTHL"
     gene            <271034..>273870
                     /locus_tag="MYCTH_2054510"
                     /db_xref="GeneID:11513016"
     mRNA            join(<271034..271141,273790..>273870)
                     /locus_tag="MYCTH_2054510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658334.1"
                     /db_xref="GeneID:11513016"
     CDS             join(<271034..271141,273790..273870)
                     /locus_tag="MYCTH_2054510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658382.1"
                     /db_xref="GeneID:11513016"
                     /db_xref="JGIDB:Spoth2_2054510"
                     /translation="KKKVKLDLPNKFDRSKEKLVRFLTTIRAYLCYYNDKFLDNKAKV
                     LYIATRLEGKALRWFEPM"
     gene            <328955..>329719
                     /locus_tag="MYCTH_2054216"
                     /db_xref="GeneID:11505899"
     mRNA            join(<328955..329099,329219..329316,329345..329482,
                     329498..329605,329630..>329719)
                     /locus_tag="MYCTH_2054216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658335.1"
                     /db_xref="GeneID:11505899"
     CDS             join(<328955..329099,329219..329316,329345..329482,
                     329498..329605,329630..329719)
                     /locus_tag="MYCTH_2054216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658383.1"
                     /db_xref="GeneID:11505899"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2054216"
                     /translation="KIELPGKYRGTKEDLVGFLTNLRSYFWLNNDKFPDKKAKVLYVA
                     TRLEASEGFWRQRQENLYIRKTRQSLTDQVSSLLYYILNNKALIQLFYNGLKEKVKDK
                     LYKYDRPKTLDKYIVQAIRIDDRLYKQGQTNGTIVKANDKKKRTYANTSYETYPGAID
                     IDVITKDKSNVTYYNCGKKGHYKQECRSPKKE"
     gene            <331915..>332076
                     /locus_tag="MYCTH_2052384"
                     /db_xref="GeneID:11505843"
     mRNA            <331915..>332076
                     /locus_tag="MYCTH_2052384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658336.1"
                     /db_xref="GeneID:11505843"
     CDS             <331915..332076
                     /locus_tag="MYCTH_2052384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658384.1"
                     /db_xref="GeneID:11505843"
                     /db_xref="JGIDB:Spoth2_2052384"
                     /translation="EELKQYLEENLRRGYICLSTLLAGYLILFIPKKDGKLWLYIDYW
                     QLNEQTMKN"
     gene            350172..353223
                     /locus_tag="MYCTH_61649"
                     /db_xref="GeneID:11505539"
     mRNA            join(350172..351201,351235..352218,352300..353223)
                     /locus_tag="MYCTH_61649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658337.1"
                     /db_xref="GeneID:11505539"
     CDS             352647..352799
                     /locus_tag="MYCTH_61649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658385.1"
                     /db_xref="GeneID:11505539"
                     /db_xref="JGIDB:Spoth2_61649"
                     /translation="MRLRTDVFHISLLEPAPKDAKIPINIEAEDEEEEWDVEEILDLY
                     IVNGKL"
     gene            <364297..>364449
                     /locus_tag="MYCTH_2052509"
                     /db_xref="GeneID:11505872"
     mRNA            <364297..>364449
                     /locus_tag="MYCTH_2052509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658338.1"
                     /db_xref="GeneID:11505872"
     CDS             <364297..364449
                     /locus_tag="MYCTH_2052509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658386.1"
                     /db_xref="GeneID:11505872"
                     /db_xref="JGIDB:Spoth2_2052509"
                     /translation="QNEELKRYLEENLRRGYIRLSTSLAGYLILFVPKKDRKLRLYVD
                     YRQLNK"
     gene            <409518..>409739
                     /locus_tag="MYCTH_36219"
                     /db_xref="GeneID:11505444"
     mRNA            <409518..>409739
                     /locus_tag="MYCTH_36219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658339.2"
                     /db_xref="GeneID:11505444"
     CDS             <409518..409739
                     /locus_tag="MYCTH_36219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658387.1"
                     /db_xref="GeneID:11505444"
                     /db_xref="JGIDB:Spoth2_36219"
                     /translation="FTVYYLDNILIFSKTIDEYRKYVRVVLDVLYVYKLLVNKEKSEF
                     YIRKTVFLGYKISLGQIRIEPSKVKAIKE"
     gene            complement(426811..429769)
                     /locus_tag="MYCTH_2294088"
                     /db_xref="GeneID:11508205"
     mRNA            complement(426811..429769)
                     /locus_tag="MYCTH_2294088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658340.1"
                     /db_xref="GeneID:11508205"
     CDS             complement(426846..429476)
                     /locus_tag="MYCTH_2294088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658388.1"
                     /db_xref="GeneID:11508205"
                     /db_xref="JGIDB:Spoth2_2294088"
                     /translation="MLSRPAFSIRKLIPSPQKKQHDGPEDYEGSYFYHDDDDEMDTLS
                     RIKTWRPPMGLMKRSKASVDVRRSEDLHQIICIPPLPDTPQSSTTSLCSVDNGSGYVV
                     NANPRSSPPRRPDRSPLASPWMSPQRSPQRSPQRSPLLLPQQFEDQQHPTRGRATEPT
                     HTLQPPQLTPPSSPPQQADMAMALETPVTSPDTLPSTPATASTGQPTSPEAVTVTPPP
                     VTPRGANNSTVSSQDVRTLTPQAGEGSGLGQTVSHRKLSDLELDKFPKPKNPSPVSAP
                     ARRKSQRRSQGSVKSVKSPTKTSMKDPLLPAQARLPSGSRPKRAKSKKSRRKPRVAAR
                     QSSVWQLTESAKDLFTIRIFHRIEVDEMLPESTLQEIRMSRAARWTRSPELGVTHIKE
                     KPKGKEGKEGKESAATTPIEPLSLDDSLDAAMAEDMVTPRASVINQATATQGEDCKTP
                     TAPSKGQLKPAGEAAIGQASTEPQVEEPPLPVQQPDSPTAKSCDGGEDEGNLPIMMVV
                     EGEPAAPPRPAPSPQLAASPMPPSLKSPTHRRMPSRQLPPLPTIPEVITTGPEEATLS
                     PTSTPLPPGTAAKANTDDYIFLDSNPYTLTMPTFRHGQIRLAKADLPIGKLAAAVDDT
                     LDWTAFQMAILGGAGDFFSEPTDYSRPSEAELDELEELTSWFGGFGFGGPGSLIGPSE
                     PRTPIQPWTPVFPRTPTLSPPSPTSTPNSSPRTVVNGRSPVMRRIDPPAATGAECSNN
                     HNNNGFSLGDSIAGRFFPSRSLVPPGPGYSPGHRRSVSSTTFGQAPSQPKLTHSASFE
                     SRNHAGLSIDATRRPSVDSIQSLPQSPMMDLVVSHDVDGNEYMVPMGFNLSHDLGDYL
                     TWQAEHVTGAGFAGDGGSHI"
     gene            complement(435096..436573)
                     /locus_tag="MYCTH_2294089"
                     /db_xref="GeneID:11508263"
     mRNA            complement(join(435096..435234,435295..436160,
                     436226..436573))
                     /locus_tag="MYCTH_2294089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658341.1"
                     /db_xref="GeneID:11508263"
     CDS             complement(join(435316..436160,436226..436394))
                     /locus_tag="MYCTH_2294089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658389.1"
                     /db_xref="GeneID:11508263"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="JGIDB:Spoth2_2294089"
                     /translation="MESQGSAPTPPILRAVASSTRPLYQLLKAINFTNKVHVDVTEHG
                     LRFAADHARVMQGVAHWSKSLFTTYTTNLPSAPNAGEDAEADDDPMFPTFQISLPALL
                     ETLQIFGAADAAARQAKADADPYRSNLRNYRPDAFSNHTLGMSGTCSLSYTREGEPFS
                     IVLDEAGVSTTCNLTTYVPEAPDDIPFDIEDLSFKIITSARWLLDALTELAPTSPEKL
                     TIVASRTEPYLRLTSSGGPLGSSSVDFAKGRDLLETFSVRGRWAQTFKFNIIKSASEA
                     MRIASKVSMRGDGQGVLSMQFMVEVEGSGPSFLDFRFVPYAVCEDDGDDDREGEEEGD
                     GTG"
     gene            complement(436586..437077)
                     /locus_tag="MYCTH_2294092"
                     /db_xref="GeneID:11508653"
     mRNA            complement(join(436586..436703,436781..437077))
                     /locus_tag="MYCTH_2294092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658342.1"
                     /db_xref="GeneID:11508653"
     CDS             complement(join(436600..436703,436781..436919))
                     /locus_tag="MYCTH_2294092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658390.1"
                     /db_xref="GeneID:11508653"
                     /db_xref="JGIDB:Spoth2_2294092"
                     /translation="MDSSLHEVWQAAAGSPFVPTVGKDSQFIVAFVLLLTGLSLGGAF
                     TLNRSVLNIPLLAVPASLALAYVDFPLLLHPQQDSN"
     gene            437199..439074
                     /locus_tag="MYCTH_61659"
                     /db_xref="GeneID:11505966"
     mRNA            join(437199..437276,437347..437471,437585..439074)
                     /locus_tag="MYCTH_61659"
                     /product="histone acetyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658343.1"
                     /db_xref="GeneID:11505966"
     CDS             join(437264..437276,437347..437471,437585..438637)
                     /locus_tag="MYCTH_61659"
                     /note="Contains conserved domains: cd04301, GNAT,
                     GCN5-related N-acetyltransferases (GNAT). cd05511,
                     Bromo_TFIID, Bromodomain, TFIID-like subfamily. COG5076,
                     COG5076, Transcription factor involved in chromatin
                     remodeling, contains bromodomain and COG0456, RimI,
                     Acetyltransferases"
                     /codon_start=1
                     /product="histone acetyltransferase-like protein"
                     /protein_id="XP_003658391.1"
                     /db_xref="GeneID:11505966"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Spoth2_61659"
                     /translation="MKDENGKRKASDEPSSPVASKRVKHDNSAEPEQKPANIPPIPYP
                     EKPAVIEERNGEIEFRVVNNDNQRESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTH
                     LSIAIVKKPLEVVGGITYRPFKGRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKAT
                     SDVMHFLTYADNYAIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTIMQCTMLPRIRYL
                     EMGRMLLKQKECVQAKIRAYSKSHIVHQPPKQWQKHGVSPIDPLSIEAIRASGWSPDM
                     DELARQPRHGPNYNQLLHLLNDLQNHPSSWPFLVPVNKDEVLDYYDVIKEPMDLSTME
                     SKLEADQYNTPEDFIRDAKLIFDNCRKYNNESTPYAKSANKLEKFMWQQIRAIPEWSH
                     LGDS"
     gene            complement(439241..>441730)
                     /locus_tag="MYCTH_75490"
                     /db_xref="GeneID:11509194"
     mRNA            complement(join(439241..440734,440797..441456,
                     441552..>441730))
                     /locus_tag="MYCTH_75490"
                     /product="glycoside hydrolase family 37 protein"
                     /transcript_id="XM_003658344.1"
                     /db_xref="GeneID:11509194"
     CDS             complement(join(439489..440734,440797..441456,
                     441552..441730))
                     /locus_tag="MYCTH_75490"
                     /note="CAZy_ID 267919"
                     /codon_start=1
                     /product="glycoside hydrolase family 37 protein"
                     /protein_id="XP_003658392.1"
                     /db_xref="GeneID:11509194"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="JGIDB:Spoth2_75490"
                     /translation="MALRHAATAALAGLSSSAAALYINGSVTAPCDSPIYCHGELLKG
                     VELAHPFVDSKTFVDMPTLKPVDEVLAAFSKLRQPLSNNSELNNFLAEYFAPAGHELE
                     EVPKGELQIDPKFLNKLEDRTIKEFVSKVIDIWPDLTRRYAGPGDCSGCANSFIPVNR
                     TFVVAGGRFREPYYWDSYWILEGLLRTGGAFTQISKNIIENFLDFIDTIGFIPNGARI
                     YYLNRSQPPLLTRMVKSYVDYTNDTSILERALPLLIKEHDFFTNNRSVSVTASNGKTY
                     TLHRYHVENNQPRPESYREDYITANNGSYYAASGIIYPVKTPLNETEKAVLYSNLASG
                     AESGWDYTARWLRVPDDAARDVYFPLRSLNVREMVPVDLNSILYENEVIIAEYLEKAG
                     NSSEAKRFASAAKQRSEAMYNLMWNATHWSYFDYNLTSNAQNIFVPADEDTASFDRYA
                     APPGQQVLFHVAQLYPFWTGAAPAHLKSNPLAVQKAYARVSRRLDTKKGAIAATNYRT
                     GQQWDQPNVWPPLQHVLMQGLLNTPATFGESDPAYQGVQKLALRLAQRYLDSTFCTWY
                     ATGGSTSDFPQLQGVSPDATGIMFEKYADSATNVAGGGGEYEVVEGFGWTNGVLIWAA
                     DVFGNKLKRPDCGNITAAHTHSEAKRSLGDGGLARRAVELDPWDAAWTKMFGRSKLRR
                     REAEDVRKRWSS"
     gene            complement(443404..445415)
                     /locus_tag="MYCTH_2294099"
                     /db_xref="GeneID:11505959"
     mRNA            complement(join(443404..444551,444629..444887,
                     444985..445415))
                     /locus_tag="MYCTH_2294099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658345.1"
                     /db_xref="GeneID:11505959"
     CDS             complement(join(443720..444551,444629..444887,
                     444985..445081))
                     /locus_tag="MYCTH_2294099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658393.1"
                     /db_xref="GeneID:11505959"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="JGIDB:Spoth2_2294099"
                     /translation="MSATNVNTAEVTGAPKHNAWVGSAGAGGYDLRSDTMTTPTPSML
                     AAIQSCTLLDDVFKEDPTTTDLENYCASLAGKEAGLFVLSGTMGNQVALRSLLTQPPH
                     GVVCDYRSHIVNYEAGGVSVLTGALAKPIVPKNGVYLTLEDIKANVHLDDDEHTCPTR
                     VISLENTLNGMIMPLDEVRRISAFAREHGIKMHCDGARLWEVVAAGAGSLVDYAACFD
                     TVTLCFSKGLGAPVGSILLGTKDLIKQARWVRKFIGGGLRQPGVITAAARVAVDETFG
                     KGPNGEGGKLRNTHILAKEVAKLWTDLGGKLVYPVHTNMVWLDLEDARCPEPRFEQLG
                     KEAGLKLMGGRLVIHYQIYERRDVVVPKLASIFKAVFESKKAGADPVSRDRVGEASMY
                     RSR"
     gene            complement(446513..448353)
                     /locus_tag="MYCTH_2294100"
                     /db_xref="GeneID:11505680"
     mRNA            complement(446513..448353)
                     /locus_tag="MYCTH_2294100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658346.1"
                     /db_xref="GeneID:11505680"
     CDS             complement(446647..448083)
                     /locus_tag="MYCTH_2294100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658394.1"
                     /db_xref="GeneID:11505680"
                     /db_xref="JGIDB:Spoth2_2294100"
                     /translation="MNLHCQLCIDLAAQVGGPLKSDEDKAKAARRAKEVVENWIENLP
                     AEYAVEKPEMRWDDEFDWVVFQRRYLHLIAYMSLFSQLRPFLARSSAEPMSELEASLR
                     AAGVDAALGLMEASWRLFENLVSVGAKFHYAIFCIFDAATVMCSAFIQDEARNLPQRE
                     TILEAIKKSLGMLAEVASQSKTTSALYRILKGLLAKLPLNARELGVIGSTKRMKGERV
                     TPSIVRAHVPTKSPTGSSSPSQGPRAEAQQNINPRHRSTSASSDSNSTPDSSNFQPHS
                     ESSISLPESGRSIGSQSLSSSPPSAEGPPQPRQVLRSNGVASTDRHLESNAFALPTPA
                     HPAYPVSTGSFMSPTSAMSTTVYVPSSGFPTTPYVQGDGFSFGPAGSIPYSQPGWQSA
                     QGAMDGLGNTLNMYEDGGLSAFNSAAPEVLQYWEWQTLGFDNPVSWSQIQAQSGIRQH
                     QAVFPDGFVGRGVANDCGASTSTEDMSR"
     gene            complement(448374..448849)
                     /locus_tag="MYCTH_2294101"
                     /db_xref="GeneID:11508490"
     mRNA            complement(448374..448849)
                     /locus_tag="MYCTH_2294101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658347.1"
                     /db_xref="GeneID:11508490"
     CDS             complement(448382..448642)
                     /locus_tag="MYCTH_2294101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658395.1"
                     /db_xref="GeneID:11508490"
                     /db_xref="JGIDB:Spoth2_2294101"
                     /translation="MDDNVRVRLETELATNVLTLANRMHAAAHKISSSIPLGKGGLVH
                     VQQLFLTAFWFKSAEKWNESWHALGRAVHAANEIGMPPSHIS"
     gene            complement(452434..>456121)
                     /locus_tag="MYCTH_2141282"
                     /db_xref="GeneID:11505868"
     mRNA            complement(452434..>456121)
                     /locus_tag="MYCTH_2141282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658348.1"
                     /db_xref="GeneID:11505868"
     CDS             complement(452564..456121)
                     /locus_tag="MYCTH_2141282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658396.1"
                     /db_xref="GeneID:11505868"
                     /db_xref="JGIDB:Spoth2_2141282"
                     /translation="MDINTNSRGSHASSKPKHISRLRKEMLQHRMHQNPFSSPPSSTG
                     SHDTVSTTTEELSRNLSDFSFSPDGEGTRRLSQELPNPSKRHASRSGRFGARQTDTVL
                     NTSVIARTFPEWTGLLSKADVSLTKTDDMAAALEPVSASPGGKENMPPNQERADENPF
                     GNVADAKRKRVRADLQARVENESDCSTVLSLSPGRPASASRRSRFAPTQPGAVLSPDA
                     AKRSLQDMASKIRTEKHTTRHDATPKRSLSDAQPDHATPAHAVGLDNSVITPTSRSFF
                     LPPLRHLPDWTSGTLKFSTMKNGVPVFVRSGKSGVRLDKHGRDHDEIHEVGISKEDEE
                     IFVSMDKLQEEVRELHDHDAMLQREAERLQREVDLLQAELKRLKGRKLSDSAIGSESD
                     ASFRRSGGPNEDLEREIAQLRDRLDQASRQVGVNDIHTAALTAERDEALHQASVARER
                     ATKLQAELEATQRDLESSLHLLQEKEELQLENENLLAENQTLKNQRDSALQNNKSLTA
                     ENDKLRRELSGVQKDLRMTREELVSVRKQYEALQEEKRQLAQDHASMERNNDNYYKEN
                     KKLQAQVAARDQHIADLKKGISSRDKMLENIEGLTTNTAVLELNAELQAEAERLQTKT
                     EKLAAELQRKDSELSVREGRIRSLKEENLDLSIENERLREENQRLRSEQEETHGQWVN
                     ERLKAARHNQSRSNKAVDDDTDDCVRLDDDFKQREAALRKKLERREAAVQKVKRLSNR
                     ISEIAEQEFTGKSAKVTRIVEPRESQTAMDDMTGKSSAVNVDDDPTRELHLTDGDSDF
                     ASVMEGEIVKLKHTYRELQKRAQQQDLEVTDHLPPSLPPTLQRSKSDSGIPSKSAQQK
                     AQPPGILKKSSQFEDTGRFSVKSALSVASLQTEEEAPNTVRNRRSSQGNTQDLPRPGS
                     RLRRNSEADRDATEPNMTSAFFMPDITLDGPKQGTAKDLPQQPLPSLSRDARRVLDGI
                     CKHNSVNCNICVRIAAHGSGGNNSFEKTTSAPAGHRTTSTAAPASNKILITPEDVRRG
                     KKIVSAEKPIPVSDRMHQPPLSGQEDPTVRPAMPPGEALAVLIKETQDEIDHLQMELK
                     KLNEIYFGLDKSIGMRERRRVMSEIKRLQGELEAKSGHLYRLHDVLEGQKQAGQLMEG
                     DGVDVTVLSGLLRAELEGDGEEIGGTETGRSGEVWEGFE"
     gene            complement(456699..458496)
                     /locus_tag="MYCTH_2294104"
                     /db_xref="GeneID:11508129"
     mRNA            complement(join(456699..457168,457263..457550,
                     457614..457812,457887..458496))
                     /locus_tag="MYCTH_2294104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658349.1"
                     /db_xref="GeneID:11508129"
     CDS             complement(join(456929..457168,457263..457550,
                     457614..457812,457887..458020))
                     /locus_tag="MYCTH_2294104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658397.1"
                     /db_xref="GeneID:11508129"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="JGIDB:Spoth2_2294104"
                     /translation="MRLIQSITTALLLLAAGVAQAASAWGFDDGSVQVAAKKGDSIKE
                     SLSQKGPLANPISLGSADTLKLILTAKENGKGKRPHQAFLVLQERESGLEAPFPLTVK
                     ETGKAVVQISQKDLPIQLRVATEPLKASVVLASFGSVQGLDAPVFDLKIEQDAAIPPP
                     TYEKPLRYGKKPEIHHIFRPDPKNPPKLVSLVFGFAVIATLPALLIGWVALGGNLNHL
                     SKAFGAAPLSHATFFGSVLAMEFVFFLYYTTWNLFQVLPVMGAVAAVTLLSGTRALGE
                     VQSRRLAGER"
     gene            460865..461730
                     /locus_tag="MYCTH_2313262"
                     /db_xref="GeneID:11505420"
     mRNA            join(460865..460947,461058..461730)
                     /locus_tag="MYCTH_2313262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658350.1"
                     /db_xref="GeneID:11505420"
     CDS             join(460906..460947,461058..461459)
                     /locus_tag="MYCTH_2313262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658398.1"
                     /db_xref="GeneID:11505420"
                     /db_xref="JGIDB:Spoth2_2313262"
                     /translation="MGASGPTLDNSCDPETLTYGCVCSDGKQPNVSEYTLTLPYYVCM
                     AWGEQCVEGCGDDNQCQSDCREKHPCGAQSPKKANTTQTSSSTTASATAAPTDQVFDG
                     LGDGSDDSDSDSSNKGNAAGALRLGDSYGVALLAGSLFAGFALVL"
     gene            complement(461839..463906)
                     /locus_tag="MYCTH_2294109"
                     /db_xref="GeneID:11508485"
     mRNA            complement(join(461839..463002,463078..463198,
                     463264..463280,463371..463906))
                     /locus_tag="MYCTH_2294109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658351.1"
                     /db_xref="GeneID:11508485"
     CDS             complement(join(461936..463002,463078..463198,
                     463264..463280,463371..463638))
                     /locus_tag="MYCTH_2294109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658399.1"
                     /db_xref="GeneID:11508485"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Spoth2_2294109"
                     /translation="MRARDVLEAAAASTERWAQGKPLSYLDGVPFGVKDDVDVEGYVS
                     LMGMKVNDAHKYFNTLPERSAWPVRKLKEAGAIMMGKLNQHEIGMDTTGCNPTTGTPR
                     NWYNKSYYPGGSSSGCASAVSAGLVPIAVGSDAGGSIRIPSAFCGVYGLKPTHNRVCH
                     MSSSVCALGPIASTAADLTIAYRFMAQPNPEDPVQSLFAVSTPPEPSAKKYLGICREW
                     IGGTVDQDVLRILDQSLDHLVALGYEVIDIRLPFLREGQLAHSAICVTEAAADARNRA
                     ETPSSFLDMLNYPNRVVIGTGSQTPAIDFLKYGQIRQVIMQHLAFLWEKYPGMMILSP
                     ATPMAGWPITEGDDKYGCFDGNMSIRNMTYAWLANLSGCPAVSFPAGYVEPKQGEGML
                     PVGLMAMGEWGAEEQLLAFARERESYLNDVYPGGRRRPEQWADPIGEARKWADLARAS
                     RQNVAEAQEARAAALAAGKNVDKDGNIEGEEDQQKEEGEH"
     gene            464955..467322
                     /locus_tag="MYCTH_2294110"
                     /db_xref="GeneID:11508433"
     mRNA            join(464955..465364,465478..465587,465692..465817,
                     465895..467322)
                     /locus_tag="MYCTH_2294110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658352.1"
                     /db_xref="GeneID:11508433"
     CDS             join(465346..465364,465478..465587,465692..465817,
                     465895..466932)
                     /locus_tag="MYCTH_2294110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658400.1"
                     /db_xref="GeneID:11508433"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Spoth2_2294110"
                     /translation="MDFYSSKQAAAECVSDEALIHLKSYKYSAVDKSPISNYILRPYW
                     NAFVELLPLWLAPNMVTLLGFMCILFNVGLMVIMVPDLEGPAPSWVYYSFALGLFMYQ
                     TFDNVDGKQARRTGTSSGLGELFDHGIDSLNCTLASLLETAALGLGTSQSGVFTALCP
                     CLPMFFSTWETYHTHTLYLGVINGPTEGLLLACTFMILSGYYGPGIWTEPLVKLFGPR
                     IEALRILGLTDETLAHLSIRDFWVAFIVLSLLFTHIPFCIYHVVKARRARNLPVAPVF
                     LEWTPMVVYTVSIGAWLYSPYSTICSENHLVLFCFIMSFVFGRMTTKMILAHLTRQPF
                     PYWTVMLWPLVGGAVLGNLPRLGLPAVSAKVEYMYLLGYLVFAAVVYFRWAWLVTTSI
                     CRFLGINCLTIPYEKQRLVHQQSQGILNGMPANGRKVD"
     gene            complement(467324..469123)
                     /locus_tag="MYCTH_2294115"
                     /db_xref="GeneID:11513101"
     mRNA            complement(join(467324..467599,467719..467897,
                     468157..469123))
                     /locus_tag="MYCTH_2294115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658353.1"
                     /db_xref="GeneID:11513101"
     CDS             complement(join(467536..467599,467719..467897,
                     468157..468993))
                     /locus_tag="MYCTH_2294115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658401.1"
                     /db_xref="GeneID:11513101"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2294115"
                     /translation="MASEHESEQHPQQSVQRAHPPEPSPNGGGSGSGSAARDGDEEPA
                     KQTPPEQTPPEDGIAQPVASTSHERGCGPDPDPDPESNRAPLFPEDGDGGNDAASDVS
                     IPSDDAASHEVVSPSASIPPYWTNPRLLERQQQKQQQQNGQQPRPHTATASSSSSSSS
                     SGRLLGQHGHARTVSSASAESVLPPGAITLQDNEREEEGGGEGVNGSGGAVGNGRASV
                     GPAGAVAGGGRRSNGGDRHGRERNRACWARSVQVTDYVLVNGSTTNIGAFVVWIIKVE
                     TLNGSRMNIRKRYSEFDDLRRRLVQTFPGFEAAVPALPPKSVLKRFHPRFLEKRRAGL
                     QYFLNCILLNPEFSGSPVLKDFLFS"
     gene            complement(469739..471740)
                     /locus_tag="MYCTH_2294116"
                     /db_xref="GeneID:11508722"
     mRNA            complement(join(469739..470396,470536..471740))
                     /locus_tag="MYCTH_2294116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658354.1"
                     /db_xref="GeneID:11508722"
     CDS             complement(join(469883..470396,470536..471284))
                     /locus_tag="MYCTH_2294116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658402.1"
                     /db_xref="GeneID:11508722"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="JGIDB:Spoth2_2294116"
                     /translation="MRHLFTSLLLLALTIIQARPSFAYTPLSDATLRHLPRLFSSSSS
                     SPSSSSSPSSSSSSSENYSDGFDPDFDPTHGALLAPILRPRVPGTPGHAAVQEHFAAF
                     ARDRLHAGWAAEWHNTTSATPATGDRAVPFRNLVLRRDPPWTTAPAPAPASASASREG
                     DVARLTLAAHYDSLYRPEGFVGAVDSAVPCALLLFVARAVDAALTRRWEAAERSGEAG
                     LDGEEKGLQILLLDGEEAWVEWSERDSLYGSRALAEAWERTRYEAGSSFSTPLEAISL
                     FVLLDLLGAAEPNIPSYFPKTHWAYQNLAKIEERLRKLDLLETKPRKPFLAESGKEAT
                     RFRGFVQDDHVPFMRRGVDILHIIPSPFPSVWHTMDDDGPHLDVPTIRDWAKIMTAFV
                     AEWMDLEGYFPDMAPSDAGDKYSEKEEL"
     gene            476593..477398
                     /locus_tag="MYCTH_2294124"
                     /db_xref="GeneID:11509016"
     mRNA            476593..477398
                     /locus_tag="MYCTH_2294124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658355.1"
                     /db_xref="GeneID:11509016"
     CDS             476683..477060
                     /locus_tag="MYCTH_2294124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658403.1"
                     /db_xref="GeneID:11509016"
                     /db_xref="JGIDB:Spoth2_2294124"
                     /translation="MADRIPRNRRDLKRERHAIAIKIEREGYEVAMPCERCWNAKPRK
                     RCVMMEGLNKCQNCVRMGKKCSSPNVTDAYRFLVVFLCSLGLLTVLVLSNLSEQEKVS
                     KEIAETEALLAQMLSRLSRLRRL"
     gene            <518303..>519371
                     /locus_tag="MYCTH_2114100"
                     /db_xref="GeneID:11511582"
     mRNA            join(<518303..518589,518684..518853,518944..>519371)
                     /locus_tag="MYCTH_2114100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658356.1"
                     /db_xref="GeneID:11511582"
     CDS             join(518303..518589,518684..518853,518944..519371)
                     /locus_tag="MYCTH_2114100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658404.1"
                     /db_xref="GeneID:11511582"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2114100"
                     /translation="MSLRPVFLITGASSGFGEAIAHEALSRGHHVIATARNAARLSAL
                     RSAGATVFDLDVTSDDATLADIFAKAHAVHGRITHVVNCAGYLLEGAVEEASAKEVFD
                     LFNTNVLETCNIARAAAPYLRESAGTPGQTAALATFGSLGSWWLGAAVAHYCSTKFAV
                     SGLTEGLAEELRPFGVDVYCFEPGYTRTGFLKNGAADGGDHRIKTARRMDVYHETEAE
                     KMRGAMDAYNGKQPGDVVKCAHVIVDVLTKEGVAKGREVQVRVVLGSDTIEAVRAKCN
                     DTLKLVEEWEDISRSVMH"
     gene            519962..>520732
                     /locus_tag="MYCTH_2313270"
                     /db_xref="GeneID:11505394"
     mRNA            519962..>520732
                     /locus_tag="MYCTH_2313270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658357.1"
                     /db_xref="GeneID:11505394"
     CDS             520059..>520732
                     /locus_tag="MYCTH_2313270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658405.1"
                     /db_xref="GeneID:11505394"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="JGIDB:Spoth2_2313270"
                     /translation="MDTSNPATDVEHPGTASLVPPSSQDPPGQRPAGPDAERRGSQGS
                     ISSTRSSRSHQEYLDSLTVPSKEQISRIAEKQAEREAEHKRAHRHKQHQSIDAVLAPA
                     IPAEPQPEQSHRIPLANRFGFNFGCRPSLSDDGLRTHAATVIQRTYRGYRARREVKGL
                     CINASTRWVHAVREAQWRELTTPHARSDLVGDGSEGPERPAAGRRSSTARQNWKKVSA
                     IARHAGG"
     gene            complement(520726..>526811)
                     /locus_tag="MYCTH_2136371"
                     /db_xref="GeneID:11508673"
     mRNA            complement(join(520726..522629,522745..522783,
                     523288..526285,526369..>526811))
                     /locus_tag="MYCTH_2136371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658358.1"
                     /db_xref="GeneID:11508673"
     CDS             complement(join(522594..522629,522745..522783,
                     523288..526285,526369..526811))
                     /locus_tag="MYCTH_2136371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658406.1"
                     /db_xref="GeneID:11508673"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="JGIDB:Spoth2_2136371"
                     /translation="MTEVPPTATSQRGSHRGRGWRGSRFRRGRQHGPRRSDPPAEGSQ
                     PVQPAQPAQPEPAVSSREPVATASQAVDVAPRLDPQPGRGSGGRGRRGGGRRGTGQRS
                     IVVSHRGGRGPHPVPGSGGSGPSGPGLSAAAPEFVPGQPVSISSLGPETASQVLPKST
                     AEDLPTRIHEDIDHRQYECVICTNEVLRNSKVWSCSVCWTVTHLHCVKKWHTNQMKER
                     RENPGPNQPEGWRCPGCNSTLHEEPGPYRCWCGKDVDPKPIAGLPPHTCGQTCSKPRA
                     TCPHQCSLMCHAGPCPPCTLMGPTQTCFCGKNTFTKRCSETDYAKGWSCGEPCGDLLP
                     CGEHYCTQTCHAGLCGSCEVPVWATCYCGKESREISCSQRNDILESFNYGQVTPRSTP
                     SGEEHTSDAWFEGSFQCDNVCGRPFDCGHHTCQKPCHVQDEGAAHCPLSPDVVTHCPC
                     GKTSLDSMPLEPRKSCQDPVPHCKKPCNKVLACGHLCPDECHIGPCAPCTQYADISCR
                     CGRTTVRSVCHQGNVSHPLCFRICRAQLNCGRHECGEHCCPGEKAAAERRKQKRSVNE
                     NYEPEHICLQVCGRRLKCGKHTCQQLCHKGPCMSCPEAIFDEISCACGRTVLQPPQPC
                     GTRPPECRFLCTRPRPCGHPSVEHQCHPDDASCPRCPFLMEKPCICGKKVLKNQPCWF
                     EEGRCGLPCGKKLKCGIHECGKSCHKPGECEDAGISGSHCSQPCGKVRKSCEHTCADQ
                     CHAPYPCMEDKPCQSKTFITCPCQHRKQEVRCQATLLNPFPTKESTLKCDDECLRLQR
                     NRKLAEALNIDPATHTDDHIPYSDTTLRRFRENVSWAQEQERQLRLFAADPEEKRIRF
                     KPMPSHQRAFIHALAEDFGLETESQDPEPHRHVCVFKTPRFVSAPQKTLAQCIRIANT
                     AAKLGTGTSTVKSAQATPAQKPQPPSFNALLLKDPRFGLTIDELEAALSPELAAASRF
                     GPALSFTTSFLPSTDEIVIKATPNLTAAAVATSLASTPQAVEAVLNKLKSEAAKKVVS
                     QQRLVGTVALCHVDASGAITRREKDTGAANSGGWSAVASRGSWRKIASKAPAEATAAE
                     QRAPSAFVALRRLEARKKKEATAPVEEDWLAAVEKEKEEQGGEAGSSNGSEIVDTAGD
                     GTWREEELTQDVAHTDQRRLVPDGE"
     gene            <529458..>530414
                     /locus_tag="MYCTH_2053555"
                     /db_xref="GeneID:11512960"
     mRNA            <529458..>530414
                     /locus_tag="MYCTH_2053555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658359.1"
                     /db_xref="GeneID:11512960"
     CDS             529458..530414
                     /locus_tag="MYCTH_2053555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658407.1"
                     /db_xref="GeneID:11512960"
                     /db_xref="JGIDB:Spoth2_2053555"
                     /translation="MEPVPETERMEEFRSSPLPSLRLSPTTALGAHEPDILRKPPTVR
                     RSTDPPSPPPISPSWMPPALPYRPRASSPLSSSHVRSRSAASLAPPMARTQSMPSTNA
                     TGHLLYSPHIRPQSPSGTPSRIRLPRKPVDETFPSSPTRISIFDHERKTPEGSSSPNL
                     AMGITPLASVPKLRRPSSPLCQVSHAPTTPSSLATSPSHRPYDSLSGGNYGYSGTYPS
                     SSVPSTPTSARSRSPSISSLETIPDSPDAEEAALEAERIAQLKAAADAADAGDTKGRS
                     SLDVPIRGRTLSGFSSRDKRKRWSVCGAERRQDLDLETIWED"
     gene            complement(530937..532648)
                     /locus_tag="MYCTH_2294137"
                     /db_xref="GeneID:11513043"
     mRNA            complement(530937..532648)
                     /locus_tag="MYCTH_2294137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658360.1"
                     /db_xref="GeneID:11513043"
     CDS             complement(531174..532565)
                     /locus_tag="MYCTH_2294137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658408.1"
                     /db_xref="GeneID:11513043"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="JGIDB:Spoth2_2294137"
                     /translation="MMTSTSPPTVPEKKDQNPDSGAAPRPGPSGAIPNLRDRIPKLEP
                     RRRKAEPANPMPVPETPPAPPRPDPATLNFTVPTRRILSQSDHQLFLSSPTYTLILSF
                     IFGLSDSVVDRPISSVKDADLSPTVRAILAILDEVEALCADSPPEDQGGSRFGNKAFR
                     VFLDKVKKRAPAWHTTLLRVPHPAAVPELSAYLCHSFGNRARIDYGSGHELNFFMWLL
                     CLHQLSLLSPAPDFPALVLRVFARYLTVMRRVQGAYYLEPAGSHGVWGLDDYQFLPFL
                     FGASQLLHHPFLTPRAVHHELTLEEFGPEYLYLGQVAFVNSTKTVKGLRWHSPMLDDI
                     SGAKNWAKIEAGMRRMFVTEVLGKLPVMQHFLFGSLIPAAEGMSEPPPPPPRRSSKEG
                     GAGEEGAEEEDGDEEEGGEVEVFDDQNGVRHVHQPSGWGDCCGIRVPSSIAAAAEMKK
                     KGAGEQLRRIPFD"
     gene            533008..534142
                     /locus_tag="MYCTH_2294138"
                     /db_xref="GeneID:11505418"
     mRNA            join(533008..533353,533435..533592,533672..534142)
                     /locus_tag="MYCTH_2294138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658361.1"
                     /db_xref="GeneID:11505418"
     CDS             join(533164..533353,533435..533592,533672..534085)
                     /locus_tag="MYCTH_2294138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658409.1"
                     /db_xref="GeneID:11505418"
                     /db_xref="JGIDB:Spoth2_2294138"
                     /translation="MTATTAPEAALGVLPRSDGSAKYSHAGYTVTASVNGPIEAQRRD
                     EHAYEAHVDVVVRPAAGVGGTRERHLESLLQSSLTQLILVKNFPRSLIQIVLQIEDSP
                     ENDHVNTKLVQASLNFAIMPALVQAAILALLSAGVPMRATATATAVAIVRQDGGKRTI
                     VDPSPREVETAESVHVLGFTSHDGLLLAESEGDFTVSEWDQVYEIARAICCRSAPAKE
                     GMAMVLDDEQTSGPDMRQFLRSAMESKVAADLHWK"
     gene            537723..540260
                     /locus_tag="MYCTH_2294143"
                     /db_xref="GeneID:11505705"
     mRNA            join(537723..539424,539524..540260)
                     /locus_tag="MYCTH_2294143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658362.1"
                     /db_xref="GeneID:11505705"
     CDS             join(537873..539424,539524..540038)
                     /locus_tag="MYCTH_2294143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658410.1"
                     /db_xref="GeneID:11505705"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="JGIDB:Spoth2_2294143"
                     /translation="MSGSIHPVPGIPADIPHPLRQERYALDGVNKPSSAISETSLAPN
                     GFLPLTLAPPDNGDPSSSSSPADLDDDATVTATSSSAADAAAAPPAAPPATITTTTTE
                     NRDDGFVAAPQSTLPITGALVPPDSDFSQQQQQKQQQQQQQYSPYSSRPGSAATACPA
                     PARGHRKNVPSTESVPRQTILKALASVARNNKPQALSLTGMLSAHSASNGADDRPESA
                     SSQQLCDALNGLAKAQNARSISAVTPTAAFPALQSPCFYHNGFDDAVNLDKVLEEIKD
                     DESMSHSRLVQTARSVREVSKQLQRRPFKRAFKNVMIVTKARDNQLVLLTRELAMFLL
                     LTPRYGSDVGVNVYVDAKLRHSKRFDARGITDLDPRFKEMLKYWTPDLCWSQPETFDL
                     VLTLGGDGTVLYTSWLFQRIVPPVLSFSLGSLGFLTKFEFEQYKDHLNRVMGDEGIRV
                     NFRMRFTCTVYRDGKGQEVEEGEQFEVLNELVIDRGPSPYVSNLELYGDDELLTVVQA
                     DGCIFSTPTGSTAYSLSAGGSLVHPDIPAILLTPICPHTLSFRPMVLSDTMCLRVSVP
                     RNSRATAYCAFDGKGRIELKQGDHVTITASQYPFPTVLRTPTEWFDSVSRTLRWNVRA
                     ATQKGFDLGGGNKGGKADGNNGESADGSEDDEGWDIDTDSACYASEENSTAASPLRRQ
                     MSMLGL"
     gene            complement(541819..544600)
                     /locus_tag="MYCTH_2294145"
                     /db_xref="GeneID:11506068"
     mRNA            complement(join(541819..543203,543256..543692,
                     543761..543872,543974..544600))
                     /locus_tag="MYCTH_2294145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658363.1"
                     /db_xref="GeneID:11506068"
     CDS             complement(join(542075..543203,543256..543692,
                     543761..543872,543974..544239))
                     /locus_tag="MYCTH_2294145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658411.1"
                     /db_xref="GeneID:11506068"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="JGIDB:Spoth2_2294145"
                     /translation="MASESSPQSSSQASPQASPQASSLASSQSSSQASPPPAASPAGS
                     LQSSATTPGASQQSLQTNSDSVSPSATREDRPKSQHPKGKRNRTSPADKAVLMQAYKQ
                     NPQPSQDEIAEITSRVSMSKQAVRIWFQNRRQNDRRKARPLSPQLIETITQGRISVSR
                     FAADPAGNNPCNPESFPADSKGLSPPELRAGSSGLPDSTGCRSDVGPGGASQARPEGG
                     SFTSQGRELVTSADPAPPVPSWSTSGTPGYLANRRNAASAPSFASNPSHHEPLKSQPL
                     PSPSSQPNPSCTGPDASAWKPSSQPSQIRLSMSITGQAEIVEAVDSPPRPIPPPTPVE
                     PVPWPDLSKSSVPRRSSLSAYSSRRVPRLLRGRSSDVHVWEDCASATSQEDPLIAQAK
                     HESSGSATAEISLLRSLSSVSANSFDQSIGSRAKRRSHLLAHTAESRHAVLKRPRLER
                     AWSSQARIETTSALSQRHNIQRVPSYTTSKPKPMSGLDHLSLLASESDKENLSPDEDG
                     NPRPFRRTLSSVTNPSGRRRLPSGPPSDKNGEKNPRRTLLDPQQHRPSASLSRSATSP
                     VSSSSWAAYSKQFQTGGSRQRRSPVKPDVPLIYEDDNDDRDEGGDADEVQRFMAAAAA
                     EISPSKKKEVDAAANLIALKFAR"
     gene            complement(<545182..>546690)
                     /locus_tag="MYCTH_2050335"
                     /db_xref="GeneID:11508155"
     mRNA            complement(join(<545182..546333,546499..>546690))
                     /locus_tag="MYCTH_2050335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658364.1"
                     /db_xref="GeneID:11508155"
     CDS             complement(join(545182..546333,546499..>546690))
                     /locus_tag="MYCTH_2050335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658412.1"
                     /db_xref="GeneID:11508155"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="JGIDB:Spoth2_2050335"
                     /translation="GACEPALNASFLQVKKEGANKGRWFYTCQKPREEQCRFFLWEDA
                     ARAREKSARNEPSVFNRPRTRRPASSGGTPQWDIASTVTSSGPLYSPASSIPFTPGPR
                     QRIFRGVPRAGAASWSSDEDEDEDGDDSGADDDRRAGTTTPTPKRKRSDVDDAAAPDA
                     PSPSRNAATDLSDLDAEMADELVEVTNQAERLHRPRLAQPPHHRSQISGPHTTPSRAG
                     LGRGDLSTPESGNSFASVTSGGPDAKRLRTARGVPVTPTPARTRNALAGAAAQRQSTL
                     SSPATATTTTTTATTPTATTPTAALSPPGNSHEGDAEITTTVLSLLRAEPVSAAARRA
                     VREELNRHARRARGVEQARDSLRQTLRARETALAELRARVAQLENERRMRREVLRSDL
                     LALSQEDLLLSSSLEGEGEGDGEGEGEGQGQGSGLVRVRARALTSGRSGGVTSDL"
     gene            complement(547530..550312)
                     /locus_tag="MYCTH_2294147"
                     /db_xref="GeneID:11508080"
     mRNA            complement(547530..550312)
                     /locus_tag="MYCTH_2294147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658365.1"
                     /db_xref="GeneID:11508080"
     CDS             complement(547795..550164)
                     /locus_tag="MYCTH_2294147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658413.1"
                     /db_xref="GeneID:11508080"
                     /db_xref="InterPro:IPR006816"
                     /db_xref="JGIDB:Spoth2_2294147"
                     /translation="MDQADIPALLARLASDEDAARKMAVFKLQSSINDPAFADVFISS
                     GGLAILRRLIMVTGGNTLAYSLQSLTRLLEVDMGWDIFEGPGAGELVERIVELIVKNP
                     LVNILRGAMSILVALVGRSQSSSTSSASPPPPPPPAGAPGGENGNGAGRPPPPRAPPP
                     GTFGFRALKPAVAVYPHFFELVIQQLQSADHALCANALMLINALIRDAVSGDGSSNNG
                     TGEEWSKFIKRLQDLGLIRAVYNLLQSSALQDLALPLLEFQSLTKVLLRKWREVRVDL
                     ERPEHRRALKGLHLASAPDRRHVNGVAAGLAAEEGDASRKGSRKHNPEKWRRLGFETE
                     SPAAEFETAGFLGMMDLTDYVRKNEDGFQKLLLEQSTRPLSERCPVAKASLAVTMILY
                     DHFEVDKSDNEDIRVYLTLGDAKSHDKLFRPLLLQWSRLHTAGLHAFFRLWKSTGARR
                     DDFDKVAELVRVLVEQVVGQASRTKDVLEVEDELHEYDAGRLREIQMELLELSFDDQW
                     GPHLVQVREELKHEALQFVKEQRIRCLLQGSWFTKPMPHVRQESQTKRPLYQPWRFAK
                     LSHNRRYLHYADFPEKLPYDPGLDALTEKIDLGTISSVVSNVSANPEADCAGSAAATE
                     ADGDNQSHNSSTTTFRHHHAAARPTTKITIYSFVEDIMAPPSSNTPHSLDNNTTATST
                     PAPNRNSNSNSTGTGTGEPREQPVLTLYPPNHSLASEWLDGLLMLLNQAPITAETNKL
                     VTLISEYGLKIRLLNVRLEHMYAGPPPQGSGVGVVPSREGLDEDYYYDI"
     gene            complement(551831..557361)
                     /locus_tag="MYCTH_2294148"
                     /db_xref="GeneID:11508616"
     mRNA            complement(join(551831..553338,553398..556099,
                     556162..556462,556550..557361))
                     /locus_tag="MYCTH_2294148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658366.1"
                     /db_xref="GeneID:11508616"
     CDS             complement(join(552019..553338,553398..556099,
                     556162..556462,556550..556741))
                     /locus_tag="MYCTH_2294148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658414.1"
                     /db_xref="GeneID:11508616"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Spoth2_2294148"
                     /translation="MATTAAANELKQQGAIEASRDPNSNVTAEDAERRIVEDSMGAGV
                     TAFTFDPDASPEEKKAQAREAIPEGFHHRPKGVAIVSDIDGGTTADVDLPSPSKAGAV
                     EVVKDESGKLVADGQAIEEEFDWSKAGWAPRFGWPDEPADEGEDMLDHSTWVESQLSE
                     KFFGDWYHNAAVIAFACLSSWLVAVLGGGLAWVFIIMAICATYYRTSIRRVRRNFRDD
                     ITRELSLKKLETDNESVEWINSFLVKFWPIYQPVLAQTVINTVDQVLSNATPAFLDSL
                     KLKSFTLGSKPPRMEHVKTYPKAEDDVVIMDWMFSFTPNDTADMTARQIKNKVNPKVI
                     LEIRVGKSMVSKGLDVIVEDMAFTGLMRLKIKLQIPFPHVEKIEMSFLERPTIDYVCK
                     PLGGETFGFDINFIPGLEKFIMEQIHGTLAPMMYAPNVFPIEVAKMLAGTPVDQAIGV
                     IAITLHGAQGLKNTDKFAGTPDPYAVVSLNKRQPLAQTKVVKENANPRWNETHYVIIT
                     SFNDSLDIEVFDYNDIRKDKKLGSASFALENVEEVYDHENERLELKHDGKARGVVLAD
                     IRFFPVLEPREGEDGAAEPAPESNQGILRFTVEQAKELDGSKSLVGLLNPYAMLLLNG
                     KEVHTTKKLKRTNNPIWDNGSKEILITDKKNAKLGVAIKDDRDIAGDQLVGTYQIKLE
                     DMLELMAKGREWYNLAGVKTGRVKMMAQWRPVAIAGIATGTGGYRTPIGVLRVHFKYA
                     RQLRNVEALGKSDPYARIVSAGIERGRTVTFKNNLDPDWDEVLYIPLQSPKGRMQLEV
                     MDAENVGKDRSLGLTEIDKADYVIQGENGEWLVHDEKVEHHDGLRMHGKGTAKGVLTY
                     TVAFYPTLNVADPEEEEEKEKEKEKGDEKQQEQENGQEKKEAGSDKDKSSLSRPSLDA
                     RASVRQSLDVRSNDGKELSAPATPTSPTSVISPRRSRDEREPPKVYLTPEELLRHDCG
                     VVIFRLMEAELPRSQCRIEVYVDDMAFPSYVSSTAKSRNNKFDEIGDCFIRELEFSKL
                     TIVVTEKGDKHDDAHEKRALARLSGNTLDTLKQCLNNPTVLKMRGEDGEMYSVRVSLK
                     YVPVRMQLDPSESINNMGNLRVDVLDAQDLPAADSNGKSDPFVRFELNGQEVFKTKTQ
                     KKTLNPTWGEVFNVSIPSRTAAKFRATVWDWDFADKPDYLGGVDINLAQLESFRAQEF
                     RYVLDGKSGVLRVRMLFTPDYVTRTRQGTSTLAGTFSVPTRIVTGVAGVPIKGGVAVA
                     GAVGHGVGKGASFLFRGIRGKKDDDSGSESDRNSVDVPRIVTSGGADETSNGAAADGS
                     VSPGRHSRTKSVGASSIHSAIVPGAASGTASFTIISASGFPPSADVYVVVTQLRDGKS
                     KQVGKTKHRKSSSGTVKFDETFRIQCTPDAQFKVEAKEHHTFGSDDALGETLYFVDDS
                     NTGMERTLAVGSGTVVIKSSFTPSEDGGGSRLIPDSPKSTKSIAGGVRRSILNKRELR
                     LPSRDGAPPS"
     gene            complement(559202..564545)
                     /locus_tag="MYCTH_75536"
                     /db_xref="GeneID:11508085"
     mRNA            complement(join(559202..560655,560780..564545))
                     /locus_tag="MYCTH_75536"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658367.1"
                     /db_xref="GeneID:11508085"
     CDS             complement(join(560579..560655,560780..564167))
                     /locus_tag="MYCTH_75536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658415.1"
                     /db_xref="GeneID:11508085"
                     /db_xref="JGIDB:Spoth2_75536"
                     /translation="MTENEPPALAAHDDGRGTRSRRIMGKLFGRDRDRKAARDDGDLD
                     DFLHGSTDKLQAAHPGPPALTKIDTRTASRYPNAHEVGTVAAEPQRAEYPVRPRDPAK
                     RAKKDVAVHFTNEEPEVIGDGGDECDVPTIEVSKRKKLRPKPSPSAAPSQPASFGGSP
                     QNPFADPSDHTAAIEAQLRRGLRRTQTGLPADPDAPGSGLSPGPNSGGRFLGAPAGPH
                     DERRKSFIEIQQAQMREAEGRAFANAVRAASGDRSRQQHQRMNSSSASLDQEPESPVT
                     PSPDSMQPSQLQSPATFTKQPPPIPAKAQRPQLPPMQPPPPPEPRDSPPSQNAYTPTS
                     QHSDSPELVKRAQKVENSPATLYSAASSSFHHPFASSRQGTKIAERDYASPTQQQAAA
                     AAAATSLQDVVAAASEDAMNAFVTRTRHLFELFRLHAESVRPLVSSTPQQLARASLWW
                     FLTGRTALEVAIRDRPSTPESQMKNDMAKQQAYADLAKSYWLLEEAMPEVVRSGRSPP
                     DKEADSVRSTIGSSLRKLAGSMKRNGFLPPEEAFLPQTVDRTVWIDYPPLSQDITSLL
                     CGSNSALAQSHATSGMTILESLPLADSATTFCFTRFKVDAFLMEQGRESRRLYLPCFL
                     SITRPQTQPDIVFILASQNGSVQLRISGNKNTGPVWDEVRWHNENCNFEVRLPRGFLL
                     LVQCAQQAYSTLRSMYDFSAKVHSSLYPRQDESCIFRSTLRAFQYIDNDPQSRQFPKE
                     STPNCEVALFERLFREGAATGPRTYHKGYRIAVVTGPRTKTLSGVNQVYSPQTPIRFG
                     FLRSETNDPALSLKFDNGRFKGNMVMSFADEAERLRMHSLLIGTALDRGESVSGEAAL
                     QGVWFSERFGDARDKGLMALSTLTWNKVRVINYDNDGDNNPSCVLADRLRVVYEFRDG
                     TLTDRINVAPGELKIRLDVQNPSCLMVFRQPQSDMTVAVTEANSSRSLSAGLAMALET
                     LRQSPTIRTFMFPNLNDLHTFETAITGFKILFDGTASAFAISRRRMVVPIHKKWEAGA
                     TRIQVVQQDGVSQLLAFFEDFSHGQCMGFHLKGTDVFEAFSRSGKAGLKIDDAKFPLP
                     KTLAPDADGAQQAADAAFLCLDLPELPGEHDDISILFDSEEERDKLIACLPAPVNRPR
                     LPKLKGMS"
     gene            <566431..569205
                     /locus_tag="MYCTH_2141297"
                     /db_xref="GeneID:11508775"
     mRNA            join(<566431..566442,566794..566894,567074..567144,
                     567207..567312,567378..567488,567580..567858,
                     567916..568165,568219..568532,568613..569205)
                     /locus_tag="MYCTH_2141297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658368.1"
                     /db_xref="GeneID:11508775"
     CDS             join(566431..566442,566794..566894,567074..567144,
                     567207..567312,567378..567488,567580..567858,
                     567916..568165,568219..568532,568613..568961)
                     /locus_tag="MYCTH_2141297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658416.1"
                     /db_xref="GeneID:11508775"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="JGIDB:Spoth2_2141297"
                     /translation="MPWMLYAHDGRRALFAQKNLGKNDGTSVRSAPDHFECHRSSGEG
                     TDPQEDDTLVVEPEQGNVLSHIISQLRPGADLSRVVLPTFILEPRSMLERITNFMCHP
                     EMLLPIPEIDDPVQRFVAVVKFYLSGWHIRPPGVKKPLNPVLGEIFTCYWDFPDNKRA
                     YYIAEQTSHHPPKSSYFYMVPGHNIRVDGTLKPRSKFLGNSAASMMEGTAILSILNRG
                     SDPSKGERYILTQPNMYARGILFGKMKYELGDHSFVRCPETGLSADIEFKTKGWVSGT
                     YNAIGGVIKNDLTGEVLYELSGLWSEEMFLKDVKTGQKEMFFNALKSKPSPPLCRPIE
                     EQEERESRRLWAKTAQAVKERNHELATEEKTKIEEVQREEAAKRAQDGVEWHPRLFRA
                     VKGGPGGPDEGQEDLEWIINATINGSTTEEQAAQIMAIYPIVKGQKPNQKNAIPPRAS
                     LGESSAGHTAPQSGEADLIDLGDDGSTSQRPSQKQPRALASRSQDGPLLDFHKDMEKD
                     LPGSIKRTDSTESDDDFVDAQG"
     gene            complement(570517..>572869)
                     /locus_tag="MYCTH_105575"
                     /db_xref="GeneID:11513264"
     mRNA            complement(join(570517..571230,571333..572271,
                     572386..572717,572824..>572869))
                     /locus_tag="MYCTH_105575"
                     /product="ammonium transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003658369.1"
                     /db_xref="GeneID:11513264"
     CDS             complement(join(570940..571230,571333..572271,
                     572386..572717,572824..572869))
                     /locus_tag="MYCTH_105575"
                     /codon_start=1
                     /product="ammonium transporter"
                     /protein_id="XP_003658417.1"
                     /db_xref="GeneID:11513264"
                     /db_xref="InterPro:IPR010256"
                     /db_xref="JGIDB:Spoth2_105575"
                     /translation="MSTNDGSSEHVGTDPTVDNLNTPFDAGDQAYIIISAAMVLLMVP
                     GIAFLYSGLARRKSALSLIWVVMMSFSVVVFQWYFWGYSLALSSTATNGFIGNLDKFG
                     LRNTLGEPSPGSPLIPELLYSFYQMQFCAVTAALVIGATAERGRVVPAMIFTFFWATL
                     VYCPLAHWVWGANGWAFKYGVLDYAGGGPVEIGSGVSALAYSWVLGRRNEKMMLNFRP
                     HNISLITLGTILLWFGWLGFNGGSAFGANLRATMACWNSCLTAMFAAMTWCLLDFRLA
                     RKWSLVGWCSGTISGLVAATPASGVITPWASIVLGVVSGVACNFGTKIKFMIGIDDAL
                     DVFAEHAIGGIVGLIFNALFAADYIIGLDGVNLGATGGWLNHHYRQLYVQVAFVVAAC
                     GYSFVMSALIAKIIDLIPGLHLRASSEAELLGMDDDQHGEFAYDYVEVRRDYLAWTPA
                     ERDPKEDGVVVIPQHGIAGHQDLVDSARLRAPGTGSEKGQTSSSAPATPPPERDLSHP
                     DSTDAAAKPVAVPDTISEKPPAAEATQ"
     gene            complement(576687..578729)
                     /locus_tag="MYCTH_2294164"
                     /db_xref="GeneID:11505775"
     mRNA            complement(join(576687..577978,578040..578393,
                     578534..578729))
                     /locus_tag="MYCTH_2294164"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658370.1"
                     /db_xref="GeneID:11505775"
     CDS             complement(join(576832..577978,578040..578393,
                     578534..578556))
                     /locus_tag="MYCTH_2294164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658418.1"
                     /db_xref="GeneID:11505775"
                     /db_xref="JGIDB:Spoth2_2294164"
                     /translation="MPSSASSSSNLHEVTVFAFALKTRTTDLFALLVQEPSPRTTSGL
                     PALQLQKHLQQRSRTWRIILPTGRGGNNIPNICFLDDETGNADKVVAVDIIGTVWILD
                     IWNVGTQPIRWPDAYTREPQMAHGVRGWGVLVLPYSSFQPVKTVREALGLPAGEVIPV
                     TKSESTSRLWLDVTCSLYYVKGFSPNPDNIFRQRHTRLDYARTHAAKSECQEDDFTDA
                     WVSDSEDDEGICMTDPREAEGEGPLHSVAAGQEPDRWLTITQPVGIPDSCFHDLSGDT
                     QMSRSIIPSFGETPPLGDNLAAHAYFNGQYSDRQRRTKHVDFAKADLPSHVVKGFCLL
                     RTSPTDVELQPFDREAPCVECKYLITHSNHFGGAGAPWDLHPAYSERLSMLIHVPELS
                     LVVAGSPTGRVALLTLTRTARRLHMATVRHGFRVECVLPRKEEEDKKLRPACTLIGVA
                     MSPAPSRRSQALELRPETEASVPSASTVYRLILHYKDHTILMYDVARGKDDEALLIF"
     gene            578785..579710
                     /locus_tag="MYCTH_2294165"
                     /db_xref="GeneID:11513378"
     mRNA            578785..579710
                     /locus_tag="MYCTH_2294165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658371.1"
                     /db_xref="GeneID:11513378"
     CDS             578973..579353
                     /locus_tag="MYCTH_2294165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658419.1"
                     /db_xref="GeneID:11513378"
                     /db_xref="JGIDB:Spoth2_2294165"
                     /translation="MVRVGLESFPGAGVPFEGIRHRVFAFVDELLVIFLVHVGLIVFF
                     KPHVGFMGHLGDEDFEVVENIGAELAQAARRVSQPGPQRRERCVSSRWFKMSKAEKQQ
                     LGPSPKLGMLRIDTLPEASSMSLV"
     gene            complement(<580471..>581733)
                     /locus_tag="MYCTH_43356"
                     /db_xref="GeneID:11505489"
     mRNA            complement(<580471..>581733)
                     /locus_tag="MYCTH_43356"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658372.1"
                     /db_xref="GeneID:11505489"
     CDS             complement(580471..581733)
                     /locus_tag="MYCTH_43356"
                     /note="CAZy_ID 267936"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003658420.1"
                     /db_xref="GeneID:11505489"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_43356"
                     /translation="MLALLLTVAALGAAALFFLQLYRTESRLRTPWTPDRSSRLFAQR
                     PLPPPVEGTFLSSPHYTLPLRTRGRDVVDARGRRFKLASVNWYGASDELMVPGGLDVR
                     HRREIARAVRRLGFNSVRLPYSDEMVATNPPVDARLVAANPDLAGARALDVYVAVVEA
                     LTAEGVAVVVNNHITSATWCCGADPCDAGWANDHLPAALCRVRQTEDQWIEHWETVMA
                     RLADNPLVIGADLRNEVRGLWGTMPWARWAAAAERAGNRLLRMNPDWLIIVGGTESQN
                     DLTGVATRPVVLDLPDRVVYSAHVYSWSGWGSWGGRYATRSYPSFVQSARKNWAYLVE
                     GDVAPVWVGEFGAPRSPGRGDANYWNNLLRYLKTIDADFGYWALNPRKPRHNETETYA
                     LLEDDWVTPVLDYRLKDLTELMRAGTTT"
     gene            complement(583849..585968)
                     /locus_tag="MYCTH_2294168"
                     /db_xref="GeneID:11508088"
     mRNA            complement(join(583849..584389,584456..584600,
                     584657..585427,585487..585725,585794..585968))
                     /locus_tag="MYCTH_2294168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658373.1"
                     /db_xref="GeneID:11508088"
     CDS             complement(join(584115..584389,584456..584600,
                     584657..585427,585487..585630))
                     /locus_tag="MYCTH_2294168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658421.1"
                     /db_xref="GeneID:11508088"
                     /db_xref="JGIDB:Spoth2_2294168"
                     /translation="MTTAANWVAVASTICCVFLLLSWAVLPVDKTYRHYLSISLTAGV
                     VCMNLGFVIPLAGNPPQCYDDITPNSMSTGSICAASGFFLIFGGWAGVMWVFLRALSL
                     HLQICWQLVVGRNFMWFAQAVGWGIPVIGVIIAFILSGVSFRFGPTCHINHKNSLADL
                     WIPLLVFASLTIVIQFATFGYCIKVYLASLADNSASTEGSGMPSYTNSIRTMTPKQAY
                     RRVRRVIALQWRGIAIVLIIVADVIFFSIVFVFQDNTVEAVMRDKSLAWDWVSCLVMN
                     GGDKVPCLDEASALAVNMATTGAVLFLLGMNGIWLLLLLGRWSMVTGWRDMLISVPKR
                     SQREFVSVDARLDDLKKDTLTPISPIQARSTTTGSPQNHEYVQMPTPDGRRTPDYFGN
                     TARYHTPARSFSSPRPPQQQTVTWDARETYARPTSPYTQQDRYMNPLGMNRI"
     gene            complement(<593356..>594207)
                     /locus_tag="MYCTH_2122013"
                     /db_xref="GeneID:11505637"
     mRNA            complement(join(<593356..593516,593593..593694,
                     594009..594060,594166..>594207))
                     /locus_tag="MYCTH_2122013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658374.1"
                     /db_xref="GeneID:11505637"
     CDS             complement(join(593356..593516,593593..593694,
                     594009..594060,594166..594207))
                     /locus_tag="MYCTH_2122013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658422.1"
                     /db_xref="GeneID:11505637"
                     /db_xref="JGIDB:Spoth2_2122013"
                     /translation="MSLRRAKSLGVPDMQQQQQQQQEEEEEGETQSESGSMARLIFDF
                     GSGAGRVIPDNAETSSNTGLDKRPQCEPTMTHDAAAAAAAAAAAAAGTEWPGFEVPTR
                     HPEPVSNTTEFASVRV"
     gene            complement(600966..602268)
                     /locus_tag="MYCTH_2294173"
                     /db_xref="GeneID:11513307"
     mRNA            complement(join(600966..601706,601765..601934,
                     602037..602268))
                     /locus_tag="MYCTH_2294173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658375.1"
                     /db_xref="GeneID:11513307"
     CDS             complement(join(601262..601706,601765..601934,
                     602037..602168))
                     /locus_tag="MYCTH_2294173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658423.1"
                     /db_xref="GeneID:11513307"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Spoth2_2294173"
                     /translation="MLGELERVLSLSSASLADDCAVHIVADNSTKRAANHHRHSTKAI
                     TFHNEEAGDVVSWLTRSTAATGGKCIIASAYTVYNVLTATRPDVIRTLARSDWPFALP
                     RFQCRPVIFYQDSKLIMNFGRAALMGSEAHPRPRNLPSLSARQIEALDAIEAIARATQ
                     LEIQTQAGDMHFINNLAILHRREGFANGQAPTEKRHLVRMRLRSAEKGWPIPRELETE
                     WDAAFRKHGVKHWHVEPMPSYFFPMRNQPN"
     gene            complement(605416..608700)
                     /locus_tag="MYCTH_2294181"
                     /db_xref="GeneID:11508150"
     mRNA            complement(join(605416..605908,605972..606127,
                     606182..606224,606287..607165,607217..607851,
                     607920..608478,608549..608700))
                     /locus_tag="MYCTH_2294181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658376.1"
                     /db_xref="GeneID:11508150"
     CDS             complement(join(605805..605908,605972..606127,
                     606182..606224,606287..607165,607217..607851,
                     607920..608112))
                     /locus_tag="MYCTH_2294181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658424.1"
                     /db_xref="GeneID:11508150"
                     /db_xref="JGIDB:Spoth2_2294181"
                     /translation="MPTQSYSDEQEKDTTVAQADDGLNSGCGSQGLFPGTDSGSGWTG
                     ARLADCFASFSMCPPFEPQSSYQPLLARTSYEYDDNGSPGLDTTVVSVQPQAQVALVT
                     PPVISEPSSLFPCDDPALMAQYLPNYPPLQPERITGLQPATSREEMIYPIVSAAGNAD
                     GAHCVSALRGQPQHYAPVQTGAVPVTYAGSSDASPFNGHGIVMNPPPRFHSVQCFDVV
                     SRIENASTQNDSPVLDFFPAQRTAPVKRGPFKDQDSREKTALTRKMGSCIRCRMQRIR
                     CNLDPENEKGPCLSCKKIASSAKVYRLNCLRLKITDVKLFKPGQVKGQEWTSRWKDSV
                     MDDIGSWEPSQPRVIRVTEGYTGRSVELQVRQFKPQQGDKVKRSWVSKDGRRHEVQIP
                     TYAIVNMDDAKASFDKYIRTSLGACCKHLLSSRDELLSRTYFLAIKLAQNRSTPQSER
                     SLLVATFELWMSVRLTTKSFEIVGDDTLGMPRNIIDDKDSPLHGKIPLPPVMGAQIDS
                     VIIHQIQPRLRRKTLEELQKMTQEKKQKTWLTTFLVTFILLHNIALITKHDADYARKH
                     GLPTRFAREANVKEYNLGANTLLAYFHYCNKAIYPFSRECKDQDLQTLAELDDEALAF
                     VHFVRESVAKKKEEWEKLWAHDEYEHEYYYVSQLFEHNWQPRTMA"
     gene            613948..616043
                     /locus_tag="MYCTH_2294188"
                     /db_xref="GeneID:11508153"
     mRNA            613948..616043
                     /locus_tag="MYCTH_2294188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658377.1"
                     /db_xref="GeneID:11508153"
     CDS             614182..615975
                     /locus_tag="MYCTH_2294188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658425.1"
                     /db_xref="GeneID:11508153"
                     /db_xref="JGIDB:Spoth2_2294188"
                     /translation="MELNSALIHDVIHPTAAFTQNPLVKDGSRARPEFVLWEDSQLNP
                     KNRLDSLEFPQPALFRIDGCTGLGTQYYAVPLFLSHVPPMRLDVFIPEQAVASPVLRE
                     LLDLNVAFHTKDATRLRRLGISRYIVRALQNWIAERGYDTYSSLVPGLPFGSRIIFEA
                     LHFDIRKTKISVVPTYYVERQLLGVANLSESLGLAPELLPEAVDIASLSTVQELYDSV
                     CLVRMRKRKACQGGDGLWIFKALTSNTKYLFVELRNLLLMEPHPNIISRPQYLVTKRC
                     LFGGKTAVAGFLVPYHEHGSVRDKLPLMRIHGHLKLEQQVRWASQLASAVLHIHERGG
                     MFYSDLRLDNVVLSATNDLVMIDFEQRGVWCEFASPEVNAIEYVRILASDEPDDANPG
                     IPEETRGHFAARLNRILPDWDVLQASEDYSAPRPHGYSNYNIAWLALDEAEQESSMVY
                     MLGRVLWCIFEGQSAPNKAAVWQSYRYEPDIEFPSFRLTPSGLRDLIDRCTRGRREVL
                     SSSIVRQAGRLVLRGKESSTAEDVLRVAREWWQAEVKAAEEFLDMREERKTRGTWDGN
                     YFGRPKLREVLAELERFQEGYDAASRPASPD"
     gene            complement(616426..618576)
                     /locus_tag="MYCTH_2294189"
                     /db_xref="GeneID:11508046"
     mRNA            complement(join(616426..617484,617566..618576))
                     /locus_tag="MYCTH_2294189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658378.1"
                     /db_xref="GeneID:11508046"
     CDS             complement(join(616574..617484,617566..618394))
                     /locus_tag="MYCTH_2294189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658426.1"
                     /db_xref="GeneID:11508046"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Spoth2_2294189"
                     /translation="MWDRPEEINLITLNCWGLKYVSKLRRERLAEIGRQISIASPQPH
                     IVALQECWTQEDYRSIRRQTRFILPYGKFYHSAVLGGGLAILSRWPIEESTMYRYPLN
                     GRPTAFWRGDWYVGKGVACAKIRYGPGPKQVVEVFNTHTHAPYEAGKPDDSYLCHRTA
                     QSWEIAKLLRGAAERGHLVLAMGDFNMIPMSPEYQLITGLAPVSDVWRVLHPDSSVGP
                     AYHPAEEARRRPIPTAEFNILENGATSDGPYNTWRWTKAQQKLLGPGKDPVTVPPDTP
                     DPLGKRLDYIFASSGDVLALGGAWVVKRASVGMMMRHPELGCSLSDHFAVEATLAFHP
                     SRQASTSPSPPPPLPEPGSNDNTVSNGGSTLGAATAAAAAGAGAGAGVGGIPKPPDEP
                     TPPTSPEEAARKADSALHNGAYLQLHSPAPSLHNSITTATGPAATAAADATEQQHPPS
                     SSLPPAAYDAILALIASYTARSRGQRTWRARHFFLSLLVTVACLVGVWFTPSGKTYVA
                     FILTLVAALGLVAGTVDGLMALLFFGSELKALREFEWEVRNARKRALLEARRDEDGGG
                     GGEAADDAGEEEW"
     gene            618943..621172
                     /locus_tag="MYCTH_2294191"
                     /db_xref="GeneID:11505774"
     mRNA            join(618943..620263,620456..621172)
                     /locus_tag="MYCTH_2294191"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658379.1"
                     /db_xref="GeneID:11505774"
     CDS             join(619782..620263,620456..621122)
                     /locus_tag="MYCTH_2294191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658427.1"
                     /db_xref="GeneID:11505774"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2294191"
                     /translation="MAGVSCLAWAPDSNTLATGSDDKSIRLWDRVTGSPAHAVAHRET
                     AAVDGMGGADVAASSRGPAGRGAARRAARTGVSPDGVRGGRTGKGPLLGHHNYVYCLA
                     FSPKGNILASGSYDEAVFLWDVRAGRLMRSLPAHSDPVSGVDFCRDGTLVVSCSTDGL
                     IRIWDTYTGQCLRTLVHEDNPAVTNVCFSPNGRFVLAFSLDSSIRLWDYVSGSVKKTY
                     QGHTNQKYSIGGCFGVLTDRDDDLAAEDNADGEHVRQQAFITSASEDGDIVMWDVKSK
                     EVLQRIKAAHKGVCFWVDVHGGTMVSAGQDGSIKVFRHRPRRGGHVKREDGDSDRYGA
                     VNGHLLDGEMPDAAAADEELQRQVEAEAEAAAAAAAVSPGQHVKEEQL"
     gene            complement(621290..622084)
                     /locus_tag="MYCTH_2294192"
                     /db_xref="GeneID:11508759"
     mRNA            complement(join(621290..621745,621871..622084))
                     /locus_tag="MYCTH_2294192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658380.1"
                     /db_xref="GeneID:11508759"
     CDS             complement(join(621457..621745,621871..621908))
                     /locus_tag="MYCTH_2294192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658428.1"
                     /db_xref="GeneID:11508759"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="JGIDB:Spoth2_2294192"
                     /translation="MATDTSAGFPCALTLDVPFPDARLASVALQALRVDKELSSLVRR
                     ELSAVATEGSSDPTVLRVEYKAATNRMLRVAVNSFLDSLALVLEVQEELDVDAVEQRR
                     RQGTSA"
     gene            622647..625220
                     /locus_tag="MYCTH_2294193"
                     /db_xref="GeneID:11508761"
     mRNA            join(622647..622786,622957..623259,623336..625220)
                     /locus_tag="MYCTH_2294193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658381.1"
                     /db_xref="GeneID:11508761"
     CDS             join(622729..622786,622957..623259,623336..624969)
                     /locus_tag="MYCTH_2294193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658429.1"
                     /db_xref="GeneID:11508761"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Spoth2_2294193"
                     /translation="MAPSARYSSNLGQIIEYIPDRLYLASYVEPPDANTVFPYPDPPP
                     RSPSKRSQRALETQSRRKQPFYFTVDDTLLYNAFHHDFGPLHIGHLYRFALQFHEILG
                     AEENKDRPIVFWSRADPRSRANASCLLACYMVLIQSWPPHLALAPIAQVDPPLMPFRD
                     AGYSQADYGITVQDVVYGVWKAKEEGCCVLETFDLDEYERFERVEQGDFNWITPHFLA
                     FASPQSTPSARTMEGTEAWEALPKTLAAVDAHPTLGQPFKNVLTHFKERNIGLVVRLN
                     SVLYDAAYFEALGIQHVDMIFEDGTCPPLSMVRKFIRMAHEMITVKKKGIAVHCKAGL
                     GRTGCLIGAYLIYRYGFTANEIISYMRFMRPGMVVGPQQHWLHLNQGTFREWWVEERV
                     ERKLRKEAALAAAAAQANGNHQPSTPVRAMQKTHLGRSSSKNGTSTPPNRGGVRTPLG
                     EIEHDQARDNSIGVQEDYLPAPTPGQPRKTQRGGVDRHHPYGRSTNAVPTVEEESVDH
                     EIEPEVASSTRRSHAAESDEEWNLRMRSHRKASASVSPGRRERSVSHHTTTMTTTTTT
                     TTTATATAMYQVIDNDASNDIENIGMATPKTKSYDQAQRATSASGVLAKVRGSSGSPK
                     RAAGGSGVREAGVRKTSGRVGSVGNVSPMAATARKVSGAQ"
     gene            <629953..>631719
                     /locus_tag="MYCTH_2051994"
                     /db_xref="GeneID:11505492"
     mRNA            join(<629953..631410,631489..>631719)
                     /locus_tag="MYCTH_2051994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658382.1"
                     /db_xref="GeneID:11505492"
     CDS             join(629953..631410,631489..631719)
                     /locus_tag="MYCTH_2051994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658430.1"
                     /db_xref="GeneID:11505492"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="JGIDB:Spoth2_2051994"
                     /translation="MSRLSLECAASTTGSQTRMQSVRANTPMPYSEHPSDTSDWEMEG
                     DDDEEEEEEETDIVPSPTGFRYNISRLSPRARQMVKGLFNQARVKEPPQISLELCGIR
                     EEDPEGNGFFYAFQMHEVVPCSVRIGSRRSGEFSTPRCECPDARYQGARPCKHLVWLF
                     DRISKQALFDHDPDSELMLTEFGYPEELGDPFDQISQIGLDILADDLRCDASEPDSDV
                     IAPNPARVREAREMVAAVAGIQPGELDEYRPDLEDSYSRDALIRRGDLGATLFSLILA
                     SHSLAEWVRSELNPSDPAVDPFRSIQHRVMHIIRQLDACSSTGGAPEEVAEKGWWRRA
                     DGPRNADWACVQIQRSVKKIEKLVSRGPSPLTESARSSAARSLVVILKAVVSHRDLYA
                     PLIGDRDTGFVHSALDMLADQSQFIDALEEIMDRVGVRGAPPSYVANMRRLIERMRSH
                     CTTEQHVDEASGLRGVRRSETPPLLPPDQQPPPPGISGNASVPFLTPVRAASTIRGRG
                     RGGGGSGSGSGSSQIGGGGRGRGGKGGRGAKRTVSPSSPPLDGPEIAAKRARGS"
     gene            complement(632872..636047)
                     /locus_tag="MYCTH_2294197"
                     /db_xref="GeneID:11513118"
     mRNA            complement(join(632872..634715,634775..635318,
                     635381..635526,635582..636047))
                     /locus_tag="MYCTH_2294197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658383.1"
                     /db_xref="GeneID:11513118"
     CDS             complement(join(633001..634715,634775..635318,
                     635381..635526,635582..635855))
                     /locus_tag="MYCTH_2294197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658431.1"
                     /db_xref="GeneID:11513118"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Spoth2_2294197"
                     /translation="MPPKAGRFVARALGIKLQENDPFKELERPGASMLSNETGHTFVE
                     EPPNVLEYLNDLIPSGKEVYDYILSLFPFLSWIGRYNLQWFIGDLVAGITIGAVVVPQ
                     GMAYAKLANLDVQFGLYSSFMGVLIYWFFATSKDITIGPVAVMSQLTGGIVADLAVTL
                     PDVPGHVIASALAILAGAIVLFIGLIRCGWIVDVISLTALSAFMTGSAINILVGQIPT
                     MMGITGFSTREAPYIVFIHTLQGLPRTTLDAAMGLTALTMLYLLRAACSYSAKRWPQH
                     QRLFFFLSTLRTVFVILLYTMISWLVNRGLPEDEVKFKILLHVPRGFQNAAVPVLNKR
                     IASNLAGYLPATVIVLLIEHIAISKSFGRVNNYTINPSQEMVAIGVTNMLGPFLGGYA
                     ATGSFSRTAIKSKAGVRTPFAGVITAVVVLLAIYALPAVFYYIPNASLAAVIIHAVGD
                     LITPPNTVYHFWLVSPLEVFIFFVGVIVTVFSTIENGIYCTVCLSAAMLLYRILRSKG
                     RFLGRVRVASMLGDHVVGGDTQRGAEYGTFTGTPEAPFRNVFLPITHADGSNPEVELD
                     NPYPGIFIYRFSEGFNYTNASHSLSYMTDYIFAHTRRTNLASFERPGDRPWNNPGPSR
                     RELKAAAAAAAAGTNAVADNVDPKLPTLKAIILDFSSVNHVDITSVQQLIDVRNQLDR
                     YAAPDTVDWHIACISNRWTKRALAAAGFGYPTMRPDVPHLRWKSIFSVAEIGGAQSAA
                     AAAEFEDNEKELESSNRLETLHSHSHASAHHHHPTTADDLEAALSKKATVPEGADEEE
                     PADAVGAVNLASRRTPALNAGRTVAVHGINRPLFHVDLTSALQSAIANVEARREYSSD
                     SGAGGKNGGAAAAAASAKADSDMVTTSGGSGTSSPR"
     gene            638508..640120
                     /locus_tag="MYCTH_2294200"
                     /db_xref="GeneID:11508151"
     mRNA            join(638508..639159,639267..640120)
                     /locus_tag="MYCTH_2294200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658384.1"
                     /db_xref="GeneID:11508151"
     CDS             join(638980..639159,639267..640109)
                     /locus_tag="MYCTH_2294200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658432.1"
                     /db_xref="GeneID:11508151"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_2294200"
                     /translation="MTAATATRRSALSKRSLAADAMSLDRLLREGPPDGDVEGALESA
                     RLKILDQGIKSDSDGMSSLRIYVWLILLNAPMLETDAYLALIHRGASPAYSKIRNDTF
                     RTLSTDPLFRRRVSEASLIRLLNAFAWTLHDAREVRTRDPSVASSTRRSLDQSSSRPG
                     TGYGSDYGSPASSPAAKRARALTLTTEGSVASVTAEPGTYVQGMNVLAAPFLYAARSE
                     AEAFVAFHQLLTKECPGYIRGAMDGVHKGLALVDKVLAIVDPKLSQHLLSKNLSAEIY
                     AFPSVLTLCACTPPLPEVLRLWDFLFAYGPHLNILCIVAQLIMIRSKIMESPRYVNPP
                     VTFFLC"
     gene            complement(642717..644529)
                     /locus_tag="MYCTH_2294202"
                     /db_xref="GeneID:11505465"
     mRNA            complement(642717..644529)
                     /locus_tag="MYCTH_2294202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658385.1"
                     /db_xref="GeneID:11505465"
     CDS             complement(642840..644159)
                     /locus_tag="MYCTH_2294202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658433.1"
                     /db_xref="GeneID:11505465"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="JGIDB:Spoth2_2294202"
                     /translation="MDGEEGLLLKLDLLLTDLERRLEYWENYGELSLDSSISAAFDTL
                     KAVRTRCSQVSEEFMGAGRRKLQVVVDTLESGYHEALAAAGSLNEKAKVSIELLDGML
                     QEMEDQAARFREKGLTNAAETLMDEAHRVVDEGIERAKRAAESLEDHIQRAIARAREH
                     GLLRYEDLPVPWRTNPHIIRGYRFSETKLACVRSVFSFSNELVNIWSHTIGLVLVLAV
                     AFYFYPTSTNFSLSSKADVFIAAVFFFAACQCLVCSVIWHTMNSVADVSLISMFACVD
                     YTGISLLIAASIMTTEYTAFYCEPVSRWVYMVTTALLGVGGVILPWHPRFNGADMAWA
                     RVAFYVALSATGFLPILQLSLTRSPGAVLEFYTPIAKSLAVYFLGALVYASKVPERWC
                     PGMFDYVGGSHNLWHVAVLGGILFHYTAMQDFFSHAFRLAKDGCAAY"
     gene            645927..647603
                     /locus_tag="MYCTH_86520"
                     /db_xref="GeneID:11506037"
     mRNA            join(645927..646478,646619..646862,646921..647603)
                     /locus_tag="MYCTH_86520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658386.1"
                     /db_xref="GeneID:11506037"
     CDS             join(646120..646478,646619..646862,646921..646962)
                     /locus_tag="MYCTH_86520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658434.1"
                     /db_xref="GeneID:11506037"
                     /db_xref="JGIDB:Spoth2_86520"
                     /translation="MTVDAHITDPALASVVETSRAAREQAQALVDLIAQATAANPDGA
                     IPADALTEISRQQKLLNTNIAHLRGLHRAAHFRARETKSRTAEARHEVDVLHLQLQNL
                     YYEQRHLEGEIAACEGFDHTYRLLPLIPVEEFLAQHPEHADADENALMVARINHERAE
                     REALEQQRLELQKRKQKLIAENKKRRDDLANLDRDLEKFIDAAKPIQKMFEKVV"
     gene            652025..653504
                     /locus_tag="MYCTH_2294206"
                     /db_xref="GeneID:11508159"
     mRNA            join(652025..652713,652771..653504)
                     /locus_tag="MYCTH_2294206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658387.1"
                     /db_xref="GeneID:11508159"
     CDS             join(652199..652713,652771..653362)
                     /locus_tag="MYCTH_2294206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658435.1"
                     /db_xref="GeneID:11508159"
                     /db_xref="JGIDB:Spoth2_2294206"
                     /translation="MHVAHPDVATTTLYSAPIIFDRNAHDVPAIVRVADILWSAAGMS
                     GLYEGSSVAPPTSVYSVPLELVDRVGGWDCDSEAIGEDLHMYLKCFFALNGNLTVRTV
                     LSPVSQTNVTGGGRGKGVPGIVADVRARYKQALRHMWGALDTGYALRKVVEVWRERKH
                     TSRAFRPLHTSMNDESDNYVPQSQIDGVDAEAVPESGIFSDVVTDTLKEPDWERIAIL
                     FHRLFEAHFLPVQMTILVIASTLYMWAADGTEDVHGVAWIYSVCNILRTLGFMEVALY
                     LFLYESFHRICVETREKEMGNAGLLKGMHFSRRKAKTNFIDYVMVPLVAPIFGSIPCA
                     QAQLCHFWTLDLVYTVSKKVTRRRAKSITADALV"
     gene            <655829..>656609
                     /locus_tag="MYCTH_2049865"
                     /db_xref="GeneID:11508647"
     mRNA            join(<655829..656009,656122..>656609)
                     /locus_tag="MYCTH_2049865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658388.1"
                     /db_xref="GeneID:11508647"
     CDS             join(655829..656009,656122..656609)
                     /locus_tag="MYCTH_2049865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658436.1"
                     /db_xref="GeneID:11508647"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="JGIDB:Spoth2_2049865"
                     /translation="MKGTDSRETIRIGVFIPTECQLLDMACIDVFGTMSHEYFALLGD
                     MVPAPIANLAPSVQIFYISTVQPGELIGMTSSARIACTHHLSDPAVQPGRLDIVLVPG
                     PDPTTDFSKLTEATDWLAAHGARPETDILCVCTGIYLCGAAGLLNGKRASGPRGLQRD
                     LATKFEAVQWVGEELRWVRDGNLWTSGTYLTLVARVRVPSRRLSCTKEKKKKEKREER
                     RKEK"
     gene            657424..659495
                     /locus_tag="MYCTH_2294210"
                     /db_xref="GeneID:11508644"
     mRNA            join(657424..657711,657773..658240,658314..659013,
                     659092..659495)
                     /locus_tag="MYCTH_2294210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658389.1"
                     /db_xref="GeneID:11508644"
     CDS             join(657622..657711,657773..658240,658314..659013,
                     659092..659297)
                     /locus_tag="MYCTH_2294210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658437.1"
                     /db_xref="GeneID:11508644"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="JGIDB:Spoth2_2294210"
                     /translation="MSPLLPVAVYGLEVPPGGVMVPAEIEFPATIRITMAAIDPTAAP
                     ETDDQGNVPSVPRSTLKIHKANVDENDEEGGDYLDSLLGKDDEDDESDEDDEEANGGP
                     SDPSKSKKARRDAAIKKLLEATKEDSDDEMEDADSKPNGVKNKNKNKGKGKASDEDEE
                     QSDDEEDDGEDLNLEEYVVCTLDTERTYQQPIDITVGEGEKIFFSVKGTHTVYLTGNY
                     VVPENEEEDDEEDDEEYSDDEYDLPPGIEDEDSDEMSDELDHIDGAARVEEVDTDEEE
                     APKLVEAKKGKKRAAEEEADGLDDMMAKDEKKLSKKQQKKLKNNQGEAVAAESKAKDS
                     PAAKGDKKVQFAKELEQGPTGPAKDRAEGKGDKAENKGDKKGLGVKVVQGVTIDDRKI
                     GTGRTVKNGDKVGMRYIGKLQNGKVFDANKKGAPFTFKVGKGEVIKGWDIGIQGMAIG
                     GERRLTIPPHLAYGSRALPGIPPNSTLIFDVKLLEIK"
     gene            660846..>662754
                     /locus_tag="MYCTH_61755"
                     /db_xref="GeneID:11505415"
     mRNA            join(660846..661579,661722..662027,662145..662485,
                     662585..>662754)
                     /locus_tag="MYCTH_61755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658390.1"
                     /db_xref="GeneID:11505415"
     CDS             join(661143..661579,661722..662027,662145..662485,
                     662585..>662754)
                     /locus_tag="MYCTH_61755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658438.1"
                     /db_xref="GeneID:11505415"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_61755"
                     /translation="MRRQMLETELFNRARELREQQQSEGSPRSSTRGSGGNKGTEARA
                     AAEARARFCRREAEHLREVRAMKAGAIRLLGSGGLAVAAGRYETVKVLGKGSFGVVKL
                     VRERGREGRVYAMKVIRKSKMLKTNQEGHLRAERDLLVASEGSRIVPLVASFQDLSNL
                     YLVMEYMPGGDFLSLLIRENVLHESVARFYVAEIVLCVEAAHSLKCIHRDIKPDNFLI
                     SASGHLKISDFGLAFDGHWSHDTTYYNSHRHDKKDLYDGEPLLNWRNRCGTRHSARSV
                     VGTSQYMAPEVIEGRRYDARCDWWSVGIILFECIYGHTPFLSEAGRQQTKENILRHHE
                     TFGFPPRPTVSRRCQHLMLSLITDKEYRGSKMRDLAGRYVFPYDAEDIKAHKWFRHIP
                     WERLHELEPPLVPQLRSVDDTHYFED"
     gene            664817..664888
                     /locus_tag="MYCTH_t1"
                     /db_xref="GeneID:11513324"
     tRNA            664817..664888
                     /locus_tag="MYCTH_t1"
                     /product="tRNA-Arg"
                     /note="Anticodon: ACG"
                     /anticodon=(pos:664849..664851,aa:Arg,seq:acg)
                     /db_xref="GeneID:11513324"
     gene            complement(665219..672092)
                     /locus_tag="MYCTH_2294213"
                     /db_xref="GeneID:11505814"
     mRNA            complement(join(665219..665618,665713..672092))
                     /locus_tag="MYCTH_2294213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658391.1"
                     /db_xref="GeneID:11505814"
     CDS             complement(join(665351..665618,665713..671864))
                     /locus_tag="MYCTH_2294213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658439.1"
                     /db_xref="GeneID:11505814"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="JGIDB:Spoth2_2294213"
                     /translation="METPMSTQEQQLCQLLLELPARHRYRYTDEAARELLTALFWCMA
                     GGKSEYMNLFFPAGGPLRNGTLKLREAQGAVEGAEYTEAARGKACGHIFKQGEASYAC
                     RTCSADDTCCLCSRCFDATDHTGHMVRISISPGNSGCCDCGDPEAWNRPMFCTIHSMW
                     EGEGKGKGKEAPALPEDLVANIRMTIGRVFDYLCDVISCSPEQLRQTKTVESIEQDER
                     MSRLSSTYCGGDTESPGEYAVLLWNDEKHTITDVQHQVARACSTTMANGLAKAYETDG
                     IGRSILMYDKSIEKLIEVANTLERIRVTVTIRSARDTFREEMCGTMIEWLRDISGCSV
                     GEDSNILRQIVCEEMLKPWRRGSPATHAIVGKGGIDDEELLDQEDREAHEDFYIQQVR
                     ILMQARRAARAEAAADDASEDDEEEDEEDGRHTPGSDMEDDGEDEEDVMMLDSREDGD
                     VPMQDWRQDTALEEDEATVAGYPPPPPPPPPAARRTARERELTPSDSDTAEPLIAPTV
                     YAKAHLEIPKTPGQPGAHTLPPPKPGSYWLATPQGYVEQENIPVAEDLFERVRLDWMI
                     LFDLRMWKKVRNDLRSLYISTVVTIPEFKRVLGLRFAGLYTTLAQLYLIGDREPDHSI
                     INISLQMLTTPSITAEIVERGNFLTSLMAILYTFLTSRQVGHPWDVASNAVLSFDTGS
                     VTNRRMYHFFLDLKYLFGSPHVQDRLRTEERYMMQFLDLVKLHQGICPNVRAVGEHVE
                     YEADGWISASLVTREINRLCRQFAESFRNVKEQDSLYVSRAIRLAAKTVIINSIGAER
                     ARFSQSEIKDEVRFKTLDNFEFEAPSRTFRVVKFVVEEEPISFHHALHYTLSWLIECG
                     KNMPVEQLRALLSFTTQELMMKPRSMGKKMMPRHDYGPEDYLMAAFDFPLRVCAWLAQ
                     MKAGMWVRNGLSLRHQAGTYRGVGQRDVSHQRDIFLLQTALVVCDPSRVLASIVDRFG
                     MEKWVKGFFEQKSKAQDDIQHLDVVEDMIHLLIVLLSDRTLLIPTDDTQDPPHIASIR
                     RDITHVLCFKPLSFSDICLKLPDKFQEQEDFHKVLDEMTTFKPPEGLTDVGTFELKPE
                     YIEDVDPYIAHYTKNQREEAELAWRKCVAKKTGKSVEDVVYEPRLRPITSGVFAGLSE
                     FTRTGMFAQIIHYSLLYTLVYPRLTPQVPSTRVETFLQVVLHLILIAIAEDNTEEEDQ
                     PQPSFVATALTQQALSVVPEAPQARTIVALMNLIASKDEFKACHPRVATILRRMQQKR
                     PKAFESTCERLGLSVDRMGTASPATNSADEERERKKKAALDRQARVMAQFQAQQKSFM
                     ENQGDINWGEMDDLEDDDVPPMEEHRDFWKYPSGTCILCQEDTDERRLYGTFAYFTES
                     NILRQTDFQDPDFVREAFNTPENLDRSAESIRPFGVASENRKKVRKVNQQGQIFETER
                     QVIGKGFPAKLSRLGPVSIGCGHIMHYHCFEAYFEATVRRHNQQIARHAPEKISRLEF
                     VCPLCKALGNAFLPIIWKGQEESYPGPLVPSTPFSSFLDSQLHSAYYTLGAARPPDRI
                     QNEFAAYTSRHLINSLAEKSAQLLDDAWVDVGAQSISTGTPFSETFSMMSAPDQGGRG
                     ASADANTPMRELVNVYRRLRDTLRKNGIVSRHQFEPPELGANELYGSDVLARSVGFSI
                     SAVEIQQRGVEAEYGMTFLEKIPEQVLTQLRILSETVTSYIAVGGLRESGENKIDTEY
                     RRDSERQHCQLFIAQYLGEETEHTRFPANSYPPLLSQDPFIFLCECVFGVIPAQGFEI
                     AHMVRLCYLAEITKVAYHLARNMPAPLWFQFVTRREEMDPPTAAFVSFCEALYEIDVK
                     CASEPVPTVDRPEWENKAFEQPGIDTWESWYILLRKYALTFLRKCVILLHVKFGVNFN
                     SRVSPNPEQRELERLTEALRVPSLNEMLTALTPALGVEHGWPADTPRLVAGWVKHQAM
                     WPYSGDDERLPQSAVLSHPGIFELVGLPKNYDALIEECTRRKCPTKGKDLTEPAICLF
                     CGEIFCSQAVCCAREDRIGPDRISQIGGAQQHMLRCQKNIGLFINIRKCCVFYLSRRS
                     GSFSNAPYIDKYGEVDNGLRYGRQLFLHQKRYDSMLRNLWLSHGIPSFIARKLEADIN
                     TGGWETI"
     gene            complement(672593..673551)
                     /locus_tag="MYCTH_2294215"
                     /db_xref="GeneID:11505477"
     mRNA            complement(join(672593..672941,673001..673049,
                     673115..673180,673243..673259,673328..673551))
                     /locus_tag="MYCTH_2294215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658392.1"
                     /db_xref="GeneID:11505477"
     CDS             complement(join(672888..672941,673001..673049,
                     673115..673180,673243..673259,673328..673330))
                     /locus_tag="MYCTH_2294215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658440.1"
                     /db_xref="GeneID:11505477"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="JGIDB:Spoth2_2294215"
                     /translation="MASAIYNALFRRNFTMLGVVFAGAFAFQLGYDGLMNKIWDNHNR
                     GRQWKDIRHKYIEGGDDE"
     gene            673566..674647
                     /locus_tag="MYCTH_2294216"
                     /db_xref="GeneID:11508839"
     mRNA            673566..674647
                     /locus_tag="MYCTH_2294216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658393.1"
                     /db_xref="GeneID:11508839"
     CDS             673794..674396
                     /locus_tag="MYCTH_2294216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658441.1"
                     /db_xref="GeneID:11508839"
                     /db_xref="InterPro:IPR015362"
                     /db_xref="JGIDB:Spoth2_2294216"
                     /translation="MSTRPTASGIVTDEVSGERIIPASKRADGSTRKAIKIRPGYRPP
                     EDVEVYRNQAAETYRNRGKGPVPGAEGLKDDKPAAQSSSAAASKNAKRREARKRAKAA
                     EEVQGHSSPATEPKKEEVDPEAEKEKKVRNLKKKLRQAKELKEKKETGQSLLPEQIAK
                     VIKINELIRELDALGFDADGEPKKKAEDTAADTEAKEAAD"
     gene            complement(675062..>676744)
                     /locus_tag="MYCTH_2131445"
                     /db_xref="GeneID:11505946"
     mRNA            complement(join(675062..675835,675867..>676744))
                     /locus_tag="MYCTH_2131445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658394.1"
                     /db_xref="GeneID:11505946"
     CDS             complement(join(675157..675835,675867..676744))
                     /locus_tag="MYCTH_2131445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658442.1"
                     /db_xref="GeneID:11505946"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="JGIDB:Spoth2_2131445"
                     /translation="MSQNTQLPASQPQYPLLSVLNPASATPLPTTAQTAAATTTTTTT
                     PTSPSAPNTPPVPSVLGLDALFNNPVFAGGIGLAGLGAAAAFGRRALISGAALLRRQL
                     LVNIEISKRDPSYNWVLAWLAQPRDNSGFLAQRLTRLRNLSVTTSTRSLSPRGVPDES
                     GGGGGGGGKIHADFRVQPGFGRHIVRHAPGVYIAVNREKAGTATTATGEPHETLTLTL
                     LWRHRHVLADVFTQAHALAQSFQQGKTVVYTARKMEWAVLGKPRLKRPLGSVILDEGV
                     KERLVDDVKEFLGAQQWGYLLYGPPGTGKTSFIQALAGELDYSVAMINLSEIGMTDDL
                     LAQLLTQLPEKSILVLEDVDAAMVNRRQRDPDGYSGRTVTASGLLNALDGLAAGEDRI
                     AFLTTNHIDRLDPALIRPGRVDVMVRIGEATRYQAAQMWDRYYGDIDKDHSGRERFLK
                     RLDELGLFGGDSQNPDVPKRHTSTAAIQGLFQFNKGDMEGAINMAEGLIPRTFEPDHS
                     ASEGSIKAPA"
     gene            complement(676881..678117)
                     /locus_tag="MYCTH_2294218"
                     /db_xref="GeneID:11513039"
     mRNA            complement(676881..678117)
                     /locus_tag="MYCTH_2294218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658395.1"
                     /db_xref="GeneID:11513039"
     CDS             complement(677240..677932)
                     /locus_tag="MYCTH_2294218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658443.1"
                     /db_xref="GeneID:11513039"
                     /db_xref="JGIDB:Spoth2_2294218"
                     /translation="MNRFTVGRLLAPDLVRPLCRIICPAATTTTNTTVPQWTRLFSQS
                     HAARNVSPTPPQQPTQQQTQQQGGAAAMNRLVQQVMRGTLRPGEPGPESLTDTLDASE
                     EENNPEPYHFHIYSHKHNTHVTVTKPNRDAIISLSCGNLGFRKSGRKHYDSAYQLGAY
                     VIDKMHQKGLVKSIHKLEVVLRGFGPGREAVVKVLMGNEGRLLRPKIVRVSDATRLKF
                     GGTRSKKPRRLG"
     gene            678243..680176
                     /locus_tag="MYCTH_2294220"
                     /db_xref="GeneID:11508156"
     mRNA            join(678243..679322,679376..680176)
                     /locus_tag="MYCTH_2294220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658396.1"
                     /db_xref="GeneID:11508156"
     CDS             join(678385..679322,679376..680051)
                     /locus_tag="MYCTH_2294220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658444.1"
                     /db_xref="GeneID:11508156"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="JGIDB:Spoth2_2294220"
                     /translation="MNSARQFQRFAPGASLRASALRSSRYTPTSHYRFLSSSRRAPLS
                     VSESATCSASVLIQRQPLLRSALPTSAIRLDRPSQTDARSFHVSARLKQQEPADKEGK
                     ARAEAKEGEQTKDSKTKEDTKEEKASEGEEEAGRKKKEKKDDLPPPPPHGDKTPWQVF
                     LDTMQKEFQQSKEWNESTKALASSANEFVESESVRKARQAYEATSGAVTSTAAKVVKT
                     TAGAVGKGASWTWETPVMKGVRKGASKTGEVLDKATKPIRETEAYKNVKNVIDDGSSS
                     RYGGWVDKEERRRLRELREQMNKKNGANNPVYQEDPNAGTNLTVHKDAAWKEAWREFR
                     DQNKFVQSLFGMKSIYQESDNPLISTARSITDKVAGFFAENETAMVIKKLRSMDPSFK
                     LEPFLQELREYILPEVLDAYVKGDTETLKLWLSEAQYSVYEALTKQYLQAGLKSDGKI
                     LDIRGVDILRARMLDPGEIPVFIVTCRTQEVHVYRNAKTNQLAAGMEDKVQLVTYAIG
                     ITRIAEDVNNPETRGWRLIEMQKSGRDYI"
     gene            complement(<680642..>681380)
                     /locus_tag="MYCTH_2122038"
                     /db_xref="GeneID:11508646"
     mRNA            complement(join(<680642..681059,681151..>681380))
                     /locus_tag="MYCTH_2122038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658397.1"
                     /db_xref="GeneID:11508646"
     CDS             complement(join(680642..681059,681151..681380))
                     /locus_tag="MYCTH_2122038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658445.1"
                     /db_xref="GeneID:11508646"
                     /db_xref="InterPro:IPR012816"
                     /db_xref="JGIDB:Spoth2_2122038"
                     /translation="MPPKRSKPQHQKSKRIRVARPETGPPAESQSPTAKSEADSPVYF
                     WRISDPAGYLSQWYPCAFSDDKDPSIIYPTAEHYMMYQKAVLFSDLDVGAEILATPDP
                     REVKALGRKVSNFSDAVWNARREGIVRRGNLLKFTRPVDPEDGWWMVHLDGEGGESVS
                     IRELLLRTGDREIVEASPLDRIWGIGFSAAKAESMRKRWGLNLLGKALMAVREEL"
     gene            683902..687013
                     /locus_tag="MYCTH_2294223"
                     /db_xref="GeneID:11505776"
     mRNA            join(683902..685328,685399..686618,686673..687013)
                     /locus_tag="MYCTH_2294223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658398.1"
                     /db_xref="GeneID:11505776"
     CDS             join(684501..685328,685399..686618,686673..686865)
                     /locus_tag="MYCTH_2294223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658446.1"
                     /db_xref="GeneID:11505776"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2294223"
                     /translation="MAYPYDADAASGLVRPPLRQVLAGLHYAYPTVVFVYYMATSTVA
                     VCTLQTRSSDPAHPRRRPITWLLVSVIATYFAQLLALGIQGAVRHVFPFADQDIIIGL
                     MSCALVFGVVVAGLSDAANPVWYPYIGSFAIALVLEPVLAILSLMVRPAGSLRFIDFF
                     DISAVAVRYFAVLLAVVLYFAGSWDHRKEKGTDSERQSLLKSNGHASHDSDSDGQSDG
                     TRQNGYGSNSDSSADGNLSSDTDEDDNPYERRQRQASEQMEKRLKEKGNWVTYAKSFM
                     IFFPYIWPVNRRSLQVRVFLVGLCLLAMNFINLLIPRQLGIIMDALAGTNGRNPWNEV
                     LLFAGLKLVASEAGLTLLRQWLWIPVEYYSFDAISTAAYSHVLNLSSDFHDSKSSSDI
                     MMAISCGQSISNILESICFRAVPMLIDMVVAFVYLSATFGPYEGFITIATATTFMYIA
                     TRMISALKTARRNEVGAWYKEHYVRQAGIQGWSTVASFNQIGHEEDRYSVAVKDRVNK
                     TQKVYFGYVLAYALQFLVLLSGLLAGAFLAVYQVTHDEATPGDFIMLLTYWAQLVAPL
                     TFFAGLGKNISRDLLQAEQLLEILQTKPTVLSKEGAPPLHFNSGEVRFDHVYFSYDNK
                     KEILKDINFTATPGMTVAFVGATGAGKSTILKLLDRFYDVSKGSIKIDGQDIRDVDLY
                     SLRAQIGVVPQAPILFDDTIMNNVRYAKLTATDEEVYEACKAASIHEQILTFSDGKIC
                     SPHLVG"
     gene            687014..687742
                     /locus_tag="MYCTH_2294224"
                     /db_xref="GeneID:11513309"
     mRNA            687014..687742
                     /locus_tag="MYCTH_2294224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658399.1"
                     /db_xref="GeneID:11513309"
     CDS             687161..687526
                     /locus_tag="MYCTH_2294224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658447.1"
                     /db_xref="GeneID:11513309"
                     /db_xref="JGIDB:Spoth2_2294224"
                     /translation="MNADRIIVVTGGEIVEQGSHEELIRADGKYAELWSKQIFVKPRD
                     KELCEDGKPATRGRKTPNIVNDLSAEATSSELAKVKSNPTTSGKPNGQVNGHADGSGS
                     TAKGTTADNPTTPGPKKEV"
     gene            complement(689219..690726)
                     /locus_tag="MYCTH_2294226"
                     /db_xref="GeneID:11513037"
     mRNA            complement(join(689219..689421,689479..690114,
                     690205..690248,690412..690726))
                     /locus_tag="MYCTH_2294226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658400.1"
                     /db_xref="GeneID:11513037"
     CDS             complement(join(689253..689421,689479..690114,
                     690205..690248,690412..690510))
                     /locus_tag="MYCTH_2294226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658448.1"
                     /db_xref="GeneID:11513037"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2294226"
                     /translation="MTDPSATKSFLEQTVSLMSSAAGYMRLPAIASTGIAAVLTALLY
                     FKQKALIYPSNVPPNARTDVPRPSQYNFRDYEELIIPTNDGEKLSAFYIRGPRGGPNS
                     KLTVLMFHGNAGNIGHRLPIARMLIAASGCNVFMLEYRGYGISTGEPDEAGLNIDAQT
                     ALDYLRDRAETRDHKIVVYGQSLGGAVAIRLVAKNQSTANISGLILENTFLSMRKLIP
                     SIMPPAKYLAYLCHQVWPSDSLIPSIKVPTLFLSGLQDEIIPPIHMKRLHDLSRAPIK
                     VWKPLPGGDHNSSVVEEGYFEAIAEFLERLMDEEKKEKE"
     gene            693317..695220
                     /locus_tag="MYCTH_2294230"
                     /db_xref="GeneID:11513042"
     mRNA            join(693317..693943,694000..695220)
                     /locus_tag="MYCTH_2294230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658401.1"
                     /db_xref="GeneID:11513042"
     CDS             join(693905..693943,694000..695208)
                     /locus_tag="MYCTH_2294230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658449.1"
                     /db_xref="GeneID:11513042"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="JGIDB:Spoth2_2294230"
                     /translation="MVYFPGTEYRSHTSCISEAQKYQGALYRDKKNKGQPAQATHQNQ
                     SNQSNQSSSNTNPNAMVQAAYVEDVAEDRDSWRNYEQRSDDDNHCIADPPPEAPTPPS
                     ALETAQAQANVNVFDFLVTNPTPTASHVSLPATAPAQLSEDTQLVRFDPEANGMAETP
                     GDANAMVQYGTGPVPSKFETPAPKAARKKVKDGDRDAKKDKKRKRLHIETDHVMTDAP
                     PVLHSGLTGGLNRLMSRPTVFPPSPDYSGGDVAETPASPLKKSKSKHHKSSRTGESLG
                     NSLMAMIAAGSKPKSSSKKRTKSKSSSTPSKKKKGSSKSLEAPKEPKLLEFRPVAKDS
                     KDEGGTMVVYKPPAEHFLSFVTKGPESERGCSVNKALKRYHRERSASGTSVSKLVKEK
                     ELWKSLRMRRNDRGEIVLFSLDS"
     gene            complement(695956..697632)
                     /locus_tag="MYCTH_2294231"
                     /db_xref="GeneID:11505642"
     mRNA            complement(695956..697632)
                     /locus_tag="MYCTH_2294231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658402.1"
                     /db_xref="GeneID:11505642"
     CDS             complement(696067..697431)
                     /locus_tag="MYCTH_2294231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658450.1"
                     /db_xref="GeneID:11505642"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Spoth2_2294231"
                     /translation="MATQPPPARPPPPLTSSPYPYAAAPDIIRAHQKDAYFQGVLANR
                     LSDLHRRLRGARSAHAWAAETRTFAAALYLCLTTLLGNRTLGEEYCDLVQVEEAPSKL
                     FASSSSKAADDHIYENGLGGGGDGGPLLPSLPRRAGYILTAIVLPHLASRALPSVRSA
                     IRKRLQSRLATLSRRRQQTGTKSGSGRGGRGGGGGITEYRVLRYLLTHLTPLTSGAHF
                     RAATLAVFYFTGAYYELSKWVWGLRYVFTTRAGRVVDDDHNRHHHSPQHGGGNGGRAG
                     YEVLGVLLVVQMAVRAWLHVREQLSSGSVAGGGGEEEEDGEDGFRERTAFGPGTNVDV
                     SLDEHAFTSNNELLGGGGGGGGSSSQRSLGEIGAMAHTPVLKAGRARYDLGTSDKVMG
                     WIKGAQQRKCTLCLEELKDPAATQCGHVFCWACIGDWVREKPECPLCRREAMVQHILP
                     LRAA"
     gene            697952..699509
                     /locus_tag="MYCTH_2294232"
                     /db_xref="GeneID:11505483"
     mRNA            join(697952..698206,698281..699509)
                     /locus_tag="MYCTH_2294232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658403.1"
                     /db_xref="GeneID:11505483"
     CDS             join(698116..698206,698281..699419)
                     /locus_tag="MYCTH_2294232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658451.1"
                     /db_xref="GeneID:11505483"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="JGIDB:Spoth2_2294232"
                     /translation="MDGDPAVESGLDSFSLTFPLPYRVAFIIILAVWGWGVNLHFLYR
                     RRIDVPALIRYPGRSSPAQITHHQSTYRLASFLSLTSAASILTFWLFTRRDPRRVIDY
                     DWLPMTNLLVVAVLFCVPLRRFSLPHAGRGRLLQTLRRISVGGFAEAKDGKFGDIILA
                     DVLTSYAKVLADLFVCVCMFLFGGRDGSGSATARPDRGCGGAVLVPLIMALPSAIRLR
                     QCLIEFVRVRRAPYREATGWGGQHLANAAKYSTAFPVIVLGAMLRAREGGSPGLFRAW
                     VAASLLNSLYSFYWDVAKDWDLTLFSKDRDLPDHPYGLRRTLLVHRPGVYYAVIVMDL
                     VLRCTWMIKLSPRMDQFSDFESSIFLIQFLEVFRRWVWIFFRVETEWIRTSVTSLGHD
                     DMVLLDDYQGNKYEDED"
     gene            699937..702062
                     /locus_tag="MYCTH_2294233"
                     /db_xref="GeneID:11513019"
     mRNA            699937..702062
                     /locus_tag="MYCTH_2294233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658404.1"
                     /db_xref="GeneID:11513019"
     CDS             700054..701790
                     /locus_tag="MYCTH_2294233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658452.1"
                     /db_xref="GeneID:11513019"
                     /db_xref="JGIDB:Spoth2_2294233"
                     /translation="MSPPQTVGISSSTLGRSRPNLRTQRSLPPPPPEEIARHEKRALP
                     PLPSRRNSVLSAFSKEVDEALATPEPVVSPDDGSTIHLIFCDETLPGDAHAEISCQAD
                     TCLDKSRHREDLRIDTELVRSVESDTPTFPHPQSKLQLHGGVSPLSDDSGDYSPGEPR
                     TAVSDVDGDVEGYGWSLSSGVAWDYLGSSFSHRRSIRSSAIPSPLRVAKPPKPSSTPE
                     GELSGFSTYDGHSSRLVPSPRIENERGGLWRDTASTKSTLDMNLETAKELSQGDCWAA
                     QQAQSTKQAHVAALQVPQAKRASHASDHHRLGVKHLPPPQHRVHRQPEHSPNPRPSWS
                     TEQLGPAWRPTTVHDTPGAVNASTFGGRLPQQQQKSVLPSPSPSSSGPRSRFSWDSDT
                     SPHDAVGSPETGGSISISTGSNDMTGDARSNTSARHHHRRHSSGIMTKVFRRTSSSCL
                     TTPPPPPSPQPNSISQHQQQQQQQQQQQQLPSCHFHPQHDGAQQPSRASQHRFQHPGP
                     SPAVLKTKSSMSALVTKTADLVDAAAEFWNRSAASIMDGTLGGGKRRKRKLKSSIRVL
                     GDGGQLLAPKSS"
     gene            702408..704332
                     /locus_tag="MYCTH_2294236"
                     /db_xref="GeneID:11508044"
     mRNA            join(702408..702805,702918..703083,703170..703220,
                     703313..704332)
                     /locus_tag="MYCTH_2294236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658405.1"
                     /db_xref="GeneID:11508044"
     CDS             join(702503..702805,702918..703083,703170..703220,
                     703313..704190)
                     /locus_tag="MYCTH_2294236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658453.1"
                     /db_xref="GeneID:11508044"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Spoth2_2294236"
                     /translation="MRAPPVAEEQPPVHAQVGSPEYQEEAETATHSIQSIQSINHQDS
                     SASDTVLQPPAELIDEKANSEDSDEDEGEDLEGATDKDEGSYYWNASTMAPLNAASAA
                     AIARLRAYKPPPFPLWDRLPLSRRAAVLMLLYADRRGDLRVVITMRAASLRSFSGHAA
                     LPGGKADTLQETPYQIARREAWEEIGLPLDDSKLPPPFRIEHLCYLPMNLARTEIVVR
                     PCVALLHTGDTTVINPAPATNRSSSSSSSSSLSSSTPAAARSSPTVDESLIPRLDAKE
                     VAAVFSAPFHNFLRATDEVPPSKSGRKKLPPGPWYEGSWTTWHDSQWRMHFFYVPVTD
                     QMVVKPRVREGGLAALSEHEADDHRDGRGGSNKDNDNNKGLERYKVWGMTARILVDAA
                     TVAYGEEPEFEHNQHFGDEALIEKLAREGRLGEKKRTGSLLVSEDLKKVREAVQEAGE
                     RGKETEKGKGEASKM"
     gene            complement(704280..705645)
                     /locus_tag="MYCTH_2294238"
                     /db_xref="GeneID:11508086"
     mRNA            complement(join(704280..704486,704575..704761,
                     704938..705121,705241..705645))
                     /locus_tag="MYCTH_2294238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658406.1"
                     /db_xref="GeneID:11508086"
     CDS             complement(join(704369..704486,704575..704761,
                     704938..705121,705241..705363))
                     /locus_tag="MYCTH_2294238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658454.1"
                     /db_xref="GeneID:11508086"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="JGIDB:Spoth2_2294238"
                     /translation="MDHSSHDHQEHHLMMDQSAHSGHGDMGGGHGGDGGPMCKMNMLF
                     TWDTTDLCVVFRQWHITSPFGLVVSLVAIVAICAGYEALREGIRRYEAVLARRVDTAP
                     PPRYPRSPSPSPSPRYSEESATERAPFLSSLGAGQNREQIAWRAHVVKAILYGIQNFY
                     AFMIMLIFMTYNGWVMIAVSVGAGLGYLLFGGKTAVTKETACH"
     gene            706416..707356
                     /locus_tag="MYCTH_2294240"
                     /db_xref="GeneID:11508543"
     mRNA            join(706416..706514,706665..707356)
                     /locus_tag="MYCTH_2294240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658407.1"
                     /db_xref="GeneID:11508543"
     CDS             join(706512..706514,706665..707102)
                     /locus_tag="MYCTH_2294240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658455.1"
                     /db_xref="GeneID:11508543"
                     /db_xref="InterPro:IPR010329"
                     /db_xref="JGIDB:Spoth2_2294240"
                     /translation="MIVGGPNARTDYHINETPEWFYQYKGAMLLKVVDEGGEFRDIVI
                     GEGDMFLLPAGTPHNPVRFADTVGLVLEQRRPPGSLDRMRWYCPACRAVVHEAAFHCT
                     DLGTQIKDAVERFRQDEDARRCKSCGQLADWRPEPGSVRNPNLE"
     gene            complement(707416..708718)
                     /locus_tag="MYCTH_2294243"
                     /db_xref="GeneID:11505395"
     mRNA            complement(join(707416..708016,708128..708339,
                     708509..708718))
                     /locus_tag="MYCTH_2294243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658408.1"
                     /db_xref="GeneID:11505395"
     CDS             complement(join(707589..708016,708128..708339,
                     708509..708561))
                     /locus_tag="MYCTH_2294243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658456.1"
                     /db_xref="GeneID:11505395"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="JGIDB:Spoth2_2294243"
                     /translation="MASLKKAGKVVCIGRNYADHIAELNSARPKQPFFFLKPTTSILL
                     PGEGPVIRPRGIDLHYEVELALILGKRLKDLNAQDEQAAMDAIESYALSIDMTARNAQ
                     NEAKKKGLPWDISKGFDTFLPLSNVISKAAIPDPHKIELYLSVNGKVRQDDSTELMLF
                     RIPRVLSEISKVMTLEPGDIVLTGTPKGVGPVVPGDVMRAGIRVDGKELEEAKIEVAV
                     EESTSSYEYAET"
     gene            <710038..>710843
                     /locus_tag="MYCTH_2050447"
                     /db_xref="GeneID:11505649"
     mRNA            join(<710038..710094,710193..710480,710643..>710843)
                     /locus_tag="MYCTH_2050447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658409.1"
                     /db_xref="GeneID:11505649"
     CDS             join(710038..710094,710193..710480,710643..710843)
                     /locus_tag="MYCTH_2050447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658457.1"
                     /db_xref="GeneID:11505649"
                     /db_xref="JGIDB:Spoth2_2050447"
                     /translation="MESIQLAQMLADLSDLNAAESPAASALVNANKAGPTSATTESGS
                     SADQVPARSGPRHHKRTGSGGSAASAGSAFMSRTASPAKFDKYGRRILTPPNTRTNSA
                     YGSIPGTPRRESEPIDDDVDRANSLMALYEIRAKLRDQHNSQNLTRLREKIAALHAKQ
                     VQAEKKDGDAGRTKFSYPKSP"
     gene            712343..714702
                     /locus_tag="MYCTH_2294247"
                     /db_xref="GeneID:11513045"
     mRNA            join(712343..712671,712747..712837,712939..714240,
                     714333..714702)
                     /locus_tag="MYCTH_2294247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658410.1"
                     /db_xref="GeneID:11513045"
     CDS             join(712568..712671,712747..712837,712939..714240,
                     714333..714440)
                     /locus_tag="MYCTH_2294247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658458.1"
                     /db_xref="GeneID:11513045"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="JGIDB:Spoth2_2294247"
                     /translation="MATGVDAKLLKSTKFPPEFNQKVDMQKVNVHVMKKWIANRVTEI
                     LGNEDDVVIELIFNLVEGARHPDIKSIQIQLTGFLDKDTPAFCKELWKLLLSAQASPQ
                     GVPKELLEAKKLELMQEKMEADRAAEEARQRREEFERRDRGRGGRGGGGGGGGPGRGG
                     DSWRGRDDRDRGGLGRGRSRSPPRFRERGGRGGRGEPRGGGWTRDVYVPRGSPPRQRG
                     GGRRDGRRWRSRSRSRSRSRSRSRSRTRSVSSARSTSSRSLSRTPSVDGSRRSYTRSP
                     TPPRRRRHGRSRSRSRTPLSRRDSHKRYRSPRGRSRSVSSDRGSPSPKRRRYSRSRSW
                     SRGRSRSRSRDESRSLSRTPTRRYSRSVSMSSSRYSRSPSRTPPRRSRRDSRSSSRGG
                     GGGGGGGGGGRRRRSRSRTRSRGRSASPASSYDSRRRSPRRRPRGGRGDSRRRGGEGD
                     GSPRGGYRDRRASSASSHSSTRNRSADGSGAESRRRSSLDDPPASGAKQDARTANELR
                     EMELKEKIKKMRSSKSGDDHVEANAA"
     gene            715197..716485
                     /locus_tag="MYCTH_2294249"
                     /db_xref="GeneID:11506040"
     mRNA            join(715197..715537,715748..715960,716067..716485)
                     /locus_tag="MYCTH_2294249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658411.1"
                     /db_xref="GeneID:11506040"
     CDS             join(715346..715537,715748..715960,716067..716300)
                     /locus_tag="MYCTH_2294249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658459.1"
                     /db_xref="GeneID:11506040"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="JGIDB:Spoth2_2294249"
                     /translation="MAESTAAAAGNAPKAAAGPNGTTATTAATDTAASSSSAGIPFYE
                     SQRKQLRELISRRRALEKKLAAIEEHIAVKEANYLESTPAGNIIIGFDNYVKGCNAAA
                     AQRRKTGLTDQNKVFSRSSVSYNPAAAAAAAATDAQTPASTPAPTPMSSSFGNGNGPS
                     GAPTPTSAAGGGRANASKKSKRNTPAAAAGAEDSETDGREAKKVRTSFGARK"
     gene            716940..719902
                     /locus_tag="MYCTH_2294250"
                     /db_xref="GeneID:11508084"
     mRNA            join(716940..717121,717319..717527,717586..719009,
                     719087..719289,719377..719493,719654..719902)
                     /locus_tag="MYCTH_2294250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658412.1"
                     /db_xref="GeneID:11508084"
     CDS             join(717020..717121,717319..717527,717586..719009,
                     719087..719289,719377..719493,719654..719776)
                     /locus_tag="MYCTH_2294250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658460.1"
                     /db_xref="GeneID:11508084"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="JGIDB:Spoth2_2294250"
                     /translation="MTLTATKFTPEVMLSAPRRSPGVPNPSGTLALYTVSTYSFKDHE
                     KTTNIRVLDINTGTATTPVDEAGASNPVWLNDDEILYVRSGDKGSSTLVVRNVTASAS
                     SSFYEAGTIQGPIGDLKVKALADGTVALACSASATPDGNLFNPETEVKPHSTARVYTS
                     LFVRHWDTWNSEKRSSIFYGVLDKKDGKYALRDGRLTNALAGTRLSSPVPPFGGTGDF
                     DIGPEGLVFVAKDPDLDPAIYTKTDLYFIPLKTFAESSPPPPKIVKTPGLEGYSNSPV
                     FSHCGRKVAFTRMRSNQYESDKPRLLLVRDIGNPDETEEFFATPDGDGAWDSRPESIA
                     WGHDDTQLYVTAEHRARTLIFTLPSTPSRATSLPTPLPTPDGSVADFRLYAASSPSSS
                     SKTDHLFVTTTSLIDNSCYSLTHPATATSTVISSASKQGRSFGLSRAQVDSITVPGPD
                     YDVHALVVRPSTWVSDAATGSTTGSRRATKKYPLCMLVHGGPQGAWQDSWSTRWNPAV
                     FAEQGYVVVCPNPTGSTGYGMALEDGIRGQWGGRPYEDLERCFDWVVANMPEVDGERA
                     VALGASYGGFMINWIQGHPLGRKFKALVCHDGVFSTLNQWATEELFFPIHDFEGTLYE
                     NREGYEKWDPARFINEWATPQLIIHSELDYRLPVTEGLAAFNVLQAKKIPSKLLVFPD
                     ENHWVLKHENSLVWHREVLGWINKYSGIDDEQKLAEETEALKV"
     gene            complement(720464..722661)
                     /locus_tag="MYCTH_2294252"
                     /db_xref="GeneID:11505481"
     mRNA            complement(join(720464..722198,722254..722661))
                     /locus_tag="MYCTH_2294252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658413.1"
                     /db_xref="GeneID:11505481"
     CDS             complement(join(720501..722198,722254..722517))
                     /locus_tag="MYCTH_2294252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658461.1"
                     /db_xref="GeneID:11505481"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="JGIDB:Spoth2_2294252"
                     /translation="MFWSGTLLSATGPLAKAWLSANQERKISKVQILQHNLQDSVDAI
                     IAPNDAPLALRLSGQLLLGVVRIYSRKARYLLDDCNEALIKIKMAFRSTGNHDIPTNL
                     HATTKESLMLPDTITPYDNLDLLPPPSSEFLTSQLEEVTATPISSRKAAVRPNNRDIN
                     LQEDFNNSQYLQDTTGDDEELALANMDDLDLELDFGMDIDERPTKLMDKSVEMGRDAP
                     AARPVEEDMLSELDMGGPSKDRKARVPSLALDLDFGDGVRVADGDGDIQMGDDDLRFD
                     VGEESAMPGAARPDVSRARISESPLSDIDEQFAKEMETEYSRHMGSDMYEPGEDATAS
                     TIRAPQRQKKKKLLQPDDQTMLSNSQIKEQQAKRDNILKPQSFLTHDPYVAGLMDLHK
                     NGGFVNNILFEGRSAGWAPELKGLLSLSSIRPNELKRKRDSGVADMDSEDEQGASKSP
                     RLELPEDETVLGPDGAIAGNQSVAADGTVLEIPADDTAVFHNDDENERPGSSREGGPG
                     SPVPNFEDTTMPIVHPADSGPVSVGTKHAVHVLRDLFGAEAATDAEKRRKTAVVFQDL
                     LPEHKTSKADATKMFFECLVLATKDAIKVEQPDGSLGGPIRVRAKRGLWGDWAEREAG
                     GEPAREQQQTQQNQPESAVRSSAAVAVEA"
     gene            724102..727992
                     /locus_tag="MYCTH_2294253"
                     /db_xref="GeneID:11508154"
     mRNA            join(724102..724358,724440..725631,725699..727027,
                     727151..727992)
                     /locus_tag="MYCTH_2294253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658414.1"
                     /db_xref="GeneID:11508154"
     CDS             join(724206..724358,724440..725631,725699..727027,
                     727151..727698)
                     /locus_tag="MYCTH_2294253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658462.1"
                     /db_xref="GeneID:11508154"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2294253"
                     /translation="MDRFTRKDDGDALPLYQNPPESRSAGVAAELERSWSTSPRLGPR
                     TTSAQSRTVADEYSCLTPAEVASRLKTSLTHGLTPAEALSRLRDYGPNEIPHDEPEPI
                     WLRFLKQFQEPLIVLLLVSAGASLLVGNMDDSVSITVAVTIVVSVGFIQEYRSEKSIE
                     ALNHLVPNHAHLIRKQAPNSSPGARSPNWPGDKTPDSTPGSATPQEEVLEATSSKVMA
                     AQLVPGDLVLFTTGDRIPADIRVTKATDLTIDASNLTGENEPVRVTANTRPRRAIGVS
                     SLGNATLQLPQPSVGGASNGHAAGHAKGDHDGLHNIAYMGTLVKSGHGQGIVFATGGD
                     THFGTIATSVSGTESPRSPLQLSMDELGSQLSKVSFVIIGVISLLGWFQGKKLLEIFT
                     ISISLAVAAIPEGLPIIVTVTLALGVHRMARHNAIVRRMPKVETLGSVNVVCTDKTGT
                     LTMNHMTTAKMWYFGADKVVDVESDDEAENKLDAATLRILRIGNIANNARLARKSNEN
                     GAAARAVLSSTENRGHASTYTRWVGQPTDVAMLDMLDRFKEHDIRDAIGPRVSETPFS
                     SERKWMGVTIGSEGGKGDKEFAYMKGAIDKVLDACDTYVTKDGREVVLDSARRQEALQ
                     AAEEMASTGLRVLAFASGPVSKPRSGRPGARSNTPGSDRAESPVHHGSEEQYKGLTFA
                     GLVGMSDPPRPGVGRSIRKLMRGRVKVIMITGDAETTALAIGKQLGMAIATPTAHASN
                     QVTIKPVLRGDEIDAMSDEELARAMEHTTIFARTNPDHKLKIIRALQSRGDIVAMTGD
                     GVNDAPALKKADIGIAMGMHGTDVAKEAADMILTDDDFSTILHAIEEGKGIFNNIQNF
                     LTFQLSTSAAGLSLVLLCTALGFKSPLNAMQILWINIIMDGPPAQSLGVEAVDKDVMN
                     RPPRRRGDAVLTRPLITRVLTQAAVIMAGTMLVYTHEMLDDGEVTRRDTTMTFTCFVL
                     FDMFNALTCRSESKSVLRGEVGLASNTLFNWAVAGSLIGQLLVIYFPWLQDVFQTEAL
                     GWSDLLKLLLLCSSVFWVDEARKWWRYRNGRRGFVGGGYSQAV"
     gene            <729002..>734778
                     /locus_tag="MYCTH_113715"
                     /db_xref="GeneID:11506049"
     mRNA            join(<729002..729106,729182..729445,729518..731313,
                     731980..733423,733546..734580,734641..>734778)
                     /locus_tag="MYCTH_113715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658415.1"
                     /db_xref="GeneID:11506049"
     CDS             join(729002..729106,729182..729445,729518..731313,
                     731980..733423,733546..734580,734641..734778)
                     /locus_tag="MYCTH_113715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658463.1"
                     /db_xref="GeneID:11506049"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="JGIDB:Spoth2_113715"
                     /translation="MAQVQMQELLVSASLVGKIDKLREINVGKHVPLPQLVVVGDQSS
                     GKSSLLESLTGIPFPRDVELCTRFATQITQRRDDISRVEVSIIPGPNASEAHRKHVEG
                     YRTDGLSPDDFRAKFPTVLQEVNVRMGIQMGRRPDSGYATDEYASDGDASNGDTTAAA
                     PAAKQAGAQGGSVFSEDVLKIEICGPSVDYLTVIDVPGIFRTPTPGMTTAEDMAMVRR
                     MVRSYIQDSRTVILAVLPSNVDVSTQEILTIAEEYDPKGERTLGILTKPDLVVEASAK
                     EAVCNIVRGKRKKLTLGYYLVRGRGADQGDSDFARREDLFKEKPWNTLPPERVGIRAL
                     KARLAELLGHIARREFPKLRKDIGDMLQAAEREMTALGPSRRDEHEQRRFLSGIAGRF
                     QELVRQTLEAQYAGESAFENSTELRLVTQIVNLADEFNQEFEDKSVLRRFQDTMDEEE
                     DDEAGRWQSKTGTNAILEFAQHIDPEDFPELERIISSDFDVDEPDDDIIYWLGELYAR
                     SRAMELGSFSSAVWASAWREQSSKWPNLSKAFMSRVVVAIHRFIMAALREACPDPNVR
                     EELWSAMLEELLRRYQEGMAQAELLVSAERDTKPYTLDHHFNERRQRSRGNRIADRLY
                     HLSVKDDGKRWVTVDQVQNSTEKMSNKDDVIEKLHDDLGAYYEIAQKRFVDNLLNQAV
                     NYRLLFGPRTPLRVLNHDWVIGLRADELEAIAGESPSNKECSATVTTAASMSALSNGV
                     ASTTAIKMSAVNNSNGSSSNSNSGSSNNRSSIPSRTRAATMTTTAAAAAAAATATATA
                     ASRKDDADPSAALRAATTPSEIRAALSALHARESALTARLDALVSAQADLARSLSRLD
                     NLRAGLGAQLLAVRNISNTMLSPAADTAARLSGRVRALDLEKQRVEDTLRVVEQVAEL
                     KACVAGVVGSMGAPQDWEAAAGYISRASRVPDAIVRGGFAAAVVPTVEVPDPPWVTLE
                     QARESLCALFLREFKKAAAENDAAKVTRFFKLFPLIGRGDVGLDVYGQYVCQGVAGEA
                     RASLREGASGPGGGPGRKDGVFYANALTRLFDHIARIVEAHGGLVERHYGTGKMVKVI
                     ERLQMEADVQGGIILDSWSDDRTIDRRLTDVKSYPFTFLVQSYLPQRGFGGTPRVNSP
                     AAGGGGGGSSGGAAGNDARNSEDEGVNTKEVDALLVEIAVMLEKWSVYSRFLAAKCRD
                     PTSPDDAPLTLPDLLVKSNLSRKVAGKLIEPYNTLATFFFRRSVEKAFQLDESPAGLS
                     LNMSKPIDSNPPYIISAVDVVMYIVNTIIRRSISTSQRAVVDSAVGAISSILGSNFVG
                     MIQRRMRHESYPKPAVQGNLPPEHLIVSFIVLINSLDMANEYLARIVSNILEPADQHQ
                     HQHQHQPNGAPGHRAGPLRDAFPFHNDAAEVAARLASLNTSFSSVSTELLTEGVRVLF
                     SQVVKPRLRPVLTDAFRDADYALNEDELAELAAQTDRTEDELLEQVARTFERGWDALM
                     RPLARLMTPRTYAALLELTADHLARVLEKRAWSYAGGRTSPYGAIRMERDFSGIVLMV
                     ANMEDEEWDELMAEHGLDDGGMEWVLTEEERRRARTIVKSY"
     gene            complement(735331..736871)
                     /locus_tag="MYCTH_2294261"
                     /db_xref="GeneID:11506069"
     mRNA            complement(join(735331..735594,735854..736871))
                     /locus_tag="MYCTH_2294261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658416.1"
                     /db_xref="GeneID:11506069"
     CDS             complement(736384..736680)
                     /locus_tag="MYCTH_2294261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658464.1"
                     /db_xref="GeneID:11506069"
                     /db_xref="JGIDB:Spoth2_2294261"
                     /translation="MTSKPPPGHFNILYFASAGSYTSKNVEALPAPLPLRKLFGTLEE
                     RYQGIRASVLDHSLVTINLTYVDVPDDETAREGEEEVVIQEGDEVAIIPPVSSG"
     gene            complement(737211..738970)
                     /locus_tag="MYCTH_2294264"
                     /db_xref="GeneID:11505461"
     mRNA            complement(join(737211..738604,738663..738722,
                     738783..738970))
                     /locus_tag="MYCTH_2294264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658417.1"
                     /db_xref="GeneID:11505461"
     CDS             complement(join(737414..738604,738663..738722,
                     738783..738821))
                     /locus_tag="MYCTH_2294264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658465.1"
                     /db_xref="GeneID:11505461"
                     /db_xref="InterPro:IPR006996"
                     /db_xref="JGIDB:Spoth2_2294264"
                     /translation="MASHRKYAALPDLDSAPDIYETPELTDDQSTIPPTTVRSPSDNE
                     YDDDEDDTTGISRSRLRIDQARSKFMPARVDATDVDFSDRLVSKRRSYKTSTRRHRIL
                     EDGTEEIGDLSDEDDAGSLARKIARLRREIEEAKEEYQKQKAASGESNDGGEEVAEDE
                     FESLSKVLNEMSTLDRPLPTRTIPAPPPASVGKKDSGEHAGGVSYGTTPGPNYERTHV
                     LAKAADFDSRLLVLEKVLGLGSAGMPEFDAGSLPRAIIPLLENLHKQISTLSEASVPS
                     LDSISRRVRALTQEAENLEKARRNAKTAQDALASAGAAPSSEGATREDSEQTAKINAL
                     YGTLPTIENLTPLLPPLLDRLRSLRSLHAEAATAAETLARLEKKQAEMADEIQQWREG
                     LEKVENAVREGDATMTKNVEVISGWVKDLEEKLAKLS"
     gene            739318..>741285
                     /locus_tag="MYCTH_105600"
                     /db_xref="GeneID:11513361"
     mRNA            join(739318..741000,741270..>741285)
                     /locus_tag="MYCTH_105600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658418.1"
                     /db_xref="GeneID:11513361"
     CDS             join(739442..741000,741270..741285)
                     /locus_tag="MYCTH_105600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658466.1"
                     /db_xref="GeneID:11513361"
                     /db_xref="JGIDB:Spoth2_105600"
                     /translation="MPGRRYIGLSSQQRVPHLLSSFSKKPVAKGIKDVDVDAPPLSSS
                     DSSDNEGLPTRANIQPTQFSDSRQSKSPLKRDVRNSGANGSGIAPGERFKRTRASTRR
                     GSAGELGSSFQRVDRQQEAEAIDSDDATSPPVSKRPKRSPPGDGELDNHFNSEFFTKR
                     ATPSRRYGKQPKTVGGKQPRRAASPARTFEPPPEDSMSDAEDVDRYKLKLPSSPSETG
                     SETLSPARKFKPIQDLGSPEPPSPTRKRRLKMPNDDGPLLSGNYDPEESQRPVFTIPD
                     EIPDSFVGDDDEKLVLALSQTTNVPSASNLIRDGSISPLTDADDVPDPVPVCPLCKSE
                     VSQSVLDEFKAAHPRMTVSDMRRFCEQHKRRSARETWIAKGYPDIDWQRLDARIAAHY
                     GALRRILEGGAPSHYDALFRDAIRSGRNRTLLRSDANLTPGYYGLRGLRAMTENLIGE
                     FSALLRRRAVEDRLVSARGYTAYLQAVLVPELAVRLIMEDLGVGEKEARKVLTESSSV
                     GELLNDEIADVVFLSS"
     gene            743509..750960
                     /locus_tag="MYCTH_2294267"
                     /db_xref="GeneID:11505396"
     mRNA            join(743509..743898,744080..744788,745090..750399,
                     750474..750960)
                     /locus_tag="MYCTH_2294267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658419.1"
                     /db_xref="GeneID:11505396"
     CDS             join(743669..743898,744080..744788,745090..750399,
                     750474..750845)
                     /locus_tag="MYCTH_2294267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658467.1"
                     /db_xref="GeneID:11505396"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR013716"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Spoth2_2294267"
                     /translation="MPQPDETSRFSSMTGSSTDSGRSSITAKPLPATPTSPSLPNPPG
                     AAGNNNASRHGPHGSRWVAPSRLKTDEGGNPTRSSIKESDGQVSPTSNDARVALSPSS
                     TNSTTSMREHPMSDLRDYRRDLAILDLAGGRSSRTQQQTNPSTGSLGGAASAPPPEPP
                     VPMTFYDDSTDNLSLGSQLSPGVRTSISRATPVGSTDSPEAAYFTDERRPSVASITTT
                     ASSQGSRTSGARGGLRKLQGFFGEEFPGRDSSEISLAHPTGGREHRSHSHSYSRPHRD
                     RNYSNATDHGRDASPSSRPRTPVPAPEVVPFLYQEADDIARYGEAPVRDILSGPDRDR
                     YITDSSTQNPPRTSGSGRSGHSIVHLPGHHRHNKSNEDSRSLRPSISREDSTVSAPKD
                     RGGSAAMYGTKSRAQSPAPSAPSGYWTSKAAVGDGQTSPGHHHKRRFLGRLRGKRDKD
                     DSGDLRKLPASAQSLQPRPSRHESPFGDGQQSQGSEWPSTPDPRETHGLRPAFVRGAT
                     FNNKFPFSSKKSRTARQRDDLEDNIGPTDRQDTGGTMFHLDTNLNDMEGILSRPVPLT
                     PMNPDFLNEVDFDKLPIKSADPRGAWNAPDSWAVRRGDEAVAQVPEADDIGSPPRPEE
                     KMTNYCIRVFRADGTFATLQMALDATVSDLISQISKKSYVIDGMENYNIVLKKHDLTR
                     VLSSVERPLLIQKRLLQQIGYEERDRIEDIGREDHSYLCRFMFLSARESHFHALTHDV
                     GFGRMQKFSHVDLSGRNLTAIPVILYSRAPEIISLNLSRNLSLDVPRDFIQSCTSLRD
                     IKYTNNEARRLPPSLSWAKKLTYLDVSNNRLEQLEHADLGELTGLLKLNLANNRLSQL
                     PSYFGAYSVLRTLNISSNFLEKFPPFLCNLESLVDLDLSFNLISDFPDAIGKLRNLEK
                     FVVTNNRLTGTFPDSFKNLANLRELDIKYNAITNIDVIAQLPKLEILTADHNSISQFV
                     GSFERLRSLKLNSNPITKFEIKSPAPTLKLLNLSNAQLASIDESFNNMPNLERLILDR
                     NYFVSLPSQIGNLRKLEHFSIAHNSVRQLPQEVGCLTELRVLDVRGNNIRKLPMELWW
                     ANKLETLNASSNILDHFPKHASRAPQPPQPPDDARSTSSSVNSKQSSGSRALSSMPSV
                     EELNGDASRRPSQASGATLLSVGPPPVPGADNRKGSMVSLYGKGGRKTSVVSRSTQSS
                     TATTGTGLRKDSGLTALLTNTFAGSLRNLYLADNQLDDDVFDQIMLLSELRVLNLSYN
                     ELSDMPQRSIKNWPQLTELYLSGNELTSLPTDDLEDYSLLQTLHINGNKFTNLPADIS
                     RARRLAVLDCGSNSLKYNIANVPYDWNWNLNPNLRYLNLSGNRRLEIKQTYPGVVAQN
                     RDQLTDFSRLQNLRVLGLIDVTLTQPSIPDQNEDRRVRTSSSLAGYMPYGMADTLGKN
                     EHLSTIDLVIPRFNSSDSTTLLGLFDGQASSSGGSKIAKYLQENFAHIFAQELRDLKT
                     NQGETAEDALRRAFLALNKDLATAAIQHAEDRPITTHRGSQAPLVLSQEDLNSGGVAT
                     VVYLDEQELYVANVGDVQAMLIQTDGQAKMLTKKHDPADPPERSRIRDAGGWVSRQGR
                     LNELLPVSRAFGYVDLMPPVQAAPHIKHHTIGDNDETILLATREVWEYLTPELVVDVA
                     RSVRGDLMRAAQKIRDLAMAYGSKDKIMVMMLSVADLKRRRERSRMHRGQSMSWFNFP
                     QDDTAHQVATRRGRKAKAEGPLDSTLQRLEAEVPAPTGMIAIVFTDIKNSTQLWETYP
                     EAMRSAIKLHNEVMRRQLRRIGGFEVKTEGDAFMVSFPTATSALLWCFAVQTQLLTVN
                     WPTEMLNSISCQPTFDRDNKLIFRGLSVRMGIHWGEPLAEPDPVTRRMDYYGPMVNKA
                     SRISACADGGQITVSSDFIMEIQRCLETYQESGSSDDSFEDDGFARAIRNELRSLSSQ
                     GFEVKDLGEKKLKGLENPEYIYSLYPHALAGRIDQHNLHERAQAAADRPAMLSPDSQL
                     AINPDDIWATWHVALRLEMLCSTFEDVTRRKLHPPETELMERMKRRGGEVTERFLISF
                     LEHQVSRIETCISTLAVRRLVLVEGKPSAKPSDLRAPISDVLETLSDQLALLKKYEAR
                     YGPLDDAGEDPSSTQGTTSAVTSLPPPAAAPPSNNNNNNNNNNNSPQVTIPQAAIGSP
                     SASAESGVSTPESSPY"
     gene            complement(752212..755588)
                     /locus_tag="MYCTH_2294268"
                     /db_xref="GeneID:11509173"
     mRNA            complement(join(752212..752977,753065..755588))
                     /locus_tag="MYCTH_2294268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658420.1"
                     /db_xref="GeneID:11509173"
     CDS             complement(join(752418..752977,753065..755210))
                     /locus_tag="MYCTH_2294268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658468.1"
                     /db_xref="GeneID:11509173"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="JGIDB:Spoth2_2294268"
                     /translation="MAAQSTLRQSVAEEAIAAFIDKYTELIRSKLRKTSRTTRLLATL
                     ALVTSIILAGEGARRRWKRKRDEREQGRKLVRTNSWLHNKDGSRTIYVPYRNRDRPAK
                     VVIHTTKPLTFQAHRRLFLNPPRVSGLGDGTVPSAQTKPGLNLAFLHQFLSLMSIMIP
                     HWNSKEAGLLLSHSAFLMLRTYMSLVVARLDGEIVRDLVAGNGKSFLWGLVKWCGLGG
                     FASYTNAMIKFLECKVSIAFRTRLTRYIHDLYLNDNLNYYKVHNLDGGLGSGADQFIT
                     QDLTQFCAAAASLYSSLGKPFVDICVFNYQLYRSLGPLAALGLMSNYFITASILRKMS
                     PPFARLKAVEGRKEGDFRSLHARLIANAEEIAFYGGAETEKTFLDKEFKSLSKWMNDV
                     YHLKIRYNMLEDFILKYSWSAYGYILSSLPVFLPAWGGLGGKSEQAEHAVQGGRERTR
                     MKDFITNKRLMLSLADAGGRMMYSLKDLSELAGYTSRVYTLISTLHRVHAGAYHAKAR
                     DNELFSLSDVQGTTQLGFDGVRLENVPIVAPALWPQGGEELIESLSMIVRRGDHLLIS
                     GPNGVGKSAIARVIAGLWPVYRGLVSRPKATGEDGIMFLPQRPYLSIGTLRDQVIYPD
                     GEADMREKRKNDSYLQYVLELARLGYLPEREGGWNTRKEWKDVLSGGEKQRLAIARLL
                     YHEPKYAFIDEGTSAVSSDVEGLLYQTCKEKGITLITISTRASLKKYHTFNLVLGQGE
                     DGDRWELQRIGTETEKMHARRELEELREKLAQVDKWRARHAEIERELAKVWVEGGEEL
                     AAEGGQEGEGEGKAKVAADAGANVGTEGNAGEVDGEETPGKGQEEEVVVGVEQPETET
                     EADYQEAQEEMEDETETETEVETATQKHGGAEEGSSAGEGSGVVV"
     gene            757877..760106
                     /locus_tag="MYCTH_2294274"
                     /db_xref="GeneID:11509013"
     mRNA            join(757877..758061,758312..758595,758656..759419,
                     759477..759626,759685..760106)
                     /locus_tag="MYCTH_2294274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658421.1"
                     /db_xref="GeneID:11509013"
     CDS             join(758361..758595,758656..759419,759477..759626,
                     759685..759996)
                     /locus_tag="MYCTH_2294274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658469.1"
                     /db_xref="GeneID:11509013"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Spoth2_2294274"
                     /translation="MSRGMEERPQVAAESSKEKETLAPEDGASSKNNRGLLPVPSRSS
                     SQRVQPSPTATGLSGATAGDSRDSIGGRSKESRGRPTATPGQSEPNSLAATSQRKKKG
                     GLFALFACCGVPDNANGLESETPLPTHKLEKIPARPQTASRRTATPSEQPSGSRIQLS
                     EKEPSQSPSVPQGPAKNARRISGTSTQDQSTVGGERDNESKQTTLVGPGASNPVISVE
                     PPHATGTDAEKVEEAASEKDAEGDVQMPDAENARQLVSQGAAATAEETLPRVPPPPSG
                     PIPAVPSAPSNALIESPPVFAPDQPQRFLLPPQAPEHKGRKCLVLDLDETLVHSSFKI
                     LHQADFTIPVEIEGNYHNVYVIKRPGVDQFMKRVGELYEVVVFTASVSKYGDPLLDQL
                     DIHKVVHHRLFRESCYNHQGNYVKDLSQVGRDLKDTIIIDNSPTSYIFHPQHAVPISS
                     WFSDAHDNELLDLIPVLEDLAGPTVRDVSLVLDVTL"
     gene            761815..763165
                     /locus_tag="MYCTH_2073127"
                     /db_xref="GeneID:11511592"
     mRNA            join(761815..761971,762190..762520,762647..763165)
                     /locus_tag="MYCTH_2073127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658422.1"
                     /db_xref="GeneID:11511592"
     CDS             join(761969..761971,762190..762520,762647..762681)
                     /locus_tag="MYCTH_2073127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658470.1"
                     /db_xref="GeneID:11511592"
                     /db_xref="InterPro:IPR005609"
                     /db_xref="JGIDB:Spoth2_2073127"
                     /translation="MASPRASSPTAGSGAGSGPSGGGASSTGSAVRPSSPPPPGGART
                     AIRRRAAADQKERIANARPNSTRAAGAGGSSSTMLRLYTDESPGLKVDPVVVLVLSLV
                     FIFSVVALHIIAKITRKFSS"
     gene            complement(<767446..>768886)
                     /locus_tag="MYCTH_2122065"
                     /db_xref="GeneID:11505400"
     mRNA            complement(join(<767446..767488,767559..767612,
                     768447..>768886))
                     /locus_tag="MYCTH_2122065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658423.1"
                     /db_xref="GeneID:11505400"
     CDS             complement(join(767446..767488,767559..767612,
                     768447..768886))
                     /locus_tag="MYCTH_2122065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658471.1"
                     /db_xref="GeneID:11505400"
                     /db_xref="JGIDB:Spoth2_2122065"
                     /translation="MGRAAQWQPSGENLGSKKSEMRYVAPRVTVDRILRRINNEGTAQ
                     GARDAKQFEFAAILRARQAQSRRGGFARLSRGGSVDGKSRDTNKDARVRQQTMQETQK
                     HFPSPSETRSGRLHTNSALSRVQDRGLDHGCAAARKNPSGQASTHAATLLSITLARCA
                     QLAERPNRIALPSAQSAA"
     gene            <768990..>772020
                     /locus_tag="MYCTH_2055311"
                     /db_xref="GeneID:11508826"
     mRNA            join(<768990..769028,769190..769333,769414..769427,
                     769518..>772020)
                     /locus_tag="MYCTH_2055311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658424.1"
                     /db_xref="GeneID:11508826"
     CDS             join(768990..769028,769190..769333,769414..769427,
                     769518..772020)
                     /locus_tag="MYCTH_2055311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658472.1"
                     /db_xref="GeneID:11508826"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2055311"
                     /translation="MAGFFQKLKGAGSGVSKSDNTASAKSKKDEPQPDLTPLEKLLQN
                     AGPIREDGSDKFFGLENFGNTCYCNSIVQALYHSEQFRRHVVNYPPPLPGDEGNRQRR
                     KVNVTIRPPVQPEQSGNAAGPSKPRQSFGGGPQLPPAVPPLRPEDKPDSPEYKKKQAM
                     LRGPILELAQESVDPSGMEECTFTALRDIFQAMIESQSRTGVISPQRFLDIFKRNNEM
                     FRNSMHQDAHEFYGIVLNDVIANVEAYAKRTQELADSTSKEDPSSHQAAGAIALTTTT
                     MTTTTTTTNAGSVTRSSGTGWVHDIFEGVLTSETRCLTCETASQRDETFLDLSIDLEE
                     HSSVTACLLNFSAEEMLCERNKFHCDHCGGLQEAEKRMKVKKLPKILALHLKRFKYTE
                     DYSRLQKLFHRVVYPYHLRMFMTTDDAEDPDRMYELYAVVVHIGGNAYHGHYVAVIKT
                     KDRGWLLFDDEMVEPVDKHFVRNFFGDKPGMACAYVLFYQETTFEKVREEMDAEGLDQ
                     VKLATQTADTAATTELPNGSSTALLSKLNSQPLSPVDENETLATLDQARSAPPEIHVT
                     TSTTSGGPPPPPLSASEVHPLVAAPPPGSAVATGEDKGTAVTSKTKAQLAKEKKEAKA
                     REKAEEKARKAAEKEQARLAAKERNEAQRRRIEAARLEREQLAQVLKESRRMAEEEEK
                     RRRKEVGAITTTDTTTSSDAGAGGGGGGRGGDGDGGDEQQHHRNGLFNRAGRTSKSMT
                     RKSFAFLHIGQNKDEDKGDPKGYRTNRSEAGESGSVQGESIPSSGAKENGAPSPYSHN
                     KNGGGSNGNGNGTSTSTSTSIGGINGSPAKKPSNPFLARAIPRSDTAPAGAVSQLRRT
                     PDKHDREKDRDGKENQNQKPALKERFSFGLGRKKSSRFLSSAS"
     gene            complement(772810..774060)
                     /locus_tag="MYCTH_2294281"
                     /db_xref="GeneID:11508470"
     mRNA            complement(join(772810..773180,773349..773456,
                     773607..773666,773764..774060))
                     /locus_tag="MYCTH_2294281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658425.1"
                     /db_xref="GeneID:11508470"
     CDS             complement(join(773125..773180,773349..773456,
                     773607..773666,773764..773791))
                     /locus_tag="MYCTH_2294281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658473.1"
                     /db_xref="GeneID:11508470"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="JGIDB:Spoth2_2294281"
                     /translation="MSILGKFLYITVLLLNAICIPSEDRFLARVGLAPGTYQRGFGQD
                     LDTSVKYKIIQLIASVRTVMRVPLIIINTLIIVYELILG"
     gene            <776271..>777660
                     /locus_tag="MYCTH_43671"
                     /db_xref="GeneID:11505409"
     mRNA            join(<776271..776415,776722..777512,777625..>777660)
                     /locus_tag="MYCTH_43671"
                     /product="Aldo/keto reductase-like protein"
                     /transcript_id="XM_003658426.1"
                     /db_xref="GeneID:11505409"
     CDS             join(776271..776415,776722..777512,777625..777660)
                     /locus_tag="MYCTH_43671"
                     /codon_start=1
                     /product="Aldo/keto reductase-like protein"
                     /protein_id="XP_003658474.1"
                     /db_xref="GeneID:11505409"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_43671"
                     /translation="MPSPVIKLNSGYDMPQVGFGLWKVDNSVAADVVYNAIKAGYRLF
                     DGACDYGNEVECGKGIARAISEGIVKREDLFIVSKLWNTFHDAERVEPIVKKQLADWG
                     IDYFDLYLIHFPVALEYVDPSVRYPPGWFYDGKSEIRTSKATIQETWTAMESLVAKGL
                     TKSIGISNFQAQLIYDLLRYAKIRPATLQIEHHPYLVQQELLNLAKQEGIAVTAYSSF
                     GPASFLEFNMQHAVKLTPLIEDETIKKIAAKYNREPAQVLLRWATQRGLAVIPKTTRP
                     ALMASNFQCTDFDLSEEDIATISSFDRGIRFNQPSNYFPTEYLWIFG"
     gene            complement(778553..780485)
                     /locus_tag="MYCTH_2073132"
                     /db_xref="GeneID:11505469"
     mRNA            complement(join(778553..778880,779043..779921,
                     780002..780485))
                     /locus_tag="MYCTH_2073132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658427.1"
                     /db_xref="GeneID:11505469"
     CDS             complement(join(778864..778880,779043..779921,
                     780002..780242))
                     /locus_tag="MYCTH_2073132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658475.1"
                     /db_xref="GeneID:11505469"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2073132"
                     /translation="MPAPVEEGNRSPGHHIELADDNPSPRHDGEASPGLRDSKGWDGK
                     LRVPKNALLANPEALSDPEYSDEDNVIPGEEVAADEDILDGEDSDTDEIICTHSRIKS
                     IPALRLERFKRVARICLRQNLIQDIEGFSCVASTLNDLDLYDNLISRIRGLDDLVNLT
                     SLDLSFNKIKHIKHVSHLTNLTDLYLVANKISKIEGLAGLTRLRNLELGSNRIRQLEN
                     LETLKSLEELWVAKNKITSLTGLAGLPNLRLLSIQSNRIRDLSPLRDVPQLEELYISH
                     NALASLEGLEHNTRLRVLEVSNNQIASLRGLGPLADLEELWASYNQIADFAELERELA
                     DKRALTTVYFEGNPLQLRAPALYRNKVRLALPQVRQVDATFVRT"
     gene            781879..783355
                     /locus_tag="MYCTH_2294289"
                     /db_xref="GeneID:11513029"
     mRNA            join(781879..782138,782196..783156,783233..783355)
                     /locus_tag="MYCTH_2294289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658428.1"
                     /db_xref="GeneID:11513029"
     CDS             join(781889..782138,782196..782923)
                     /locus_tag="MYCTH_2294289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658476.1"
                     /db_xref="GeneID:11513029"
                     /db_xref="JGIDB:Spoth2_2294289"
                     /translation="MVVFQNKIIYMPGLPPTSRREQIANWASMCGGVQWTEERTVAED
                     GTELALAVTTVPLPKGRRPAAAAAKNQPAPAHVYVLYFQGNASSIPPRLPDLSWTLRA
                     VSDSKTHALAPMELTFVCLSYRGYWTSRGRPSEPGLRLDAEAGVRWIAERHERVFGKV
                     GIGATEPILLVWGQSIGSGVATNLAATGRVPAGMPIRGLLLETPFVSIRAMLETLYPQ
                     KWLPYRYLWPFLRNHLDSWENLGLISQASEEKGVPGPMVYILEAERDELVPKEQSERL
                     YRRCVDLGLTVEKVTVPVAFHQQAIARGDGKKLAAQALLEMTQSAWKSG"
     gene            <784635..>785618
                     /locus_tag="MYCTH_90789"
                     /db_xref="GeneID:11505527"
     mRNA            join(<784635..784810,784881..785516,785579..>785618)
                     /locus_tag="MYCTH_90789"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658429.1"
                     /db_xref="GeneID:11505527"
     CDS             join(784635..784810,784881..785516,785579..785618)
                     /locus_tag="MYCTH_90789"
                     /note="hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658477.1"
                     /db_xref="GeneID:11505527"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Spoth2_90789"
                     /translation="MFSRRFEPSQTKSVSKSGRHRRASSSFTKEAGISKRPVELGRRR
                     AGTVSNAGASETTLGGFVSAIVTLVVGQEQRIFAAHENILSASPFFQSVLRNQLMDSQ
                     TKKISLPDEEPEVFSSILEYLYKGDYYPRLVFNKKRNSWELEEAGEDGRSEATIYHHS
                     VEGELLKDTAIYCAAEKYGLEELKRISLRKQGLQSGIQASTILASARYAYANTPDTDS
                     KLRAHYLALIIRSRNTFKRSGTMQLEMFNGGTQLFFDLFVALCNHVDDISSAASTPRT
                     PRSGRPF"
     gene            complement(787505..790110)
                     /locus_tag="MYCTH_2294293"
                     /db_xref="GeneID:11509183"
     mRNA            complement(join(787505..787872,787961..788038,
                     788318..788726,788776..788837,788892..789117,
                     789173..789471,789549..790110))
                     /locus_tag="MYCTH_2294293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658430.1"
                     /db_xref="GeneID:11509183"
     CDS             complement(join(787816..787872,787961..788038,
                     788318..788726,788776..788837,788892..789117,
                     789173..789471,789549..789842))
                     /locus_tag="MYCTH_2294293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658478.1"
                     /db_xref="GeneID:11509183"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2294293"
                     /translation="MEIGPALYNRFAEALSNENGYRLAETLSPDIPNEQLRKVFKSQN
                     AQNIKNVLRRGLQGNAALALDHQTLQGWVDVYAAYWNATGVLLTARESESDSSKSSHL
                     VWTKVYEAWTELLNTLLRGYQNFGFEAFTIPCLYVVCKYLRVFAIQADEERNRNAPFD
                     NGATTLQDDFDPETNKNQKLEDCARVLSRVFMICQTDRAPLEESRKWGSYYIANLLLK
                     TYFRLNSASLSKNILNSLRAGGRDMPDFSLFPKSQQVTFKYYEGVLAFLEENYIQAEE
                     CLTEAWNLCHKNAMRNKELILTYLIPCHLIKSHTLPTKKLLEPFPRLQKLFLPLCRCI
                     KRGELHKFDLALQEGEDEFVKRRIYLTLERGRDIALRNLLRKVFIARGFEEAKEGEKP
                     VRRTRVPVAEFAAAISLGSQEKIDNDEVECLLANMIYKGHMKGYISRQHGIVVLSKSG
                     AFPGTGKALRKVHKGQFRARVRQM"
     gene            <790602..>791423
                     /locus_tag="MYCTH_2122073"
                     /db_xref="GeneID:11509204"
     mRNA            join(<790602..790623,790786..790970,791026..791202,
                     791265..>791423)
                     /locus_tag="MYCTH_2122073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658431.1"
                     /db_xref="GeneID:11509204"
     CDS             join(790602..790623,790786..790970,791026..791202,
                     791265..791423)
                     /locus_tag="MYCTH_2122073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658479.1"
                     /db_xref="GeneID:11509204"
                     /db_xref="InterPro:IPR002670"
                     /db_xref="JGIDB:Spoth2_2122073"
                     /translation="MTRTWFGSRLQEYQVIGRHLPTEANPNPSLYRMRIFAPNEVVAK
                     SRFWYFLRGLRKVKKATGEIVSVNVISEKHPLKVKNFGIWIRYDSRSGTHNMYKEYRE
                     TSRTAAVEALYADMAARHRARFRSIHILRVVELEKTEDIRRPYIKQLVAKNLSFPLPH
                     RVPKINNKKLFSAKRPSTFA"
     gene            791539..793104
                     /locus_tag="MYCTH_2294298"
                     /db_xref="GeneID:11505771"
     mRNA            join(791539..791727,791834..793104)
                     /locus_tag="MYCTH_2294298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658432.1"
                     /db_xref="GeneID:11505771"
     CDS             792113..792859
                     /locus_tag="MYCTH_2294298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658480.1"
                     /db_xref="GeneID:11505771"
                     /db_xref="JGIDB:Spoth2_2294298"
                     /translation="MSAAPELSSSSEQRPTPGTEPDPRTFIRVRTTRPRQPFPPHSVR
                     QPITTERLVLRALTEDDFGAFRALRTEPEVMYWTAVGVPDADEELTWTRLRAFLPPRD
                     QSHYNFAICLRETGEFIGVGGCHAPRSSLGRPEVGYMLKRDAWGNGFATEFLRAWLGA
                     WERLEREETEIEVDPRTIGGDEARGEGGLVRERLLAITADGNDRSQGVLKKSGFEWFL
                     TWLAVDSRKGKGPDNLIGLPTFWYFPKTEE"
     gene            793789..796650
                     /locus_tag="MYCTH_2294300"
                     /db_xref="GeneID:11505735"
     mRNA            join(793789..794098,794169..794256,794326..796650)
                     /locus_tag="MYCTH_2294300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658433.1"
                     /db_xref="GeneID:11505735"
     CDS             join(793970..794098,794169..794256,794326..796379)
                     /locus_tag="MYCTH_2294300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658481.1"
                     /db_xref="GeneID:11505735"
                     /db_xref="InterPro:IPR013957"
                     /db_xref="JGIDB:Spoth2_2294300"
                     /translation="MAATSSEAKDGKSFYGFLFAKAKPIPVPTPIFDALLRAIAQHIA
                     SELGDKTDAHLTPAKLAAFYKTAGHDWDSFFVDMPHAGISTVYQGLGCQHSLLPGDDD
                     FAAPSIPALTTKGFVRWQAIQTLLEPQIQVPVLQYAAANWALKHPDTGTPLPADLPQE
                     AFPADVDSDTDRWYQECAQRARSKLAAEEEAEAPKETAQPEFAERKVPYTHVRVNPAS
                     PRDYFASRPVNVAYVRIPSPRHTPTGRSPERERERAREREHFVRRPTASQEDPAPRRR
                     SFSDYPHSPQDARPARVTRLVPDREPHRRRHSQPRRYSSTSSGSDDPAISPRSTPRHT
                     GRSNEPPPISIRRVYTNSSEDSPRVVRTTAGPSPVPPSHMHSSRSSDAGRTPSYDDGK
                     WHSTLSDIKEKITSFISPADRARSVSSSRGRRERPPRSAGVSREDVLPNSRLSRSWSE
                     IDTDDTDLEEERRRRSRRQSSELKDYHRREKERERERDRDRDRIYRDRERERERERER
                     DRPSLRERDRAHSESDRHRLAERRDAARDIRDRAERLVPSPSPAASAAASALNRDAGP
                     GTPLSGAAAAARRRVNSDDDYDHLSSSRRGLYSTGSVVDGGGGGGGSGGYTRRTSSHT
                     DLDRLDGTRRRAEWDSIRVDRGRDRDRERELMMRERERERDRDRERIRLESRERERER
                     ERERFRDDSSGGGGGERWLREGERLPRERNRDRDRDRDRDRERERERMPSPAMSASGV
                     TGVGGRKYPETMPWDH"
     gene            complement(<797153..>798047)
                     /locus_tag="MYCTH_2122076"
                     /db_xref="GeneID:11508468"
     mRNA            complement(join(<797153..797487,797771..>798047))
                     /locus_tag="MYCTH_2122076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658434.1"
                     /db_xref="GeneID:11508468"
     CDS             complement(join(797153..797487,797771..798047))
                     /locus_tag="MYCTH_2122076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658482.1"
                     /db_xref="GeneID:11508468"
                     /db_xref="JGIDB:Spoth2_2122076"
                     /translation="MPSGRRGTEASSAQFCGQLLHPVPSSLAHRQLLTAAAQHLGWSI
                     NLLGQAVCMSAYRPAVQSARYGAVLAHPSAVVALTAACPPTPATRGVEAKPVRPDKKP
                     GSRHVLIPRVPTLTGPGCNATPYFSPTAAIGVPRPTALQNGLLPPCNFRPPYIRGVGS
                     IDWVSGVLLALALLVSPPESGDPSDGRGDFFWAVQCGRIEAEP"
     gene            799617..800928
                     /locus_tag="MYCTH_2294303"
                     /db_xref="GeneID:11508565"
     mRNA            799617..800928
                     /locus_tag="MYCTH_2294303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658435.1"
                     /db_xref="GeneID:11508565"
     CDS             799745..800845
                     /locus_tag="MYCTH_2294303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658483.1"
                     /db_xref="GeneID:11508565"
                     /db_xref="JGIDB:Spoth2_2294303"
                     /translation="MKGRPVETLVYEYMFPKPRPSDPQNFHALLQRYLILEVRQETHS
                     FYGHLDTPEAKYPGLDYNNRIHRIRLSRWPWHRRLFRAFDGLRLTPAEISSLTKWEGT
                     KWAKERFERDQGIKIRDTTADGFPNYADPTDPYCAQSLLHAQSQETDNQVEVGGRAEE
                     AGEDEEEKDEEEEEEEEEEEEEEEEEEEGEDGGEEESDGELESVGVALNERLRQRVAM
                     RNMSGDNTMPLDEEWENWLKHAIESGELPHVADQIARFPGSHNTLTADDIFPPRMVAA
                     ARAGHWEEIPDFLHDMIRQALQSGHRPAPAQTSAMTGSSSRPSIRYSNVLNTFTRVGV
                     YPPVPEARSTAFTSRRTTTTENPPQQTARPGA"
     gene            complement(801836..802978)
                     /locus_tag="MYCTH_2313301"
                     /db_xref="GeneID:11509051"
     mRNA            complement(join(801836..802256,802320..802515,
                     802812..802978))
                     /locus_tag="MYCTH_2313301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658436.1"
                     /db_xref="GeneID:11509051"
     CDS             complement(join(802186..802256,802320..802515,
                     802812..802835))
                     /locus_tag="MYCTH_2313301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658484.1"
                     /db_xref="GeneID:11509051"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="JGIDB:Spoth2_2313301"
                     /translation="MSSKAGVNVLRYSVLGLGVVYGFYHQRSINAAQKAAAAQREYEH
                     QQELINKAKEAYAKTKQTSSSPNPAQSSGLNQDLNSPNFDLEAFIEGLLKQK"
     gene            803233..>805316
                     /locus_tag="MYCTH_2074571"
                     /db_xref="GeneID:11508585"
     mRNA            join(803233..803688,803748..>805316)
                     /locus_tag="MYCTH_2074571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658437.1"
                     /db_xref="GeneID:11508585"
     CDS             join(803575..803688,803748..>805316)
                     /locus_tag="MYCTH_2074571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658485.1"
                     /db_xref="GeneID:11508585"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2074571"
                     /translation="MQHRRDEILAKKAKLAELKRQRELRASQANRSSITPSEIISPTP
                     GRADNRREIESLIDSLVRESRPVSVSTGANSPGRFGSRPNSVLSAGESENVSEFAGPA
                     SGQVVTPQPQVLSAVPSKTVYECPPSPVKEVYSYSKGVQTTEEWTSPRRSRAFSDSEG
                     EEAAVAASPSKRLSRRERDREEELRENIRKEIEEELKAAKELVTDGVLKPSAAANFPA
                     RTLTEDELRAVTQSEEFMDFIDRSTKVIEKALDQEYDILTDYTLQVHDVDDDDEQSGN
                     TGGKGRRKIREIAQFYDDRWSKKRMVSAVDFSPRFPELLLASYTKNPTAPHDPDGIVQ
                     VWNLHLHDRPEFVFHAQSDILTAKFSPFHPNLIVGGAYSGQVLLWDTRARAAPVQKTP
                     LTGNGHTHPVYCIDIVGTQNANNIISASTDGAVCGWSVDMLAQPQESLTLVAPLPSKT
                     EDLAPTCIAFPQADPTFFLVGSEEGPIYPCHRYDRAGAKAGVDTRVSYRGHAAPVMSV
                     SFHPARGPVDLGDLVLSASLDWSVKLWKVRAPAATSAGVGGTVAAGGAAGGGS"
     gene            complement(<806450..>807119)
                     /locus_tag="MYCTH_2106095"
                     /db_xref="GeneID:11505759"
     mRNA            complement(join(<806450..806583,806646..806716,
                     806807..806990,807068..>807119))
                     /locus_tag="MYCTH_2106095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658438.1"
                     /db_xref="GeneID:11505759"
     CDS             complement(join(806450..806583,806646..806716,
                     806807..806990,807068..807119))
                     /locus_tag="MYCTH_2106095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658486.1"
                     /db_xref="GeneID:11505759"
                     /db_xref="JGIDB:Spoth2_2106095"
                     /translation="MPRINGQEVGTTGHGLMGHIRRPDPIPHERAFEMMRTALAKGMN
                     FWNGGEFYGTPENNAMTLRPSWTPTWPSTQRTPTRQLNGHKKLDVFECARRDPKVPMD
                     AEVAASTIHEAVKHAKIVAVEAELSIFCPEVLTNGVACRVRAVV"
     gene            808005..809898
                     /locus_tag="MYCTH_2294307"
                     /db_xref="GeneID:11508422"
     mRNA            808005..809898
                     /locus_tag="MYCTH_2294307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658439.1"
                     /db_xref="GeneID:11508422"
     CDS             808293..809750
                     /locus_tag="MYCTH_2294307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658487.1"
                     /db_xref="GeneID:11508422"
                     /db_xref="JGIDB:Spoth2_2294307"
                     /translation="MAQNNSSASVTGAARMAGARHKKRAAALSASSAFQLFLEHRRRA
                     LRNSTSPEVESKIVIPDRYSTPSQSQPPSNCRPFASPLRKPKLGDATHSRALLRHLSK
                     LAPLYRRHRNLERALNLFLLRRQLWRRTRRPFFQMDFIKRLRDIQADESSSDEDSGLV
                     LTSASVSALRHHSPVSEQAAVVAANQPEKTKTAGEKRKRKRDTPAEGPAEDVGPENLP
                     AAKKEEVETVPPAVGRKLAVPLPNGRGGTDGNKSTKKRALDEETAGATAEERAAKKVR
                     IVKPVGGAKVEAENRKSAQSESSKAAGSAAAAAPRPKPVAQMEYHDQRVHDMLTDPLG
                     FDDFVHDTTKPIPRHLARSFARYRRRQPQSPPPLVMSGAIGPAALAAKSPVTPKLKGP
                     GNSLAKEAQKRAYQQRINERVKDMKEKKAAESESGFPAEQGKGKAVVGRQPPGGLKGG
                     SGKHKEKRWLTAARQGGVNHGEQHRARVKKYKKPV"
     gene            810345..811668
                     /locus_tag="MYCTH_2294309"
                     /db_xref="GeneID:11511640"
     mRNA            join(810345..810671,810735..810783,810845..811668)
                     /locus_tag="MYCTH_2294309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658440.1"
                     /db_xref="GeneID:11511640"
     CDS             join(810552..810671,810735..810783,810845..811605)
                     /locus_tag="MYCTH_2294309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658488.1"
                     /db_xref="GeneID:11511640"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="JGIDB:Spoth2_2294309"
                     /translation="MPGPGVGFEYPPKEVSWTKRDALLFANSIGATADELHFLYELDP
                     NFSVFPTYPVILTFKGTTQEVVDFYAAQKAVPIPGVPEFDPARVVDGQRLLQSFKPLP
                     PSSAGKKFEIRTKVLGVYDKGRPGTVVETQSDLVEASTGDVYTRVVSSSFFVAQGNWG
                     GPKGPATVNYPPPRDRAPDVVFSYQTTPETALLYRLNGDYNPLHAHPDPGRKMGFGGV
                     IIHGLFSWNWAAHGLLKHLGGSDPANLKEYQARFASPVRPGDRLVASAWRTGQKQGEW
                     EEVRFEVKVEGGKVCLSNGRALIKCQAPAKGKL"
     gene            812098..814229
                     /locus_tag="MYCTH_2294310"
                     /db_xref="GeneID:11511662"
     mRNA            join(812098..812290,812374..812776,812886..814229)
                     /locus_tag="MYCTH_2294310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658441.1"
                     /db_xref="GeneID:11511662"
     CDS             join(812119..812290,812374..812776,812886..814206)
                     /locus_tag="MYCTH_2294310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658489.1"
                     /db_xref="GeneID:11511662"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2294310"
                     /translation="MPLTPRIGERRSYDGALCTVRYIGEVAGTTGSWLGVEWDDPSRG
                     KHDGQHKGVRYFSCTSKSPNAASFVRPTRAADPPQTFLSALQHKYAGGPAEDQAPARQ
                     IKFSGKVAEEVGFDKIRRQQAQLHELQFVILDGLQVAHATDPEAKDGHQSIAQVCPKV
                     KELDLSRNLFERFGPVVDICAELKQLRSLRVNGNRFRDVLDDDVLEAAGDAFHGVTEL
                     ALEDTLLSWHEICHIASKFPSLTTLHAGSNQLTALAPIPPAPFTTTLTSLHLEFNDFT
                     SLSELAPLASISTLRNLLLKGNRISTISPPSTPAPVFGAQLHHLDLSYNLITSWSFID
                     ALPSAFPGLTSLRITHDPLYSDPDMDETAAALPEENSALSPATQRITSATAPGAKKTE
                     EAYMLTLARLPSLRILNFSTITPADRADAEMFYLSRIARQLASVPESGEAAVLRRHRR
                     WAELCETYGEPAVVRRTGRDALDPGFLEARLIRAEFYLCSPPGGRAAEGPERGDGKEE
                     KEEKRVAVVEVPRSLDIYAVKGLVGRLFGLKPLGLRLVWETGEWDPVGGFDEDREGAT
                     SEGEQEEEDLEAEWERTQGEGGELPSGLGTRRGRWVKREVELRDGPRQFGYCVDGSEV
                     RIRVERR"
     gene            complement(814708..817025)
                     /locus_tag="MYCTH_2313303"
                     /db_xref="GeneID:11508632"
     mRNA            complement(814708..817025)
                     /locus_tag="MYCTH_2313303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658442.1"
                     /db_xref="GeneID:11508632"
     CDS             complement(815569..816948)
                     /locus_tag="MYCTH_2313303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658490.1"
                     /db_xref="GeneID:11508632"
                     /db_xref="JGIDB:Spoth2_2313303"
                     /translation="MSPLGGVWAPVALRVLRKHLVSNARMATKMLRSKLSAATRPLNA
                     QLQPVAVRTGNARQPVHPAAWLRQQKRAGAGRWFSSANLPAAAARRFLSSSHGPAGPK
                     PAFRFERFKLPTSTVSRAVNQLTGRAPFASTLRPNLTGGTLGRTAGGYGIPGSGRVGG
                     VRYFSHTPAAPAQVVQNVSQAMRAFWLSGQRARFDGVGPRGEKRYRAVSATQEEARVM
                     MAKAMLAHRHAPGAFVDFKISPTITALSPLGAMLPFAGGKERAAAATAAATLHAEGFL
                     DVLAVDFARALQDLAAIMTDLKRLAGLGDLPVYLEKDGVLRVRFPGLDAEAVERLCDD
                     VGVRRGVVGQDPDLDSSPAVDVALRFPFAPDAVCDRTVTSPGGSLRSRRSGSSSSSDV
                     EDAFIVQEYEDNPWRLSVVSELEGYESMSSPSPVLSRSGEHYSDDFEGLEGIYRFLEE
                     CDRARGRFR"
     gene            complement(817469..820566)
                     /locus_tag="MYCTH_2294314"
                     /db_xref="GeneID:11508604"
     mRNA            complement(join(817469..817596,818014..818136,
                     818195..818323,818500..820566))
                     /locus_tag="MYCTH_2294314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658443.1"
                     /db_xref="GeneID:11508604"
     CDS             complement(818683..820317)
                     /locus_tag="MYCTH_2294314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658491.1"
                     /db_xref="GeneID:11508604"
                     /db_xref="JGIDB:Spoth2_2294314"
                     /translation="MGSVFSRPAAAAATPTVLPTLTIRNLTVTPLELRLVEHLKSVHH
                     HHPHLHKPNGLVKTSSRSSNPEQSHEQPDAPLPSTATPVSGTIEPFSECRTAVYAPDA
                     ARHEQLRLTFEDPATGHRYSADIPGSSRRSIVLKAHHPAGAGDGETKEFTAIYLPEHA
                     YLALFSSANLSSWMSTLDPALPLSALSIPGTHNSPTCYVALPSVRCQAVSVLDQLNNG
                     VRFLDVRVSCPPYRASTVSAPSNSSPKGGEEEEGEEEQEGGGEGTRVPELALVHSAFP
                     VSLTGPKYLSGLLATVYDFLAAHPTETVLLSLKREGTGRGSDADLARILHRHYVRPRR
                     DRWYTAPRVPTLAQCRGRVVLVRRFGLGRSPAAVPASEAGIDGSAWPDNVADGTCGSG
                     TIRIQDYYGVGSGSDIQKKLRYAQEGLARAAAQAQAVVAEVRSSSSSSSSSSSAAAAA
                     TTPLPPPPPLFINFLSASNFFNASCWPERIAFKINPSMIEYLCMKHGTEGKGSGEFGA
                     GDAVTGIVVTDWVGHRGDWDLLRCIVGWNARLQLRQ"
     gene            821959..823315
                     /locus_tag="MYCTH_2313305"
                     /db_xref="GeneID:11505988"
     mRNA            join(821959..822399,822469..823315)
                     /locus_tag="MYCTH_2313305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658444.1"
                     /db_xref="GeneID:11505988"
     CDS             join(822171..822399,822469..823037)
                     /locus_tag="MYCTH_2313305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658492.1"
                     /db_xref="GeneID:11505988"
                     /db_xref="JGIDB:Spoth2_2313305"
                     /translation="MRFSITAFLALASAVVAQDPTEGFDPITKPAEGEKVPAGSTYDI
                     VWLPSEAYPGDIKIALLGGASPQTLTVVDTIAEGVDASTGTYSWSVPSTLGDLATYGI
                     IVTLESDPSIFQYGFPFKIVSGDDSNGGSSSNSSATVISTSTTASSSSATSSSTGHAS
                     TATSTTSDAEATSSTTQSKTKTHSSTVTSTSLTVPSSTLVSSTIRTNTSFTTSAPPLT
                     TITSSVIVANPTSTTSSTSTIATNGVPSLAAGSFALFGGVAMAVLAL"
     gene            824675..826976
                     /locus_tag="MYCTH_2294321"
                     /db_xref="GeneID:11508789"
     mRNA            join(824675..824824,825194..825252,825322..825632,
                     825690..826193,826277..826849,826911..826976)
                     /locus_tag="MYCTH_2294321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658445.1"
                     /db_xref="GeneID:11508789"
     CDS             join(824813..824824,825194..825252,825322..825632,
                     825690..826193,826277..826755)
                     /locus_tag="MYCTH_2294321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658493.1"
                     /db_xref="GeneID:11508789"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="JGIDB:Spoth2_2294321"
                     /translation="MRGEILHVHLGQAGAQLGHSAWELYLLEHGLAADGRPDPNAKDL
                     AEGGSFETFFTETSNGKYVPRSIFVDLDPSPIDEIRTGTYRQLFHPELLISGKEDAAN
                     NYARGHYTIGKEMIDNVIDRIRRVADNCQSLQGFLVFHSFGGGTGSGFGALLLERLST
                     DYGKKCKLEFTVYPSPRLSSAVVEPYNAVLSTHSTIENSDCTFLVDNEAVFDICRRNL
                     DIPRPSYEHLNRLIAQVVSSITSSLRFDGALNVDLNEFQTNLVPYPRIHYPLISYAPV
                     ISAAKSAHESFKVSDLTFQCFEPNNQMVVCDPRKGKYMAVALLYRGDVVHRDCSAAVA
                     QLKSKASFNLVEWCPTGFKIGINYQKPVAVPAAPEDGGLASVDRSVSMLSNTTAIAEA
                     WSRLDYKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVAADSAEFDEG
                     EAEY"
     gene            complement(827584..829980)
                     /locus_tag="MYCTH_2294324"
                     /db_xref="GeneID:11505983"
     mRNA            complement(join(827584..828170,828278..829477,
                     829539..829605,829671..829980))
                     /locus_tag="MYCTH_2294324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658446.1"
                     /db_xref="GeneID:11505983"
     CDS             complement(join(827622..828170,828278..829477,
                     829539..829605,829671..829681))
                     /locus_tag="MYCTH_2294324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658494.1"
                     /db_xref="GeneID:11505983"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294324"
                     /translation="MAKGKPGLSAAFKAIDPALDALFSQSAGAVKTPPKSRYADLLPQ
                     KPKTASKGEEDEEDKDNSENEESEAPEEELEEESGAESDASMPYEEEDESENEDDSDN
                     EEEDGEVSGKDESEVDGEADASSVDDEAAAAEIMERAVSGDKHQNEGRKRKRKQRDDD
                     EALEADYLERLTNEEKPSVKRRKADAIADNKAVSATSSPEEEDDDESGDDVPVHESIA
                     ADPTAAELEKANRTVFLSNVSVEAIKSRKAKKTLLRHLSSVLDKNADPPQKVESIRFR
                     STPFQSAGIPKRAAYIKKEVLEATTKSTNAYVVYSTTAASRLAVAQLNGTIVLDRHLR
                     VDSVAHPAPIDHRRCVFVGNLGFVDDETVYNTKIDEEGKEVVVKRKRTKTPMDVEEGL
                     WRVFGEEAGKVESVRVVRDPVTRVGKGFAYVQFYDGNAVESAILLNGKKFPPMLPREL
                     RVSRCKAPHKTARAMEARMSAKLDKKKGGRKANGTDAASYVPKLTAEAQTLAGRASKL
                     LGRFGAAKLTGKPAGPVNKKRQARKERFLNGGGTEGGENGGIKAPEQFVFEGKRASAR
                     DGKPRDLKFKKTKSKAAKAKPKASKKKKKAKAKAGKAGKAGK"
     gene            830307..832706
                     /locus_tag="MYCTH_2294326"
                     /db_xref="GeneID:11513395"
     mRNA            join(830307..831499,831555..831624,831681..832167,
                     832230..832706)
                     /locus_tag="MYCTH_2294326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658447.1"
                     /db_xref="GeneID:11513395"
     CDS             join(830407..831499,831555..831624,831681..832167,
                     832230..832664)
                     /locus_tag="MYCTH_2294326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658495.1"
                     /db_xref="GeneID:11513395"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="JGIDB:Spoth2_2294326"
                     /translation="MATEDTTPSFAPSSPPAPAPDNDASNASSPLSEPEDKDTYGDEA
                     DLDMRDLGDGNNTPGRNGAQGEPGSDPASQSDDDSKLSEVDVNDSEAETERLYDTPPK
                     NGATRDAAGAVGEGNRRFTDRRDRVFERSPSKLHQQLRAGVDADEAVGGRNSASEPED
                     GEDDDVSVPSSEAELDSAKQPRLRAAALGKKSQAAPSNNAPTSHPRKTSADSRKRKRS
                     SVAEQSDSEQPLKKRTGLVSGADRESADDVAMADDDAISTNPQSSNHTAEEEDEEPEA
                     TTEPKEELPDAAEEDVAVSSGSRKGRRSPAKKRKSKSPEERNAKEEAPEEPPEDAETQ
                     SLEVPTPQAEDDHVDEVDEEAEAAHRNEEELERKKAAWEELISIEKQFSSFRERLYRE
                     RLEQLNREEAMLTGDNPTHPEYLAMLQCLQERRDEKIRRSTLELQFKLSVLRRRAVAE
                     RAQIMSQFYQAVRESRDETVAELGREWYQIQQERRRAANTIPDYGLRFPATRAQAIRD
                     AVSYNKEVSVLSGFAKHVGFPAAPSINGATEEQVEADLEAIQSAREALPRHNSNQVPG
                     YRPEYPGGISPFVQGLGAAGEQFIEQTPWANPNHPAHRMQQQHHHHHHHHHPPHRDIN
                     VQPTYAGPSSAPKRQSNQPGAMYSSSTSTILNGDSPAQVQKTHSPAMPESSLKGKMGP
                     EPLRREPAIHAS"
     gene            complement(832718..833699)
                     /locus_tag="MYCTH_2294330"
                     /db_xref="GeneID:11505730"
     mRNA            complement(join(832718..833126,833200..833356,
                     833429..833556,833617..833699))
                     /locus_tag="MYCTH_2294330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658448.1"
                     /db_xref="GeneID:11505730"
     CDS             complement(join(833259..833356,833429..833556,
                     833617..833621))
                     /locus_tag="MYCTH_2294330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658496.1"
                     /db_xref="GeneID:11505730"
                     /db_xref="JGIDB:Spoth2_2294330"
                     /translation="MGFSRSTYWDARNRQSPALIRARRPYLVKNTVTGLALGAIAVGV
                     WAYTINAIGQDEFEDVKVPDVPVKPASQDAKK"
     gene            834461..837839
                     /locus_tag="MYCTH_2294333"
                     /db_xref="GeneID:11507984"
     mRNA            join(834461..834931,835165..835330,835385..835512,
                     835571..835774,835830..836175,836233..837166,
                     837276..837839)
                     /locus_tag="MYCTH_2294333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658449.1"
                     /db_xref="GeneID:11507984"
     CDS             join(834567..834931,835165..835330,835385..835512,
                     835571..835774,835830..836175,836233..837166,
                     837276..837403)
                     /locus_tag="MYCTH_2294333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658497.1"
                     /db_xref="GeneID:11507984"
                     /db_xref="JGIDB:Spoth2_2294333"
                     /translation="MAADSTSTPSSENAISVAEQLEQLGAARKLVLENPTYYDRIVKG
                     VLPIIGPAAPVELRRWGADFLAESLATPVLTMREKENITVAVLDTLRSLLDHAGEDAI
                     VLKSSIVAAASAYPVALRWIVHNSYHTESWEQMSAIKSRILSIWDGAPAPVKLSCIKF
                     AQRVVLAQTVSNGMEQKYGGLDISLNMIPANHPLLDPRQLEAEATGLLDRMLGVLQDN
                     SSDALLVDATINCLSILARTRPNTSNRILNTVLNFNPLKLANSPMTPKTRVLVKSLEK
                     TTRMFLTHLLRRDPNNAMSGRIQQYLERLMRSRAEIFDEAGRKRALIDQGMAAFGDAK
                     RQRMEAGVPQFTIPPLGPGPHTVATIFTLTDNPGLQVFDATQLPANLAAKISVRTLAT
                     LDERVLDLAVSGIRDRLTSLYAAGAAGEAATQPALINAATAPLGIDEDDDDYEPDLTP
                     AEDTEQILNKLDNAPPEEPIEPAADAGAAMTLGPFKLPPPPTVDPDVATKLSQAAASR
                     VFGPLSALKDAGMARKPKAGINRLAASSYDRDSWLTLITRLATRTTAGLEDTPMGIKS
                     EDALDRPLASRVSLGDSIREMLYAYILEDWRRRIEIAVAWLCEEWYNDQLTKRRRGGS
                     EVSPGELHYERWALRLVDGFLSYVTAQDKVLTRFLAEIPGLSKPLLGKLKALCADPTT
                     VQLALTSLLYLVMMRPPAREMALDTVAEIWAEYEDARPLAAKYLVKWRPGFIESQTRS
                     AGEGDAAHANNMAIAT"
     gene            838805..840702
                     /locus_tag="MYCTH_2294336"
                     /db_xref="GeneID:11509115"
     mRNA            join(838805..838958,839226..840702)
                     /locus_tag="MYCTH_2294336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658450.1"
                     /db_xref="GeneID:11509115"
     CDS             839381..840676
                     /locus_tag="MYCTH_2294336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658498.1"
                     /db_xref="GeneID:11509115"
                     /db_xref="JGIDB:Spoth2_2294336"
                     /translation="MSRTPTGGADGKAVPSAPASSLSPRTTTPSRANSTIRAVPSVDD
                     RQRSSEEDSGTEGTQSHATSRDSGFSSSLNSTASIASSNPPQRIPATTSTGIPRMPSY
                     NKLKLNPSDLAQSSGDVLSDGTSLPLRRGPSFGDIPTRESSLNATTTTTASSSQSIDA
                     GGFTEASLAATEAQLSSGWDNSVGKAGLGKTGRVINRLVSDNEALRRDIQIERLRAEE
                     SRQAARLLEDKLERVISDYESRLLEASVTKTLLARKERQVESLQDAIELERRRADAAA
                     GRERAWKDELETARAEAKRKVDEATNYAALCEGRYNAISSHWKDQGEEVRRSIGRMRR
                     EVQALVEERRRDDEKIETLRELCDQQDGNIRELRRQKDEILAQFERYKAEQEEGLREI
                     KRRAEEREREQERTLQEAREVLNKLRWALNVKEKIEWAQ"
     gene            <842468..>845668
                     /locus_tag="MYCTH_2114188"
                     /db_xref="GeneID:11512951"
     mRNA            join(<842468..842563,842613..842783,842843..843163,
                     843218..844971,845030..845529,845580..>845668)
                     /locus_tag="MYCTH_2114188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658451.1"
                     /db_xref="GeneID:11512951"
     CDS             join(842468..842563,842613..842783,842843..843163,
                     843218..844971,845030..845529,845580..845668)
                     /locus_tag="MYCTH_2114188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658499.1"
                     /db_xref="GeneID:11512951"
                     /db_xref="JGIDB:Spoth2_2114188"
                     /translation="MEYMTEFYLTTLWTYKPKVVRQIIDDMTSLGFTQAEFTYDSEYS
                     WFKVTCRSDDADEIREQFGNIARDIEREAFEACENDLLNIDDTLKSSFDNEWFGQDVG
                     DVSSSESGQVDEIYCRPKPHVEYRFAEVWDILDKNDEPYTIMDILDRRQAKLVEDELK
                     VKLDARLNGKLVHIAANSKEPIHEACERLEVMLAARKLLPASSRATHVVDPEDHADPT
                     DPGFTADVRYLANIDQKLASSTLLDPAMVHQLTEAYKSIYRDASSIRICLWAPDKGYH
                     ISLLGPKVNVRLRDRKVFGNRPAVSIKTIDKFDFVANNSSPPKQNSALEASSQVEHWI
                     RQLPVVEESLRHAAHHLINDQVAVKSSTASVEQEDLMSFHNDETTLCRETSTAAVSET
                     MTAHSEQQYNVAARISELCNKISPLYTGLDMLSEQSVSKSREDELGFTGEDCLIDMMA
                     AVDITSPDNGLRSTIGWQMPALIPLPGENVRLGDKNDDSNDQPAVVGSSTQNRHPLPA
                     PHSNQWHPQQDTTTTRSPGKEVVIKKQRVTQNGGSSKSLNPHGPPSFDALSSQPPLPR
                     NSKVDGYSHLPSSESFLKEIEAAIAKLLLLGPYRRGKLAVRAELGRIILEKVDRSGLA
                     FNNATTPSNGWMKAQLLRNLNNDFGGSHNISFTKILSTYGCDVEDMVNLQVNGTRLWE
                     EIPSRVWITYSFHCGLRSGKGLSRFIVDIEDRDPKSSQFSYSIRLFDGAESADKPMPV
                     YVHAICRHWDLRITMTHTKTDELEEMYGAFAKDLLRSLSVVRNEQGSLEVRFAVPAEA
                     PADVHAVRVLTKWRYPSADRKSALEITEILQLVTDSYSEGPYSGTAWNTYEGKRSRPW
                     SQRITREKRDKGEVPRWYEAAVVSLELEDLFQQNAFLKIGEKAGWDATDVRNRGIFPS
                     IYSPALQMVRQIDHVGRLDDNHLSQKYGELLLQGSGRAAPSPASEARLDQVRFRSWIK
                     PAQL"
     gene            846661..849076
                     /locus_tag="MYCTH_2294340"
                     /db_xref="GeneID:11513070"
     mRNA            join(846661..846940,846999..847035,847128..848017,
                     848132..848528,848584..849076)
                     /locus_tag="MYCTH_2294340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658452.1"
                     /db_xref="GeneID:11513070"
     CDS             join(846798..846940,846999..847035,847128..848017,
                     848132..848528,848584..848712)
                     /locus_tag="MYCTH_2294340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658500.1"
                     /db_xref="GeneID:11513070"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2294340"
                     /translation="MGDVENGRKPPSAGVDVDSKTPPRAEEEVSVDAGDNISGILPEG
                     QVDPVYEKKAKILNRAIQEIGMGWYQWQLSIVISFGWASDNLWPIVTSLILPPVTNEF
                     RQERPPLLTLSQNIGLLAGALFWGFGCDIFGRRWAFNLTLGITAVFGMAAAGSPTFAA
                     IGVFAALWSFGVGGNLPVDSAIYLEFLPASHQFLLTVLSVAWAVAQVVATLIAWPLLG
                     NLTCEQGEGAATCAREDNMGWRWFLICVGGLTVIMFVIRFCAFTIFESPKYLMGKGRD
                     EEAVRIVHEVARRNGMATSLTVEDLKAVEPEGYVPPARAADALKRNLEDVRLDRVQAL
                     FATKKLALSTSLIMGVWALIGLGYPLYNAYIPYVQQLRGADFGDGSTYLTYRNSLIIA
                     VLGVPGALIGGVLVETKKVGRKGALAASTILTGVFLYASTTAVNSKSLLGWNCAFSFF
                     SNIMYAVLYGFTPELFPTPQRGTGNALTATCNRVFGIMAPIVAMFADLNTAAPVYTSG
                     ALFIAAGLMVLGLPFESRGKAAL"
     gene            849292..853181
                     /locus_tag="MYCTH_2294343"
                     /db_xref="GeneID:11513303"
     mRNA            join(849292..849652,849785..853181)
                     /locus_tag="MYCTH_2294343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658453.1"
                     /db_xref="GeneID:11513303"
     CDS             join(849482..849652,849785..852811)
                     /locus_tag="MYCTH_2294343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658501.1"
                     /db_xref="GeneID:11513303"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Spoth2_2294343"
                     /translation="MSSFAIEVPGEAAPLNQWELVKALSSAATSTDHAQRQSAGQQLQ
                     AWEPHSDYFALLQTIYLDASQDKQVRFLAIILLKNGIDKYWRQTAKHAIKPENKQAIR
                     SRLLQGSLNEEDRTLALHNALVTAKIVRIDYPNDWPDAFSTLIETTRAANASNPLHLR
                     GALLLLLRIAKELGTARLRKSQTALQAVTPELVQLLGTIYTEKTAQWQDLWTKGVGDE
                     ATVGFAVENSLTALKVLRRLVTVGYEQPHTDPMVCGFWSLSQSQFDQFLSGVAEGSWV
                     PAPYQDSVGKHLIQFTKLHIDMSEQHPASFPVLPNSIPLVKAYWNLVKGFSDVFEKSG
                     GIRQTGGETAGGNPKHEGPLYEKLALKGLLLLRSCLAVAHHPVQTFKYRSPEVKELEK
                     QAVHTLKTELLTRDMLLDMVQVIISKLFIFRKSDLEAWEEDPEGWESQERIEGQAYEW
                     AVRPCAERLLLDLLTHYKELGEPLLAYCNLATKVDMDIITKEAAYCALGCAAAIIYQN
                     FDFDRFLTTFLVKDAQIRAPMAKLLRRRIAILLSQWIPVRISQASRPVVYDIFRHLMN
                     PDDEHNDEVVRITAARQLKYIAEDFEFSGESFYPYAADIFNLLVNLLKEVESDETRLA
                     LLETLRVIVSRMETHVSQFGDAIMLMLPKLWESAASEEYMIKQSVLAIMSALVSSMRA
                     ESQRYQSVIVPLLREAMNPESALHLHLIEESVDLWKAVLTQSSPPLNPDLTQMVQLAL
                     PLLEYDSEVANQCLDITKDYILLAPRDILSDSLRRPTLSALGKALRSESRDQSHVGAK
                     SIELVVRVAEELGGAQGVSVVVQDLLETNVLHAMLEGLHSAWEAGQTTGPKRKQSKIS
                     TVKETAYFAILARIALADPALLVSMLTSFGSPIDQVWSWLSTQWFANFDCMGDVEREK
                     LSCLALTRLWELPDQQMQELVLNRLQDYLSMWTSVIMELADGGAQPPPAAAAGEAAPP
                     GPPPLGAHDTLVWTGELPGYEYDTPLDVAEREFAAKDPVHCVVTYDFVRARLADMVQR
                     VGGEQAFEANWAVNVDREVLAGFQRLSQPASGGHD"
     gene            853822..857116
                     /locus_tag="MYCTH_2294344"
                     /db_xref="GeneID:11508846"
     mRNA            join(853822..855110,855223..856136,856207..857116)
                     /locus_tag="MYCTH_2294344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658454.1"
                     /db_xref="GeneID:11508846"
     CDS             join(854211..855110,855223..856136,856207..856777)
                     /locus_tag="MYCTH_2294344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658502.1"
                     /db_xref="GeneID:11508846"
                     /db_xref="JGIDB:Spoth2_2294344"
                     /translation="MGLTQSKSPPPPPLDYGHGYGHDARGHGYGYGYGFRPGRAGQWD
                     PHHRSRTGRKSSSSSLPFSSIRSNSRSSSRRRSDRALLAAAAATTPSVPFFSFQQGSE
                     RAQNVRHPSEASPLLGRYRAVPRPAAAAHDALASSLLKGGGGSRAAAGAGRRTGSWGT
                     GPVALGGGSVVRGGVGGGVGGGGGGGGGGGGGAQMGLLSAEPGWRGSVHVGYGALIAA
                     AVEREEEEEEDEEEGHYGEDDGDGADGRYCCYCCCCCGTGWVKRLLRRFTDTWVDPKA
                     SVVKRVVDVWWSRWLTLVVLPALLAVAWVAVPFPQYPLLDEDDDNGDGAVQRPGGPPP
                     TSGSKVPGHGAARVRVNFWFFLFVYYSFYNLTALIWITKVFNLYSLNWWPQSLGFPIT
                     VSLIAALSIAAPIPVYLIPESRFLTVHNTAWISWTFVIMAMPVGIAFLILMTNERHLK
                     LRRSFSETQRIFTSSWWAGEPDSETSWRDGRRNRAVVGPDAFDPNQDALTVGYVDGRH
                     HRATMPVRLRRRWLPASFVRFVWFCLALSIGLLAYVIGEAYAEIYLRTLPHNNFETIV
                     YVYGWISTVHLLDWLTGWILGGNEGERVGSYPLSWIFKLYFMLTYQTYVRALYARLRS
                     PSQFVMLQLLSSTGLIIVTPTLMSAPFHWFLTVIGVNGQSYGAYQKMCIRNVFIRFLA
                     ENASMLTFLGSVVVLHFGANKDVYPYFAFDGTEGVEDYDFGLTFYASSITWACELAAS
                     FIVAGLIGWIYKVSVVTEGKLDFIVWPELLPTCVAVMLHVLQNMLFSIIRLQFR"
     gene            861171..862595
                     /locus_tag="MYCTH_61858"
                     /db_xref="GeneID:11505443"
     mRNA            join(861171..861777,862007..862595)
                     /locus_tag="MYCTH_61858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658455.1"
                     /db_xref="GeneID:11505443"
     CDS             join(861231..861777,862007..862155)
                     /locus_tag="MYCTH_61858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658503.1"
                     /db_xref="GeneID:11505443"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Spoth2_61858"
                     /translation="MSTSADAAQSLAQTTKDQTSLTTTEAAALASNSNDASRGQPATA
                     ASGASELASTKITLLKALKHFPDFPIPGIKFVDILPLFQDPVIHETLLRALELQVLEF
                     GEQAKPDVIVGLDARGFLFGPSLALRLGASFVPVRKKGKMPGPCVTAAYEKEYGTDYF
                     QMQEGAVKPGQKVLVVDDIIATGGSAAAAGSLVRQLGGELIGYLFILEIAALNGRSKL
                     GGVQTVTLLETNE"
     gene            complement(862805..866638)
                     /locus_tag="MYCTH_2294347"
                     /db_xref="GeneID:11508685"
     mRNA            complement(join(862805..866124,866254..866638))
                     /locus_tag="MYCTH_2294347"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003658456.1"
                     /db_xref="GeneID:11508685"
     CDS             complement(join(863080..866124,866254..866550))
                     /locus_tag="MYCTH_2294347"
                     /note="CAZy_ID 267788"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003658504.1"
                     /db_xref="GeneID:11508685"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Spoth2_2294347"
                     /translation="MTCRELAASDGSGTSRPGPALNDLPCPRMQARVRRRCTWLGLHN
                     STLWLGCMLLALCVGYWPVAAAMRPDRVRELRQETVNMFYHGFDNYMKIAFPEDELRP
                     VSCSPLTRDRENPRNVELNDVLGNYSLTLIDSLSTLAILASAPPEDGETGPKALRDFQ
                     DGVAALVEQYGDGTSGPSGVGLRGRGFDVDSKVQVFETVIRGVGGLLSAHLFAIGALP
                     ITGYNPRHPGDDLLHPRPVVWPNGFRYDGQLLRLALDLGQRLLPAFYTRTGMPYPRVN
                     LRHGIPFYTNSPLHEAAAPGTTADGSPEITETCSAGAGSLVLEFTVLSRLTGDPRFEQ
                     LAKRAFWAVWYRKSQIGLIGAGVDAEQGHWIGSYAVIGAGADSFFEYALKSHILLSGH
                     ELPNQTAVRPDRASDGWLDPNTLFNPLSDAENSPDSFLEAWHHAHASIKRHLYSDRDH
                     PHYENVNLWTGSLASSWVDSLGAYYSGLLVLAGEVSEAIETNLLYAAIWTRYAALPER
                     WSIREKTVEGGLGWWPLRPEFIESTYHLYRATKDPWYLYVGEMVLRDIARRCWTPCGW
                     AGLQNVLDGQKSDRMESFFLGETAKYMYLLYDDQHPLNSLDAAYVFNTEGHPLIIPKA
                     ASASGRRRPRAERKDLAIYNDDAFTNSCPPRPSATPISGSVIAARDDIYHAARMLDLH
                     LLSTSPRTVDGGQMSGQHMARSNFTLFPWTLPSELLPSNGTCAKVHHPTELVLEFASN
                     AGQMVGGGAFNFMIGAQNLERLSADRIRVTSLSGLKLTMHLEGDLEQEWRVTKVNGIP
                     LGRDEFLVFDRSILGEVSDPRFNLVRDPVMVKLQHLHQVDIPEDDADTVDDDAPQASN
                     HEPGPEPEPLEDGPNPSVTVTDLGSLVKSLLSRITSSLDNIQLPTSLPRIGATLLPFN
                     LVLNTTAITSTGIGSAPLPPGASPPSAAQRHRTPPFGPVPDALFPWSTIYASPDDACS
                     SPLPDAAPRDHQIILIRRGGCSFSTKLANIPAFTPSPDSLQLVIVVSDDGDDADQDNR
                     GGGGGGGGVAGLVRPLLDEVQRTPGGIQRRHPIAMVMVGGGEAVFRQLEAASRVGVVR
                     RYFVESQGVKIRNIIVDEGGDEMDW"
     gene            867901..868371
                     /locus_tag="MYCTH_2294348"
                     /db_xref="GeneID:11506065"
     mRNA            867901..868371
                     /locus_tag="MYCTH_2294348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658457.1"
                     /db_xref="GeneID:11506065"
     CDS             868123..868350
                     /locus_tag="MYCTH_2294348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658505.1"
                     /db_xref="GeneID:11506065"
                     /db_xref="JGIDB:Spoth2_2294348"
                     /translation="MAPSTKPGPTDLKASESAPHAFLNCSRKAEDETDRVTSLQQGLR
                     LHQKDINTTKISTSTRPSTLPFTPYHRKTRQ"
     gene            complement(871200..873885)
                     /locus_tag="MYCTH_2294350"
                     /db_xref="GeneID:11508969"
     mRNA            complement(join(871200..872086,872220..873266,
                     873361..873885))
                     /locus_tag="MYCTH_2294350"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658458.1"
                     /db_xref="GeneID:11508969"
     CDS             complement(join(871322..872086,872220..873266,
                     873361..873639))
                     /locus_tag="MYCTH_2294350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658506.1"
                     /db_xref="GeneID:11508969"
                     /db_xref="JGIDB:Spoth2_2294350"
                     /translation="MDLDRQDEIESPVIEDFLDCDQLFSDSDGDSSGSPPPKKTPGRL
                     HIPVDMSSTQYMTSGAHHPERSQMDGLPICTSGPQTGAYHSGELDPYSAVSGVSSFNY
                     PAAADPSLLTPASSSGSPPLPHKQSVKPMRNYHQSTLPSQAPTPPDSSRMYGYNGYDM
                     ASSSQSPSPLTVNPAVTESGGFMPPYMAHSPPISHHPSSPRTEIPPPINPYLGHYTVS
                     GPNEAEVTPHSLQDYHPYGVEVAPEAYLAQQRQQQQQHQQHHVSAGSPPVHQRMPSDG
                     GATPDLSQPHPAQFRPHQVGAVEDLRDPGLLLGPPYPPAGALSPGRRAQTRRKPAPGR
                     KPSRTPPKTAAATATTTTTTLVGSAGANSQLQPSEDEEEELTLRDDAPEDDKYLFQLR
                     KEFISEKGKGMWEEMKAKYSEKHQGNWEKAALQMKVSRAVARYGVWPAKEIERLKEAF
                     EYFEEMRYQFILARMKENGGCRVWDWKKPHIIAMLVKLGLEEPTVNEKTGTRRRRQKA
                     AARRQGSPQVGVAAAAAAAAAAAGGAHPAMGDWSAGLGLHHPMYHSHAHHVAAGAAAM
                     VTEDFGGPPQLSPKQEEDLINEVFRDVRPERDLSSDDGMEGLSYGPNNGDAGADRRPS
                     TAAAAAGTAGAGAGAPQSELNHNHNHHHHHHHHHHQGSTRVARQTCDQQLLQHPAPHP
                     APPSQMTENPYAPQ"
     gene            complement(<878369..>879809)
                     /locus_tag="MYCTH_2106114"
                     /db_xref="GeneID:11513154"
     mRNA            complement(join(<878369..878654,878922..879002,
                     879043..879194,879261..879467,879536..879577,
                     879613..879622,879745..>879809))
                     /locus_tag="MYCTH_2106114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658459.1"
                     /db_xref="GeneID:11513154"
     CDS             complement(join(878369..878654,878922..879002,
                     879043..879194,879261..879467,879536..879577,
                     879613..879622,879745..879809))
                     /locus_tag="MYCTH_2106114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658507.1"
                     /db_xref="GeneID:11513154"
                     /db_xref="JGIDB:Spoth2_2106114"
                     /translation="MVTDQCLAPCILLLRMLPGSPTAYLYVKYAAVPSEGSLQYTIIV
                     LPTGSAKDKLAKRSLLTGEITMCPPPATIPVRGGSAQRPYLRESSTSIHQLRPACFFF
                     FGKRHPQLHNSVCRIWSGTGAAHVMMGARCRSRQLVATVAQPPRECKDAMSLRWWWSS
                     TTPPPRQVVHTYVQFLPGRRLSGAVSNLVHTTTLFYRSEPQTRLEDGPGLARPRTTPW
                     QSVKESKCHPPFACIKLATNIESEQAGGDLDGETNAMRGQEGAGKVGDASSSHVALQS
                     AGVA"
     gene            complement(886917..889687)
                     /locus_tag="MYCTH_2294353"
                     /db_xref="GeneID:11505616"
     mRNA            complement(join(886917..887175,887390..889094,
                     889278..889687))
                     /locus_tag="MYCTH_2294353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658460.1"
                     /db_xref="GeneID:11505616"
     CDS             complement(join(886925..887175,887390..889094,
                     889278..889514))
                     /locus_tag="MYCTH_2294353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658508.1"
                     /db_xref="GeneID:11505616"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2294353"
                     /translation="MESPEFAAGMRGQGSNGTASSTSKRKRSTVDSSPASLGDHEHDQ
                     EQEQDHDERTDASPETKSRRLPGVKRACNECRQQKLRCDVVQEPFQSCSRCNRLKLEC
                     KIESNFKRIGKRSKHAEMEKEIERLRRAVELAKSRGFVLDEDDETLHSTVHSAMQSQL
                     HSPVVTSQYSHTRNPSLMGSDEAVSSLLHLKRGGSYALPRIARELDTFQITEEEESQL
                     FSQFFNYYHPFLPFLNPAQTPDQYYQQHPLLYWSIIAVASRRYGSDHNILTKLSGPLT
                     RLLWNTVGDVPQSYFVVKALCLLCTWPLPTSTTSSDPTHILCGVLMKTATGIGLHRPN
                     HINDFSRVAVELNKEGLHDRIKTWAVCNIVAQTIGTGYGQPASTLYDWTLAVRPGIDG
                     PFSLGPELEARLQIERFCDKVSKEMYSNASDPRGVAGDEHRAMLMRVYRREFNELQAS
                     ILAQNLSPIVYLHLKAACLHLRLAGFFDSSRTPGYLDDLMALWRATTGYLDFILDGPE
                     TCDEAYRYQLQDQFLLKYATNYIQQMLVAAGFALLKLMRSFFVKQIEPERGRTLFHRT
                     IQAIRTTSVVQNDLNWRLAELMVQIWNGARNKDASSFQGDDPEIDDSLQLKVRCRHSM
                     SLVFDSIWHWREEYQARGRGTLDASTHLDSTLAPPSQSLPANLGLAASNGPMTPGGNS
                     AMGGGTQGGSLMGLNNYESNYDFWDPQHWMLDGLIDFNYNTFVPIEST"
     gene            <891368..>892082
                     /locus_tag="MYCTH_2122102"
                     /db_xref="GeneID:11512967"
     mRNA            join(<891368..891551,891652..>892082)
                     /locus_tag="MYCTH_2122102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658461.1"
                     /db_xref="GeneID:11512967"
     CDS             join(891368..891551,891652..892082)
                     /locus_tag="MYCTH_2122102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658509.1"
                     /db_xref="GeneID:11512967"
                     /db_xref="JGIDB:Spoth2_2122102"
                     /translation="MGASGSKAAQRTVRKFPSRAPGSSPAATTNPMTRPARRPPPAPS
                     EDVQPRSQRQAFYTKDDAIRADSTDPDGTELSPDFAARLQKMGIVQPNPTYSPSSIAS
                     PFPDVSGIRQSVSTPQYPASSNNATLGVLEVRRQLEARAREELENTGKSTDKGREFLD
                     IGTIRQILVLRQGGASPADIEARLRLKPGVVERFGPQGVVAPAS"
     gene            complement(892164..893634)
                     /locus_tag="MYCTH_2294358"
                     /db_xref="GeneID:11505450"
     mRNA            complement(join(892164..892619,892811..893634))
                     /locus_tag="MYCTH_2294358"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658462.1"
                     /db_xref="GeneID:11505450"
     CDS             complement(join(892322..892619,892811..893493))
                     /locus_tag="MYCTH_2294358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658510.1"
                     /db_xref="GeneID:11505450"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2294358"
                     /translation="MSSFIRKTALTAGPRGPALLARRSLLLPIGLSRRSFHGTPTRQN
                     GSSVSGNGKNPYLLPEFSLKDRVIVVSGGARGVGLTQAEALLEAGAVVHALDRLPEPG
                     AGSDFARVADRAASELGGRDDGRSPRLSYHRVDVRDQAALGEIVGGIAEAEGRIDGLI
                     AAAGIQQETPALEYTAEDADRMFGVNVTGVFMTAQAVAREMIKRKQKGSLVFIASMSG
                     TVANRGLICPAYNASKAAVLQLARNLAAEWGEHGIRVNTISPGYIVTAMTAGLFEDVP
                     ERRTAWPDANMLKRLSYPEEYRGAAVFLLSDASSFMTGADLRIDGGHCAW"
     gene            <893808..>894312
                     /locus_tag="MYCTH_2122104"
                     /db_xref="GeneID:11508933"
     mRNA            join(<893808..893841,893902..893993,894175..>894312)
                     /locus_tag="MYCTH_2122104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658463.1"
                     /db_xref="GeneID:11508933"
     CDS             join(893808..893841,893902..893993,894175..894312)
                     /locus_tag="MYCTH_2122104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658511.1"
                     /db_xref="GeneID:11508933"
                     /db_xref="JGIDB:Spoth2_2122104"
                     /translation="MGIPCPSQVEKGSGAIWPRRPETERYHHANLDDQERPPPPPQLE
                     SVEREPAFLFGYFREPEEGENATIIAASTSSHFGPFDTKDDEG"
     gene            896285..898264
                     /locus_tag="MYCTH_2294361"
                     /db_xref="GeneID:11508763"
     mRNA            896285..898264
                     /locus_tag="MYCTH_2294361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658464.1"
                     /db_xref="GeneID:11508763"
     CDS             896615..897868
                     /locus_tag="MYCTH_2294361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658512.1"
                     /db_xref="GeneID:11508763"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Spoth2_2294361"
                     /translation="MALTYQQSKLVKDTIPVLRERGEQITTTFYRNMLRDHPELRNYF
                     NSVNQKNGRQPRALTAVILSFASNINHISELIPKFERMCNKHCSLGIQPEHYDIVGKY
                     LLQAFGEVLGPDMTPAVFAAWEKAYWLLAKMLIGREAHLYRDFEPWTSWRKFKVDRVV
                     PETDDIFSFYLVPEDGKKLPKFLPGQYVSLRVQGPDGYMQARQYSLSDAWRPDYYRIS
                     VRRDEGAPYANSVSRSFFHPGLVSNLLIDKMGPGSLVELSHPAGDFFLDVHNTSTMPL
                     VLISAGVGVTPMVAIANTVVHLQPGRPISWIHGSRRSVPFEDHVAQLRREHGPSFRTK
                     IFKSRPASGDTPGVTYDYASRVDLARLDPEQDLHLHRGGAEYYICGPEQFMLDVVDYL
                     TAKGVGPERIKIEQFSTGDLAMKRP"
     gene            complement(<899651..>901152)
                     /locus_tag="MYCTH_2122106"
                     /db_xref="GeneID:11509200"
     mRNA            complement(join(<899651..899972,900100..900429,
                     900522..900612,900816..900930,900991..>901152))
                     /locus_tag="MYCTH_2122106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658465.1"
                     /db_xref="GeneID:11509200"
     CDS             complement(join(899651..899972,900100..900429,
                     900522..900612,900816..900930,900991..901152))
                     /locus_tag="MYCTH_2122106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658513.1"
                     /db_xref="GeneID:11509200"
                     /db_xref="JGIDB:Spoth2_2122106"
                     /translation="MSPSEHTRRDAPVACGSCDENPKNPNDQIPTGSAAHAHGVAASL
                     IEANAVENPTGPPRDADEHHLQEIFNLYTQTETLSPSLAPLRVKSNSDILTNYTQQQY
                     QNPYGPWCCASKKLRKHHVRTREQQVRRAPEHTSPPPSGAAACAGGNKAGFEEFFTIR
                     PSKLGGLGAFATHDLRRGETILTERPLLRTTHFRLMLDYYNLSDAAKKTYLSLHGGED
                     GDRFGRVERVKVLNSFQVPGGVAIFEIASRFNHACPPARNVRYAFDDESGVLSLTVCH
                     DVAPAGAELLISYGGSPAELYSTYGFRCRCGGCTPLTDDDIRTLRCRQFGAGDCSDEY
                     DASEW"
     gene            956746..958490
                     /locus_tag="MYCTH_2294362"
                     /db_xref="GeneID:11509135"
     mRNA            956746..958490
                     /locus_tag="MYCTH_2294362"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658466.1"
                     /db_xref="GeneID:11509135"
     CDS             956877..958325
                     /locus_tag="MYCTH_2294362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658514.1"
                     /db_xref="GeneID:11509135"
                     /db_xref="JGIDB:Spoth2_2294362"
                     /translation="MTEVTTYSQRHPFEASNPRLLAPAPGFQTLSISNPNSEMVYHSE
                     GYYAFQAPPRPPLEPRSSSVSSASSSGSSSVPYSTVPPDNVGAVRTVSPASSTSSDSG
                     TGAMVYSRNHCPAIAHEQPFAFRAHPLPSQLLQAQAPSSLPFYPSTYQTSRDVSRPSP
                     YGAYSVDALHHQPPSFSYETWHPMFASTAPCHSSQPSTSYQVRPRNNDANWFLNGMRR
                     LPPDVIRRIQKYVTWYHCWKATRICQWFLHNFHPDNFSHEWKVAEILNTERNRGHEPL
                     DDEPGDTPEQKKPGKDFNFFACYHCFRFKGFDQFEAQKHTPLVFREEDDSEEASGTTN
                     ALTTTKKREQSSTLSSPSRSPPANPHYDPSLTRSSLRAASSSSSSSSSSSSTAGRGRR
                     AVGGGGSPAASDDPFAHMHPRAKRTYGQRRFCVDCGLKAGFYEPGDLIELQKPRKKGD
                     AMWVCRCRKLHSRMDSAQCHVCNSIAPLSVPR"
     gene            complement(964667..967721)
                     /locus_tag="MYCTH_2294366"
                     /db_xref="GeneID:11509210"
     mRNA            complement(964667..967721)
                     /locus_tag="MYCTH_2294366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658467.1"
                     /db_xref="GeneID:11509210"
     CDS             complement(964685..967573)
                     /locus_tag="MYCTH_2294366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658515.1"
                     /db_xref="GeneID:11509210"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2294366"
                     /translation="MDSSAAASTLTRQRLSVAFLSLAATATVGYFCYRIYHPPLPEPP
                     PDRRLHRSNAVRHRRRSIPDVVRAHSREPSEASTTSVESNADENAHLGNVQPLNDAET
                     VADDHVMEDNWYDDDANNNQFGGQQQRAGQNIVSLLFRVSEDNARRNAYVHRGCLCNG
                     CGVTPIRGIRYRCANCTDFDLCETCESQGLHTKTHIFYKIRVPVPRLGSRPLQPVWYP
                     GDPENCVRLLPKHLMAKLSKETGFERPELEALWEQWTFMASTEWREDPDELGLAMDRK
                     TFERYLVPSGGYRHIGPNLLHDRMFAFYDDNNDDLIGFSEFLRGTAYRKRKDRLRKVF
                     KGYDIDGDGYISRRDCLRLFRAYYAIFKHMHRDILDGLDDQVMSSTEVEQLVTSRQPL
                     SSLFGREGGFSHADTDRPMEGKVVNLNTGEVHITDGSNRAVSEDTPDTDDRRSILTNV
                     FTRQAHVAESLFMPVMDHPRSTGERTSGLEYLNGLLNPPTRIGDLPALLLGETRDGDD
                     FVVVVNGSGGQDGRSGDDNSSSARENGGASGSGDDSGDNRGSADRSSGSASGDGNQRR
                     PSYRVASSRRLRVNARRKLFDRWKRRQFYLDEEEGMLPPEDWSEDDDILANLNNGPVD
                     ESKSAQPPLSSRSRSSSKVRFAQDTDDFEVRSNPSTSSRSIPERWGGIEIPDAERDLG
                     KEIFYQVSQQAFNEILDTLFKAKEDLAVQAAETKALRDQYRPLFESINPDEDDEKDGA
                     TPAKSKATEDPELQELLARSGYTIDEGTQNDTQNDTPKPEEDETSDEGGDDDSSLPPP
                     VPEEGSADGSSSSSAEVDTYRDPTLPQFRPNSEAAASRAGRTQQNPPHQAAATASTSE
                     GRRAEPNPPPASSRKSSAKAAGKTAAGDGKKPAAAAAAAAAPKQPIPRTTLVNWKRLD
                     LAEQEAKERGGWGRLSYDEFERIYKSAEARGNRLDYLGTWIDFCIPST"
     gene            968006..971413
                     /locus_tag="MYCTH_2294367"
                     /db_xref="GeneID:11508738"
     mRNA            join(968006..968285,968456..971413)
                     /locus_tag="MYCTH_2294367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658468.1"
                     /db_xref="GeneID:11508738"
     CDS             join(968243..968285,968456..971112)
                     /locus_tag="MYCTH_2294367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658516.1"
                     /db_xref="GeneID:11508738"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="JGIDB:Spoth2_2294367"
                     /translation="MNIISVAESPSLDSVEYDPIAHLNLLFSHPSTVSSVSRVSSAIR
                     RHKDDLSRSIASLEAAQAYGPDSSLERMQSAQAELASLFQRIESVRSRALQTERDITT
                     MTADIKRLDGTKRNLTLSMTALKRLQMLTTAYEQLRGLARTRQYRECAGLLQAVLQLM
                     RHFNSYRSIEQIAVLSRNVSELQRELLEQVCEDFELAFAKGEVAARRAVLVEACLVMD
                     ALGEHAKTRLVTWYVNTELREYRQVFRGNDEAGSLDNIGRRYAWFRRMLKTHEEEHAS
                     IFPPHWRVGETLAMAFCDGTREDFKGILEKSMRRIDGAKLDVNLLLSCLQETMDFEQS
                     LERRFASEPRLSIDTLSSADDRVQNFNGSISVAFEPYLSLWVELQDKALAAMIPKYKT
                     QPLIPADEEFSPQAVIPSAIELFHFYKLTLSQCAKLSTGERLLELSKTFAKYLDEYAQ
                     QVLVAFLQRGGPQGPPVQEVILVLNSADFWYTNTGQLEESIKKRIDPDMASNVDLSSQ
                     SDAFMGVASAAVMTLVAKVELDCEGAWREMRNTNWSRMESVSDHSSYVGELLKRLNGK
                     AREILPLVIKQQYARAFCDNLVEHLATAYINNVVQCRPVGEVGAEQMLLDKYVLTKSL
                     ENLLSYHNTSASTTTTTTTTTATTSSSTSSPAGPGSAPPSQHPPPAAFLKRVNQAMGR
                     IDPLLKTLQVRPSPPEGLVQAYLIHIGDRSDTNFRKILELKGVRKQDQAHLMELFAIH
                     RDAASSAAGGQQQQQLVQSSPLLTPLMAGPGSSSTSSSSMGLGGGGGGGGGGGGMSGL
                     AVGGGGGSTTSGGATGLQGRFDAASLGEKLLNAARDGVERMGTTAGASGPGAGGGAGT
                     GAQEKATINENLKNIGKFFRRDIGGFGARFGKRDITPTGGSES"
     gene            971738..973544
                     /locus_tag="MYCTH_2294369"
                     /db_xref="GeneID:11512819"
     mRNA            join(971738..971866,971924..972364,972464..972934,
                     973011..973544)
                     /locus_tag="MYCTH_2294369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658469.1"
                     /db_xref="GeneID:11512819"
     CDS             join(971824..971866,971924..972364,972464..972934,
                     973011..973186)
                     /locus_tag="MYCTH_2294369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658517.1"
                     /db_xref="GeneID:11512819"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="JGIDB:Spoth2_2294369"
                     /translation="MIQGIFYARFFPQEGTKIVAQSPPGCIVPDPDAPTTKPPLFDYS
                     VLQEYIIPRQAFCNRYITVADPEGKYFVLGFPVSIPSPRYDRNEFIFNFGLVVDHDVD
                     QVPYERVVRRLAVTFAEMEKQSGFLSQDADASGTRRPIGSLLEIIKEDLNNYGECMIP
                     VDDANTINMKLFPYHPTPPEVKGWHVPVAKMKFDEVVDSTWDLTLQRVVKHIDGVSDV
                     RRIAILADVSLELTQLALRHLLYYDTILLLDMFFFGACYAPRPGIHDFIANVDGMVDE
                     CANYVCVGLGSAAYQQQQQQQQQQHQQQSATRPGGSVRRDDPAVTTTTTTTITTTSTK
                     TTTITTTITTFIIIIIINININPTIITPTSPTASPTTCSSSS"
     gene            complement(973734..976233)
                     /locus_tag="MYCTH_2294372"
                     /db_xref="GeneID:11513140"
     mRNA            complement(join(973734..975189,975288..976233))
                     /locus_tag="MYCTH_2294372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658470.1"
                     /db_xref="GeneID:11513140"
     CDS             complement(join(973902..975189,975288..975703))
                     /locus_tag="MYCTH_2294372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658518.1"
                     /db_xref="GeneID:11513140"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="JGIDB:Spoth2_2294372"
                     /translation="MRTKRIGAYVGVDPTASSMHVGHLLPLMPLFWMYMHGYGAYTLL
                     GGSTVKIGDPTDRIKDRDPISKADLAMNVTKMHFQMKKLWANVELQARRFGYQKEWAW
                     KRGLVNNNTWWNSVPMLEVLKRVGAFMRIGPMLSRDTVKRKMTEGNGVSFAEFSYPIM
                     QGWDWWMLFSRNKVQMQIGGSDQYGNIVTGVELVKAARDSEPDPSRRLPAEGPLDDPV
                     GFTVPLLTDSSGAKFGKSAGNAVWLDQYMTPTFDLYGYFVRRPDADVEKLLKLFTFMP
                     LEEIKKVMAEQVEDPAKRVAQHRLAYEVVTLVHGEAAAKEAQEQHRMMYGKGGPIIQF
                     TTTTKAPGDEYAAPSGEPITPNNAPRIDMILPESLIMGKSIGRILYAAGLASSAKEGH
                     RLAAQQAAYVGGMPGRSPGKGEPMNPAQLTWNPVKLWFPQETQKYLIDGKILILRKGK
                     HNVRVIQMVSDEEYKASGQHYPGQPYTGRLRALREHMAALKAGKMTPREVREAMQQPT
                     EEDDGAILKFPKEKNPEQTKLEAQLEELLKEAEEKEKKEKEKEKEEKEESAETKPGTS
                     S"
     gene            976511..977776
                     /locus_tag="MYCTH_2294375"
                     /db_xref="GeneID:11513171"
     mRNA            join(976511..976840,976928..976945,977148..977776)
                     /locus_tag="MYCTH_2294375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658471.1"
                     /db_xref="GeneID:11513171"
     CDS             join(976699..976840,976928..976945,977148..977500)
                     /locus_tag="MYCTH_2294375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658519.1"
                     /db_xref="GeneID:11513171"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="JGIDB:Spoth2_2294375"
                     /translation="MASIARSSLLRQVASARPSFQQSVITNAARATAFHTTARRNLLP
                     PLPQRVEGTVNDAAPVPEPSPSHGSYHWTFDRLVAASLVPLTVAPFAAGSLNPTLDAI
                     LCATILIHSHTGFQNIIIDYVPKYRVPRARKLFMWGLNAATAVVGLALYEFETTDVGI
                     TETIKRIWTA"
     gene            complement(<979431..>981113)
                     /locus_tag="MYCTH_75696"
                     /db_xref="GeneID:11508907"
     mRNA            complement(join(<979431..979815,979899..980264,
                     980343..980909,980980..>981113))
                     /locus_tag="MYCTH_75696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658472.1"
                     /db_xref="GeneID:11508907"
     CDS             complement(join(979431..979815,979899..980264,
                     980343..980909,980980..981113))
                     /locus_tag="MYCTH_75696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658520.1"
                     /db_xref="GeneID:11508907"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_75696"
                     /translation="MSATSSSPTTSPVKPHFPRPQHNCLECKRLKRACDKKLPCGKCE
                     KAGRNCEYRDSGDDGVFGPISAARDIHSLAFGTLLDILVHKQGIKEAISSYFDGVNTW
                     FTVVERAAFERELEANWDNLQAETSAMALCMALIARPPNQKSSKGMGDTVYPSTKAIL
                     SLVQSKVPISTKMLQAELLVAMYEFSHSMPQQAYLSLGRCLQMTKAMGWHDPTFWALE
                     KQISRPADLKLCSILCLLNVAYQDPATQGYPMNTMGLNLGFPIPGPDALDQFFPGSPF
                     QIGGQNQGFRDANSDQMAGVVFPEAVSAWYLFQVLQHLSNPAVQDNDSRRELSNHIFR
                     HMKATGRSRWRACDRAIGTDLIALMKLHQPHLAGMPDPLTMMIDPSHAEDTTRMRTVI
                     DVIHGKAGKVTQIEELDRGAVDPSWAFAMCYASQLLISYGYNTLQDLNWLQKVADLRA
                     ALERVSRRWKIAEQYCRQVTIDLDNRLAAGFVN"
     gene            complement(982537..985192)
                     /locus_tag="MYCTH_2294384"
                     /db_xref="GeneID:11508475"
     mRNA            complement(join(982537..984726,984793..985192))
                     /locus_tag="MYCTH_2294384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658473.1"
                     /db_xref="GeneID:11508475"
     CDS             complement(join(982786..984726,984793..985074))
                     /locus_tag="MYCTH_2294384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658521.1"
                     /db_xref="GeneID:11508475"
                     /db_xref="JGIDB:Spoth2_2294384"
                     /translation="MSEFVNVPEFFSSVYLVDLSPSLCEVARKRFARLGWANVKVICE
                     DARKFRLEDYEDGLSGRRTSLTRSPTSYFEARPDHGGADLITMSYSLSMIPDYYSAID
                     SLTSLLSPHGIMGVVDFYAQSQVDVRFRNHTGGMIGRHVHYLARTFWRAWFDLDRVSL
                     EPGRRDYLEYRLGTILTANLRNKALGSIPYYIWLGCHKKPFSSSSLPHEIIERIDALA
                     TESPYLLPSNKPKGSDALTRAVERTAPELRSKAFDAAVGNLSANLPLPSFFYQNHHWR
                     IYYDDQLEKHTQFKDEYIYAFTWEDSKVDASLLKLGPDDVVLAITSAGDNILSYAMQS
                     PARIHAVDLNPNQNHLLELKVASLTALPYEDFWKIFGEGKHPEFRSLLLSKLSPHLSS
                     RAFQYWLDNVSVFTKAGGRGLYDTGGSKHAIRVFRWISRIFGCRKAVGELLAAETLAE
                     QRRIWHSKIRPALLSPLVSNLVVSSEAFLWAALGVPKNQLAMIEADHAVSPAVRGPSP
                     TAKNTRAHAIWHYMVNTLDPVIETTHIATDNPYYHVCLTGAFSPRCHPNYLSREAHAI
                     LSKPGAFDGLRIHTDEIDEVIARIAPGTLTVAIIMDSMDWFPRTTTTTTKTKTTQQSS
                     SSSSSSSSSSNPAAAQIRKLNRALRMGGRVLLRSAAREPWYLREFEAHGFAATRAGDR
                     APGACIDRVNMYASCWVCEKVTNLPPPTPELEATLGASEGEGEGEGEGGLAAMTMIGE
                     "
     gene            complement(985298..985912)
                     /locus_tag="MYCTH_2294385"
                     /db_xref="GeneID:11505694"
     mRNA            complement(985298..985912)
                     /locus_tag="MYCTH_2294385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658474.1"
                     /db_xref="GeneID:11505694"
     CDS             complement(985312..985644)
                     /locus_tag="MYCTH_2294385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658522.1"
                     /db_xref="GeneID:11505694"
                     /db_xref="JGIDB:Spoth2_2294385"
                     /translation="MASLGGNTSPPENIISPQVFVAGLAGVVLFTIGFCQLSAKPSER
                     RPRDGGDDEPGIVRSILLFCYSCFLKPHSRTANGGQQGALESFYASQADAVRPALVGD
                     PGSSAKNR"
     gene            987482..990306
                     /locus_tag="MYCTH_2294386"
                     /db_xref="GeneID:11505605"
     mRNA            join(987482..988081,988312..990306)
                     /locus_tag="MYCTH_2294386"
                     /product="histone acetyltransferase subunit 3-like
                     protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658475.1"
                     /db_xref="GeneID:11505605"
     CDS             join(987574..988081,988312..990014)
                     /locus_tag="MYCTH_2294386"
                     /note="1| histone acetyltransferase subunit 3 [Glomerella
                     graminicola M1. 001] Contains conserved domain: pfam10198,
                     Ada3, Histone acetyltransferases subunit 3"
                     /codon_start=1
                     /product="histone acetyltransferase subunit 3-like
                     protein"
                     /protein_id="XP_003658523.1"
                     /db_xref="GeneID:11505605"
                     /db_xref="JGIDB:Spoth2_2294386"
                     /translation="MAPSSSQKGTGKKGGAGAIRQQQHQQQHQQRSRNTTPGPAPPSA
                     SLPPFETVETETIELRFDVFRDLTFEDMVDPAASSSLIPDSKSLDGLLTRLQRLGDVI
                     EKRSTYCDRGMRLLAQNRRQRMDDLALERDREEERRQREAEDGERERKSNKKKRKGTD
                     TLTPHGGNTERSSPLRESTGKARKLSREDSASSSLSPVAPGTPGNMDVDDKAKAEAND
                     SDSDSSSDDGRPPPPARPQANTFGDDPSTFPDPTVYEILPVKPGMSEEEIKKIYSVAS
                     YPKSDLSHLIAGDPPDKDFSNAKPSNQISFSTFNSYIEPYFRPFTEEDLAFLRERGDR
                     VTPFIMPKRGKRHYTEIWAEEDGGMALDSSPPGKLPPNQPRGNIENMDDEVAETDKLS
                     VGPLLARLLQAMRPENRAPPADDKQQGNANGVNGEADNNANGIATFDFSSGDNQPAGQ
                     TNGANGVNGASSQPANPDQPPQPQTLPPATFMPESNSDSWKKATHPKLDYTQVDERIK
                     QELRHIGFLPLPPHQDPSNPAGANSSASASNPGGAPSNSNASAASAAAGTIQPDPASQ
                     AEYDGHYDDEVAARLRLLQARLREQALLNGARKARLTELVKERMAYQEYQTILEDLDS
                     QVQAAYLKRTRTMGKKLKKARPGQSAAAAAAAAAAAAAASGPVARPGIGDLTRTLMER
                     RRRWIESIGTVFDDESVAKVPRVQDGDTSIFKPAVMAELLKREREAWDEEVEEE"
     gene            complement(<990734..>993032)
                     /locus_tag="MYCTH_98729"
                     /db_xref="GeneID:11509014"
     mRNA            complement(join(<990734..990774,990850..992356,
                     992417..992483,993013..>993032))
                     /locus_tag="MYCTH_98729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658476.1"
                     /db_xref="GeneID:11509014"
     CDS             complement(join(990734..990774,990850..992356,
                     992417..992483,993013..993032))
                     /locus_tag="MYCTH_98729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658524.1"
                     /db_xref="GeneID:11509014"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_98729"
                     /translation="MSDNAYVNPSWKGGGTVTSTVIRNITALSRDLSYSAQFFGNTTT
                     LSSRFASVENGVISGLLFVPNLPDGDSCNSETASHVPASAVRLADLPPMNLHLIAIAP
                     WVNGHCSEAYLNAARTTPVRAFLFYQPGTGSDSPPPADADDWHISGGSNWMKRASFPV
                     FAVSGTVGEIVMQHLSLYSGNITEVPYGRNLTERYLADPADYLRIWTELEIRTPPSGF
                     ETWVYVLIILAVLLTVITATSLLMHCVQAWRRVSLRRRVISGEVNLEAMGIRRLTVPV
                     SHIKQFPLFTYHYEPEAMSSPVSPPPVRATRARTQTGTRTGSVSFGDSSVASQAARFD
                     AITGPGLGGPFTVSTTATDYQPNCEICLESYQNRVTIIRELPCGHIFHPECIDEFLQE
                     ISSLCPVCKASMLPKGYCPKVTNAMVRRERAIRRLRGRVEIQDDGEDSTPGDLPGRWM
                     ATKSRLFSVARRGTPSSFSTELEDNRPKPETRGSQRSQPQPRPDNRPDTDPRGGSPTA
                     LARERMRELAGFGPDDEDASLTMWQRLRTRIFPGFD"
     gene            994454..997304
                     /locus_tag="MYCTH_2294390"
                     /db_xref="GeneID:11508077"
     mRNA            join(994454..995630,995687..997304)
                     /locus_tag="MYCTH_2294390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658477.1"
                     /db_xref="GeneID:11508077"
     CDS             join(994542..995630,995687..997198)
                     /locus_tag="MYCTH_2294390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658525.1"
                     /db_xref="GeneID:11508077"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="JGIDB:Spoth2_2294390"
                     /translation="MAPLASEPRQVLTVLNPARRKALYTLLVEITAFMRSQLDFNEPA
                     GGGHQGAAPLLVDPSADNSIIIPAGTAGANDAAPPNPALVRLRAAAVEHFDGWRKDVL
                     AKLKELLSTPDDASIVEERRKRTERIAAQQRQQRQQQEQKNNTGSSTDTRRVDLLGSW
                     DAWPEDDRGDGAKTEGGRGQTEEQEENTGDAVARLQSHWHPIPTRLVTIPEEDRKEAL
                     SCVLLVLLSTGHYSAHSRALAVYLTSALELPLAVLNAEEVEIAVSLVERSAEAERQQR
                     TMSAEAEAEKRKQQNQASRYWKVGLASVAGAALIGVTGGLAAPVVAGAIGGIMGSVGL
                     GGVASFLGIFWMNGALVGTLFSAFGARMTGEMVDRYAREVDDFRFIPLKDEWGTRGSS
                     QNDRRLRVTIGINGWLGTEDDVAKPWRALGDDSGAFALRYEMKSLLGLGKSLRELVSS
                     YAWNAVKVEVLKRTVLATLWSALWPAYMLSMASTVDNPFSLAKNRSEKAGEILADALI
                     NKVQGERPVTLIGYSLGARVIYSCLRSLAARRAFGVVDSVVFIGAPVPSNRQHWQMMR
                     TVVSGKLFNVYSENDYLLAFLYRATSIQLGVAGLQEIKDIEGVENLNLTEEVQRHMRY
                     AKLIAKILARCGIPVVKGASAPIEEDEDAIKLTYPDKENANLIDLDGLNITAPPEEVQ
                     PAPPRFQNRTPGSQPQFAQRNEQRTAATGAGPSAVAAGRDLLDLESPNSSGGPAQRTA
                     AIPSPSMPTPTPQPAAARQSPDPPEYAPRELPNTKLFMMPQVPDRSLQAYVPPGPAAS
                     SASSAPAVPASQMSAHHLPTSHSQSAVDGIEDDDGSDEEGGMGIKMVDNDDGLEYCDP
                     TPLEEDPNWR"
     gene            complement(997304..999985)
                     /locus_tag="MYCTH_2294392"
                     /db_xref="GeneID:11508638"
     mRNA            complement(997304..999985)
                     /locus_tag="MYCTH_2294392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658478.1"
                     /db_xref="GeneID:11508638"
     CDS             complement(997410..999836)
                     /locus_tag="MYCTH_2294392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658526.1"
                     /db_xref="GeneID:11508638"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="JGIDB:Spoth2_2294392"
                     /translation="MTAAKKNLKATKKFEKKHLKGVLEKRKAVRKIKQRQQLKEKKKA
                     KRAQDEEFYKGPGGDANGENKAANNKKPGAKASEMSVDEFFKGGFEILDTKTKDKTKS
                     AAKLGKRKRGEADAREDDSEGSGSEPEISDFEEPVVSDSESDDDDASDEGDLGMSKSA
                     MEALAEKDPEFYKFLKENDPEALDFDENADLAEVDDLSGSEDEDEQPKKKQKKDKKAA
                     KEQQEKDDRELTQAMIAKWKASIQATHSLRAARQVVIGFRCAAHLNESDEENRQRYTI
                     TSPDVFHDIVVLALRGIPEVLQHHVPVKESAAGKVYVQTEGKKFKALSMLIKSFAASV
                     IRLLGTLSDEATLKLTLSALQPLLPYLLSSRKLLKLLIKTVVAFWSQSASTDATRITA
                     FLVIRRLVVIGDKAAREVVLKATYQGLVQGSRLTNANTIQGINLMKNSAAELWGLDQT
                     LGYTTAFTSIRQLAIHLRNSIINNKNDSYRAVYNWQYVHSLDFWSCVLSEHCSPLRQA
                     EAGKESQLKLLIYPLVQVTLGAMRLVPTALYFPLRFQLIRSLLRLSRATDTYIPLASA
                     LLEVLNSAEMKKPAKASTLKPLDFSVAYKAPKSYLRTRVYQDGVAEQVVELLAEFFVL
                     WSRSIAFPEFSLPVVISIKRWLKEGRKPGRGNRNGKVASGLVLLVQKLEANARFVEER
                     RARVDFAPKDRAQVDAFLKDFEWERTPLGAYVVSQRKLRAERQRLVEEARREEEKKRK
                     EEEREALEGGDGDGGESGDESAEEEEEDEDIDGAESEDEGKEEEDESEEEEEESEEEE
                     EEEEKEAEED"
     gene            1000065..1001157
                     /locus_tag="MYCTH_2294394"
                     /db_xref="GeneID:11512956"
     mRNA            join(1000065..1000311,1000397..1000633,1000711..1001157)
                     /locus_tag="MYCTH_2294394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658479.1"
                     /db_xref="GeneID:11512956"
     CDS             join(1000228..1000311,1000397..1000633,1000711..1001100)
                     /locus_tag="MYCTH_2294394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658527.1"
                     /db_xref="GeneID:11512956"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="JGIDB:Spoth2_2294394"
                     /translation="MIPRQPYAPTPHSYVPNSTLSATINLDEEVKLAETRAERDLQDS
                     LAEIFSIIVTIDELEKAFLKDAIPEAEYTEICERALKQYKSLLADETVAKAFVGLEEF
                     KAEWDLEVPRATERIRVGMPSTAVTAISGAAPAPAAGGNTSGALILEATQDFITFLDA
                     LRLGLLAKDQLHPLLTDVIQSVNKVTDRDFDSRGKIVQWLITLNQMKATEELSEEQAR
                     ELELDINSAYQGFKSILS"
     gene            complement(1001158..1002994)
                     /locus_tag="MYCTH_2294398"
                     /db_xref="GeneID:11507968"
     mRNA            complement(1001158..1002994)
                     /locus_tag="MYCTH_2294398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658480.1"
                     /db_xref="GeneID:11507968"
     CDS             complement(1001215..1002873)
                     /locus_tag="MYCTH_2294398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658528.1"
                     /db_xref="GeneID:11507968"
                     /db_xref="JGIDB:Spoth2_2294398"
                     /translation="MSIDLNWETVTGGPDGQELAERIRDFIHTKFQSVPLPRFIKSVT
                     VHDFQFGTIPPELELKDVTDPLPDFYEDHVDSDLASDDSDGENNGADRIAQAQNERRR
                     RAAESEMLSGGGRNLGHLPPHLMFGGPGGPGPGPGSMRNGDTGGGPTMRVPTPGIPGG
                     TSNLHYFHSHLASGLSGTQTPLAAVAGAHHLSTANWLDGHGHSSSTPNLHHFANFGGA
                     DTSPRRFPESGHSRNPSQSSISVADLSPTVPTGNSNLAPPSSSSNNNNNNGGGGGGGG
                     GSGSGSNNNLSLPSLREKHSVSTLAPTSAGASRPPTRDATGTLMSSAGDDSTGGEAKP
                     NQPQQQQQQQQQEDRQPRLRERRVDDMQAVFRIRYAGDVKLLLTADILLDYPMPSFVG
                     IPVRLSITGLTFDGVGVLAKIRRRVHFCFLSPEDAVAAVGNDGEDLPGEGEEREEEEV
                     PEEEGGKEQPTVGGPRHRRGRTAAGSGSIGGNSTSSSSNNRRGNTKPGGLLQEIRVES
                     EIGQRESGKQSLKNVGKVERFVLEQVRRIFEEEFVYPSFWTFLV"
     gene            1003379..1007353
                     /locus_tag="MYCTH_2294400"
                     /db_xref="GeneID:11508479"
     mRNA            join(1003379..1006591,1006650..1007353)
                     /locus_tag="MYCTH_2294400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658481.1"
                     /db_xref="GeneID:11508479"
     CDS             join(1003560..1006591,1006650..1007301)
                     /locus_tag="MYCTH_2294400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658529.1"
                     /db_xref="GeneID:11508479"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_2294400"
                     /translation="MDAQSPPKRMTRARSAAKTSELAAKSARVVTPAARAKTARSAAT
                     TTATTRATLKRKSPSDDDEDGHEMQPAKKITIAAADKPTRGRGRPRKVVVEQPAAEPT
                     PEPAPAPAPAPPTTVRARGRPKKAAEPSAEKPAKATRVTRTRKTADESTSAAAEPVKK
                     VSRGRPASSTGTATVTTTAKPVAKSAVKKTVKFEEPEKENVAPTSTAARKASTKTSAQ
                     GPSTTTTTAAAATTSGLRGKPVRKAASATATRSGRKTKAAPDTESGENVEKPMPLSPK
                     KVNQLTMNCVESDDELGMDEKIPVRPFKKLPIKPTTRSAKPTTVHAPVSAGENDENAI
                     EVKQAETEVNLLLASPAKRLPPTPWKGSIQSPARRVEGLVPASAQKTEGKAPQVPSKT
                     GLLQSPAKRQPLNLNPHGTDSSSGSGITPIKLSFLSTPAKRPPISPIKPLPRTIEEEE
                     PTDRSPAPKPTLLASPSPQEVSEGLEERPSTTEDKSADNETLHESPTTLDFPGRLSAV
                     LPRDADPTLTPPASTASAATAQAQAEEDQAETKEDVQEHDGTEDQGEPMVVDQPSAEH
                     PAADSASTTPPTSPKNINPMFGLRAKDLDPYGNLADSDSDDDDDSPVRQSRYTSAFSA
                     LPATPCPGSANSSKVWQSSSRSIAKKTPKNGGLDFTPLAQQLSGWTAGPTPLRIGSPA
                     GLATDSPTADHTPKAVSAPAEAPQNTFFEDEMHVRPETMDAEEDAATEVGDDDDDAVL
                     EDLSFTEEDMELAAEANEMSLMEKEQGDHGSQDHDDSNSEASQEYGDENAIPIDPTLA
                     SSGNGLSGSAVPPVTPQRTIRRREVHTVAKVPLKPADESTPQPRQENRCYSVSRLPAA
                     RPTERLTRNATAPSCSPCKGGEVDPLDDRSVDGRADPSLPVTPQKADIWSTMGTPART
                     PRGDLNPALLQGAVVFVDVHTSEGADASGIFVELLTQMGARCVKTWSWNPNNSSESGA
                     DSRVGITHVVYKDGGKRTLEKVRESGGLVQCVGVSWVLDCERENQWLDESPYYVDTSL
                     VPRGGARRRKSMEPRSIAKLNGMLVPQPVRSSRGSQTAPNTPANNRRASTLWVRSPEK
                     YSDEDDDDHDGSDSGDDNDDKGGGEHTEWGALTPVPKTPAPEAIARFVANISPGSATP
                     SSVGSVDSEDPLGHGDEHDRKEALLRTCPPKRTAFVELGESILSKEKDERILMRLMAA
                     RRKSLQFAPKIGSPLSKSWKAWN"
     gene            complement(1008047..1010536)
                     /locus_tag="MYCTH_2294401"
                     /db_xref="GeneID:11513010"
     mRNA            complement(join(1008047..1008741,1008841..1010218,
                     1010286..1010536))
                     /locus_tag="MYCTH_2294401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658482.1"
                     /db_xref="GeneID:11513010"
     CDS             complement(join(1008209..1008741,1008841..1010218,
                     1010286..1010318))
                     /locus_tag="MYCTH_2294401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658530.1"
                     /db_xref="GeneID:11513010"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="JGIDB:Spoth2_2294401"
                     /translation="MASSKRGPSVLVTDSRDPPLPRGTNRPRAATGPARPSTRLISVD
                     NVLQYSSDIPSGQPRGPPGQRPTRAAAMRRNTQGKGLPTLASARTGQQNVPSRTTKVS
                     EKLVLIPEAPQDEEAEGDDEELARRASILRADDEDRPLKDEELDVLRKRGGIRGKSYA
                     ERLPKVQRGEKVSRLTAYCTAQSYKMQATADFLKTKHEAKIKLYDDCLYTVYHLPLLP
                     GVEGYRLRSRPVLKTPGTGKTVLDLEIERSERRDEHEGLWDEYSYGAQGLGGSPIAGP
                     LLQHVGSAPENLEPSTGGTGGGGGDDQAPGHEGVSSPINRLVPDAKNFGDMFVFSYGV
                     VVFWNFTERQEKDILADLTFAEHETGIPLVAGPLDEMDFETEEFHFEYSPDVKRPRVF
                     NDMITLLPRSDHMVKLTISHAIAQSTKLCFFEARMSETMLNAQHVPKRLALTGELNMT
                     RTEIVKILGRLFKSRVDINLSSNILDVPNFFWDSEPTLHPLYVAVREYLEIDPRIRVL
                     NERCRVFLDLADILADSIADSKMSYITWIIIFLIVISIIVTVTEVGLRFAILSREKGR
                     EGGGSIGVGVGPANGGPGNVIGGGDGDGDEPQQQQRDLRWLVRENKNVTLEELRLWSR
                     ALSERERAAVCGADVVGKTFAGV"
     gene            complement(1011037..1011911)
                     /locus_tag="MYCTH_2087238"
                     /db_xref="GeneID:11505382"
     mRNA            complement(join(1011037..1011526,1011626..1011911))
                     /locus_tag="MYCTH_2087238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658483.1"
                     /db_xref="GeneID:11505382"
     CDS             complement(join(1011323..1011526,1011626..1011769))
                     /locus_tag="MYCTH_2087238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658531.1"
                     /db_xref="GeneID:11505382"
                     /db_xref="JGIDB:Spoth2_2087238"
                     /translation="MCIIFTCGEHTFRKEVEGYEGLVCRCNNCGNYSGSVTKSHPWFT
                     FCFIPVLPLSIKGYEDVTCRICHFEQPLSHRPDVQALRGQGGHGIHMQPPPGPPQGWG
                     QPSPKPNQPMQYG"
     gene            1012492..1014256
                     /locus_tag="MYCTH_2294405"
                     /db_xref="GeneID:11508748"
     mRNA            1012492..1014256
                     /locus_tag="MYCTH_2294405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658484.1"
                     /db_xref="GeneID:11508748"
     CDS             1012696..1013901
                     /locus_tag="MYCTH_2294405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658532.1"
                     /db_xref="GeneID:11508748"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="JGIDB:Spoth2_2294405"
                     /translation="MLYDLNIAWSPGVPAADLERTLKFAKTLGYDVVALNHIISGPIP
                     TQPNPITNPVPQLTPPHPSYPGGRGPLSSSSSSSSSSLSSASTTTTTNRPPPSKPTTS
                     SPSSSPSSPSSSSSLPITLRRATLVISDPSTTNYRLADYARAYDVLALRPTSDKSFAW
                     ACLGTTDPPALVSLDLSSHLGWHLHHRTAMAAVQRGVRFEICYAQALPGNNNNSTGSS
                     SSGGGVGGGYGEGTAAGPGPGPRERANFIANLQALVRATKGRGVVVSSEARGALGLRA
                     PADVVNLLAVWGLGPEKGFAALREGARAVVVNEGIKRRGFRGVVDIVKPAEGGSAEAG
                     KQQQQQQQQQQGQQGQQGQKRKNGEGKGAVGGGGGGGGGGGGGSGQQGELSKRQAKKQ
                     RKEAAQAKA"
     gene            1014258..1015657
                     /locus_tag="MYCTH_2294406"
                     /db_xref="GeneID:11508045"
     mRNA            1014258..1015657
                     /locus_tag="MYCTH_2294406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658485.1"
                     /db_xref="GeneID:11508045"
     CDS             1014580..1015389
                     /locus_tag="MYCTH_2294406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658533.1"
                     /db_xref="GeneID:11508045"
                     /db_xref="JGIDB:Spoth2_2294406"
                     /translation="MPPNAPGKLTVGVAIGSTSVSVSELAEPGRGASDVTEEVAELSE
                     LGRGASVVVDEEAAELSELGRGASVVVDEEAAELSEPGRGASDVTEEEAAELSELGRG
                     ASVVVDEEAAELSELGRGASVVVDEEAAELSELGRGASDVDDATAEPSDTGAPATGTL
                     VLAELVWETWEEDESASEVEDVEASEGLGGGTCPDSVVVPPCVGSDAREEDEIELASA
                     ALEGAAGGFPTELVIRAPSGTGITVTPTPPLATTEDGAPPVPDTPSTAPLA"
     gene            complement(1017154..1018809)
                     /locus_tag="MYCTH_2294408"
                     /db_xref="GeneID:11505766"
     mRNA            complement(join(1017154..1017615,1017696..1017766,
                     1017858..1017903,1018002..1018034,1018117..1018809))
                     /locus_tag="MYCTH_2294408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658486.1"
                     /db_xref="GeneID:11505766"
     CDS             complement(join(1017495..1017615,1017696..1017766,
                     1017858..1017903,1018002..1018034,1018117..1018292))
                     /locus_tag="MYCTH_2294408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658534.1"
                     /db_xref="GeneID:11505766"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Spoth2_2294408"
                     /translation="MEASCQCGAVSFKTPLPKPLALYICHCHDCQRQSSSAFGTSAIF
                     PRFPLPDAELLGCYKRPTTLGETMYCYFCTRCGTRLIHTIPGKNVVSVKGGCIEGLDW
                     KSAIHIWTKSAMVPIPEGSETYPDGGPTEQLSDGQDSLDPPIELAG"
     gene            complement(1019334..1021358)
                     /locus_tag="MYCTH_2294412"
                     /db_xref="GeneID:11508183"
     mRNA            complement(join(1019334..1020577,1020711..1021358))
                     /locus_tag="MYCTH_2294412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658487.1"
                     /db_xref="GeneID:11508183"
     CDS             complement(join(1019412..1020577,1020711..1021116))
                     /locus_tag="MYCTH_2294412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658535.1"
                     /db_xref="GeneID:11508183"
                     /db_xref="JGIDB:Spoth2_2294412"
                     /translation="MITTTSPSHRRGTPSTSSTQSLLTHGPIQSWIRRLRPLLPSFVA
                     DDLFPEHRPTWRLHPTSYLDGLRGIAAIIVFICHYTENNFRPLTRPYAPIPPAPGPDP
                     PLDEPPMYGSKDLPDSLIQLPFVRCIFSGRPMVHIFFVISGFALSYKPVQALHARDTA
                     KCYAALASSAFRRPFRLFGPCIVSTFLIMCLRQLGCLPGGQETLAEELWRWRGAVFHQ
                     VTWPWAWDHDLRPAYDVHLWTIPIEFAHSMLLFMVVLMLSRVRLPVRLAAELGLIGYC
                     LVCGKWAGFEFLAGLFLAEMHVLRAARAKEWEGHEEMLRSRGSTNWALKAFQVFLIVL
                     GLFIGGWPNRFADRTPGIRYFLVLTPSPFATMDALAPQKFWFGLSAVATVWALGDLAP
                     LRRFFEGPLAQYCGRISYAVYICHGPVEELFKDWFLGHPPIPEYGEPGAPDYKPPLPA
                     TGVKGLVGYETITQITVGWILGLWLLAPVVIWAADLFWRGVDSPLVRLARKLEMMCLH
                     ETEPSPRSQGYSAAA"
     gene            complement(1022983..1024250)
                     /locus_tag="MYCTH_2294414"
                     /db_xref="GeneID:11508766"
     mRNA            complement(join(1022983..1023920,1023989..1024250))
                     /locus_tag="MYCTH_2294414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658488.1"
                     /db_xref="GeneID:11508766"
     CDS             complement(join(1023119..1023920,1023989..1024119))
                     /locus_tag="MYCTH_2294414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658536.1"
                     /db_xref="GeneID:11508766"
                     /db_xref="JGIDB:Spoth2_2294414"
                     /translation="MASLNMSPEELKQLELVRNRFAQLTSSLTSLRASVLNSNPLPSR
                     ESLQASVTILQQNIRSIQELADENADLFQRLAIHPSTNFPGRTHEHILTQLLRKKLEP
                     DVESWVEEARATARAAGVDASKLAAGVRPRGVHDYDDEDAYDLGAAVNPDDGPSDPFS
                     EQWADMADNFRQTLQQYVTVQVKKKYTVEEQAMGIENVRTGLRQTLEESDEEDEDEEE
                     EEEEEEEEEGAAGTTAAQAAPGAPAAAGAAGATGATGAAEGQGGHGGGLPVVVEPEHI
                     FYLQAQGSFDLPRNIPLESKRVQTGATRRVAPPR"
     gene            complement(1024450..1027207)
                     /locus_tag="MYCTH_2294415"
                     /db_xref="GeneID:11508882"
     mRNA            complement(join(1024450..1024797,1024974..1025537,
                     1025604..1025938,1026281..1027207))
                     /locus_tag="MYCTH_2294415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658489.1"
                     /db_xref="GeneID:11508882"
     CDS             complement(join(1024671..1024797,1024974..1025537,
                     1025604..1025938,1026281..1026943))
                     /locus_tag="MYCTH_2294415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658537.1"
                     /db_xref="GeneID:11508882"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="JGIDB:Spoth2_2294415"
                     /translation="MAPDLNSLPASPAQGKAVNLTRSGLNSGPAPGEKLPNILYIMAD
                     QLAAPLLKMYNPDSQILTPNLDALAARSVQFDSAYCPSPLCAPSRMSMITGQLPMKIG
                     AYDNASSISSDIPTYAHYLRLKGYHTVLAGKMHFVGDQLHGYETRLTSDIYPGDYGWA
                     VNWDEPDTRLEWYHNASSILQAGVCVRSNQLDYDEEVMYRSTQFLYDHVREGPGARPF
                     CLTVSLTHPHDPYTIEQKYWDLYEGVDIELPKVKIPKEEQDPHSKRLLKVCDLWDNEF
                     TDEQIKRARRAYYGAVSYVDDCVGKLLDVLKKCRLDKNTIVIFSGDHGDMLGERGLWY
                     KMSYFESSVRVPLLISHPTQFTPHRVKANVSTLDILPTMCDLVGTKPASFLPLDGVSL
                     LPHLQGVPGGHDEVFAEYTGEGTVRPLMMIRRGRWKYITCPADGSQLYDLEADPLELV
                     DLVKSGAASSDEKIRRVFEDFEAEAHAKWDFDEITRRVLESQRKRRLVWSALIRGKFT
                     SWDYNPIDDGREKYIRSHIPLDDLERRARFPAVDAFGNETSSAVVAHQAGSHGE"
     gene            1028519..1029216
                     /locus_tag="MYCTH_2294417"
                     /db_xref="GeneID:11508666"
     mRNA            1028519..1029216
                     /locus_tag="MYCTH_2294417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658490.1"
                     /db_xref="GeneID:11508666"
     CDS             1028601..1029137
                     /locus_tag="MYCTH_2294417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658538.1"
                     /db_xref="GeneID:11508666"
                     /db_xref="JGIDB:Spoth2_2294417"
                     /translation="MKPTTVFFSLFAIAAAAKLPSTGPSTDTATVDVVARHGPSHEGR
                     QHDGHNEVIPTDEEEAHDLDARGLKIKPSKVCGILGCKDKDKDKDKEKQKEQEKQKEQ
                     EKQKEQEKQKEQEKQKEQEKQKQEKETEKDKTNPVNKINKQNGKHKGQKSDAAALADL
                     DVSVLLAGLVGTGIAALL"
     gene            complement(1029242..1030585)
                     /locus_tag="MYCTH_2294418"
                     /db_xref="GeneID:11508225"
     mRNA            complement(join(1029242..1029703,1029832..1030585))
                     /locus_tag="MYCTH_2294418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658491.1"
                     /db_xref="GeneID:11508225"
     CDS             complement(join(1029440..1029703,1029832..1030428))
                     /locus_tag="MYCTH_2294418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658539.1"
                     /db_xref="GeneID:11508225"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Spoth2_2294418"
                     /translation="MEALRSAIQPVTHNLPGPIRSLGESIIGDACYKTLLLDVDLENA
                     ECVKLAISKGLGIGIVGASSIVKVPQILKLVRSRSASGVSFLSYLLETSSYLISLAYN
                     VRNAFPFSTYGETALVLGQNVIITILVLNYSGRATLAATFVAAFAAAAATLFAESIVD
                     MQTMKYLQAGAGALSVASKVPQILAIWQEGGTGQLSAFAVFNYLLGSLARVFTTLQEV
                     DDKLILYGFVAGFALNLVLALQMVYYWNAPSAKAKGKQKEVPVAAPTSSATTTSAAPK
                     SKGPTTRRRG"
     gene            complement(1031748..1032834)
                     /locus_tag="MYCTH_2294421"
                     /db_xref="GeneID:11508721"
     mRNA            complement(join(1031748..1032256,1032471..1032834))
                     /locus_tag="MYCTH_2294421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658492.1"
                     /db_xref="GeneID:11508721"
     CDS             complement(join(1031770..1032256,1032471..1032541))
                     /locus_tag="MYCTH_2294421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658540.1"
                     /db_xref="GeneID:11508721"
                     /db_xref="JGIDB:Spoth2_2294421"
                     /translation="MPFGEDLFPDRDLSPAPIQSDLLKSLEAEMDRDYGEVQSAGPTI
                     VTLADRAVVDREPAGVPEPDQQVQAEEKVNAASPEPAAPSSTFKTRGRPSLSASATPV
                     GSAASGTPKSATTPKGARASSGKRKAAQGEPKETETAATPVPKRGRPARTAGVSASAR
                     LAAAAANKPARGRPRSTTVSDPRQP"
     gene            complement(1033003..1035331)
                     /locus_tag="MYCTH_2294422"
                     /db_xref="GeneID:11508407"
     mRNA            complement(join(1033003..1033501,1033580..1034772,
                     1034835..1034911,1034974..1035048,1035113..1035331))
                     /locus_tag="MYCTH_2294422"
                     /product="guanine nucleotide exchange factor
                     synembryn-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658493.1"
                     /db_xref="GeneID:11508407"
     CDS             complement(join(1033393..1033501,1033580..1034772,
                     1034835..1034911,1034974..1035048,1035113..1035134))
                     /locus_tag="MYCTH_2294422"
                     /note="1| guanine nucleotide exchange factor synembryn
                     [Glomerella graminicola M1. 001]. Contains conserved
                     domain Ric8[pfam10165], Guanine nucleotide exchange factor
                     synembryn"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor
                     synembryn-like protein"
                     /protein_id="XP_003658541.1"
                     /db_xref="GeneID:11508407"
                     /db_xref="JGIDB:Spoth2_2294422"
                     /translation="MAQLTGPAKLDAVRKLLDDLNEDLKSRTLQPQERDAALEQLKVY
                     GRDPSFADPIFTKEGIETLTKFAFDSSSDITSRNALRVLCNALFLKPETRQNFVDLSY
                     EDKACAKLKNDNRDDEFLVSRLLLLTTYGTSIDLPKLIEQHQLADSIIQNLARHAERF
                     SKKKSTTAAAEPMTEMALAETLKLLFNVTNFAKKHVNSFDGALAPVASILCAHPFPQT
                     KTPLDPPFSLLINTLINLDLTTPAAQAALYPPADPTKVANRLLELLDLAMKSYADSQL
                     DQDVSPLICALSEYYKNAPKKEDAKGTAPTDPVRVRVRAALLPTDEDRKLVLGKADTL
                     PSRLLRNWTNPLAPQFRSAVAHLYFDLSGRDPVQFVENVGYGYASGFLFENKINVPEE
                     AMRQQQQEQEQQGGKSAAGSTGIRRDVNPITGQFLDEEKFPDLPEMTKEEKEREAERL
                     FVLFERLKQNKVMSVQNPVEKAVQEGRFQELPDDYSEDDSD"
     gene            1035908..1041735
                     /locus_tag="MYCTH_2294426"
                     /db_xref="GeneID:11513348"
     mRNA            join(1035908..1039145,1039198..1041735)
                     /locus_tag="MYCTH_2294426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658494.1"
                     /db_xref="GeneID:11513348"
     CDS             join(1036188..1039145,1039198..1041504)
                     /locus_tag="MYCTH_2294426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658542.1"
                     /db_xref="GeneID:11513348"
                     /db_xref="JGIDB:Spoth2_2294426"
                     /translation="MSSPAVLSSYLSALPPRPPTPPREAHLEAVAPNRQSLPFVDSRS
                     SVHTPPGLQSPASSDATTSTSRRARKKVGFSAQAEYKDPPVYPDGEGVIQHPTPVSLP
                     RSASKPVKSILKVTANPQNLLDPTAGNDCDLSNPQISVAAMLESTLQQLAGGDRDSKL
                     DAYLMLTRAWKASNNLPDRVALQEKMTLFTQFMQRDIVAKTPEGSLDSSLVNHALNLL
                     NTFLHFPAISSTISNDFGVFIIDHCIHSFEDASTPKDTARRLMQVISLQNFSPKVMTA
                     DRVGRLVSSLHNIEEHLKGKSIILSRVLIYRKLVQQSRQLMIIHADWLLDMFTDMLSN
                     LRDIRSAAIALGLEAAFSIGHEKQLSRKVMEVFNLSYEDKRYIQYYEEKLKTMTKDKY
                     ESAVVPHIWSVVILLLRIRLDKWEFAGPWLHIIQNCFNSSDFPTKIAANHAWARFVYL
                     MHLEERALPKNLSTLTTPLISQLRRRGSGKTSEELRQAVLGGICNLFYYAFKPNTSST
                     LLDTYWDTSVRPVLTKLLDPAAEAADDNLRQASLILGGLFDCTTPRRWRVDHIVESPL
                     VKPDELPPIESKWIRQNTNRVFGVIEPILEQDFFALSEADSATYKLWRSLVSTVASAA
                     AKEIKVSKDTASFVGVALNTLHKVWKRGVSEQEGTGGNVTRFLISARAYLDAMISLLG
                     PLPFTEKAGKHQASAKAPLYTLFSMLSTLPPGVPDERDYADFFGSVFAPFFASKGDRA
                     KMELAQDLMSVIPMDAPRPYGPWLLVAENISSWLEPVHNSHHSTGSVGETPVGHDYRD
                     VVKVLERGIRSTPNLPPKHWMSFFHTVHGRVREETGDAGAAIVVIEPLAKVLAEQSAA
                     QECSSAPLSRVAIVTELVSVATQPRDRQAVDAARKRLWGTVFAGSRSSSFDPFDNLYK
                     AVSDALESLYDNFGAVNVDSTVQLFKEIGSFFDRCNRQLFLRAMMALQDGLLPWIQDD
                     RRLLGSQANSVFASVKSLWDKLARLIGDVDHPEQQLQCLDRFFRASFASCHRVIVNSA
                     ISLWNGLFENVGQLDYPEELKAALAKIQPHADIVLPGMETSSSEYAGQRLSFIDSFED
                     FSFSELPSTRSSNRRGTSRPTSSHSKSPEVPPQTEPAASDRRTTTPRTKHDDSQVHFA
                     TIEPSSELDSPAASQILTERQKEVRERQRETAALFPHIRSSPGPKAAKDPDHQMLPVG
                     LQMRHATPEPEARFDDYVSSTPTPRRGQLVVMPEHDMTDPPSSPPELRGNPLAAEIRS
                     RSASHSLLEEWQFSSSPVSGSPNPGRHGVVPDPSSQRGYVSVVSLPEVPSSPAKEEED
                     KTASQSTGDEVVEDSMIFEPANAAAAPAPWGTLAGANPSTPRRSTRLSQARARETPTP
                     KSDGEEFVDAPTSPPPPTPKPSVRTGEANQESDGKQALVIPADNTSFDISDVDESSLF
                     RLVVELDSGKADRSEYHRPSPSVSPDGKAQSPPVVDCIVVGESPQKSEAPPPLRKTRA
                     SSAASAISSHAEAQNMTSSQPRARVGRPKRKRATSKAQETGAKRQRHDPAEESREVPH
                     IQETPVLDMAVEVQGSAEAPEVSTGLSGNMEKEDIPEERIPSSSAEPSSSEHPSQESG
                     PQKPTVPRTGKGMQFEEEDDQDVQSQIAHESSQHQEEGASARSGEAFAIPISAVEQMQ
                     VDDQQPINTNQEEDAKVVSEGEEGVSNVERGAAPEPTQAQKIMDLFRSGLDELRSARL
                     SREQVYQIEDMFMDMRRELYEAERRGRG"
     gene            1042186..1044430
                     /locus_tag="MYCTH_2294427"
                     /db_xref="GeneID:11513366"
     mRNA            join(1042186..1042518,1042636..1042991,1043128..1043460,
                     1043690..1044430)
                     /locus_tag="MYCTH_2294427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658495.1"
                     /db_xref="GeneID:11513366"
     CDS             join(1042734..1042991,1043128..1043460,1043690..1044070)
                     /locus_tag="MYCTH_2294427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658543.1"
                     /db_xref="GeneID:11513366"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Spoth2_2294427"
                     /translation="MVGRANKPKELVSTPGLPPQATVTFSEDNSRVRAELPTGESVEV
                     LLYGATVISWKDASGDEKLWLSDAAKLDGSRAVRGGIPVVFPVFSTAPDHPQTKDLPQ
                     HGFARTSRWEFLGKSTSESLVGKAANEPTVKLDFGLSSAAPGLDPKASAHWPFKFNLI
                     YSVTLNQRSLTTSIVAANDDSAPFDCQVLMHTYLRVKDITNVEITGLASAPYFDKVDS
                     ANPHKTQPAEPAAATITGETDRVYTPAGDVTVAEGGVPRYRVTRENFGNVVVWNPWAD
                     KARAIPDFEPKHGFRNMLCVEPGAVAGWQSVESGDAFEGAQTITLLD"
     gene            complement(1044408..1046416)
                     /locus_tag="MYCTH_2294429"
                     /db_xref="GeneID:11508697"
     mRNA            complement(join(1044408..1045559,1045651..1046416))
                     /locus_tag="MYCTH_2294429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658496.1"
                     /db_xref="GeneID:11508697"
     CDS             complement(join(1044641..1045559,1045651..1046144))
                     /locus_tag="MYCTH_2294429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658544.1"
                     /db_xref="GeneID:11508697"
                     /db_xref="InterPro:IPR002480"
                     /db_xref="JGIDB:Spoth2_2294429"
                     /translation="MTTQTTTTSNGQVPDWTPDSWRSKPIKQCPEYPDKAALAKAVSE
                     LKRLPPIVHPREIIELKQHLRDVAQGKAFLLQGGDCAELFDYCEQNAIESKIKLLLQM
                     SLVLLWGANKRVVRIGRMAGQYAKPRSSPMETIDGRQVPSFRGDILNGYHPDERELDP
                     DRLVKAYYHSSATLNYARAAISSGIADLSRPLDWSLGHVRDPVLKAKYEKAVDFLKDM
                     RDFLHTIGAENEKFHTVDLFTSHEGLLLEYEQPLTRLLDDPTAPPSAPRKEYYNTSAH
                     FLWIGDRTRQLDHAHVEYFRGIANPLGVKVGPSTPASDLLALLRTLNPAREPGKITLI
                     TRYGADKVASLLPAHIRTVEDSEYAGTVVWQCDPMHGNTQSVGGGIKTRRFSDIFSEL
                     QQTLRIHKEQGSYLGGVHLELTGDPVTECLGGSEGLAEDDLSTNYTSFCDPRLNEKQA
                     LELAFLIADHYRTERNGNGN"
     gene            1046558..1047662
                     /locus_tag="MYCTH_2294430"
                     /db_xref="GeneID:11508617"
     mRNA            join(1046558..1046935,1047087..1047662)
                     /locus_tag="MYCTH_2294430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658497.1"
                     /db_xref="GeneID:11508617"
     CDS             join(1046666..1046935,1047087..1047191)
                     /locus_tag="MYCTH_2294430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658545.1"
                     /db_xref="GeneID:11508617"
                     /db_xref="JGIDB:Spoth2_2294430"
                     /translation="MAEDRQPADIVEGATADVEDEVQPTAKSAEDRKAAAALSKLDDT
                     RADDEGAAREVDQEAVKNAVSALGGGAGTKKETKAVKVDAADVKLLVDELELPKAKAT
                     ELLKAHDGDAVKAMKAYLQPAF"
     gene            complement(1047876..1051673)
                     /locus_tag="MYCTH_2294433"
                     /db_xref="GeneID:11512964"
     mRNA            complement(join(1047876..1051469,1051530..1051673))
                     /locus_tag="MYCTH_2294433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658498.1"
                     /db_xref="GeneID:11512964"
     CDS             complement(join(1048052..1051469,1051530..1051591))
                     /locus_tag="MYCTH_2294433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658546.1"
                     /db_xref="GeneID:11512964"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2294433"
                     /translation="MSLAAPPAHMATTTLKIEGMTCGACTSAVEAGFKGVDGVGSVSV
                     SLVMERAVVMHDPQRISADRIREIIEDRGFDAEVLSTDLPSPVTPRASFGGHPSDSGP
                     ATMVTTVGIKGMTCGACTSAVEGGFKDVAGVKHFSISLLAERAVIEHDPSLLTGEAIR
                     EIIEDRGFDAEVLESNEKGPEAKAGSEGAKTTPSTATTTVAIEGMTCGACTSAVEEGF
                     RNVDGLVRFNISLLAERAVITHDPTRLPSDKIVEIIEDRGFDAKILSTIFDSLDHGSG
                     ASTAQFRIYGTLDAAAAKSLEEKLSALPGIKSARLALSTSRLTVTHLPNVTGLRAIVE
                     TVESAGYNALVADNDDNSAQIESLAKTREINEWRRAFQISASFAVPVFLISMVFPMCI
                     PALDFGSIRLIPGLYLGDVICMALTIPVQFGIGKRFYVSAWKSLKHGSPTMDVLVVLG
                     TSCAFFFSVMAMIVSILFPPHTRPSTIFDTSTMLISFITLGRFLENRAKGQTSKALSR
                     LMSLAPSMATIYVDPIAAEKAAEGWTSDPNGEDPKQPLDGGAAEEKVIPTELLQVGDI
                     VILRPGDKIPADGVLVRGETYVDESMVTGEAMPVQKTKGSFLIGGTVNGHGRVDFRVT
                     RAGRDTQLSQIVKLVQDAQTSRAPIQRLADVLAGYFVPTILFLGLMTFLVWMVLSHVL
                     PNPPKIFLEDASGGKIMVCVKLCISVIVFACPCALGLATPTAVMVGTGVGAENGILVK
                     GGAALETTTKITQVVLDKTGTLTYGKMTVAKADIAPPWSDTDWRKRLWWTIVGLAEMG
                     SEHPIGKAVLGAARAELGLGPDGTIEGSVGDFAAAVGKGITAYVEPATAADRTRYKVL
                     IGNALFLRQNDVDVPRTAIEASEQTSESRSAKPNNTGTTNIFIAIQGAYAGHLCLSDT
                     IKDGAAAAIAVLHRMGVRTAMVTGDQRGTALAVASAVGIHADDVYAGVSPDQKQAIIR
                     QLQEAGSVVAMVGDGINDSPALATADVGIAMSSGTDVAMEAADVVLMKPNDLMDIPAA
                     LSLARTIFRRIKLNLLWACLYNVVGLPFAMGVFLPFGLHMHPMMAGAAMAASSVSVVT
                     SSLFLKLWKRPRWMDEMEAEMRDGGVVHPRRKRWWAVLGGARELVGGLFGERREKAEG
                     YVPLATLDRESPV"
     gene            1053335..1054890
                     /locus_tag="MYCTH_2294435"
                     /db_xref="GeneID:11508269"
     mRNA            join(1053335..1053555,1053708..1054365,1054715..1054890)
                     /locus_tag="MYCTH_2294435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658499.1"
                     /db_xref="GeneID:11508269"
     CDS             join(1053523..1053555,1053708..1054365,1054715..1054794)
                     /locus_tag="MYCTH_2294435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658547.1"
                     /db_xref="GeneID:11508269"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2294435"
                     /translation="MEQAKALNALEPFLALSKSATSPRAAADLVVRATSAPNTYIFTE
                     LLQTPQIQALALSDEFSPYLTLLRIFCHGTYSSYLSTPGLPELNDAQRLKLRQLSLLT
                     LAKKDGSSSNGASPALDYASLQKALDLPSRQALEELVISAIYAGLIKAQLNPKASRVQ
                     IDSVSPLRDVAPTTISSLLSSLKAWAGRCDATLESLSCQMTQLRAEADRRAARAAARA
                     REVDALVEKEKTAVTSPQGQQAQQSQTSPVAAARRGTK"
     gene            complement(1055108..1057231)
                     /locus_tag="MYCTH_2074663"
                     /db_xref="GeneID:11508149"
     mRNA            complement(join(1055108..1055892,1055949..1056633,
                     1056691..1057231))
                     /locus_tag="MYCTH_2074663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658500.1"
                     /db_xref="GeneID:11508149"
     CDS             complement(join(1055656..1055892,1055949..1056633,
                     1056691..1056860))
                     /locus_tag="MYCTH_2074663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658548.1"
                     /db_xref="GeneID:11508149"
                     /db_xref="JGIDB:Spoth2_2074663"
                     /translation="MADNAPANPPPQSDFPRNRLPTLFEVLSRRTLPPVDLFSFYIYM
                     RDQQRSVDYLDFWLDVAQHMSLCRHYVRELRRSVLVGTPDLDRASKRSSGILEGLGDL
                     SYSAPGPSMYATEKEKDQDARMSAFLREDRELHDSPASSDARQNRPSTNLSTPRELNT
                     DSTSPPHTVARQDIRASAEKILYTFLLPGAEREITLPGSITQDVTTAIEEFGRDDPEV
                     FDVAKDYVFQAMERDAFPGFLRMKALGNLIPPTMVMRLIIGLVSMFGGFWAAFILIFL
                     DKSRMERLWLILPFTIGVYCLASYQYCLDPILALIGLSEYTPFNFSRMREPYVRKLLA
                     RRSVMVLAVTALVDAALCVLFILVPGKRL"
     gene            complement(1058030..1059803)
                     /locus_tag="MYCTH_105650"
                     /db_xref="GeneID:11512848"
     mRNA            complement(join(1058030..1058910,1058961..1059293,
                     1059391..1059604,1059691..1059803))
                     /locus_tag="MYCTH_105650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658501.1"
                     /db_xref="GeneID:11512848"
     CDS             complement(join(1058808..1058910,1058961..1059293,
                     1059391..1059497))
                     /locus_tag="MYCTH_105650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658549.1"
                     /db_xref="GeneID:11512848"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_105650"
                     /translation="MSFAEDGHNAVPGSVQANKLGGARKGAEPGQNAAKRLQTELMQL
                     MTSPAPGVSAFPSADGNLLSWRATIEGPDDTPYSGLTFKLSFEFPSNYPYAPPTVLFR
                     TPIYHPNVDFSGRICLDILKDKWTAAYNIQTVLLSLQSLLGEPNNASPLNGEAAELWD
                     KDPALFKTKVMDRHKDVEDD"
     gene            1060246..1062712
                     /locus_tag="MYCTH_2294445"
                     /db_xref="GeneID:11509077"
     mRNA            join(1060246..1060507,1060589..1062712)
                     /locus_tag="MYCTH_2294445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658502.1"
                     /db_xref="GeneID:11509077"
     CDS             join(1060422..1060507,1060589..1062320)
                     /locus_tag="MYCTH_2294445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658550.1"
                     /db_xref="GeneID:11509077"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2294445"
                     /translation="MQHSQLDPLPRDLPFRIISKTIGRGAYASIKKAIPLDAPSPVFA
                     VKLIHKGYAIRQGRISAKQIAMEVSLHSHIGQHPNIIEWFATGEDAVWRWIAMEFAEG
                     GDLFDKIEADVGVQEDIAHLYFLQLISGVSFMHSKGVAHRDLKPENILLSESGNLKIA
                     DFGMATMFEYKGARKQSSTMCGSPPYVAPEVLQCARQDRKSGDGPKYSADLVDIWSCG
                     VILFVLLVGNTPWDEPTSGSWEFQEYVRTNGRSTDALWGRVPADALSLLRGMMNVEAS
                     KRFSFAQIRQHPWYTRRNPLLTSDGKISDPVALATRMLAGLRVDLNAEPTPSQRQSQP
                     EAMDIDAHPAHDWSSSKLPATQPETPINDVLFDWERPAPRTLLGGTYAISSTQPLATG
                     SSSSSLRTALAGNNNNNPPSSAAAAAAAALEALADEPTMSQFSQTPGVPLSLTQHARQ
                     FRDIVPSYSLTRFFSAVPPSLLVQMLHDALHQLNVPLPPPSRSAAPTDPHHHQHGEHV
                     ATFKVRTLDGRRQGLHGDVLVDRFRLVSSSAGHHGGKEEEEEEGGELELLEVRFVKVK
                     GDPLEWRRFFKKVALLCRDAVYSGDGGNAGGTGVGLERA"
     gene            complement(<1063559..>1065049)
                     /locus_tag="MYCTH_2041072"
                     /db_xref="GeneID:11505593"
     mRNA            complement(join(<1063559..1063623,1063849..1064298,
                     1064530..>1065049))
                     /locus_tag="MYCTH_2041072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658503.1"
                     /db_xref="GeneID:11505593"
     CDS             complement(join(<1063559..1063623,1063849..1064298,
                     1064530..>1065049))
                     /locus_tag="MYCTH_2041072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658551.1"
                     /db_xref="GeneID:11505593"
                     /db_xref="JGIDB:Spoth2_2041072"
                     /translation="DGHPPSRPRPSHGPCYYPPKRRSVDMTVHDDYGPHSLHKRPRYA
                     HHPQFADPVAFKAVDATLSFPHLYHPHPHPHPHPRYPHHPYPSPCARVLSPQAAGTAV
                     AAPALERTASGHSIRPDTTERCASTELLEDHEAAQRVRDHLAAFRRRNPDSKHERILR
                     SIISPRPLPPRRRQYPLDNDALESIFSAANEIFFNGRLSQRVTWDWSHASSARYDSRV
                     IGTTALRRAAAHQRGFETLIVLSSPILRDPRYSRRLLISTFLHELIHCYLFVCCGFRA
                     RGCGGHTQGFRDIAALMDDWIGDGARLYLRRVEADLDLFRIGGRAHRHGRFGVPGNVY
                     PCSGMPADQEE"
     gene            complement(1066642..1069232)
                     /locus_tag="MYCTH_2294446"
                     /db_xref="GeneID:11506055"
     mRNA            complement(join(1066642..1068231,1068315..1069052,
                     1069155..1069232))
                     /locus_tag="MYCTH_2294446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658504.1"
                     /db_xref="GeneID:11506055"
     CDS             complement(join(1066988..1068231,1068315..1069052,
                     1069155..1069197))
                     /locus_tag="MYCTH_2294446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658552.1"
                     /db_xref="GeneID:11506055"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2294446"
                     /translation="MDHLPGEVLLLILSFLEPAEITNLQLVSRGFYNLARDNSFWRAR
                     CLEESTFLENLDRRRRLFGPTGDRESPPRFLSGSGSNGSPDAGAALANNDAKPTTTSF
                     VWKGGETRERERVRIMANWDPCFPSERVSWYDEYVQRHGPIAINWMQYAYEEGRDPSS
                     PASVADMVEARGVALYYPDGEAGEAVLAVSPLDDGSVAMWDVGGTMGKRGALVARSRR
                     GILFVDGPEADNRKRSKRIDSGVTECVSVDSRLHRAFFAVQSRLIEVDLRRLSVVGCE
                     SFPWSITALSAASPTVPLTVGTNLGIHLHDYRARKPRRNDQDEMMDDFDRIGANEFYE
                     RSLRRIFDDEPLPPYAPLSQPGPLSILHLQQPGQEADISDDIYVAGRFSNILHYDRRK
                     FPSIRGSIHSGARLCAMTSLPYPFSTVDSELRRKAALSLEQVEASKTAAGGRTLIACG
                     EYNTKGSLELYGLTPTTASTHSTSAPGGLQNSAFKNRQNCSRSKLMSVVNHGTRIAFS
                     DGSGFIKWFERDGFTEVRRCRIGHSERNTEEPSIFSSMPGSDDIARKLLPTRPAAAVA
                     GGGHEPEGDDGGGGGDSDNNGERRRHSNDLLFWTGEKLGLVTFSARPGFAPEDFEEST
                     ENGDGPEAKALAAAQSEYNEMMRRALERQADDVRFVRNLGLDSGLHPTPL"
     gene            <1070825..>1073962
                     /locus_tag="MYCTH_42476"
                     /db_xref="GeneID:11509164"
     mRNA            join(<1070825..1073258,1073322..>1073962)
                     /locus_tag="MYCTH_42476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658505.1"
                     /db_xref="GeneID:11509164"
     CDS             join(1070825..1073258,1073322..1073962)
                     /locus_tag="MYCTH_42476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658553.1"
                     /db_xref="GeneID:11509164"
                     /db_xref="JGIDB:Spoth2_42476"
                     /translation="MSSKSDGDEDTHTQYWNPTEDAQRTPLSHFKSPRSITPKGPLFP
                     NLGEAHQAITSRLVSRSTTNQPPAAHIEPVPSSSSTSFVNVSSLSDLATGKPDPPSRQ
                     RYLTPCSASASTGADSAKTPTDPSPVVSGLESSSASNSVRDRLNQGAKADPAGLPVSE
                     AGNSMEDIYSYYHKPSPGTEPSGILSNCQSRAAIGAHSDSSHQHNPKENLSRATSKGP
                     RLSPHKPVHSSDNESYSTQKPFDGVQNFSRPVLSLQSVSHPHDWIAVSSNPGEVSRVD
                     STSINLAARNYSAISQSTANPVASDVVVYGRVPPYSCTGSLHDRGYGEAKESHGETSD
                     DLSSDSDEDPFKYDRDSFTVFLQPSREREVSAALRCVSADSAASISGISCHTPSQRPN
                     NTPRVGHTTNPFANRLQRYQTSIVDHDWESGDASNEVKISVRPPKAPPNSPVEAASGV
                     RDHVEGPGSGHDRKNVNTLMSDGADWETVATSVGQFDSNRALASSSGLSGSHLVKVTG
                     SSIADYSDTSSIHVPHFDAFSSTEQILPQQASENMSNTSHPRALNGPGRPVFLPKPRI
                     HRVNGYLQNSRRMFTDTTTGSSANSSRNALVEKLSASIRSRSARKRAQLLQRCSNEQW
                     PKSRFESLESLSSTYSEQPSVTDSAPMASSACEGGSTLVAVNENAGGIVMVRRGKEGR
                     QTQESKRGILASPLAGEPSAGHAKDKQPTDSSHSPRSFDSPTLFSFPLISLQEAARRA
                     ANRSHNDDDRTVTSKGRTHKNSSMVSSKANQKTAPPTPQVTEPMHAHTRRPTSASILG
                     IRATHQDSPVRSQDRIALGCNRVSSYRSGSPLSCGRSALSRTFDPMADSTSQQSIFPG
                     GQQSVFRIRPCLIARDQRNTSRSATVMRTMTADLHRIATATETSRGHTGTNISLRSGH
                     YPLPCRGTVVDDYFFPTDSVNEEAYLSWEARRRRRVCYYAMCVLSAFPFFAPLVYRGT
                     FDSALSWYTRGETGSLTRRQRRNVLVVGVVFAGLWLVVLAVFVTIVVNRRVG"
     gene            complement(1074891..1080034)
                     /locus_tag="MYCTH_2294448"
                     /db_xref="GeneID:11508848"
     mRNA            complement(join(1074891..1075871,1075932..1076857,
                     1076928..1079490,1079565..1080034))
                     /locus_tag="MYCTH_2294448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658506.1"
                     /db_xref="GeneID:11508848"
     CDS             complement(join(1074987..1075871,1075932..1076857,
                     1076928..1079490,1079565..1079876))
                     /locus_tag="MYCTH_2294448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658554.1"
                     /db_xref="GeneID:11508848"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2294448"
                     /translation="MPLRDPNSMLKVLGAGLAVIGLCSVPALGSTVARLTKRDAQQDT
                     YEDGDGKASPESLKAYSARLPKALAVVSAGAGLAISIVLLVISAHAKGQVLTSSLGTA
                     SWALLLFQAIAIASSRNSVQAYDLGLYTFFAATLLAGILLSLGTEIGEDLWHSAPLSF
                     ALRAAELVSSISLAVSTLCIPRRPDVFYQGQLVDRMWTASAFSRFTWSWASDLLALAS
                     KKKDLDLEDLPRPNRFVRAASVSASWRAQKNTGKRLWLALLLAHFKPLALQWFVTLIA
                     SILNFAPQWVILQLLRFLETREPGGGRELDAWMWVVWLGIVIIAQGWVETYVWWLGYA
                     ELQIPVRAQLSALIFEKSMRRKDVKGADDAKKKASEEGNAESSSTAPDQPRPAAEADD
                     SEEHLKKSKQSTVNLIGVDAKRVSDFSAFQNLFPGSLFKLIVSLAFLLDLLGWKALLG
                     GFSAMLAIMPVNIYFSKRYSDAQDRLMKVRDEKMEVVTEALQGIRQIKFSALEPEWQA
                     KIGAVRERELSAVWTVFINDTMLIGCWVTSPILLAAISLAVYAVVHGSLAPSVAFVSL
                     GVFKSLEMTLAVVPELTTDLLDALVSINRIEQYLNSPELEQVSKPADEISFQDASIAW
                     PTDEEVDESERFVLRNINVTFPKGELSVISGKTGTGKSLMLAAILGEVDILGGTLYVP
                     RAPPLSERHDDKAHKGNWIIPNAIAYVAQIPWIENASIKDNILFGLPYDEERYNKTIE
                     VCALKKDLEMLDDGEHTEIGANGINLSGGQKWRVTLARAIYSRAGILILDDIFSAVDA
                     HVGRHIFERCLNGDLAVGRTRILVTHHVALCESKAKFLMELGNGGVLHAGLLSELREE
                     GMLQKIRTHEQTAEEIEADESATAVNSEDSSVREREQDSAVTSTPKNPPVMASEARKF
                     VEEETRERGAVKKHVYMTYLKDSGGFFFWAFALCIYLLVQVFNIGRSWWLKIWTGNYE
                     EQGNYQQHALVGPEDYGYPYTEAVRQSIHAMSAPATSIQGSLTYYLGIYVALALISSI
                     IGTLKYLYVYIGSIRASRKLFEKLNFTILHTPTRWLDTVPLGRILNRYTADFNTIDSQ
                     LASTVGFGANSFLSLLAVVVAGLFLSPYIVLFAIVLLLVCLYYAILYLHGARPVKRLE
                     STTKSPVFEQFGSALTGVTTIRGFDKAPVYVDRMYRKIDDYSASSWHLWLFNRWMGWR
                     MSLVGSFFASFVSIFILLTPGIDSALAGFALAFALDFSSSVMWTIRMYANIELNMNSV
                     ERIVEYTELPTEPLDGQKPPAAWPTEGRIEVNDLVVAYAPDLPPVLKGLNFTVNRNER
                     IGVVGRTGAGKSSLTLALFRFLEARSGSIYIDGLDISKIRLHDLRSRLAIIPQDPVLF
                     SGTIRSNLDPFDRHTDEELRDCLERVHLVPSGASASSSGSATPVGSAAPKNANIFSDL
                     SSPVSEGGLNLSQGQRQLLCLARAIVSRPRVMVLDEATSAVDMHTDALIQRSIREEFT
                     DSTLIVIAHRLSTIADFDRALVLSDGRVAEFGTPRELWEKGESGIFRGMCEESGERDK
                     LRGIIFGDD"
     gene            <1081441..1084345
                     /locus_tag="MYCTH_75762"
                     /db_xref="GeneID:11505954"
     mRNA            join(<1081441..1081569,1081627..1081729,1081807..1082040,
                     1082146..1083250,1083328..1084345)
                     /locus_tag="MYCTH_75762"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658507.1"
                     /db_xref="GeneID:11505954"
     CDS             join(1081441..1081569,1081627..1081729,1081807..1082040,
                     1082146..1083250,1083328..1083916)
                     /locus_tag="MYCTH_75762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658555.1"
                     /db_xref="GeneID:11505954"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_75762"
                     /translation="MKATPLIINWHHDNNNPYPIYSAHFEPNGKGRLATGAGDNNVRL
                     WKIEDDGDGPKVDYLATLAKHTQAVNVVRWAPKGEVLASAGDDGNVILWVRSETHHPT
                     FGSEGLDDKETWRTKHMCRSLGTEIYDLAWSPDASFFIIGSMDNVARIYNAGTGTLVR
                     QIAEHSHYVQGVAWDPLNEYIATQSSDRSVHIYSLRTKDGQYTLHNHDDKPSKLASHA
                     KTDLPPRRIPSSSPAPPDTGYRSVLTAVDSVPGVAAGSPVPSAPGTPTSIALPMNPPS
                     TITHSRRTSFSSRRSVSPAPSMPLPAVMPIEASPKPHHNGMSMGVKNASLYANETLTS
                     FFRRLTFTPDGSLLLTPAGQYQTQHQVEGAKPTYEVINTVYIYTRGGINKPPIAHLPG
                     HKKPSVVVRCSPVVYTLRQSPPVTKNITIDTSSAEEPIPSLPEPLSNPPPGPSVMDPP
                     PAPVSAEASGSTSKPLSLETGVQGQGPKSVFALPYRMVYAVATQDSVFLYDTQQYTPI
                     CVVSNLHCATFTDLTWSSDGLTLLISSSDGFCSTLTFEPGELGTVYTGEIGPPKAPAA
                     NASSQNTPAPTPTSVLAPPSPFPNGSHHRHRDSASSLTAPSPPPPTASFVNQRAASPA
                     RSTSSAASQTGVLSNPPLIAGQVPSIAATNSSKVVGLPVTTPPETPGTSFTGSTGTKR
                     DPAEGETDEASGGKPKRRRIAPTLVTQPSTSGDESKT"
     gene            1084859..1086920
                     /locus_tag="MYCTH_2294455"
                     /db_xref="GeneID:11513326"
     mRNA            join(1084859..1086464,1086576..1086920)
                     /locus_tag="MYCTH_2294455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658508.1"
                     /db_xref="GeneID:11513326"
     CDS             join(1085001..1086464,1086576..1086845)
                     /locus_tag="MYCTH_2294455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658556.1"
                     /db_xref="GeneID:11513326"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Spoth2_2294455"
                     /translation="MLLLDYLQHRRDCRLKQAERARLIASLPPPYHDPLTASDKEALT
                     QPIENLVASVHAGGTATALSVLRTYGKLALKAHARTNCLTEILLPSAESWLSSPPDPH
                     GSGGINLKGPLAGVPVSLKDTVVVGGYDTTVGYSSFTGPGHRAAADGPMVRLLKDAGA
                     VPYVKTNLPITLLSFESTNDVWGRTRNPHNPDYSPGGSTGGESALLALGGRIGIGSDV
                     AGSVRVPAHFAGCYSIRCSTGRWPKSGIATSMPGQEGVPSVYSPMARTLGDLTYFARA
                     VLGAMRPWTYDHTVHPLPWRGEVEAEFADPARKLRVGVLRTDGVVDPSPACARALRMA
                     EDALRRQGCDVVDVRGAPDMYHGLRLASLLLNADGCQMFESFRRPGEWLDPGAAQMRR
                     LAALWAPFRYLYYLWVKYVRRDPVWAGLVRHWRPHSAFENWKLVSQRELYRAAWFEWW
                     NEQGLDVIIAPPNATPAVPHDGMHDAVSSCGYTFLFNLLDYSAGVLPVTHVDRALDQL
                     PASFNLKKLNGVARGAYKHYDAERMHGLPVGVQVVGRRLEEEKVLAVMKRLEDALGDD
                     KYQLMSLDDLD"
     gene            <1087351..>1088424
                     /locus_tag="MYCTH_2054555"
                     /db_xref="GeneID:11508492"
     mRNA            join(<1087351..1087383,1087459..1087561,1087871..>1088424)
                     /locus_tag="MYCTH_2054555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658509.1"
                     /db_xref="GeneID:11508492"
     CDS             join(1087351..1087383,1087459..1087561,1087871..1088424)
                     /locus_tag="MYCTH_2054555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658557.1"
                     /db_xref="GeneID:11508492"
                     /db_xref="JGIDB:Spoth2_2054555"
                     /translation="MADRKDNWSSEAYQNAASFVPKLATKVMQWLDPQKDDVILDVGC
                     GVLDATTLPSAGHLRRGEYTKAFSNAALHWILAPEATREAVFRGVRDALAPGAPFVFE
                     MGGPGNCAEIRAALLSAVARRVGLARARAADPWFFPDEAWVRDMLEARVGGWKVERIE
                     REWRPTRADKGGVDGWVRLMGKKWFEVLPEAQREECIREVVAVLDIVCRQPAGGYMLS
                     YVRLRAVARKV"
     gene            1088787..1090869
                     /locus_tag="MYCTH_2294459"
                     /db_xref="GeneID:11507974"
     mRNA            join(1088787..1088941,1089020..1089529,1089609..1090869)
                     /locus_tag="MYCTH_2294459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658510.1"
                     /db_xref="GeneID:11507974"
     CDS             join(1088909..1088941,1089020..1089529,1089609..1090544)
                     /locus_tag="MYCTH_2294459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658558.1"
                     /db_xref="GeneID:11507974"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="JGIDB:Spoth2_2294459"
                     /translation="MSADDQAFLDVLSSLPNEIQKYSRDVADYIDRHVDQIADTLRDA
                     LAKAQWVPEQFRPRPPPPPPIVTVPVSALERVQNWISRHKILVGLVAVTTGVVAYRTY
                     RSTAQWRKTRRARRSRSGGRMDVVVIAGSPALPLTRSLSLDMERKGFVVFIVCNSHED
                     EIMVQNLARPDIRPLSIDITDPPSAGTSIDAFARYLQAPHAAIPNGKRHHLLLKAVIL
                     IPSLKYQTSPIATIPPSSFADLFNTHLLQPILTIQTFLPLLTTRLSSPSEKERPSPKV
                     LVFTPSIISSINPPFHAPEATVCSALSAFTEVLTAELRPLGIPVTHVQLGSFDFAGFT
                     PAANSRLVQPHGLLAAPEDPEALPWPDSARHAYGKNFVSQSGSAISAGRIRGLRGSSL
                     KELHNAVFDVIDGSITSGTVRVGLGASVYGFVGRWVPRGLVSWMMGIRKVDELATWQG
                     NNGSSAFGSPKSTGSEGAGNGDSFVAVQPLEHAGEANVWREA"
     gene            complement(<1090919..>1091677)
                     /locus_tag="MYCTH_16224"
                     /db_xref="GeneID:11508431"
     mRNA            complement(<1090919..>1091677)
                     /locus_tag="MYCTH_16224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658511.1"
                     /db_xref="GeneID:11508431"
     CDS             complement(<1090919..>1091677)
                     /locus_tag="MYCTH_16224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658559.1"
                     /db_xref="GeneID:11508431"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Spoth2_16224"
                     /translation="AAQLLNHTAPSYTFTFTPFLQRTYQHSLPPDRPVCKAYLSGSCP
                     LKSHCPERHTTPAGHPASQRDGGGGGGGGGGGFGSLVCKHWLRGLCKKGEACEFLHEY
                     NLRKMPECNFFVRNGYCSNGDECLYLHIDPSSRLPPCPHYERGFCPLGPRCDKKHVRR
                     RMCPYYLAGFCPDGRACRLGAHPKWVADGELEKPKEKEEKAKEDGADEREKEGEREKE
                     KEREREREREREREMQREREMDRAGRDRDGERGHD"
     gene            <1092433..>1104807
                     /locus_tag="MYCTH_2122159"
                     /db_xref="GeneID:11508413"
     mRNA            join(<1092433..1092465,1092524..1092659,1092717..1093028,
                     1093101..1093613,1094419..1094670,1094830..1095648,
                     1104773..>1104807)
                     /locus_tag="MYCTH_2122159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658512.1"
                     /db_xref="GeneID:11508413"
     CDS             join(1092433..1092465,1092524..1092659,1092717..1093028,
                     1093101..1093613,1094419..1094670,1094830..1095648,
                     1104773..1104807)
                     /locus_tag="MYCTH_2122159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658560.1"
                     /db_xref="GeneID:11508413"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2122159"
                     /translation="MRGIQLTQYVKAPHELRVTELPDPKPAPDEYLIEVHAAATNFFD
                     ILQIQGKYQHQPPFPWISGAEFAGIVLATPANSKNPKFPVGSRVFGATQGAYATKAVA
                     KETSMLPVPNGWSFKEAAGLFVTAPTSYGALVVRAGVKAGDYVLVHAAAGGVGLAAVQ
                     VAKAFGATVIATAGTERKREVAKSFGADHVVDYRDPKWPEMVKKLTPKGRGVDIVYDP
                     VGMVDKSTKCTAWNGRILIVGFAAGTIEKVAMNKVLLKNISLVGIHWGQYAVHEKETV
                     VAVWQGIMKLIAEGKFRGTEFTDKEYVGLEAVPDALKALGSRETWGKVVVSVPQQVTK
                     QPVPHPQTAKLFASYFRRTLRSSATGLSVAAAATLSQKGTSFYQSEIQTIAKRRMHSK
                     VVIIGSGPAAHTAAIYLARAELKPVLYEGFMANGIAAGGQLTTTTEVENFPGFPEAVT
                     GQELMDKMRKQSERFGTVIISETVSKLDLSKRPFEYATEWDPDTVRTADAIILATGAS
                     ARRLGLPGEDKYWQNGISACAVCDGAVPIFRNKHLVVIGGGDSAAEEAMFLTKYGSHV
                     TVLVRRDRLRASNIMAKRLLNHSKITVRFNTVGVEVKGDEKGLMSHLVVRDVVTGKEE
                     TLEANGLFYAIGHDPATNLVKGQLETDADGYVVTVPGSTLTSVKGVFAAGDVQDKRYR
                     QAITSAAVLSVDEYGAL"
     gene            <1133591..>1134085
                     /locus_tag="MYCTH_2054177"
                     /db_xref="GeneID:11512952"
     mRNA            join(<1133591..1133815,1133852..>1134085)
                     /locus_tag="MYCTH_2054177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658513.1"
                     /db_xref="GeneID:11512952"
     CDS             join(1133591..1133815,1133852..1134085)
                     /locus_tag="MYCTH_2054177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658561.1"
                     /db_xref="GeneID:11512952"
                     /db_xref="JGIDB:Spoth2_2054177"
                     /translation="MANRIRKKSKSKPATSTLYTNYLLTAILSSDSLLTIRPCSPYKS
                     KGLSSYEVSKADSSRYAEYVRNKRSNCNVLGYQKLKDELIAAKEQVLRLWKQKRIWFK
                     KMIRAIARGIDSVEELERVEREEAAAAAVAEASRVTTSSSTLSCLSADFG"
     gene            complement(<1143579..>1143854)
                     /locus_tag="MYCTH_2054788"
                     /db_xref="GeneID:11505955"
     mRNA            complement(<1143579..>1143854)
                     /locus_tag="MYCTH_2054788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658514.1"
                     /db_xref="GeneID:11505955"
     CDS             complement(1143579..>1143854)
                     /locus_tag="MYCTH_2054788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658562.1"
                     /db_xref="GeneID:11505955"
                     /db_xref="JGIDB:Spoth2_2054788"
                     /translation="FIRVYIDNIIIFSKVEEEYLEYLYTIYEILNKAYIHISITKSFI
                     GYLAMRLLRYIINSKGITKTNDRIATFKKLKFLDTLDSLEHYLRMAR"
     gene            <1158521..>1158817
                     /locus_tag="MYCTH_2050200"
                     /db_xref="GeneID:11513297"
     mRNA            <1158521..>1158817
                     /locus_tag="MYCTH_2050200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658515.1"
                     /db_xref="GeneID:11513297"
     CDS             <1158521..1158817
                     /locus_tag="MYCTH_2050200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658563.1"
                     /db_xref="GeneID:11513297"
                     /db_xref="JGIDB:Spoth2_2050200"
                     /translation="LFLKYRYFVKVYIDNIIIFRKTKEEYLEYLYTVYEILNKAYIHI
                     NATKSLIGYLAIRLLRYIINSKNIAKTDDYITTFKKLKFLDTLDSLEHYLRIAR"
     gene            1217406..1218347
                     /locus_tag="MYCTH_2313324"
                     /db_xref="GeneID:11505384"
     mRNA            join(1217406..1217586,1217665..1217748,1217813..1217874,
                     1217928..1218347)
                     /locus_tag="MYCTH_2313324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658516.1"
                     /db_xref="GeneID:11505384"
     CDS             join(1217701..1217748,1217813..1217874,1217928..1218087)
                     /locus_tag="MYCTH_2313324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658564.1"
                     /db_xref="GeneID:11505384"
                     /db_xref="JGIDB:Spoth2_2313324"
                     /translation="MSDRGFTYKGSGVNSQGNHWCSRDYGNGSNSYHYSNQDGSYYYA
                     NPDGSTYYSDGKGGSTYTSPSGYKVYSTGFVSGPSSNDSGSGRSK"
     gene            complement(1218572..1219306)
                     /locus_tag="MYCTH_2294471"
                     /db_xref="GeneID:11509069"
     mRNA            complement(1218572..1219306)
                     /locus_tag="MYCTH_2294471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658517.1"
                     /db_xref="GeneID:11509069"
     CDS             complement(1218599..1219165)
                     /locus_tag="MYCTH_2294471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658565.1"
                     /db_xref="GeneID:11509069"
                     /db_xref="InterPro:IPR013901"
                     /db_xref="JGIDB:Spoth2_2294471"
                     /translation="MANTQDTAPCRLAQATALLLGTLSAGANLTLSAFLVPRLLESPT
                     PLMLRQWVRTYRRGAATVPFAAGLAAAAYTYLYYYLGTRGGGAASASALLRARAYLAA
                     GALTIGIVPYTLAVMAGTNSELKRMERAVGEVAGADAAEVPAGEEEEVVVVEEESAKR
                     LVDWWGVLNLGRGVLLLAGSICGLAATL"
     gene            1219652..1221891
                     /locus_tag="MYCTH_2294472"
                     /db_xref="GeneID:11511700"
     mRNA            1219652..1221891
                     /locus_tag="MYCTH_2294472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658518.1"
                     /db_xref="GeneID:11511700"
     CDS             1219917..1221692
                     /locus_tag="MYCTH_2294472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658566.1"
                     /db_xref="GeneID:11511700"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="JGIDB:Spoth2_2294472"
                     /translation="MSDSDPKPTAAKGAAPTSIPNSTRNPNPTPPNPNPNPNPISTPA
                     PTPTATPSPPIASSSNNGNNSTRSTNIDTNNNTNNAFFQAQQRIAARREAREAAAAAR
                     QATQQSASRLRARIAASQSPLLRRLGTSTLSLWDTLTSREGTRPAFRVGQVDAELLDE
                     ELVELLRGQVREALRYVGGGGGGGGGGGGGGVGSGVAQDWEAEISLALRAVLFKLTVW
                     DHDATYGAALQNLKYTDARRDGPALAPPSRWQKALYGLVTVGGRYLWAKWEDWLLEQD
                     DGFEGPSPRVKRLARWTSALSTLHASAALVSFLVFLLHGRYRTLLDRLLRMRLAPPTS
                     QVSREVSFEYLNRQLVWHAFTEFLLFVLPLVGINRWRRWLARTWRRTKKIMTADADGG
                     AGDKKGEYSFLPERTCAICYRDQNSASSETELLAAASGGVVGSAQTDITNPYEAIPCG
                     CTYCFVCLATRIEREEGEGWPCLRCGELIKECKPWNGDVLEEPQVKSSPATTKTVVFA
                     DDVKAPSDHEEEENEEEEEQQGELGENEGESSQVLVEADPDGGLNDLRPETPSVSSDQ
                     ADDSRGSESEDYEAEEDGLDEDPES"
     gene            complement(1222515..1225857)
                     /locus_tag="MYCTH_2294476"
                     /db_xref="GeneID:11508022"
     mRNA            complement(join(1222515..1223029,1223123..1223941,
                     1224021..1224430,1224511..1224765,1224845..1225080,
                     1225562..1225857))
                     /locus_tag="MYCTH_2294476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658519.1"
                     /db_xref="GeneID:11508022"
     CDS             complement(join(1222953..1223029,1223123..1223941,
                     1224021..1224430,1224511..1224765,1224845..1224945))
                     /locus_tag="MYCTH_2294476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658567.1"
                     /db_xref="GeneID:11508022"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Spoth2_2294476"
                     /translation="MPLLTLLKKQLTKTKLTFHFLFWSLHWGLFAYGWYKQANDARLA
                     GLNTLQYSVWISRGAGLVLSVDGMLILLPVCRTIMRFVRPKIRFLPLDENIWMHRQLA
                     YAMLLFTIIHTAGHYVNFYNVEKTQIRPVTAVQIHYVQPGGITGHVMLFCMLLMYTSA
                     HHRIRQQSFETFWYLHHLFIPFFLALYTHTVGCFVRDTAEPISPFAGEEYWKHCIGYL
                     GWRWELWTGGFYLLERLYREIRAVRETKITRVIRHPYDVVEIQFSKPSFKYKAGQWLF
                     LQVPEISKYQWHPFTITSCPYDPYVSVHIRQVGDFTKALGDRVGAGAAQSKLYEGVDP
                     MGMYEVALQNGQQMPLLRIDGPYGAPAEDVFENEIAVLVGTGIGVTPWASILKNIWHL
                     RNGPNPPTRLRRVEFIWVCKDTTSFEWFQTLLSSLERQSDEAARVPGSGGIEFLKIHT
                     YLTQKLDMDTTQNIVLNSVGADLDPLTELKARTNFGRPNFNKLFTSMRDGILNRTYLN
                     GLEGNMRTTVGVYFCGPSAAARDIKKAAKAATVREVRFRFWKEHF"
     gene            1228879..1232670
                     /locus_tag="MYCTH_2294478"
                     /db_xref="GeneID:11505596"
     mRNA            join(1228879..1229184,1229297..1232670)
                     /locus_tag="MYCTH_2294478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658520.1"
                     /db_xref="GeneID:11505596"
     CDS             join(1229182..1229184,1229297..1232641)
                     /locus_tag="MYCTH_2294478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658568.1"
                     /db_xref="GeneID:11505596"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="JGIDB:Spoth2_2294478"
                     /translation="MGITRRAKDKAARAERAAGGGGQAAPSKPKKATFDTTKKKEIGV
                     SDLTLLRTVSNDAINENLKKRFEGGEIYTYIGHVLVSVNPFRDLGIYTDQVLQSYRGK
                     NRLEMPPHVFAIAESAYYNMKAYKDNQCVIISGESGAGKTEAAKRIMQYIANVSGGGD
                     TGDIQQIKDMVLATNPLLESFGNAKTLRNNNSSRFGKYLQIHFNAQGEPVGADITNYL
                     LEKSRVVGQVTNERNFHIFYQFTKGASQHYREIFGVQKPETYLYTSKSKCFNVDGIDD
                     LAEFQDTLNAMKIIGLTQAEQDSIFRMLAAILWTGNLVFREDDSGYAAVSDQSVVDFL
                     AYLLEVDPASLVHAITIRVLTPRSGEVIESPANVAQATATRDALAMAIYYHLFDWIVE
                     RLNQSLRARQATSNTIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQE
                     EYAREQIKWTPISYFDNKIVCDLIESVRPPGIFSAMKDATKTAHADPAACDRTFMQSI
                     NSMSNPHLTPRQGSFIVKHYAGDVTYTVDGITDKNKDQLLKGLLNLVQGSQNKFLHTI
                     FPVHVDQDNRKQPPSAGDRIKASANALVDTLMKCQPSYIRTIKPNENKSPHEYNVANV
                     LHQIKYLGLQENVRIRRAGFAYRQSFEKFVDRFFLLSPATSYAGEYTWQGSYEAAVKQ
                     ILKDTSIPQEEWQLGVTKAFIKSPETLFALEHMRDRYWHNMATRIQRMWRAYLAYRAE
                     AATRIQRFWRKKRTGAEYLQLREEGHKILQGRKERRRMSLLGSRRFLGDYLGINATTG
                     PGAQVRNGIHLGSNERAVFSCRGEILEAKFGRSSKPSPRILIVTNSKFYIVAQVMGQN
                     GQVQIVAERAIPLGAIKFIGTSTCRDDWFSLGVGSQQEADPLLNCVLKTELFTQMKRV
                     MPGGFNLKIGDTIEYAKKPGKMQIVKVLKDAPGPQDFYKSGAVHTQQGEPPNSVSRPT
                     PKGKPVPPRPITKGKLIKPGGPGGRPSRNPVNRTPQPRPSAASAATSNTTTTATSRPV
                     PQPQPAVSVSIPSHTRQKSNSSAVRAPPPPPPAAPAKPKIMAKVLYDFTGQRDNELSV
                     KAGQIIEIVQKENNGKPFLCLSLPFRS"
     gene            complement(1232671..1233222)
                     /locus_tag="MYCTH_2294482"
                     /db_xref="GeneID:11513248"
     mRNA            complement(1232671..1233222)
                     /locus_tag="MYCTH_2294482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658521.1"
                     /db_xref="GeneID:11513248"
     CDS             complement(1232700..1233035)
                     /locus_tag="MYCTH_2294482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658569.1"
                     /db_xref="GeneID:11513248"
                     /db_xref="JGIDB:Spoth2_2294482"
                     /translation="MAFFLASSASARLPARLGVGVLLLLLSEPFMLMPESRACRPAGF
                     LPATGRLAGGCGAAGLARAATPFAAAAAGGGGGGRGAGAGAGAGSCSSTYAAGTQACP
                     LDVLASHQP"
     gene            complement(1233198..1234960)
                     /locus_tag="MYCTH_2294483"
                     /db_xref="GeneID:11505666"
     mRNA            complement(join(1233198..1233221,1233271..1234960))
                     /locus_tag="MYCTH_2294483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658522.1"
                     /db_xref="GeneID:11505666"
     CDS             complement(1233410..1234870)
                     /locus_tag="MYCTH_2294483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658570.1"
                     /db_xref="GeneID:11505666"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Spoth2_2294483"
                     /translation="MTSLRTGPATAGLHRLYIPAVCALIAFLGYYSQYLFNTDPDLAP
                     GPLTRRETLTFNGLIACVWLTYYRACTVDPGRYRFPRSEQQQQQQHHHHHQPTPEADP
                     RGPHPLLRPTRFCKKCDAPKPLRAHHCRHCGRCIPKMDHHCPWTGTCVSLQTFPYFLR
                     FQLYANVALWYLGALLWRRAAAVWADRRLPAYLGPSLASLAGLTVLTLADAATALPLG
                     LLLVTTVRGWVFNTTLIEDWEVERHEALVSRMVAAASDGDTDPASSSSSSSLSFWADD
                     DAAVRDALARVEFPYDLGVFANMAQAMGTRNVLRWFLPVFGGGPVVNNETPGKGVGWE
                     WEENGFNDLPGLWPPPDPEKMRQARRGPWPGAAAHDQDRRAEAWDAYQTPEEIKAAFA
                     RRQREDQLRRERARALQAGQRSGIIAELEELGGGVVGQPSWTNAEGDRLWDYGVDEEV
                     EEDIMPSRADDENVPLAELIRRRKVRTREGGDDDDG"
     gene            1235319..1238959
                     /locus_tag="MYCTH_2294485"
                     /db_xref="GeneID:11508480"
     mRNA            join(1235319..1235601,1235688..1235743,1235826..1235930,
                     1236034..1236188,1236253..1238959)
                     /locus_tag="MYCTH_2294485"
                     /product="glycosyltransferase family 90 protein"
                     /transcript_id="XM_003658523.1"
                     /db_xref="GeneID:11508480"
     CDS             join(1235576..1235601,1235688..1235743,1235826..1235930,
                     1236034..1236188,1236253..1238799)
                     /locus_tag="MYCTH_2294485"
                     /note="CAZy_ID 267989"
                     /codon_start=1
                     /product="glycosyltransferase family 90 protein"
                     /protein_id="XP_003658571.1"
                     /db_xref="GeneID:11508480"
                     /db_xref="JGIDB:Spoth2_2294485"
                     /translation="MANQLTALSAVTSFAWLAYSIEYHQVIEQPRPSSLLVLLIGALS
                     SYGASFFSVCLPGTNGRFDDERAPLRARRSNLPKKPRRYFLPALVFCVILRLEIFHRV
                     SLDLQCSKQGIEAFLPLLIFLYEFLPGLGPPSGVGDDDREAHDFGMTVYEALGSWFCE
                     SKASLTLAVTMLTVGTYLVSSNDPRSTFFCSSKDASASVVFLQWVGLLLDTAIIIVAW
                     RILAWTRTTKSRLRTLSGILLFAAVGTGLLYQFSRLVLPGTPTRSDFRRLDSLYLFDV
                     VVDGLAFSIFVISTSLLATESSPLSLVGLFTFLLGFTQAVRKTALTGTWENVAPGVVY
                     AGLMLVCVGFSSLLYTNDIRSVAFLHRAFIVLLLVVVTIVATIYTPVKALRITEKHPL
                     TKIMYDARTEADRWLVNAAVSDSLRVAVEEYKDRHHGRDPPAKFDVWYGFAKDRNSVV
                     LDHFPQIEKDLLPFWGMAPSKIREGVRRAAAEPDMAILQIQNGKPRHNLPPSSPYKPV
                     MEDLVELVTTFAEHLPDMELAINLNERPRVLAPWEDVQRLSKTATRKGVSKLLPRASN
                     PLGELPAAQPAAESQELSNPDGFTTSVEAYREMTALACPPGSRGRAGTHWDVRDVCTS
                     CARPQSLGQYLTNWPLSQDICHQPDLFRLHGFHMTPPPLRPLQELLPVFSRAKTDVYS
                     DILIPLRRISEPPEPRTEGFKVKYKRLFWRGKVDRHDTSHELARGGHQERLVHMLNNP
                     SRSETTRLLLPTKDRFMFEQVPTADINELFPMDVAFSSYTACKDSGDDETDNKNKQKI
                     SDNKESCKAIGAEFHTNTDAPPADDPLRHRYVMVIDTDDGPAPEFLRTLRSNSVPFYS
                     SIFREWYSERLMPWIHFVPIDVRYHALHGTMAYFFGLLKRDGRTLNGREVLMYPRQED
                     AQWIAEQGKRWAEKAIRREDMEVYLFRLLLEWGRVIDDNRDEIGFVLT"
     gene            complement(<1240518..>1241839)
                     /locus_tag="MYCTH_98773"
                     /db_xref="GeneID:11509011"
     mRNA            complement(join(<1240518..1240607,1240741..1241312,
                     1241389..1241620,1241678..>1241839))
                     /locus_tag="MYCTH_98773"
                     /product="glycoside hydrolase family 18 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003658524.1"
                     /db_xref="GeneID:11509011"
     CDS             complement(join(1240518..1240607,1240741..1241312,
                     1241389..1241620,1241678..1241839))
                     /locus_tag="MYCTH_98773"
                     /note="CAZy_ID 267908"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003658572.1"
                     /db_xref="GeneID:11509011"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="JGIDB:Spoth2_98773"
                     /translation="MSSSQRKSPVVYTNAVYWPNYRVFHGDSPGQLNYGCINRVYYAF
                     ATVTANGGVFLSNEEADAEVACDGVKGALGSLMHLKQKHTHLQVVLSIGGGASAETFP
                     IVASSPILRDNFARSARGLLDASGLNGIDIVWEYPCTPEQGSDFLALVAAIRIYLPEE
                     HYLLTATLPAVRAVLQNIDLGQAAEYLDTINLAAYDFFGPWSHKSGHQAQLYAMNKDE
                     PSGASGVRDLMSAGVPSRKILLGIPLFGRSFLHVSGPGHKNRGAGGGPDGSFEYSQLP
                     RKGTKEQVDKRAVAAQCVGGDGGFVSYDNPDTVRMKAAFCKQKRLGGLFYWSAPSDSK
                     DPKRSLIATGFKALHSS"
     gene            <1244032..>1244662
                     /locus_tag="MYCTH_2122175"
                     /db_xref="GeneID:11511647"
     mRNA            join(<1244032..1244051,1244148..1244472,1244531..>1244662)
                     /locus_tag="MYCTH_2122175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658525.1"
                     /db_xref="GeneID:11511647"
     CDS             join(1244032..1244051,1244148..1244472,1244531..1244662)
                     /locus_tag="MYCTH_2122175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658573.1"
                     /db_xref="GeneID:11511647"
                     /db_xref="JGIDB:Spoth2_2122175"
                     /translation="MSVEKGRGAETMIGQEQLHHPAVDIWGSGAIHCLTFTRTMRFPL
                     SVWRCGPASLFGPVLAPLTPPHLVVCNTATAVLQPRKVPGKESKDDRDVGSSGPSWLV
                     PRPLLGTDPFSGPPGQPTQLPAQNVLKKKPYRRLARREHPVSSFHVAENDHTGNGQ"
     gene            1246030..1247791
                     /locus_tag="MYCTH_2294490"
                     /db_xref="GeneID:11508140"
     mRNA            join(1246030..1246744,1246810..1247791)
                     /locus_tag="MYCTH_2294490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658526.1"
                     /db_xref="GeneID:11508140"
     CDS             join(1246307..1246744,1246810..1247709)
                     /locus_tag="MYCTH_2294490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658574.1"
                     /db_xref="GeneID:11508140"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Spoth2_2294490"
                     /translation="MADNNETGSDAQITFKVKSSNDKTHTITMDESATVLDLKNKLAG
                     ADFEDIPADRQRLIYSGRIMKDSDALSVYKIKNMNTIHMVKSARSNAQPAASGSSSTP
                     TPAAVPQNMAAGSVAGDPLAGLTGARFAGHANLPSADLFGADGGMGAPPSEDQLADML
                     SNPMIAQTMNEALNNPNFIDMMIRTNPALAAMPNAREMLQSPYFRNMMTNPEAIRMAA
                     RMRRVLQGGGGSAFPAPGATDNTPADAPGSGNAATTGNNNNNNNNNNDDPLRALFGAA
                     GDAGNAPSGFPLASLLGMMPPAFGSATPGAAGQAAPANPPQSPSSTENRDAPAAGANT
                     QGQAGSTTQPAANPFAALFGGAAPGANANNPFGLPPISPEALQQMAQLLGLGGAGAAP
                     AAPPDNRPPEERYAEQLRQLNDMGFYDFDRNVTALRRSGGSVQGAVEYLLSNP"
     gene            1248786..1249857
                     /locus_tag="MYCTH_2294493"
                     /db_xref="GeneID:11509059"
     mRNA            join(1248786..1249055,1249287..1249857)
                     /locus_tag="MYCTH_2294493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658527.1"
                     /db_xref="GeneID:11509059"
     CDS             join(1249037..1249055,1249287..1249630)
                     /locus_tag="MYCTH_2294493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658575.1"
                     /db_xref="GeneID:11509059"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="JGIDB:Spoth2_2294493"
                     /translation="MALYGGVVFGPAAATWFRLLSRHVNLRSPTATMLARVACDQGIF
                     APTFIGVFLGSMAVLEGGSPRDKLARSYKDALLTNWAIWPFVQMVNFKLVPLQHRLLF
                     VNVISIGWNCYLSYLNSS"
     gene            complement(1249859..1251931)
                     /locus_tag="MYCTH_2294496"
                     /db_xref="GeneID:11508549"
     mRNA            complement(join(1249859..1250173,1250253..1251931))
                     /locus_tag="MYCTH_2294496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658528.1"
                     /db_xref="GeneID:11508549"
     CDS             complement(join(1250111..1250173,1250253..1251668))
                     /locus_tag="MYCTH_2294496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658576.1"
                     /db_xref="GeneID:11508549"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="JGIDB:Spoth2_2294496"
                     /translation="MASVQNAPQEPTAQQLSELKEKYTLAGQSQVFTFYDSLSSAEKA
                     ALYQQLSQFDPTYINTIAAKALAPPQAQDAAPSLEPLPDSARASIMDSAPADIDRWYS
                     QGLDLIAANKVAVVLMAGGQGTRLGSSEPKGCFDIGLPSAKSLFQIQAERIRKVEQLA
                     AKKAGTGAGVTVPWYVMTSGPTRGPTERFFKEHNYFGLKPENVFIFEQGVLPCISNDG
                     KILLESKAKVAVAPDGNGGLYNALVEAKVLDDMKRRGIEHIHAYCVDNCLVKVADPVF
                     IGFSASADVDIATKVVRKRNATESVGLIVSKNGRPDVVEYSEIDPQIAAEEDPQQPGV
                     LKFRAANIVNHYYSFRFLESIPTWVKTLPHHVARKKIPYADLESGETIKPAKPNGIKL
                     EQFVFDVFPKLELSKFACLEVRREDEFSPLKNARGTGEDDPDTSKHDIMAQGKRWLQA
                     AGATVVSEDPNAGVEVSPLLSYGGEGLESVTGKTITAPTLLE"
     gene            <1252571..>1253665
                     /locus_tag="MYCTH_2019108"
                     /db_xref="GeneID:11508971"
     mRNA            join(<1252571..1253420,1253457..>1253665)
                     /locus_tag="MYCTH_2019108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658529.1"
                     /db_xref="GeneID:11508971"
     CDS             join(1252571..1253420,1253457..>1253665)
                     /locus_tag="MYCTH_2019108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658577.1"
                     /db_xref="GeneID:11508971"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="JGIDB:Spoth2_2019108"
                     /translation="MGADITEDTRPPPTFQGRLQLESFMFKAGFATAGLRRSLRLSSA
                     SSSSAAALPVPPPRRASRSPSKRKADPPDEDDLKEEDTSSPSTPAATSTTSITSTISA
                     TATATATVTVTRSPSRNNRSKRARVPSSYAPPSAYAHLPGLPDALAPNLLVLFVGLNP
                     GIETARTGHAYAHPTNLFWRLLHSSGVTPRLCAPAEDRQLPARYALGLTNIVARPSRN
                     GAELSRAEMDAGVAVLEAKIRRWRPEAVCLVGKSIWESVWRVRHGRPIRPAEFRYGWQ
                     DERENMGQEEEEEEEEEEKEEGVVYDPDWKGARVFVATSTSGLAATLKPKEKEEIWKE
                     LGDWVVKRRAERAAAGDSV"
     gene            complement(1253937..1255533)
                     /locus_tag="MYCTH_2294498"
                     /db_xref="GeneID:11505930"
     mRNA            complement(join(1253937..1254602,1254919..1255533))
                     /locus_tag="MYCTH_2294498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658530.1"
                     /db_xref="GeneID:11505930"
     CDS             complement(join(1254077..1254602,1254919..1255169))
                     /locus_tag="MYCTH_2294498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658578.1"
                     /db_xref="GeneID:11505930"
                     /db_xref="JGIDB:Spoth2_2294498"
                     /translation="MRLTSFFLAAALLSDAALGALGAPPPVDLAKPQSVQIHERDEAA
                     PEELWKRKGGGGGGGRGGGGGGRGGSSGSGGGRGSSGSGSNPSRPVPAPAYGGGRFYG
                     GGAATPYRAGSRSPSGIVPVFFAASALAFWPGLWLYGAHIYRFDDEYEFFNVTSQRTE
                     SKPVECACAQNADCGCDENRDKDYLDDLIGNGSYAALNKTLVNVADVNGTSTILVNGT
                     LPDGTAALAGNAAGGGLRALLHHAGWWPVVATVCAIVLTA"
     gene            1256192..1257988
                     /locus_tag="MYCTH_2294499"
                     /db_xref="GeneID:11508904"
     mRNA            join(1256192..1256548,1256690..1257988)
                     /locus_tag="MYCTH_2294499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658531.1"
                     /db_xref="GeneID:11508904"
     CDS             join(1256454..1256548,1256690..1257905)
                     /locus_tag="MYCTH_2294499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658579.1"
                     /db_xref="GeneID:11508904"
                     /db_xref="JGIDB:Spoth2_2294499"
                     /translation="MPSSQPPGSDRSLLDRLNALKPTSITFDKSANPASATGPGTRPE
                     SKEDALTARLRVLRSQTSGEKPGEGAPQTQGRGQQPGRPDDAVRDGAGTAASPLVDQA
                     GTQPSSVSPKGHRSPKQNKFSYQIADSQADDEEAVDELLEALADEDFELAAAEDEEPA
                     PRQSRDDEAERVSDLLRSLQHDAGASTPQGSNPPSADDSDHSDGEQMTRAVETVLSQI
                     RDEIRSLPPPGATLAKQDDNQLAEDCQQKSGEVESAESERGAGLQAPAGWAADRPGDR
                     DEDGGGGGDGDEPSFTLPAVPSQLPDPATTTTTTTTTRMATDGGGDDFEKDISARLAS
                     LRGFGSLDALGLPSAPTFRPQDRHGQSSSVPVGKNLLRPSRYTDEDQKTWCIVCLEDA
                     AIRCIGCDNDVYCARCWKEMHVGPSAGYDERGHQWVKFERNAPR"
     gene            complement(1258289..1260599)
                     /locus_tag="MYCTH_2313329"
                     /db_xref="GeneID:11509132"
     mRNA            complement(1258289..1260599)
                     /locus_tag="MYCTH_2313329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658532.1"
                     /db_xref="GeneID:11509132"
     CDS             complement(1258513..1260354)
                     /locus_tag="MYCTH_2313329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658580.1"
                     /db_xref="GeneID:11509132"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="JGIDB:Spoth2_2313329"
                     /translation="MASEGLLQTSLIWVAYAVAIVLVLIVSVITTLTWQTPHERSVAV
                     STVSVLSLTALLATVFLLPVDIALVSSTSSAHLGAKKDWATPERVEGILLTLKIVYYT
                     LYTLDALLCLVVIPFTYFWYEEYDEVEEEEGTSSPGKRLWRAFKYTLGFVFLVVVLFL
                     IGFFVPAAGRDAGRHVDLDYFKRLLAENNGEKALTFGVGLLMTLGTLLYVVYTGSGLA
                     LLPISFIKSAPSISAPQLSATTASALERNRELQRQLEMRNAGRPGGMSQKDRREMDAL
                     LREERTLVRRERLAAEARGDGRGRIYRAWTKVQAVFRPLKLLGGILLLLVALLVWVSM
                     LITGIDKAANSVCKQHCGYILGHLNVFQPANWILVQSARVFPVDYVLTALLVLLFFSS
                     SVTGLAAVGIRFLWVRVFQLKKGRTAPQALLVATVLLALTVLAINYAVAMLVAPQYAT
                     YGTQTFCVASGSGVLVPSRADCRGHPDMVRPCSELAREPSARDVCTPTVVSTFLNRVT
                     LGWPVFGAVAFWAQFAFLAVFLVVFATSLFRTPRLDLSELDEEAEVDEEEGLLASTRR
                     RFGATWGDITGRASGTAGAGGQNEEGGAGYGTVGSGSGNGNGSRSRT"
     gene            1261025..1266383
                     /locus_tag="MYCTH_2294503"
                     /db_xref="GeneID:11505599"
     mRNA            join(1261025..1263326,1263386..1263702,1263770..1263943,
                     1264037..1265279,1265402..1266383)
                     /locus_tag="MYCTH_2294503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658533.1"
                     /db_xref="GeneID:11505599"
     CDS             join(1261136..1263326,1263386..1263702,1263770..1263943,
                     1264037..1265279,1265402..1266120)
                     /locus_tag="MYCTH_2294503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658581.1"
                     /db_xref="GeneID:11505599"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="JGIDB:Spoth2_2294503"
                     /translation="MQCYTELTPPTAVTHSTTLQFIPGQGTNLVVAKSSLLQIFRTKI
                     VATELDASQTGIGGNRARSAAQYESRLANDDDGLEASFLGGDSLGLRTDRANTTKLVL
                     VAEFPLAGTVTGLARIRTPKANRNHDGGAGHAGHAGHGCDSLLIAFRDARLSLVEWDA
                     EQHTLSTISIHYYEQEELQGSPWAAPLSHYVNFLVADPGSRCAALKFGARNLAILPFR
                     QADEDIDMGDWDEELDGPRPAKDPSSNAVVNGASNIEDTPYSPSFVLRLSNLDPSLLH
                     PVHLAFLHEYREPTFGILASATAPSNALGRKDHLVYMVFTLDLQQKASTTILSVSGLP
                     QDLFRVVPLPAPVGGALLVGSNELIHVDQSGKPNGVAVNPMTRQCTNFGLVDQSDLNL
                     RLEGCAIDVLTPDLGELFVVLNDGRAAVVTFRIDGRTVSGLEIKMLPESAGGSLIPGR
                     VSTLSRIGRNAVFAGREEGDSLLLGWAKRQAQTGRRRLRARDAAGSGDVDAEGAELAE
                     GDEDVVAEGEDEDEDEEDEDDLYGEESAPRQQPVSAASSFLSGDVSFRVHDRLLSVAP
                     IQALTYSQPVYLAGSEEERNSAGVRSDLNLVCTVGRDKSAALATVNLAIQPRVIGRFE
                     FPEARGFWTVCAKKPVPKSLQGDKAGNSLSKDYDTAGQYDRFMIVAKVDLDGYEKSDV
                     YALTAAGFEGLGGTEFDPAAGITIEAGTMGKGSRIIQILKSEVRCYDGDFGLSQIVPM
                     LDEETGAEPRAVSASIVDPFLLIIRDDSSAFIAQVDSSNELEELDKEDPTLASTKWLT
                     GCLYADTTGAFAEEAPGKGGKLSQSVLMFLLSASGALHIYRLPDLSKPVYVAEGLSYI
                     PPGLSADYSARKGTAKETIAEILVADLGDMTHKSPHLILRHTNDDLTLYQPFRYNTGA
                     GLEFSKTLFFQKLPNTVFAKSPEEADDDEATHQPRFLSMRRCANVGGYSTVFLPGASP
                     SFIIKSSKSVPKVLPLQGTGVIAMSPFHTEGCEHGFIYADSRDMARVAQLPQDWSYAE
                     LGLAVRKIPIGEDIAAAAYHPPMQSYVVGCNTPEPFELPKDDDYHKEWARENLAFKPT
                     VDRGNLKLVSPITWTVVDSIQMEPCETVLCVECLGLEVSEFTNERKQLIAVGTAITKG
                     EDLPTRGRVYVYDIADVIPQPGRPETSKKLKLIAKEDIPRGAVTALSEIGTQGLMLVA
                     QGQKCMVRGLKEDGSLLPVAFMDMSCYVTAAKELPGTGLCLMADAFKGVWFTGYTEEP
                     YKMMLFGKSATRLEVLNADFLPDGKELFIVVSDADGHIHILQFDPEHPKSLQGHLLLH
                     RTTFNTGAHQPTKSLLLPVTTPADQERDRKPADPSSSFSSSSSSSPSSPSSPFFPSTS
                     SSNHQNQNQTQSREQATKKDQQANGGGAAAALTSPRPHVLVLAAPTGVLAALRALPES
                     AYRRLSSLAAQLAGSLPHAAGLNPRGYRLPDGVASSSSPWSSSSSSFSAVVPGVDAGV
                     GRTIVDGALLQRFTELGMARRVELAGRAGYAGGVAEVRAELEAVLGWAGLSYF"
     gene            complement(1266466..1268991)
                     /locus_tag="MYCTH_2294504"
                     /db_xref="GeneID:11513320"
     mRNA            complement(join(1266466..1267201,1267289..1268254,
                     1268929..1268991))
                     /locus_tag="MYCTH_2294504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658534.1"
                     /db_xref="GeneID:11513320"
     CDS             complement(join(1266806..1267201,1267289..1268254,
                     1268929..1268973))
                     /locus_tag="MYCTH_2294504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658582.1"
                     /db_xref="GeneID:11513320"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="JGIDB:Spoth2_2294504"
                     /translation="MEGRSSHGISINKQCASDYILGPLYDPEPSQVCAIHPAPSTVYP
                     DHPSQAHKETAVDNSDDDELPFSRRVLGRRASSVKRKPLPPSVVRSQYPPLSSLERKR
                     SLYTASPPTTRWNQGTILVRANSVSSPKPGVDAMAALGDQNVSRRRATSLAARYPDDR
                     SHPPPAMLTNERRAKDGGQETRPRRASSLRERYPGDMSHRPLAMLTREFRAADRAPHL
                     HNRHRQQPHDTIDALDVTGPVPGVYHHGGPFDAAMKARNLDKKYAPLEAVRSTNIEAL
                     KATPSEFVKDSLVKHVPLQGTAIIPPGMRDFSGCTMQYEEGADLMREEDAEGGPYKRW
                     DHIRYRDDDLKGKGEPSFSQDQARRRKASNAFHSGSGNVYYEMRSRGQGNRGNDGGDS
                     RPKEGGTAHVRQRSLSANGAYQRLPPGIVDDGDDDGYGGGSSGLGSSNTTGKNIAQSL
                     KRRFGSLRKKRAGDEAGS"
     gene            <1270105..>1271157
                     /locus_tag="MYCTH_14609"
                     /db_xref="GeneID:11508109"
     mRNA            join(<1270105..1270353,1270429..1270674,1270834..>1271157)
                     /locus_tag="MYCTH_14609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658535.1"
                     /db_xref="GeneID:11508109"
     CDS             join(<1270105..1270353,1270429..1270674,1270834..>1271157)
                     /locus_tag="MYCTH_14609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658583.1"
                     /db_xref="GeneID:11508109"
                     /db_xref="JGIDB:Spoth2_14609"
                     /translation="LPPLPPAFHDLYASTVRTAPRDDPALHQGRTRQIPHVPGLWPSH
                     VYVEWRPAPPVHALLCELLAALQQQQQQQQQVELQLPQDSDVGVPQPLHVSLSRPLAL
                     STEQKAQFLSELEAALAGGGGGGGGGQGGGGGRRRRVTSFSLRCSRVEWHRTAESGRS
                     FLVLREEEGEEGNVNPELTELLRRCNEVAERHGQPALYRWAEEGAVDEADKRIGEAFH
                     VSIAWSFAEPTEELVRATERVFGSQEIIDKIREIEIPVEGVKVKIGNVVTHVALE"
     gene            complement(1271297..1274173)
                     /locus_tag="MYCTH_2313331"
                     /db_xref="GeneID:11505431"
     mRNA            complement(join(1271297..1271724,1271812..1273478,
                     1273621..1274173))
                     /locus_tag="MYCTH_2313331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658536.1"
                     /db_xref="GeneID:11505431"
     CDS             complement(join(1271616..1271724,1271812..1273478,
                     1273621..1273737))
                     /locus_tag="MYCTH_2313331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658584.1"
                     /db_xref="GeneID:11505431"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="JGIDB:Spoth2_2313331"
                     /translation="MMKSASRLFYLSVFALWGPQVWCHNPESVSSPSSQDDCAISPKA
                     IVGDACASYSTLERLNRNVKPALDELTRTTDFFSHYRVNLFHKKCPFWNDENGMCGNI
                     ACAVETLDNEEDIPPVWRASELGKLEGPRAKHPGKSMQKEEPVRPLQGGLGENVGETC
                     VVEYDDECDDRDYCVPEDESATSKGDYVSLLRNPERFTGYAGDGAKQVWDAIYRENCF
                     QRSSFPHSAALGKDTSPKGPAAMDFKAVLEAAGRQQALEEQRQHNPLTPFVAKTGYEH
                     EDECLEKRVFYRVISGMHASISTHLCWNFLNQTTGQWQPNLGCYLNRLHKFPDRISNL
                     YFNYALLTRAVAKLGPYLSQQQDYTFCLGDPEQDAVTRTKVMAVTERAASVPQTLDES
                     LMFKNGEGPSLKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQTAGYGTALKVLFEFDNN
                     DPPSVPVLKRTELVALFNTYARLSNSLEAIQKFRKMVEQPETETETETETEAEAAAAD
                     KFEERLKEAAKTSVIPDRAKKPRHAVGPPESPHAVPSGPVNEARDKDDDSSVYENRTL
                     KEEFDDELDKVIRTLKFVLTRWVTFPATLWHIVTCELRRLWQSFIGLPVSPRTWTFEA
                     PRVDEL"
     gene            complement(<1275241..>1275758)
                     /locus_tag="MYCTH_44554"
                     /db_xref="GeneID:11506019"
     mRNA            complement(join(<1275241..1275271,1275341..1275399,
                     1275451..1275595,1275655..>1275758))
                     /locus_tag="MYCTH_44554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658537.1"
                     /db_xref="GeneID:11506019"
     CDS             complement(join(1275241..1275271,1275341..1275399,
                     1275451..1275595,1275655..1275758))
                     /locus_tag="MYCTH_44554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658585.1"
                     /db_xref="GeneID:11506019"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="JGIDB:Spoth2_44554"
                     /translation="MGIDISRRNRVPRPVTEEERARLDEFIDSIHYSTRYSDNEFEYR
                     HVQLPKAMLKAIPPEYHDKSKGTLKLLWEDEWRGMGITQSLGWEHYEVHEPEPHILLF
                     KRPLNYQPPQ"
     gene            1276981..>1279570
                     /locus_tag="MYCTH_105669"
                     /db_xref="GeneID:11508446"
     mRNA            join(1276981..1277075,1277324..1277424,1277478..1278152,
                     1278219..1278477,1278545..1279055,1279143..>1279570)
                     /locus_tag="MYCTH_105669"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658538.1"
                     /db_xref="GeneID:11508446"
     CDS             join(1276989..1277075,1277324..1277424,1277478..1278152,
                     1278219..1278477,1278545..1279055,1279143..1279570)
                     /locus_tag="MYCTH_105669"
                     /note="Bromodomains are found in many chromatin-associated
                     proteins and in nuclear histone acetyltransferases. They
                     interact specifically with acetylated lysine."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658586.1"
                     /db_xref="GeneID:11508446"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Spoth2_105669"
                     /translation="MDHKRKASSSGAGIADGDDRATKRLKTPGQPSDYNLLQGETRES
                     TTAYGLHFLETIRRTKDKSGRLVASYFENLLPRETNKEYYERIRMPISLKTIERKLHN
                     QDFKNLSELESYFKRMVTNAKEFYPKNSEVFEDAERVRKALSNYMTKTNPAYKLIPGY
                     SCQATPIPNDLQPEPEVAALTATAERTEAENQKAGNQDAEGEEDAQGEEDADGEEDED
                     EDDGSSRRIVLKRKGPGRPARAGSEQARKLDKSGRVKADHEYEGVPYKGLTFQQAQEK
                     IVEELIRKPDESGDPYFLDFINLPPRSYKDYFAVITSPLSLKGLQKLVKGIHGRQPAT
                     GVSDFKSWAAFEEKASLLWTNAHFYNEEGSVIHTLATELKNCFEAELNEAKAVVQEPP
                     QPKIKLKMTPGQETPVLGSKKITIHVGGSRSSTAAPSPAPPTGRSGDSGGTDGNRALP
                     PANTAAAGFQGDSAKTVPGAVASPRPAVAGAQQAAGPNGNVPGAVNGTDGAGAPGQSF
                     QQPPPGQQLQNGHAQSGPTPAPAPPIYDFKYRAPGRGVADALLPSVLIRTHPTLVIDP
                     KFRLEIPAHPKEAHQNLTTHIPATHSRLQLIPRLAPFEQQGRQYRMFVTVNGQTIGRA
                     PPVPADDDPLPPNPIVFDLVLQPVTNIIAVTVIASLPKGQRLPNGADCEVEKLVLNVQ
                     LLRV"
     gene            1281110..1282851
                     /locus_tag="MYCTH_2294518"
                     /db_xref="GeneID:11511625"
     mRNA            1281110..1282851
                     /locus_tag="MYCTH_2294518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658539.1"
                     /db_xref="GeneID:11511625"
     CDS             1281467..1282669
                     /locus_tag="MYCTH_2294518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658587.1"
                     /db_xref="GeneID:11511625"
                     /db_xref="JGIDB:Spoth2_2294518"
                     /translation="MLTPEFWPRVDQLTLQITVLLLPLVDLMDEHFPASQAASLRSFY
                     QDLHAIVARAGYLSLGIRLSKNIFHFSSPVPGTVWDNDQANVDNRIYRASEAANTRAD
                     AAAEKEWRSRRARRLAAQRERREIRDRGAGVLASARSGFEAVRGFVTGHGQEEGSGDH
                     QQGANDVWRRPSRMGKVQIVLWPMLQRFATVGEIDPRTGTAYGESITTISKSRVVYYY
                     GRVDERGEVGDRSPSLAEWVRKTDRRRARIAFLPLRWAAYIAGIWLLLAFLAGNDPTA
                     ADGLLRHVGHVPAEVARYLVREAALFVMEVFITVIAIFIASSRMLMYFASSARSSLDG
                     LLEDGQRWLLGSVGGVDRRGTLENSTTGHGSAFNRDDLSWASVKDVAKALAEQLIWYV
                     HPPPSSSP"
     gene            complement(1283427..1285343)
                     /locus_tag="MYCTH_2294520"
                     /db_xref="GeneID:11508498"
     mRNA            complement(join(1283427..1284724,1284843..1285343))
                     /locus_tag="MYCTH_2294520"
                     /product="SWD1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658540.1"
                     /db_xref="GeneID:11508498"
     CDS             complement(join(1283653..1284724,1284843..1285201))
                     /locus_tag="MYCTH_2294520"
                     /note="Contains conserved domain WD40[cd00200], WD40
                     domain"
                     /codon_start=1
                     /product="SWD1-like protein"
                     /protein_id="XP_003658588.1"
                     /db_xref="GeneID:11508498"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2294520"
                     /translation="MNLLLSDDYLLQDYPENITNTIRSGHSTCVRFNRKGDFLASGRV
                     DGTVVIWDLETMGVARKLRGHSKNITSLSWSRCGRYLLSACQGWKVILWDLQDGKRYR
                     EVRFRAPVYGAELHPWNHHQFAAALFEDQPMLVDITEPVEVRYVLPSVPKRTSTETDP
                     ALREKQAKEDAKHMTTAIVYTASGDHLLAGTTKGRLNIIDARTREIIYSEKIASGIIT
                     TLRLTESGRELLVNAQDRIIRTFIVPNLSAADLDPDTIQLPLEHKFQDVVNRLSWNHV
                     AFSATGEYVAASTYNNHELYIWERGHGSLVRMLEGPKEEQGVIEWHPHRALLAACGLE
                     TGRINIWSVTTPQRWSALAPDFVEVEENVEYIEREDEFDIHPQEEIQKRRLDQEDEEV
                     DVLTVENGGGMDEDLGAFRMPILFNLGESDSEEEFVNVSLGTLRRKSPGDQDEGDMTG
                     EERGSGKRGGGGGGGGGSGRGRGRKK"
     gene            1285591..1287196
                     /locus_tag="MYCTH_2294522"
                     /db_xref="GeneID:11508348"
     mRNA            join(1285591..1285709,1285777..1285866,1285928..1286059,
                     1286132..1286176,1286303..1286475,1286531..1286619,
                     1286676..1286780,1286844..1287196)
                     /locus_tag="MYCTH_2294522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658541.1"
                     /db_xref="GeneID:11508348"
     CDS             join(1285696..1285709,1285777..1285866,1285928..1286059,
                     1286132..1286176,1286303..1286475,1286531..1286619,
                     1286676..1286780,1286844..1287062)
                     /locus_tag="MYCTH_2294522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658589.1"
                     /db_xref="GeneID:11508348"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="JGIDB:Spoth2_2294522"
                     /translation="MANSKFEYVKQFEQTDNLLPNTWIVVRIDGRGFTKFSAKYAFEK
                     PNDKRALELMNAAARAVMAELPDITIAYGVSDEYSFVFHKSCSLFERRASKLISTVVS
                     TFTAYYIHLWPVHFPDTPLSPPLPSFDGRAVCYPTVQNLRDYMSWRQVDCHINNLYNT
                     TFWALIQLGGLDATEAEKTLKGTYAADKNEILFSRFGINYNNEPEMYKKGSVVFRDYE
                     LVEPGTHNTTAEVDNLAEPVQQSKTQTENDKKRRAKARIVVQHLDIIKDDFWDRRPWL
                     LSNKPGKVPKEP"
     gene            complement(1287197..1288301)
                     /locus_tag="MYCTH_2294523"
                     /db_xref="GeneID:11508051"
     mRNA            complement(1287197..1288301)
                     /locus_tag="MYCTH_2294523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658542.1"
                     /db_xref="GeneID:11508051"
     CDS             complement(1287331..1288059)
                     /locus_tag="MYCTH_2294523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658590.1"
                     /db_xref="GeneID:11508051"
                     /db_xref="JGIDB:Spoth2_2294523"
                     /translation="MDAAALLKAQGWRGKGFSLHPTNNAIGLSKPLLISRNTDGRGIG
                     QNKHYTSDQWWLHAFDQKLKGLDTSKKGTVVQSVTQGKLDAVASSQPKGKYTGARGLY
                     ASFVRGGMLEGTIEVNVVADGAATTGTATGESTDATPATSDDGRSEESVSKKEKQSES
                     REERKARRAARRLRKAEKAARKAAEARAAQKAAEKAAKKELKRARKASETKEERRARR
                     AERRARKEERRRKRAEAAQKADQG"
     gene            1288880..1294633
                     /locus_tag="MYCTH_2294525"
                     /db_xref="GeneID:11508094"
     mRNA            join(1288880..1289358,1289423..1294302,1294374..1294633)
                     /locus_tag="MYCTH_2294525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658543.1"
                     /db_xref="GeneID:11508094"
     CDS             join(1289002..1289358,1289423..1294302,1294374..1294401)
                     /locus_tag="MYCTH_2294525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658591.1"
                     /db_xref="GeneID:11508094"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="JGIDB:Spoth2_2294525"
                     /translation="MANLIFAHSSAPIREIKEIQFGLLSPEEIKGMSVCHIVYPETMD
                     ETRTKPRDGGLNDPLLGSVDRQFKCKTCTENMTECPGHFGHIELARPVFHPGFIRRTK
                     KLLEMVCHNCSKVLADRSDPQYAAAMRIRDPKVRFKRVWDICKSKRRCDNDPPKQAED
                     GEYNLNGTGDRPVEGHGGCGNIQPVIRQQALTLWGSIETKDEDGVKTKEKKIITPEMA
                     LNIFRRMSDEEMIDIGINISQARPEWMIITVLPVPPPPVRPSISMDGTGTGLRNEDDL
                     TYKLGDIIRANGNVRQAIAEGSPQHIITDFENLLQYHVATYMDNDIAGQPQALQKSGR
                     PVKAIRARLKGKEGRLRGNLMGKRVDFSARTVITGDANISLDEVGVPRSIARTLTYPE
                     TVTPYNIAKLTKLVQNGPNEHPGARFVVRSDGTRLDLRHHRRATGIQLEYGWKVERHL
                     MDGDYIIFNRQPSLHKESMMGHRVRVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQT
                     EETRAEVKELCMVPLNIVSPQRNGPLMGIVQDTLAGVYKLCRRDVFLTKEEVMNIMLW
                     VPDWDGIIPLPAIHKPRPRWTGKQIISLIIPSIINIHMPSEQQDKDHPFEDDGLLIQQ
                     GELMFGLLSKKSVGASGGGIVHLCYNELGPQGAMDFLNGCQRVVNYWLLHNGFSIGIG
                     DTIPDEVTIGLIQKHINDEKAEVARLTQQATNNELEPLPGMNIRETFENKVSTALNKA
                     RDKAGTSTQKSLKDLNNAVIMARSGSKGSSINISQMTALVGQQIVEGKRIPFGFKYRT
                     LPHFTKDDYSPEARGFVENSYLRGLTPSEFFFHAMAGREGLIDTAVKTAETGYIQRRL
                     VKALEDAEARYDGTVRNSLGDIIQFVYGEDGLDGLAIERQRVDHMNLSNKNFEKRFRL
                     DVMDEAASSSILDSLEYGREMASDPAVQELLDQEYEQLLADRELVRQINRRKMADDYM
                     QLPLNVARIIETAKKLFKVDDSQRSDLTPNDVIPAVRALLDRMVVVRGDDIISKEADY
                     NSTLLFKIQLRSRLAYKRLAVEQRINKLAFEHILGELENRWARSMVAPGEMVGVLAAQ
                     SIGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEILNVAKDIKTPSMVVYLDYANATQE
                     DAKRMRSAVEHTSLRSVTAVTEIYYDPDITSTVIPEDYDMVESYFLIPDSSDQDSIEN
                     QSRWLLRLTLDRQKMLDKGLRVEDVAARIKEEYKKDVAVIFSDNNAEEMVIRIRVIRQ
                     DDDKDEDGNKIIEDDVMLKRLEKHLLDNCTLRGVPGIERAFLNKGVKLAVLPDGSQVA
                     NKETPECMEWYLDTQGTSLREVLTIEGVDTRRTYTNDLYQIVDVFGIEAARAALMQEL
                     TQVLAFGGSYVNHRHLALLVDVMTYRGSIAAVTRHGINRADTGALMRCSFEETVEILL
                     EAAAVGELDDCRGISENVMLGQMAPMGTGHFDVLLDPKMLETVISDNSRMGLMPGMTI
                     KGGQLEGAATPYDTGSPMADNGYLGSFSPTMGNFSPIQGAGSDSPSGFGTEYGGGFGG
                     SSSANPYATSPRATSPFSTSPTSPFSYSPSSPLGYSPTSPLLDAGGRYASSPQFSPSS
                     PSFSPTSPMLRPGSPTSPNYSPTSPSYSPASPAATRHYSPTSPAQFNSPTSPSYSPTS
                     PSYSPASPNLHSTSPSYSPASPTWSPTSPDAYSPTSPSFHRSPGQQMSPTSPGYSPTS
                     PSFSPRTPGRGPSGGSGDQYSPTSPTND"
     gene            <1302858..>1303548
                     /locus_tag="MYCTH_2122196"
                     /db_xref="GeneID:11513001"
     mRNA            join(<1302858..1302955,1303194..>1303548)
                     /locus_tag="MYCTH_2122196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658544.1"
                     /db_xref="GeneID:11513001"
     CDS             join(1302858..1302955,1303194..1303548)
                     /locus_tag="MYCTH_2122196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658592.1"
                     /db_xref="GeneID:11513001"
                     /db_xref="JGIDB:Spoth2_2122196"
                     /translation="MPREAHSAAPAIAGPAFLADPIGTALFSLFGQRQQVSPPPPQMA
                     RLRAGALPLACPNRDGLMAARRSATFVRDGRHPSARCLLAGAHSAERNRPVPEVGGRC
                     DRSRTWPRLRPGCSVAGALRTQHILECNTELTVTNNGPRLRLRLCDNC"
     gene            1306228..1307436
                     /locus_tag="MYCTH_2313333"
                     /db_xref="GeneID:11512895"
     mRNA            1306228..1307436
                     /locus_tag="MYCTH_2313333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658545.1"
                     /db_xref="GeneID:11512895"
     CDS             1306357..1306707
                     /locus_tag="MYCTH_2313333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658593.1"
                     /db_xref="GeneID:11512895"
                     /db_xref="JGIDB:Spoth2_2313333"
                     /translation="MAASTTEEIRQLNKQAVEFTPTMSHHRPRRPSTFLSLAPSTSDS
                     YPRAQRPRQPLTPEALAAVTKQDGAASGEAMKRRSSSLSSDASKFRFLKIGPVHWGEH
                     QDDHKGDYYELAVE"
     gene            complement(<1309279..>1310427)
                     /locus_tag="MYCTH_2122199"
                     /db_xref="GeneID:11513317"
     mRNA            complement(<1309279..>1310427)
                     /locus_tag="MYCTH_2122199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658546.1"
                     /db_xref="GeneID:11513317"
     CDS             complement(1309279..1310427)
                     /locus_tag="MYCTH_2122199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658594.1"
                     /db_xref="GeneID:11513317"
                     /db_xref="JGIDB:Spoth2_2122199"
                     /translation="MPPERFEFFFDLPPEIREQILSYLCLFPTGIWVGGGVGGKSIAL
                     SPAAAALLMGKMPTGPQRTATRKSRSTHNGIGGNVDISCGGGGGDSGGGDDGAYGLGD
                     CNADPPVNLFLASPILYREAGDLYYGRNLFHFAFSLCTWGRKKLQQQQGHDQDKEKAK
                     MQQEQQQGDRPISAAAAARNAPRDPSGAALARFLTHADTVRARRRVRSAVVHLGRLGG
                     LVEDLVVPALADLALTGALRRLGVHIGGELFLCVGHPPEALSLVVDREERPHQQQLLQ
                     RRQHLGGRDDQDGALAENPALRALLVLLADPSLEKAELRVLWPHRDRFWCNFHPGGWL
                     DERGCRCAVPGRRLSGPYEGALVEMDIPRLVDAFAGDAAAEFNIKKVG"
     gene            complement(1311027..1313648)
                     /locus_tag="MYCTH_75824"
                     /db_xref="GeneID:11505545"
     mRNA            complement(join(1311027..1311644,1311707..1312516,
                     1312583..1312961,1313023..1313191,1313254..1313431,
                     1313543..1313648))
                     /locus_tag="MYCTH_75824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658547.1"
                     /db_xref="GeneID:11505545"
     CDS             complement(join(1311376..1311644,1311707..1312516,
                     1312583..1312961,1313023..1313191,1313254..1313431,
                     1313543..1313585))
                     /locus_tag="MYCTH_75824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658595.1"
                     /db_xref="GeneID:11505545"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Spoth2_75824"
                     /translation="MADEVYDGAIGIDLGTTYSCVATYEGTNVEIIANEQGSFTTPSF
                     VSFTEDERLIGEAAKNQAAMNPANTVFDVKRLIGRRFDDPTVKKDMESWPFKVVDDGN
                     GNPKVEVQYLGTTHTFSPQEISAMVLSKMKEIAETKLGKKVEKAVITVPAYFNDNQRQ
                     ATKDAGAIAGLNVLRIINEPTAAAIAYGLGSGKSSKERNVLIYDLGGGTFDVSLLNIQ
                     GGVFTVKATAGDTHLGGQDFDTNLLDYCKKEFTRKTKKDLSGDSRALRRLRTACERAK
                     RTLSSGAQTTIEIDSLFDGEDFNMQITRARFEDLNAKAFAGTLEPVAQVLKDANIEKS
                     AVDEIVLVGGSTRIPRIQKLLSEFFDGKKLEKSINPDEAVAYGAAVQAGILSGKATSA
                     DTSDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVADNQQTVQFPVYQ
                     GERVNCEDNTSLGEFTLAPIPPMKAGEPVLEVVFEVDVNGILKVTATEKTSGRSANIT
                     ITNSVGKLSSSEIESMINDAEKFKSKDEAFSKRFEAKQQLESYISRVEEIISDPTLSL
                     KLKRGQKDKIEQSLSEAMAQLEIEDSTAEDLKKKELALKRLVTKAMSSR"
     gene            1313982..1315531
                     /locus_tag="MYCTH_2313336"
                     /db_xref="GeneID:11508583"
     mRNA            join(1313982..1314452,1314515..1314586,1314655..1315531)
                     /locus_tag="MYCTH_2313336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658548.1"
                     /db_xref="GeneID:11508583"
     CDS             join(1314264..1314452,1314515..1314586,1314655..1315143)
                     /locus_tag="MYCTH_2313336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658596.1"
                     /db_xref="GeneID:11508583"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Spoth2_2313336"
                     /translation="MAEQVDLTTIPISPDGENKPDGASNENAEEKLVTVFHDKDNFNV
                     KHPLSSRWTLWFTKPASGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKSDY
                     HLFKEGVRPEWEDPQNKHGGKWSYQFKDKRSVNIDELWLHTMLAAIGETLEDEDDGEV
                     MGVVVNVRKAFYRIGVWTRTMGRHIPGRGDGDIAGGKGRSAEKGKEILMAIGRRFKNV
                     LKLPPNEVVEFSGHTDSAHSGSTRAKAKIVV"
     gene            complement(1315800..1318227)
                     /locus_tag="MYCTH_2294540"
                     /db_xref="GeneID:11505977"
     mRNA            complement(join(1315800..1317034,1317123..1317418,
                     1317527..1317995,1318104..1318227))
                     /locus_tag="MYCTH_2294540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658549.1"
                     /db_xref="GeneID:11505977"
     CDS             complement(join(1315808..1317034,1317123..1317418,
                     1317527..1317749))
                     /locus_tag="MYCTH_2294540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658597.1"
                     /db_xref="GeneID:11505977"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2294540"
                     /translation="MASTLPRLPVFEAIARHDPESTAVIHSNSGRRFRYGELLGDVCK
                     VRNRLCEAAGKDDIDGERIAFLVENSYDYVVTLLAILAAKSIAVPLSPAFPAPELQYI
                     LNHSEALMLLSSAKFTSKAEEVLKTELDFQPVHLQLEKFQGNGVHEKVTLEKSDPGSA
                     GMMLYTSGTTNRPKGVLLPQSVMTAQARSLLQAWEYSPSDHLLHVLPLHHIHGTINAI
                     FTPLFSGSTIEFLFPFNADAVWRRFAAPFLTPDQTPDSDSDSPQPRHRKITFFTAVPT
                     IYSRLLAAHKALPPDMQSAARAAISPANLRLAISGSAALPTPIKRAWADLSGGNVLLE
                     RFGMTEVGMALSCGLDVADRVDGSVGWPLPGVEARLVDVDTHQVIEPGQERDADGRER
                     AGEIQLRGPSIFAGYWRSPEATAREFVNAKDGRGPWFKTGDVAVRRPVEGAGRSDRPS
                     QRDWARGDLYFILGRRSADIIKSGGEKVSALEVEREMLALPQVAEVAVLAVPSGKWGQ
                     KVGAVVILDREHVPDGKWSPLDMRRALKGRLASYKIPQVLKVVDHIPRNAMGKINKKM
                     LVKEMFIDEFSGDEL"
     gene            1318430..1319307
                     /locus_tag="MYCTH_2294541"
                     /db_xref="GeneID:11509088"
     mRNA            join(1318430..1318750,1318859..1319307)
                     /locus_tag="MYCTH_2294541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658550.1"
                     /db_xref="GeneID:11509088"
     CDS             join(1318709..1318750,1318859..1319143)
                     /locus_tag="MYCTH_2294541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658598.1"
                     /db_xref="GeneID:11509088"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="JGIDB:Spoth2_2294541"
                     /translation="MASRTPVEDAIREKITAGLKPTTLEIYNDSHLHAHHAPMQGVTS
                     KETHFRLVITSEAFRSKTQPARHRLVYGLLNDELKREGGIHALQLRTMTPEEEAKRRA
                     QEAEAE"
     gene            complement(<1319511..>1321637)
                     /locus_tag="MYCTH_2122204"
                     /db_xref="GeneID:11508592"
     mRNA            complement(join(<1319511..1320622,1320675..1320783,
                     1320933..>1321637))
                     /locus_tag="MYCTH_2122204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658551.1"
                     /db_xref="GeneID:11508592"
     CDS             complement(join(1319511..1320622,1320675..1320783,
                     1320933..1321637))
                     /locus_tag="MYCTH_2122204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658599.1"
                     /db_xref="GeneID:11508592"
                     /db_xref="JGIDB:Spoth2_2122204"
                     /translation="MAKAGSSVPPDAWASWSPAILANPTKIPRRYVQIPSDQQKLLDR
                     PDAWSLGRYPNVPPKVLTDVRAQSVRDTPPNVSALEETLLSQPASPASPGRAGEDLHR
                     SASPERGVGAGIGLENDSAKAEEDGNRGVENTPGTPIPWSSSPPEHFLGPHQREEARA
                     KDVSDSSRHSPEQRGPRTTGRVSARAAFLTDFPPSSSAKSDPGLEIEVPNAVTEALEP
                     VNRQAVSVFNHTPPSAQVHIPVSAVWPDHQLLVDDTGTARSTWAWANITGYAIPTASL
                     QPAGEQGPSEFPIDTPSDTSSSQAPYTTFKAAYPDYEGSLGVYLRAVLSILPLQKKRA
                     LAEFLYDDFVRVFSTDFLTYISGQEANPRPLSAVEFYNENVSRPVYLRGVLTKNNLSE
                     TLNKYANEIRAIRGGAVEPQEPEDTTRQRHDQRAPDKAPFERQTARQPRQRTDTSYAS
                     HESDSSSAAVSASPGPGTRETGSPAVPTCAATEPRPTKQVRETVPPPTAGIDVPPPPS
                     TVRPPTEAGKPAREAIVSPSRPVFRTQPDSPSLDIEPSPTPVTPAMSKRTLPAVDKFS
                     GAGLSQASNPESIPETTLKRRAAPRASAGSSTAEPGAEFKRPQAAKTNADKRALRFKK
                     FLMQKRIQSSAPQRSTP"
     gene            1322322..1330119
                     /locus_tag="MYCTH_2294543"
                     /db_xref="GeneID:11509139"
     mRNA            1322322..1330119
                     /locus_tag="MYCTH_2294543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658552.1"
                     /db_xref="GeneID:11509139"
     CDS             1322581..1330020
                     /locus_tag="MYCTH_2294543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658600.1"
                     /db_xref="GeneID:11509139"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="JGIDB:Spoth2_2294543"
                     /translation="MANPHGLEAPSLGPSVPSSPVDARSRRDSAASLSVASHADREHY
                     ALALDKIHTSASQSNVLTTFNDFAPPPDSLPSSEPKSTTSDMVQQGLSGLYTRFKEAV
                     GAVGKASAQEVDDANSQDGASSRKSVGAAGESAKTSPLPRGESGATASTHESAAISEI
                     QTSGLSSSGVPTSESQTTAPQSSSKASSITTPSTSKTPSLQNMPKMAKAGAPTAVNAA
                     VDPVTAQGVMEMDASAGRAARVEDQLPNRAGGRMSISRPADTPPIPSPSGNASLDSVA
                     TVDRMAMPSNRSRRDDVVSMDGSIDAPRSPSQPAAEGRASSSSSSRPTPSAETMRRPA
                     VIDRIASSRGRSHSRSSSLGPGAAASPVSTSAHSSVYHDSFTHNERPQRLQSGILRIP
                     GTTTNEGSPEVVNARLERMRKQVLSKEFWMADETCKECFLCGTPFTAFRRKHHCRTCG
                     CIFDSKCTSSISGQKFGVQGNLRVCKTCLSVINRRYDSGSDDSADESYLPAILRASHQ
                     AKAASPVTARLRTDDEASSISERTEQAEDPRDATTPMMAIPATRRMGENNRHSAVLEI
                     DMPQLSRPGSSRSLKSLSATRPQSSGHRRHHSKHNILSRLKAPPEERAPFRTPASEDL
                     AKKKPNVNAFHADNIIDPELADYMSDESSEDEQMSSIFATMEGGDFQSPSLDPGRASF
                     GTYLSAGRKHRFRTGEKSISGPSHAGRGYEEANGLQNLSIHTRPPRRRNLSTASASIH
                     HLRSPWPKSAVLKGPSASADTLSIFESVVDTPALKRRNSIRDGKPAEEGLSPASLQHA
                     KKLFRQLLQDAEIPNPASWEKALIPILDKCAEDVDPDIRNGDDMDIRHWVKLKRIPGG
                     KPSDTAYVHGVVFTKNLALKSMPRKIRNPRIVIITFPLEYQRHPEQHFMSLQPVIEQE
                     KEYLRMVVNRILNLEPHVLLVARSVAGLALQYLSEANVAVAYNVKPSVLEAVARIVNM
                     PVISSMDMLTLGARVGVCENFEVKTFVNNEIRGRKKTYIFISGCPKDRGCTIALRGAS
                     SEVLARMKRITEFMVYVIYNLKLESCLMRDEFVQVPSEASPAARPASPSEQSRDSLPP
                     PPGEETPDPSSDRPAAVVTRQSTENGDTLRDAGGTTAAAAESELSSAENAPQRATEPA
                     QRPISMHDLHSHEQVPDNLPMPSFHSEMVEKYETRILSTSPFVKFREPYLLMKAREQE
                     RRATYLKRLLEQEETEATDGDEKQNPEPFQLVQPEMVRGVEQRAPKKVMEVLHAVHDA
                     EYDRAMHSFRTQAKQWEAYVHASADLFDPYSHQNIVVLYSVTCTATKIPCSEPSLVAI
                     EFYNEHPDPKSGLDQDCTLGQYIEDICECADFICYSNGCDRKMHEHHRTYVHDNARLT
                     IILKTSPAWPENFPEKPQVRDEDEDETGICMWNYCKLCDKHFGLMPMSVSTWKYSFGK
                     YLELSFWNRGLQPHPQSGCPHDHQKDHIRYFYYLYRDIAVKVHYDPIDLYEIIVPRTK
                     ITWKVDYDLRVKNDVFLRAEDRWNRFMNSVMARLKSIRIDSVLPEKAEACKAEVERLS
                     KKAQEDQAELIRALQDAYMNSKYYEVIPFNTVIRAMLEKVTDWDAAFAKFEADFLSDK
                     DVRQLTIIQLKKIFTDHETKESLPSTEGTPSLASENEEKTTPATSPPGSSEVEERPSQ
                     PSDGDASPPQETPLSPAAEPVPAQKEGVAVETEVLLERVEPLDLAAPNPSAVTNLLFP
                     AAEAAAEAPEPPSDHPSSSTSSATVSASATSSPAQASAPPPPPTGHMSLSEKVEQLRR
                     EQQRALANDTRGSAAGVENAASTPKPAAERAVPRRSGAAVSPPIVRAISHPPGSLPRT
                     QSAIGKLLREQKAQDVGSETQKAPGEVGPKGDKKFADRIGLGALKSHRKAGPSGIPRY
                     VHKRESKVSTLARHFEQLSREFEKERLKDRKQRAAKMHHTRAFLPRSSTRTIVEVYKD
                     VDQAVQEPAPEDDQLLDKERGDKPAEQSSTIAAEATLPESQRSKPPETERSVPQERIS
                     SEPTSQQDETVAQTEAEEGRQEGRAGFEDEGAESDGDNPAITLDDILPNVKEFADTLE
                     RSEEIAEELPKYQKKSLMTMLTNFWAERSASGWPQLEYPINATDHIFFDSDVIIREDE
                     PSSLVAFALNSEDYRSKLAEIRQKWDTPDEPEAGESSSDGLAMKGPQTSGPDSAKAGN
                     KASRSDAELERSLLRKTGMHVKYQFTDGSARMTCQIFYAEQFDALRRKCGVADRFVES
                     LSRCLKWDSKGGKTKSVFLKTLDERFVLKSLSPSETSSFLRCAPNYFTIMKEALFHDL
                     PSVIAKMFGFFRVFIKNPLTNTEIKLDLLVMENLFYDRFPSRTFDLKGSMRNRKIQST
                     GEQNEVLLDENMVEYIYESPLFSREHSKRLLRASVFNDTLFLAKQDVMDYSLMVAVDE
                     VKKEIAVGIIDCIRTYTWDKQLESWIKNRGFAGGGRNRPTVTSPKEYKSRFREAMAR"
     gene            complement(<1330731..>1335204)
                     /locus_tag="MYCTH_90896"
                     /db_xref="GeneID:11508762"
     mRNA            complement(join(<1330731..1331140,1331248..1332116,
                     1332231..1335006,1335075..>1335204))
                     /locus_tag="MYCTH_90896"
                     /product="uncharacterized protein"
                     /note="Only within the first exon there is one EST signal
                     peak"
                     /transcript_id="XM_003658553.1"
                     /db_xref="GeneID:11508762"
     CDS             complement(join(1330731..1331140,1331248..1332116,
                     1332231..1335006,1335075..1335204))
                     /locus_tag="MYCTH_90896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658601.1"
                     /db_xref="GeneID:11508762"
                     /db_xref="JGIDB:Spoth2_90896"
                     /translation="MAGEDSSSRPPYGSPDASRTQWLGVPAEADIPRIHQGLRIAVDA
                     GFVKFLMDYAANNNNSDECPPLFKAYLEEVVLRPGAEDLRLQVESHLRNPRIRDFGLG
                     PVFLRELERYSIFDQVFPPVPGRRPALPSAPIPEPYRPLAPTPGRLAETASEPPELVE
                     PGLREGGGEETDSGDDERERAAMMERLQALEQGRAPPHRNLNAPAAPLPGPGVVSVPP
                     PIPSRSAFGEQGRGGQDTGRLAALLRRLQSIPVLSRAGDFREQGDEAMGSRRDWEADS
                     WYKGKRQPPLAVRLDTVVKFLAEEDVDRCLNWEARFGEVVSYLEWLALGDGSHQLQAA
                     HPQTRATFNDAVTKAKAHVLFEKHHYEPTPPLTMMMMTKIAKPPPRHHPLRSTRLDWM
                     VDPRRRPLPSWTAAVVPDRSELLPRAIVPRPPVPVNRMLVDRPGDRALYDRFAEDERR
                     WWRRVAGRNGPDDIPRDDGGAKDAAAERQNLAYIEEQSFLSVCRRQDREQQNNNNNNN
                     YNNNNTDNTGDDRPAARWARERGARRARLQRALCALPTDPLPFRHDSSASSSSSSSPR
                     RPRNTLILPLPAAVLRQARERADGLQWTPPSLSASELLLPAVREGPGPGPGPRPGPGP
                     GPGPGPGPGPGPGPGPGPGPGPGPGPGPGRGADEGEENDDGDNHHQQQQDYYDRHHPF
                     ETMPYNVSYRERLRRIRQARELARLRVEEEEEEEKEEEEKQEDEGGGRVALPRNLVVG
                     GPLVWAAADAGARARRDLLRACRTALSLLRAAGRRVPRPLLKAVLRAARKGAEKGRGG
                     SGGSGGGESFPDGDGRNVVPAGIRPAADDWEPQQRENEEGEVVGRGRGRGRGRGRGER
                     QRRPRLLDTDEVEWLKFLAGECVNRKNWTGRFVPDTPRDKYRLFLLFATKVQKLLDDK
                     NPRGLFASHRAAVEVEDLLRAINAGKDSSAVTKHEFRPHDACCWLDRLKKSGHVRFHL
                     DPRCYGIVKRPEAEFFPEHRVLWPAAAGGADERPRPSFSRGDVADWGRVVRDGHVPDT
                     GEGSAIWNFFLSLAFRLGYTISTLEAETEAEAEAGQRQQQLVRTRLRLREAIDKWKRA
                     CARDPSSAASAAEPTPRELALIRTRLIDELHANETMLHPARRRVWFDNSRGQQQPRAV
                     LVRDFNWDWAAVPRPGRRRNNRRHQFWSLDRWPAPSSKEDDGGNQDRFADGAATYDPA
                     AADPTTDWRYTQPRMRPYGYERVLFRPGPAVYQAGDTRLQREVLRGLVEDMADQAAGL
                     DEEQQQQQQQQQQQQPEQEQQPRAWSDMLASWNPLSRCSSRAARNKEAEGQDDGGEPE
                     SKLPPVDVSAIPSSWDPVAAAEQHDDVDDVDDVDDDMMLLDDADEAGDDGAHDDDDIQ
                     SVDVLMTGMGDPWTTA"
     gene            <1335981..>1337910
                     /locus_tag="MYCTH_42394"
                     /db_xref="GeneID:11508230"
     mRNA            join(<1335981..1336504,1336623..1337109,1337233..>1337910)
                     /locus_tag="MYCTH_42394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658554.1"
                     /db_xref="GeneID:11508230"
     CDS             join(1335981..1336504,1336623..1337109,1337233..>1337910)
                     /locus_tag="MYCTH_42394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658602.1"
                     /db_xref="GeneID:11508230"
                     /db_xref="JGIDB:Spoth2_42394"
                     /translation="MGGPASLVVRDSQTPSHAVGPGGPLSRDDAPGARRRSSTTSRRA
                     AYNARNFAHNRHSHEAAIFGSHRVRTRSVARAEGQELQGHTQHADSHPGVVRTDSSDK
                     AVKEWKPSIVIGSPLWLEGEDLSAIQIADRKVAQTRLWADHYRGVPYFAQAHQEAVEQ
                     RQRLDEASEENTKPRSALESTRNRAIQDRLDVLGALLQSSSFPPERQNIEAAMAGYRS
                     GAILYSDSYTLLWAGRVVDRCPDYSSFTRDREARLNRYAAEYGPGWLWYEPPLTRGQT
                     NVVAKKGFCLESKASWRQPTENMGHYQIRMGFRRRKANVSRGGVGEGGGGGGGKQPSS
                     FFSARTIPQPSTSAPGETVPDPDGPRIIYSVLLDSGATFPTLWESDLPALGIHPARYA
                     AQSARRVHTADSTLVSRIYELDVSVMGSLDDDDDDDDGYDNGNDGGGTNRGPLSRTGS
                     RARAEPGRDPTSPSSHSTTTKTTTTTTTSLSCTIPVLVFPGASRDATTAADGSPSSSP
                     DAVPDRLSGLLPFHTCYLSGAPGSFRLWMGDRRRDVLGASRLPGMMRYGEVLGGA"
     gene            complement(1340110..1341538)
                     /locus_tag="MYCTH_2294547"
                     /db_xref="GeneID:11508524"
     mRNA            complement(join(1340110..1340979,1341064..1341538))
                     /locus_tag="MYCTH_2294547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658555.1"
                     /db_xref="GeneID:11508524"
     CDS             complement(join(1340152..1340979,1341064..1341255))
                     /locus_tag="MYCTH_2294547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658603.1"
                     /db_xref="GeneID:11508524"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Spoth2_2294547"
                     /translation="MAPSSYQPDETFFVESDEPSQRMMMRDAAKMLARNKQEMIANEL
                     SRLACDEYLEDIMQHIRQMEDETLPDANLIDMQREIQWFMRPYLIDFLVEAHAAFSLL
                     PETLFLTVNLLDRYCSKRVVYKQHYQLVGCAALLIAAKYGDKKDRVPQINELNNMCCG
                     LYDAGMFTQMEMHVLNTLDWNIGHPTVDFFTKLVAAEERDSLEVEHMAAYICEIALYH
                     RDFVSTKPSVMARASLALGRAILGKPEVNDGEWDHADNVTLVALSQHLHQPSVTLARK
                     YSSQYYSRVSTKLADFLAQQAAIARRGVPPSPPAEHSLSDKATDVYSTPQRGLVPSRA
                     SPTAT"
     gene            1346563..1347226
                     /locus_tag="MYCTH_2294549"
                     /db_xref="GeneID:11505712"
     mRNA            1346563..1347226
                     /locus_tag="MYCTH_2294549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658556.1"
                     /db_xref="GeneID:11505712"
     CDS             1347048..1347218
                     /locus_tag="MYCTH_2294549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658604.1"
                     /db_xref="GeneID:11505712"
                     /db_xref="JGIDB:Spoth2_2294549"
                     /translation="MASEASPLLARSPRPFATAHNAPSNPDPPPASTPQRDPTAPQRK
                     SRLHPCGVVRDF"
     gene            1354381..1355145
                     /locus_tag="MYCTH_2294550"
                     /db_xref="GeneID:11509038"
     mRNA            join(1354381..1354510,1354571..1354668,1354738..1355145)
                     /locus_tag="MYCTH_2294550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658557.1"
                     /db_xref="GeneID:11509038"
     CDS             join(1354474..1354510,1354571..1354668,1354738..1355121)
                     /locus_tag="MYCTH_2294550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658605.1"
                     /db_xref="GeneID:11509038"
                     /db_xref="InterPro:IPR004235"
                     /db_xref="JGIDB:Spoth2_2294550"
                     /translation="MTSKKEKQITFEEYLGVTEAAFEWADSYDTKDWDRLRKCIAPTL
                     RVDYRSFLGKVWEAMPAEEFIAMISDKSVLGNPLLRTQHFIGGASKWERVSDTEIIGH
                     HQLRVPHQVYTDASLRNVEVKGHAHSHNTHYYRKVNGVWKFAGLEPEIRWFEYNFDKV
                     FASGRDSYGEHK"
     gene            complement(1355691..1357605)
                     /locus_tag="MYCTH_2294554"
                     /db_xref="GeneID:11508822"
     mRNA            complement(join(1355691..1356713,1356829..1357605))
                     /locus_tag="MYCTH_2294554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658558.1"
                     /db_xref="GeneID:11508822"
     CDS             complement(join(1355849..1356713,1356829..1357352))
                     /locus_tag="MYCTH_2294554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658606.1"
                     /db_xref="GeneID:11508822"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="JGIDB:Spoth2_2294554"
                     /translation="MDANGRDAQRGGNEYGEEWAHGLRVQFEQLLRTKRLNELQARSR
                     QGSPGPGHSASTNSHRDGHASGRNRQGNSGDASTPPSYSVVRNLPKVPIPPSPDDLES
                     TRFRNLLISLSATPMKYENPGLLDEALQAVPLDRIYSEAEEECQVLQAQAESMGDGRK
                     PEWGYQDCIVRALLRWFKNDFFTWVNNPQCPVCFSPTIAQGMTQPTPEEKACGALRVE
                     LYRCSNNSCRAYERFPRYSDVWRLMQTRRGRCGEWANCFSMLCRAIGSRVRWVWNAED
                     HVWTEVYSEHQKRWIHVDACEEAWDNPRLYTEGWGKKMSYCIAFSYEGATDVTRRYVR
                     KTEYYNERTRCPEEVLLYVMKEIKHLRRANFDKQKRFELEKEDSREERELHSYVVASI
                     TQAVTQLVPNAVDAGPSGRGTSSNEDTKVPVSADLPARQSGNAEWVAARGENGRRNQG
                     FPPPHGQEPPFP"
     gene            complement(1363136..1366070)
                     /locus_tag="MYCTH_2294555"
                     /db_xref="GeneID:11508061"
     mRNA            complement(join(1363136..1364879,1364943..1366070))
                     /locus_tag="MYCTH_2294555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658559.1"
                     /db_xref="GeneID:11508061"
     CDS             complement(join(1363192..1364879,1364943..1365969))
                     /locus_tag="MYCTH_2294555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658607.1"
                     /db_xref="GeneID:11508061"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2294555"
                     /translation="MDIHRCRFIRYPASAINAVAFTHSSLPPVSGQKKHTQKHIQVRL
                     AIGRANGDIEIWNPLQGAWHQELVIHGGKDRSVDGLVWVTEPDEEMADGKVIHGKSRL
                     FSIGYTTTITEWDLEQARAKKHASGQHGEIWCIGVQPPSNKGASAPGSRKLVAGTVDG
                     NLVLYSIEDGDLRFQRTLIRSPTKKTKFVSIAFQSHNVVVVGCSNSTICAYDIRNGTM
                     LRQMTLGTDISGGSKNIIVWAVKCLPNGDIVSGDSTGQVCIWDGKTYTQAQRIQSHSQ
                     DVLCLSVSADGSKIVSGGMDRRTAIYEPIAGQAGRWSKVFHRRYHQHDVKAMASFESK
                     GISVVVSGGSDANPVVLPLRGAGKEYHRTLPHLPQNPPLHSAPKARFIVSWWENEIRI
                     WHLLSPAQKLLDDPQAALGLRKNRKLLAQILVKGESHISSAAISEDGTLLVASTATDI
                     KVFQLRLARGEHAEQPQIRKVDMPTSGHAATKVQISPDSRWISWVEEGNKVMIARVHT
                     TESSAGVAYTISRPSKLNRLRRQIPKHLLLGGLGSYDRNITQMAFSPDSKLLAVADLA
                     GFIDTWVLRGPGEGASGAGSRDDEGAASSDSSSDSSDEEYGDVAGERWARNPSAKLLP
                     KLTAAPVVLSFSKTRREDGDYDLLTITAVKTLLVFNPLRGALSEWSRRNTYPKLPAPF
                     RDTRDQVKGVVWQGHRAWIYGVSYLFMLDLSRDLDPEKDSAGQKQGTKRKRGVQESGA
                     GGKMEKHSLAPQRVKAAVGPDGAKWEDVEMADADDQKSISASSGVDDDDDDDDEDIDG
                     GELQRLRDDQGAAAQANGDDAAGAGKQVTKPAAATAAATAAAAAKWWHTYQFRPILGI
                     VPLEGGPGLANGDVSEGRLPPLEVALVERPLTSEDLPERYFAENEWER"
     gene            1366719..1368527
                     /locus_tag="MYCTH_2294558"
                     /db_xref="GeneID:11507990"
     mRNA            join(1366719..1368220,1368332..1368527)
                     /locus_tag="MYCTH_2294558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658560.1"
                     /db_xref="GeneID:11507990"
     CDS             join(1366914..1368220,1368332..1368470)
                     /locus_tag="MYCTH_2294558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658608.1"
                     /db_xref="GeneID:11507990"
                     /db_xref="InterPro:IPR015977"
                     /db_xref="JGIDB:Spoth2_2294558"
                     /translation="MDFNSSSPYPEGVISFLDTDLYKLTMQCAVLKYYKDVPVTYQYT
                     NRTPEKKLSRKAFRWLEDQVRKLGNISLSTEELNYLKEHCPYLSPAYLEFLSEFRLRP
                     REQVELSFRPTGQDTGAETDIGDLDIKISGVWSETILYEIPLLALTSEAYFKFMEPDW
                     TYEGQEQLAFDKGMRLLEAGCVFSEFGTRRRRDYHTQALVFRGLTKASKEAAKRGLPG
                     KLSGTSNVHLAMRFNIPPVGTVAHEWFMGTAAIVGDYHKATEEALRRWVGCFGEGVLG
                     IALTDTFGTPEFLKAFRKPVQHLGEPLPASARKPSIADSFISTGSGAQTVQKTNKTYA
                     DIFTGVRQDSGDPKSFVKLIRDFYDQEGIHDKKVIVFSDSLNIDRCLEYKQVSEEAGF
                     QPTFGVGTFLTNDFVNTKTGKKSTPLNIVIKLSSANGNPAIKISDNIGKNTGDKATVE
                     KVKRELGYVEKEWEGGDETARWGREEDVPKA"
     gene            1373921..1375913
                     /locus_tag="MYCTH_2294559"
                     /db_xref="GeneID:11505579"
     mRNA            join(1373921..1374091,1374464..1374591,1374663..1374768,
                     1374829..1374977,1375058..1375114,1375167..1375310,
                     1375374..1375799,1375873..1375913)
                     /locus_tag="MYCTH_2294559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658561.1"
                     /db_xref="GeneID:11505579"
     CDS             join(1374536..1374591,1374663..1374768,1374829..1374977,
                     1375058..1375114,1375167..1375310,1375374..1375799,
                     1375873..1375903)
                     /locus_tag="MYCTH_2294559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658609.1"
                     /db_xref="GeneID:11505579"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_2294559"
                     /translation="MSSADSAVAMDSEPYRGHLTNGVSQNRTYQEVYAENGRWYGTFK
                     KGKYMFPIDETELERLDVFHKIFLVARQEATHSAPFPNQETPHILDLGCGTGIWGIDM
                     ADKYPGGVHVGVDLNYIQPEFIPANMRFLQKDIEDRWQDLDPGTWDLIHMRCLMGSIS
                     NWPRVYAEIYRHLKPYYGYFEQVEIDWTPRCDDGSLPRNGYLVQWATQLMDVMDSFGR
                     PMRFNSNTIKQQLADAGFDDIKEEIIQLPVNGWPIDTHGKALGRWFNLGIRQALQPLS
                     LAPLCRGLGRTPAEVQELAENTKHEVFSNSVRAYCTLHIFTARKPR"
     gene            complement(1378921..1380888)
                     /locus_tag="MYCTH_2313342"
                     /db_xref="GeneID:11513050"
     mRNA            complement(join(1378921..1379815,1380012..1380096,
                     1380367..1380888))
                     /locus_tag="MYCTH_2313342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658562.1"
                     /db_xref="GeneID:11513050"
     CDS             complement(join(1379572..1379815,1380012..1380096,
                     1380367..1380655))
                     /locus_tag="MYCTH_2313342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658610.1"
                     /db_xref="GeneID:11513050"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="JGIDB:Spoth2_2313342"
                     /translation="MSFALVMRRSGLSMGRTLARFESTASNSTTTKAAEAAKQTASKA
                     SSTASEASSKAAQGLSRVTAAGGPAIVSAAKGVSGALSRVGGRTGRLVAFVERQTPFV
                     VYYSKVGLELAKLVFKGQNMTPPSISTFQTYFQNLWKQLQHPGAFFSNLAHSLNPQQL
                     RNLSRTQVAAGGVLLAECLGFFTVGEMIGRFKLIGYHGETHAAHH"
     gene            complement(1381471..1382851)
                     /locus_tag="MYCTH_62052"
                     /db_xref="GeneID:11513408"
     mRNA            complement(join(1381471..1382473,1382602..1382851))
                     /locus_tag="MYCTH_62052"
                     /product="L-arabinitol 4-dehydrogenase"
                     /transcript_id="XM_003658563.1"
                     /db_xref="GeneID:11513408"
     CDS             complement(join(1381543..1382473,1382602..1382822))
                     /locus_tag="MYCTH_62052"
                     /codon_start=1
                     /product="L-arabinitol 4-dehydrogenase"
                     /protein_id="XP_003658611.1"
                     /db_xref="GeneID:11513408"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_62052"
                     /translation="MNGIKSVNGTNGTEGINGTTGAVKASKPNIGVFTNPNHDLWVSE
                     ATPTLESVQKGEELKEGQVTVAIRSTGICGSDVHFWKHGCIGPMIVGCDHILGHESAG
                     EVIAVHPSVTSLKVGDRVAVEPQVICNECEPCLTGRYNGCEKVDFLSTPPVPGLLRRY
                     VNHPAVWCHKIGDMSYEDGAMLEPLSVALAGLQRAEVRLGDPVLVCGAGPIGLITMLC
                     CKAAGACPLVITDIDEGRLRFAKEICPEVVTHKVERLSAEESAKAIVKSFGGIEPAVA
                     LECTGVESSIAAAIWAVKFGGKVFVIGVGKNEIQIPFMRASVREVDLQFQYRYCNTWP
                     RAIRLVQNGVIDLKRLVTHRFGLEDAIKAFGTASDPKTGAIKVQIQSLD"
     gene            1385173..1386624
                     /locus_tag="MYCTH_2294574"
                     /db_xref="GeneID:11508960"
     mRNA            join(1385173..1385415,1385527..1385612,1385674..1385826,
                     1385942..1386624)
                     /locus_tag="MYCTH_2294574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658564.1"
                     /db_xref="GeneID:11508960"
     CDS             join(1385395..1385415,1385527..1385612,1385674..1385826,
                     1385942..1386323)
                     /locus_tag="MYCTH_2294574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658612.1"
                     /db_xref="GeneID:11508960"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="JGIDB:Spoth2_2294574"
                     /translation="MTLYYTLVFLLLVAEMALFMLLILPLPFPMRRKVFTFISENPIV
                     AKVQYWLKITFVFILILFIDSVNRVYRVQVELASATENTGTSAPTIMGHERLEVQARK
                     FYSQRNMYLCGFTLFLSLILNRTYIMILEVLRLEEKLKQYEGSEKNTKQAEKLAAAGD
                     AGEIARLKREIELRDQDIATLKKQAAGLHREYDALAEKYGRTQEDGTMSKKDK"
     gene            complement(<1386925..1390435)
                     /locus_tag="MYCTH_2087375"
                     /db_xref="GeneID:11508004"
     mRNA            complement(join(<1386925..1387833,1387921..1388641,
                     1389225..1389761,1389983..1390115,1390205..1390435))
                     /locus_tag="MYCTH_2087375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658565.1"
                     /db_xref="GeneID:11508004"
     CDS             complement(join(1386925..1387833,1387921..1388641,
                     1389225..1389761,1389983..1390115,1390205..1390313))
                     /locus_tag="MYCTH_2087375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658613.1"
                     /db_xref="GeneID:11508004"
                     /db_xref="InterPro:IPR010856"
                     /db_xref="JGIDB:Spoth2_2087375"
                     /translation="MPSTATPSPDSVSDSEFHELLASYSDCIAEISGSKGTKPGQETL
                     SSLDQYRYGAALDTFGSGDRAAAMGLDDVKKLVEWKLRHGKFRPTLMKLVSSNEPGFV
                     KDTIREAVTLYRGKSDVSGALNILTRLKGIGPATASLLLAVHDPERVIFFADEAFYWL
                     CCNGSKAPIKYNQQEYIELDKQAQSLIKRLGVKAMDVERVAFVLMRQPKGERAASASE
                     VKSPTGSPANGMVKKRPAKRKALGDVPADDAAPVRRSKRVQAPLPVSSSMADTLLLAR
                     RDEAHSFACPDPIQLTPRFAALKESLALGKESAISSSWHRLLQRLPVEIGVVSSLGSD
                     AIPTIRFEDAADLQQADRFLRDLGQRGVGIIRGVVPKDTALMWSREAEEYLGQSPPVR
                     SPSGGFQAQDVYWSPAQVKARAHPNLLAAQKFVMSAWKSKDENARVTTNFPISYADRM
                     ALRGREGPESSPWATVDGGSVERWEPDGYGRAGTYKDIFEGRWEDYDPWESSTRLGVT
                     SDLYHRAGACSIFRMFQGWLALNHVPSGPGSVQVCPLPRLATAYFLLRPFFSPPPSSI
                     STPTTTPDRSTETGDDAQWAFNHPQNSILHGALPSYAQQITPSLHPHLQLDRSLISVP
                     DLQPGDYLVWHPDLIHRIIPDRPQPQPHHHHHHHHHPSDSDPDPSSSSSYSRAAAACM
                     YLPACPLTQTNALYLARQRKAFLLGHPGPDFAWGGHGHGHGRRESGEPVWSCDGSGSG
                     SGSGSVISRPEAQEVLDAGGDDGLRAMGLLPWDEEEADEDKEREVLAMANGILFPDLY
                     DMFG"
     gene            1391181..1391928
                     /locus_tag="MYCTH_2294582"
                     /db_xref="GeneID:11513351"
     mRNA            join(1391181..1391312,1391433..1391510,1391596..1391666,
                     1391781..1391928)
                     /locus_tag="MYCTH_2294582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658566.1"
                     /db_xref="GeneID:11513351"
     CDS             join(1391298..1391312,1391433..1391510,1391596..1391666,
                     1391781..1391862)
                     /locus_tag="MYCTH_2294582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658614.1"
                     /db_xref="GeneID:11513351"
                     /db_xref="InterPro:IPR015023"
                     /db_xref="JGIDB:Spoth2_2294582"
                     /translation="MGGGNGAKAAQKRARNEKHKNVPKAASQLKSNAAAMNIICAICK
                     QAFLSTSREPQLTLHAVNKHNATLPQCFPDFKPPASK"
     gene            complement(1391929..1393497)
                     /locus_tag="MYCTH_2294585"
                     /db_xref="GeneID:11513334"
     mRNA            complement(join(1391929..1392782,1392956..1393497))
                     /locus_tag="MYCTH_2294585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658567.1"
                     /db_xref="GeneID:11513334"
     CDS             complement(join(1392265..1392782,1392956..1393361))
                     /locus_tag="MYCTH_2294585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658615.1"
                     /db_xref="GeneID:11513334"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Spoth2_2294585"
                     /translation="MKNAPSFLGYSRLSAEITAGAIDHREQIDLSTEHPLPGPDAPRY
                     YNLLAPNQWPSPEVLPDFRPVFTEYMKRMGEISIYFTSLIAEAIELPSGAFNKYFDAD
                     QQHKLKIVKYPDVGELGAEGKGGNQGVGPHKDSMLTSYLLQATHHRGLQVQNMRGEWI
                     DCPPIDGTLVVAIGQGLEALTQGVCVSTTHRVLSPAAGEGPRFSIPFFQGVSGDASFE
                     DLETVGVGQVPEHVREQRRAVLERNGGRRLDDVEFTFRRGGAARTLGEATLRNRVKSH
                     PDVGERWYPDILESLRAEQQQKAGNVGVAAA"
     gene            complement(1394362..1397536)
                     /locus_tag="MYCTH_2294587"
                     /db_xref="GeneID:11505515"
     mRNA            complement(join(1394362..1396147,1396261..1397057,
                     1397121..1397536))
                     /locus_tag="MYCTH_2294587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658568.1"
                     /db_xref="GeneID:11505515"
     CDS             complement(join(1394376..1396147,1396261..1397057,
                     1397121..1397416))
                     /locus_tag="MYCTH_2294587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658616.1"
                     /db_xref="GeneID:11505515"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2294587"
                     /translation="MDVNGDTASLKRKREPKDDPALSQKKHRRKSKLQEVNVNGEDTT
                     NGAPQQRPDGDVDLPDASSQSLAGPVQSKSQPWRLSKPMGGRMLDIDPIFSPDERHLL
                     ITYNTSIQVYSTEDSLLVRRIALPIPGSDGENELVSTHIVASVLSKCDTDYVWVACSD
                     GRIWYLNWTSGSGVDAPFKVEAKKVLDMTVDAVELGGKAEDVVLVLQKLTYSSAQIFA
                     YNTKALSAGRGTLLHTYDESPQLLQSVAGGRLIVAAAKETLHIGQLKPKKLASLDDLV
                     YRFVCFDVPDIVSCLNVRHTVRTTKKGGIEIQSVDLVIGGARGGIYVYHDILSKLPGE
                     GSASSKAGLIQPRKYHWHRRAVHSVKWSEDGNYLISGGYETVLVLWQVDTGRLDFLPH
                     LLASIENIVVSPRGSSYAVHLDDNSTMVLSTAEMKPTMYVSGIQSLVLGDRPSKDSLV
                     RRVWRPVDEIATPLVAAINPQSPSQMCLCVGNGQQASLGGSLSTPLLQVFDISSFQGV
                     TKHAIARTNPPEANITSEGAPITEPTATKLAFSRDSRWLVSVDEWQPPERDTDVFLIG
                     SKTPADACRERREIYLKFWEVSADGQSLELVTRINDAHHTDRAETIFDLASDPTSSRF
                     ATIGNDGTVRFWTSRMRKRDGLAATGPDGEPLRSWTCSRTVSLPLYERQDDTIEVAEN
                     EPRSGAITFSEDGSILFAAFGPPSGALVVAIDTETGAFRDVVSGMFRGEVRALKSLGS
                     SLIMLSEDLVVYDIVSDELLHSYSLKETSEAAKRLTQVAVNYESRSVALVAPIPNQNQ
                     EKLKRGTRSELVVFNIDEEEPQLVKTFSQLITSVCAAPSSSGFVLVDSAAQIWSVTQG
                     IEQAPMLQPLADIGVDVNAVGDATPNELQLQDGEASDEEMGDADQDVDMEDEDDTHAA
                     VVAPQRLAEIFNAAPAFAMPPIEDVFYQVTGLFSTKPLNA"
     gene            1397652..1398389
                     /locus_tag="MYCTH_2294589"
                     /db_xref="GeneID:11508628"
     mRNA            join(1397652..1397818,1397877..1397938,1398003..1398089,
                     1398159..1398389)
                     /locus_tag="MYCTH_2294589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658569.1"
                     /db_xref="GeneID:11508628"
     CDS             join(1397783..1397818,1397877..1397938,1398003..1398089,
                     1398159..1398219)
                     /locus_tag="MYCTH_2294589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658617.1"
                     /db_xref="GeneID:11508628"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="JGIDB:Spoth2_2294589"
                     /translation="MIIPIRCFSCGKVTGDLWEKFVKLIEEEGLSDGDALDQLGCKRY
                     CCRRMVMTHVDLIEKLLKYTPDGRNYKKIEMQQRNQE"
     gene            <1401967..1404253
                     /locus_tag="MYCTH_2294596"
                     /db_xref="GeneID:11512948"
     mRNA            join(<1401967..1402065,1402127..1402225,1402290..1402443,
                     1402502..1402904,1402986..1404253)
                     /locus_tag="MYCTH_2294596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658570.1"
                     /db_xref="GeneID:11512948"
     CDS             join(1401970..1402065,1402127..1402225,1402290..1402443,
                     1402502..1402904,1402986..1404069)
                     /locus_tag="MYCTH_2294596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658618.1"
                     /db_xref="GeneID:11512948"
                     /db_xref="JGIDB:Spoth2_2294596"
                     /translation="MMIRTNIPDHLRKPLSEEVVSVIHAPPNFQNWQSSDATSKSNTA
                     SVTSVESTSASSPPPSEPSTVTPPAQQQPTVNTKVKPVTFGVDAPTPQAQKLDDVLAN
                     EPPRLRSSTASSLELIPESHEVDADDDEDEDADDFSGPTLSRENEVKALKAALEECWT
                     LCNTLANLSSIHRERVFNSSGTPDAHERAWKSCWKLCKRLYQSRDDVSESYGVRTNLD
                     LCRDFCQCLFDVRQKKDETADSILRVSFELNNHLYSAQDSRSLPEAFRERTLDFYITL
                     CHRLMKQRSDLAEETDSLLRACWSLAEMLFSLRQSRRDGKAPDEELLGSAVQACWELC
                     DIFREGWTQIRPDRGTPRPNQVNFFAAGTPYGNQSTGSHPSDVARSNAGSRASLHSKR
                     ESLRSLADIDRPRPHPVVPETPVTEFEDTPVSPDASPRMPPNILILGTSGDSRSDRGG
                     RWSSNASNLSSYSQSSQHTSSTATTTAAVEDTNVTRIKALILKAAMNVGFDRDTAVAN
                     GTSSAASLQNFVKTLPTGSFGSLPSHAALLQSYKNLVLTDASFRFSTSLPARGKRFTA
                     AEIAKSVGWITQRSAQYNFLRDLFRLVFGIQPDEAEARKNMSITV"
     gene            complement(1405386..1406865)
                     /locus_tag="MYCTH_2294601"
                     /db_xref="GeneID:11512983"
     mRNA            complement(join(1405386..1405741,1405841..1406865))
                     /locus_tag="MYCTH_2294601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658571.1"
                     /db_xref="GeneID:11512983"
     CDS             complement(join(1405424..1405741,1405841..1406281))
                     /locus_tag="MYCTH_2294601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658619.1"
                     /db_xref="GeneID:11512983"
                     /db_xref="JGIDB:Spoth2_2294601"
                     /translation="MGEITRRWPFEDHGHGAFSLVIREPPLTGDSLGLKTWGSSYALA
                     RLLHQFADGPLAHLFVPGALSAPHEVLELGSGTGLLGLAAACVWKTSVVLTDLPTIIP
                     NLAHNVSLNREVVGRLGGKAEAAPLTWGGSREDVDPMFWEPNCFQLIIVADPLYDDDH
                     PTLLACAIDEQLALGTDARVLAMVPQRDEITRRLLSSLREELGRRPRPLLCLEEGVVD
                     GQDDWGDEHGDGDDDGMRNVGFWWGIFGRAPSSC"
     gene            complement(1408051..1409240)
                     /locus_tag="MYCTH_2313350"
                     /db_xref="GeneID:11508782"
     mRNA            complement(1408051..1409240)
                     /locus_tag="MYCTH_2313350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658572.1"
                     /db_xref="GeneID:11508782"
     CDS             complement(1408320..1409090)
                     /locus_tag="MYCTH_2313350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658620.1"
                     /db_xref="GeneID:11508782"
                     /db_xref="JGIDB:Spoth2_2313350"
                     /translation="MNARGYGLPTYPGCSTYLPAGSRNYHDQARKLSLCDLSLSDDNH
                     SEHMPCWVKDRKSNLRVSGIHDPANKQRDLKAPPAPQCLGIDAILRNLHHEISSSLKM
                     LQALVQCFEADVEALRPWAEESTLDTVWRNKVKKVFRGKRDKARFEGVAGRISASRAA
                     IKGAVRTVKTVKAAWEDRHTVEGQIRTAKKAIVFCDGIVDLAERAASERAACKQLVTE
                     LEETICLLDRRKHPWICKSALLSTCPPNLKASSAGPGQ"
     gene            1418189..1421211
                     /locus_tag="MYCTH_2294607"
                     /db_xref="GeneID:11509092"
     mRNA            join(1418189..1418574,1418774..1419138,1419192..1421211)
                     /locus_tag="MYCTH_2294607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658573.1"
                     /db_xref="GeneID:11509092"
     CDS             join(1418401..1418574,1418774..1419138,1419192..1420953)
                     /locus_tag="MYCTH_2294607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658621.1"
                     /db_xref="GeneID:11509092"
                     /db_xref="JGIDB:Spoth2_2294607"
                     /translation="MVLNFPESGVVIESSAIKDMAEFPTQAFAITLSDSVIEDMILCV
                     QNGGDIQLALGSNPKFLFDDHEIRIPKTSDPSGYDLFLANSDDPSTARKLPEPTMSIL
                     RQPKRKPKTTAPKTAKPAGKGEPVAKKAPARGSAKSSGAAARPGSSAAEDGESQKQED
                     ATAKLKRTFDSLAADKRENSAVIVGGLPSSKGAKFGRLLDTHGAPSPRSLPPSPALSG
                     VGSPSLLPSGSTPQERAKQQRFPLMHELAVQDLSREELLEKWDGTEEEFNAALEKVAT
                     FDKDLQKWVLKKNCWKDLDIFEYDYSDDDRRQKAITNAIKWFDRNRVSASDPLWQKLL
                     PKADRGKGICLSNLQVTLAKGPVMQAPKQRTDAASAGGADSEKDDSATSATKKGPGGE
                     AMSRSSSQASNGKKKLSASEAQAKRLLSTNKKKPLPAATTKAAPKTSAARSSTKGTSA
                     KGGRVLSKEFVTDSDSSDDEVPLSSSKAKSKAASAPAPKPMARPAEKPKALAENGKER
                     PKEAPVPKPKPAPAAKVSPREQKNEKEKDTIRAEVIARPIKPAAKRPREADDDDSSSS
                     GTPLSKRVKPAAKPLPTQTKARTASDASQHSRVAAPKPKHTSPVKSSPLASSPPTNAS
                     DVEQDRTTPAKARERERERERERERERERDREWRRETAVRGSSSSTTDTSSTSGSIAK
                     KRPPTTTTAAAADSLPQGKAKRQRPSQETIEMAAKFRQFYARYLQLHRDVASHDNPDP
                     GKMTDLLDMHERLSRMKTEIYAAVEV"
     gene            complement(1421874..1423438)
                     /locus_tag="MYCTH_62074"
                     /db_xref="GeneID:11512829"
     mRNA            complement(join(1421874..1422440,1422520..1422589,
                     1422663..1422689,1422757..1422791,1422869..1422902,
                     1422979..1423001,1423083..1423174,1423321..1423438))
                     /locus_tag="MYCTH_62074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658574.1"
                     /db_xref="GeneID:11512829"
     CDS             complement(join(1422376..1422440,1422520..1422589,
                     1422663..1422689,1422757..1422791,1422869..1422902,
                     1422979..1423001,1423083..1423146))
                     /locus_tag="MYCTH_62074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658622.1"
                     /db_xref="GeneID:11512829"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="JGIDB:Spoth2_62074"
                     /translation="MPTDERKQARSSSPVAREKLEAQIKSADMTEDMQQEVIEVAQEA
                     MAKFTIEKDIAQHIKRTFDERKGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLF
                     KTQ"
     gene            1423770..1426844
                     /locus_tag="MYCTH_2294614"
                     /db_xref="GeneID:11508394"
     mRNA            join(1423770..1424121,1424174..1424953,1425155..1426844)
                     /locus_tag="MYCTH_2294614"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658575.1"
                     /db_xref="GeneID:11508394"
     CDS             join(1423891..1424121,1424174..1424953,1425155..1426639)
                     /locus_tag="MYCTH_2294614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658623.1"
                     /db_xref="GeneID:11508394"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294614"
                     /translation="MESSRVFVKNLPPTISEAEFRNHFSAQGREVTDVKLFSNRRIGF
                     VGYKSHEDAAKAVKYFNKTFIRLSRISVDLAKPIADSKPKLPAAKDEQRHDGAGISSR
                     KLDGTGVDQTDDEKSKKRKREALEEADPKLQEYLEVMGHPVKKPRDREVVGTGQEADS
                     VAAVPPAVIEAGESDDEYEDIPSLKPKGGPKGDPAPVEAAPTAVPDGEGPTPAAGDVR
                     VREVPKVAADATDDDWLRSRTNRLLDLVDPDDPEFAARAVPSAPAAATTHAPEPKDSG
                     HVETTTNTDGPNQGAPVPTEDTEDAIKQIEKTRRLFLRNLSYTVTEDDIQEHFSKFGA
                     LEEVNLPLDSRGQGKGFAMIRYEQPAAAVAAFQTDGSIFQGRIIHIIPGSAKREKKLD
                     EFALSKLPHKKQQLLKKKAEAASSTFNWNSLFMSQDAVNTAVAERLGISKHELLDPTD
                     ASAAVKQAVAETTVIQEAKAHFAAHGVNIEAFKSQQRGDTAILVKNIKNASIEELRNL
                     FEEHGSVVRVLMPPSGTIAIVQFGQPAACRAAFAKKAYSRFKDSVLFLEKAPKGLFVD
                     NAAPPQEPQDRPAGVQKPSVADLLERHDDEDQQLETTSLYVRNLNFSTTAEGLTNAFK
                     HLDGFVSATVKTKKDPKRPGQVLSMGFGFCAFRTKEQAQAALKVMDGYVLDAHKLSVK
                     ASHRGHDAAEERRREDLAKKAAAQRTKIVIKNLPFEATKKDVRALFSAYGKLVALRLP
                     KKFNSMSRGFAFAEFATAKEALNALTALKDTHLLGRRLVLDFAEADEVDPEEQIKAME
                     KKIRGQVNKVTLQKLTGEGRKRINIGDKDEDEA"
     gene            <1427411..>1430525
                     /locus_tag="MYCTH_8962"
                     /db_xref="GeneID:11508185"
     mRNA            join(<1427411..1427873,1427927..1428154,1428289..>1430525)
                     /locus_tag="MYCTH_8962"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658576.1"
                     /db_xref="GeneID:11508185"
     CDS             join(<1427411..1427873,1427927..1428154,1428289..>1430525)
                     /locus_tag="MYCTH_8962"
                     /note="Contains conserved domain pfam01285: TEA/ATTS
                     domain family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658624.1"
                     /db_xref="GeneID:11508185"
                     /db_xref="JGIDB:Spoth2_8962"
                     /translation="AQCYSPLPNHEHEDRHPGSPCRQCLQELAGNVQLPHMAWYGQQF
                     EALSSIPPSIPPSIPPVMAAPVLRTQSLGPDYGTPAYPRPQQRQEARLRGRKQGRGSN
                     PLMPLLTQAFQNYRKKQADKPEQKWPEALEGHFLDGKSTEQTKARPPSAVPFSLLLIP
                     QMGRSKYSIEQRQQGRNQLIGKYLWLASCRDLGPGEKPSALLLEIRGEKGRKRVSSHI
                     QVVRNFFAAHRCLHFLFGPRQKDKDDKDERHIEKVSLKNNPILIALSENRMPDQRPNY
                     EYFAQILALNEQVQFRPRRCWIFVSHPDVLVSKDGSGYLPTTGTKLGQAEYPHLRRNL
                     ERETWAREEEQHLFRGALLHEFTKEIHQVESGSVGDLARKWASAFPSLQQRLRAITSS
                     TTDGQCDVLHLHTTLELREKPGFPADSSLSSWVEISIEQPHLLNHRWRVETHLVGPPE
                     LSYARDDSGEEGSYQEDIYERHGEFTIKYQHQPGCDGSRSSSSSSSSSSSDSARGHCD
                     CLSRCSGRDAFSVPFPIPFPATAWAQTLTNCAEYPAYPSSGSKRHARGWGVECEREED
                     REEAGWRRRGSKEPTQMDLVPKIAMMQEILSCPPPAPSHQGESSEASSEQGWTRRGLI
                     LWTFDTIHSVAKEGGRERGKPQTASGGRTCWRFLTILDPSSEHHLRQAAVTSRRTPAD
                     EFRGVSDSLACASRPGSRAAIPSPTPSYPQHPSATTNENFPPAWNNVAVGPGAALSLP
                     PTTRAYGADVDAISHAIPPRAAAGEAGYELPDSFGGSHGGLATPPSTASTASSLTQPF
                     STASAGSDVFPGYVSPPHGPVTTADPGAGPHTLGGALPGAMTDPFLSDVGGAYGGAQD
                     GIIHGWDSHVAVAVAVAGLDADPWSSPGYSDASAAAHQVHHHDTIAWSAGTQPQTVRS
                     RRGSEQQQQHHHHHHQHHHPSGSPEQHTWASSTHSDSIIDNHELWMPPIAAETQTPAA
                     ETAP"
     gene            1433504..1435126
                     /locus_tag="MYCTH_2294618"
                     /db_xref="GeneID:11508603"
     mRNA            join(1433504..1435016,1435102..1435126)
                     /locus_tag="MYCTH_2294618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658577.1"
                     /db_xref="GeneID:11508603"
     CDS             1433660..1434949
                     /locus_tag="MYCTH_2294618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658625.1"
                     /db_xref="GeneID:11508603"
                     /db_xref="JGIDB:Spoth2_2294618"
                     /translation="MRTSIDRIVAAWLLAALSGTATAHSWPEQTVRLGPDGKEVGKPG
                     ADRAHIENGPDASFLIPPNGGPKVFDANQKIVRDGQGTLTDSSYSDQFPMLSVAPGDF
                     VAIKHRENGHVTRADKTNPMKPINRGTIYLYGTTENDLSNVNLMDVHLKWTADGKGGD
                     GKGRLLATRNYDDGQCHEQKPADGDLEGIGDYRKQHVSNADSLLCQSDIKIPEDAPVG
                     KIYTVIWVWDWPDMKEPGVAVPPAEYNSDQVATPETYTGVVDFKIVDPCDESLGEVKG
                     PTCKSSTADSNVKFAMDAPATARGIPSQLAEPFIVKVPQAGASVPSATADPKYIPFAV
                     LIGQEPTEFPLPQSILEKQNTPGAAGGGGGGVPTPTPTPSPDSGSGSGGGDEEEVVTI
                     TTTVPEGFTTMTVTRSKAEKTPEAKPRGILLRRRHRA"
     gene            complement(1435469..1436872)
                     /locus_tag="MYCTH_2294621"
                     /db_xref="GeneID:11505724"
     mRNA            complement(join(1435469..1436026,1436138..1436283,
                     1436350..1436375,1436644..1436872))
                     /locus_tag="MYCTH_2294621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658578.1"
                     /db_xref="GeneID:11505724"
     CDS             complement(join(1435688..1436026,1436138..1436283,
                     1436350..1436375,1436644..1436681))
                     /locus_tag="MYCTH_2294621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658626.1"
                     /db_xref="GeneID:11505724"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Spoth2_2294621"
                     /translation="MASTVLPESGNPLVFFDITLGGEPLGRITFELFKDVVPKTAENF
                     RQFCTGEYKDHLGRPQGYKGSKFHRIIANFMCQGGDFLNGDGTGSTCIYGTKRFADEN
                     FNIKHDRAGLLSMANAGPNTNGCQFFITTVPTPFLDGKHVVFGRVVEGMDVVRKMEHT
                     KTGLKGKDVPNLDVVIAECGEL"
     gene            complement(1437007..1439755)
                     /locus_tag="MYCTH_2294623"
                     /db_xref="GeneID:11507976"
     mRNA            complement(join(1437007..1437418,1437477..1439408,
                     1439465..1439755))
                     /locus_tag="MYCTH_2294623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658579.1"
                     /db_xref="GeneID:11507976"
     CDS             complement(join(1437331..1437418,1437477..1439408,
                     1439465..1439655))
                     /locus_tag="MYCTH_2294623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658627.1"
                     /db_xref="GeneID:11507976"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="JGIDB:Spoth2_2294623"
                     /translation="MESQETAKRPQEEANGSTDHQNIPNGDEPALKKIKLDGPSSVSD
                     VPAQSSPRPRVKGVAPIKAEYLIFVPGQTGKPAEDEVADDDAAEGQRAREPQEATQTS
                     KKDGKRKKQKGQNKDRDFGTFSDAKRLCNSVAWTPEFSPRPCKHGDRCNALHDLRQYL
                     KEGRRPDLATFGGKCPVWAKYGKCPSGWRCLFVRSHMDEIKHTDGRSELVLLENTTKQ
                     SPDGGKGEKDEGKKEEGEEEEEGEMGDVKPGVVNVVPARIKFDLAKKRLRLEKSDRYL
                     EWLAKDTERLTRHYHKQKNDTDEANDYRAQYVEPPLKPSEKRRIYFGRETPVLAPLTT
                     QGNLPFRRLCVELGAQVTYSEMALGLPLLQGQKADWTLMRAHEIETTPPRFVPGNGSI
                     VRDYDNSRDLKFGAQIAASVPWVAIKAAEALSRFLPHLRLIDLNCGCPVDAVYKSGAG
                     SALLDAQSKLERMIRGMNAVSGEVPITAKIRMGVRDDRHTAHKLVERLALGGEDMRSV
                     VGAPGCAAVTLHGRTRQQRYTKAADWGYIAECAALIKQFNDKADSLADTIREADESTL
                     PNGGKMYFLGNGDCYSHVDYFEHIDKAKVDSVMIGRGAIVKPWIFEEIEKGQYLDKSS
                     SERLTYIEKFARYGMEAWGSDELGLNYTRRFLLEFLSFFCRYVPVGLLEHLPPSLNDR
                     PPAYRGRDDLETLLASKNYKDWIKISEMFLGPAPPGFKFQPKHKSNSYELEAEG"
     gene            1440948..1443270
                     /locus_tag="MYCTH_2294624"
                     /db_xref="GeneID:11508790"
     mRNA            1440948..1443270
                     /locus_tag="MYCTH_2294624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658580.1"
                     /db_xref="GeneID:11508790"
     CDS             1441036..1442889
                     /locus_tag="MYCTH_2294624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658628.1"
                     /db_xref="GeneID:11508790"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Spoth2_2294624"
                     /translation="MADQARGVGQEDTLQSPQNRKAVRSQRIAPVSPSDSRLPPSEPY
                     DDDDDDDDDDEEEEEEEEEEARDRAPPIPRSHTPGHLSSKSQDRRNKPTDLSLRQRSQ
                     SLAAAIAPSSSSSSSGVTPLLPVSAASFSSGTLKTPTPSLTRQPATSEDATPVKTPGR
                     ERQESAAGSSGGGSKEPPRRPQALRSTSAIASRPGGGGAGGSGGAGGSGQSSGGGGGG
                     SGRSSSSNNNNNNNNHNNNHSNNGNGGSSSAVPGTVTRIGTGRGAPAKGAEVYTPSPP
                     LVDPRTAADVPAAPSSGMYWSRAPASGAPHTALRAHTATLVGSNVFVFGGCDARACFN
                     ELYVLDADAFYWSTPHVAGDVPVPLRAMTCTAVGKKLVVFGGGDGPAYYNDVYVLDTV
                     NFRWSKPRILGDKAPSRRRAHTACLYKNGIYVFGGGDGVRALNDIWRLDVSDINKMSW
                     KLISAPSPATGTGKDAVPKARGYHTANMVGNKLIIYGGSDGGECFNDVWVYNVETHVW
                     KAVNIPITYRRLSHTSTIVGSYLFVIGGHDGNEYSNDVLLLNLVTMSWDRRKVYGLPP
                     SGRGYHTTVLHDSRLLVIGGFDGSEVFGDVWILELAVHSYYSQISHFTVDV"
     gene            complement(<1443579..1444466)
                     /locus_tag="MYCTH_2074790"
                     /db_xref="GeneID:11507981"
     mRNA            complement(join(<1443579..1443628,1443707..1444466))
                     /locus_tag="MYCTH_2074790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658581.1"
                     /db_xref="GeneID:11507981"
     CDS             complement(join(<1443579..1443628,1443707..1444346))
                     /locus_tag="MYCTH_2074790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658629.1"
                     /db_xref="GeneID:11507981"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="JGIDB:Spoth2_2074790"
                     /translation="MKVISKEEEQEHYSRVVRGGLIGGTAGLAVGLAGVIYGSKRYPM
                     IRQLTLPFRSFLVTSSGTFGAIVVAERYSIEYQRSRDAMNNYLEETHRAVEEARRAQL
                     SEKQKLLNWGRENRYTIVFASWIAAMGVAMAIVGRNKYLSTSQKLVQARVYAQGLTLA
                     VLIATAALETADAKSGKGRWETVLVVDPNDPTHKHMIEKKIHKEDYEGQDLWKEMVAA
                     EERRLGEQKKNR"
     gene            1449025..1451644
                     /locus_tag="MYCTH_2294631"
                     /db_xref="GeneID:11505381"
     mRNA            join(1449025..1449703,1449894..1451027,1451103..1451283,
                     1451337..1451644)
                     /locus_tag="MYCTH_2294631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658582.1"
                     /db_xref="GeneID:11505381"
     CDS             join(1449111..1449703,1449894..1451027,1451103..1451283,
                     1451337..1451477)
                     /locus_tag="MYCTH_2294631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658630.1"
                     /db_xref="GeneID:11505381"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2294631"
                     /translation="MPSRSWTQWFNSKADPEAAEPAGTHCNKNSTRNHTSPTHSDSPS
                     PLDHSPRSPSPTPQPATPCLAVLGHTVTSQQVAFAGPAQKYPPRASSPAIAGGQDDFD
                     YSYTTGRITNIADAADTDLALDIDTKDVDMTTGPDFGSATGRSRQDSFVSAGAKPISM
                     TNPNREHANRARRESLAGSLMGGMSWGGISVGSFIREDMMMTGTSPYINNQSSSFQSS
                     SYIPRLEASFMRDFTCCDQRWPTLHDLLQHYEEHHHPTTTPNTSKDAFGATQPNSRAT
                     SRAGSVAPSAGRTQQASQSLHGFPQQRQAGSGMGVGGIGQMMRQQQQQQKQQQATGSS
                     QKANALSSHMNDEMDTVGDMEMDETVGPMDMDDNTRTIQATRELFGQQQRPQLHLNSS
                     GLPHQALRTSQPPTPAAVSFGFQNNPTVSSVNTPTLTTQQQGVPQRGQQFGQDGNGDE
                     DEEIAGMPMKMNLGNMNLGGSQLGGLAFGALGTIDDPAKRLYSPGGTNQMTSQQRALD
                     QQMQLQQQLQQHLQAMNLDLSQFPPGTDPALILQQMTALMMPPAEEHKPFRCPVIGCE
                     KAYKNQNGLKYHKTHGHSTQQLHENGDGTFSIVNPETSTPYPGTLGMEKEKPFKCEVC
                     GKRYKNLNGLKYHKQHSPMCDPDIRAHHQSILTSMMQNPAAFLALQQGLPNINEDAML
                     "
     gene            complement(1453203..1455867)
                     /locus_tag="MYCTH_2294635"
                     /db_xref="GeneID:11513271"
     mRNA            complement(join(1453203..1455122,1455189..1455867))
                     /locus_tag="MYCTH_2294635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658583.1"
                     /db_xref="GeneID:11513271"
     CDS             complement(join(1453237..1455122,1455189..1455600))
                     /locus_tag="MYCTH_2294635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658631.1"
                     /db_xref="GeneID:11513271"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Spoth2_2294635"
                     /translation="MAQHHHPATPGASAAGPSVLGGQGQTTTSVTPQVSASSSALTPA
                     SASSSNTYIMPNSPLKNRGLADGYRPRVTRTLGQRPACLVNASVTYCGNNQIYAFGGF
                     DQYTDEVYNHVLRLDLVSHQWTLVDNYGDIPGVRMGHTATLYKGDKLLVFGGENEHRT
                     YLSDLIIFDLKTAHWTQPQVSGPIPKGRARHAAVLHEDKLFIVGGITGHDNYVLDDIC
                     YLDLKTFTWSRSWRFVGRFDHSAYIWSDRVWVFGGLSEDMDKVSDLWWLDLKGNPAFE
                     SPPQIGYLDKSGLVRSAVSPRPPYQVSQSPVVGSSGYAANSRTPQVNTPSFHLKTYAP
                     PAPGAISALKFVSGSSVPSQMQGIHFHVYSSGTLLDFVTPAATITSKDCSLSALDLGT
                     LRWQKLAEGREIFKPGYRWHYCTLNEDGTKAWLLGCPTEAGAMELGANGLEEYLSDIM
                     EIDLRRYGFLGNNLASEARTDLARPSLRARSVEPPSKGLGADLARLFNKPPETGSGTD
                     FVVTALSRDFDEDEVMGSALMHANEPDEGSQTWLAPDAPTSPPIYVHRLILQARWPHF
                     ARLWASQMAEFHTKKMHIPEPYSVVKAFLYYLYTDRIDPADDDAEENTMSDLSDVAGL
                     LVMSNIYNIPHLRLLCVNRLSKELDVDHACIIWYCAGLANEEWLRKRAAGFCMTHWGR
                     VVRTAGFQRLPRTALVELSQEVDMEGRVVGGDELDNMIMDGVGGRYGDGALSAASRRK
                     ESVSSNQTQMLETEDDDEDDGMEMS"
     gene            1456150..1458687
                     /locus_tag="MYCTH_2313356"
                     /db_xref="GeneID:11505449"
     mRNA            join(1456150..1458100,1458162..1458687)
                     /locus_tag="MYCTH_2313356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658584.1"
                     /db_xref="GeneID:11505449"
     CDS             join(1456429..1458100,1458162..1458280)
                     /locus_tag="MYCTH_2313356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658632.1"
                     /db_xref="GeneID:11505449"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2313356"
                     /translation="MATASVSTPIKSHAGLFSSRTAGGRMPLTPSPCQRSSLVNISSS
                     PFTPETASNDAHRAPSTSVYGGNLAAHFAKSTKNHRDSPKSNIARVAPTPRKVLELGV
                     SDFTLRGTGAHMKTSPSSKDKKPVAVKKQTSKSRITYNSDRFIPNRSASSAISNSGSM
                     KARAREGQQRPRSGEASAVLASAADDALAALEGLNINDDEPPSYSRPSPGTVAYRETL
                     ADACGVNLNTRILEFKPAPPEASKPIDLRQQYNRPLKPANGSSAQFRRRIATAPERVL
                     DAPGLIDDYYLNLLDWSSGNQVAIGLERNVYVWSADEGTVSCLLETSPDTYVSSVKWS
                     GDGAYVGVGLGTGEVQIWDVAEGVKIRSMYGHDTRVGVMGWSKHILSTGARSGLVFNH
                     DVRIAEHKVAELVSHTSEVCGLEWRSDGAQLATGGNDNLVSIWDARSLAVPKFTKTNH
                     KAAVKAIAWCPWNMNLLATGGGSYDRHIHFWNSTSGARVNSIDTGSQVTSLRWSTHYR
                     EIVSTSGFPDNSLSIWSYPTLVRNVEIPAHESRVLHSCLSPDGQMLATAAADESLKFW
                     KIFEKKPGTSSSAGMGLSSKVTTPKHMTIR"
     gene            1459312..1461345
                     /locus_tag="MYCTH_2294640"
                     /db_xref="GeneID:11508064"
     mRNA            join(1459312..1459571,1460098..1461095,1461159..1461345)
                     /locus_tag="MYCTH_2294640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658585.1"
                     /db_xref="GeneID:11508064"
     CDS             join(1459452..1459571,1460098..1461095,1461159..1461243)
                     /locus_tag="MYCTH_2294640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658633.1"
                     /db_xref="GeneID:11508064"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="JGIDB:Spoth2_2294640"
                     /translation="MSNAAVGPVYDTIITEVINAVRVDFEENGVDDSALEDLKKTWQH
                     KLSQMNLAQFPWDPKPEPPPTPASANAPPASAPPSAPPITANYTQSTLSPQSSAQTLS
                     LPGSLHPNSNSVGTKQEPGFTQAEPTIKQEPGLPPAPSGYNPANGVPPIAAQRAASAL
                     HNQYGPRAAKSIAQINSAAQQSHQNQRPGQVPQQHMNPHQQQQQQQQQQQQQQHLNPQ
                     QQYRQNVAAAMQQQRMQQVNRTGPNGLPTSQVDGPSDAAEAASSVTMDRAQIDELLHA
                     QLAARAKQMEGGGLMLPLKQATKDRSVASKQAGATGPAQFDGGLDDDGKSEDDDEDAI
                     NSDLDDPDEMGDDDEDEDDSMGHMMLCMYDKVQRVKNKWKCILKDGVLTVNGKEYVFA
                     KATGEYEW"
     gene            complement(1462804..1464359)
                     /locus_tag="MYCTH_2294643"
                     /db_xref="GeneID:11505669"
     mRNA            complement(join(1462804..1463751,1463835..1464359))
                     /locus_tag="MYCTH_2294643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658586.1"
                     /db_xref="GeneID:11505669"
     CDS             complement(join(1462961..1463751,1463835..1464078))
                     /locus_tag="MYCTH_2294643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658634.1"
                     /db_xref="GeneID:11505669"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="JGIDB:Spoth2_2294643"
                     /translation="MYGAGMYGGYGGYGGGMYGGGMYGGMPGAMPGDPNNPDSLTQRF
                     NMSTQATFQMLEGIVGAFSGFAQMLESTYMATHSSFFAMVSVAEQFGNLRDTLGSVLG
                     IFTLMRWIRTLIAKLTGRPPPADAKALTPASFARFEGRHSPAGEGGPPRPSRKPLFFF
                     MLAAFGLPYVMSKVIRSLAANAEEEERRRQLVASQQTLDPSKLEFCRVLYDFSPATQG
                     QALVQGVDLEVRKGDLVAVLSKSDPLGNPSEWWKCRARDGRIGYLPSTFLEVLRKPGA
                     PIAAIKAAPASESSRTSSLTSTVSAPGALPEAAAAPAKPAAPAPGPVMPSTKVGNVTV
                     ESFQKSQFQS"
     gene            complement(1465257..1466154)
                     /locus_tag="MYCTH_2294646"
                     /db_xref="GeneID:11509105"
     mRNA            complement(1465257..1466154)
                     /locus_tag="MYCTH_2294646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658587.1"
                     /db_xref="GeneID:11509105"
     CDS             complement(1465596..1466069)
                     /locus_tag="MYCTH_2294646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658635.1"
                     /db_xref="GeneID:11509105"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Spoth2_2294646"
                     /translation="MIKVYEGERTMTKDNNLLGKFELTGIPAAPRGVLQIEVTFSLDL
                     NGILEVSAQDKGTGRKETIMISSDGGRLTQHEIARMIAEAEKFADEDREARERIEARN
                     GLESCAFSLKNQFDDEAGLGGQLGGDEKESVRSSYPAWRPAQRINTMLTLPLPPV"
     gene            complement(1466522..1468716)
                     /locus_tag="MYCTH_110187"
                     /db_xref="GeneID:11509125"
     mRNA            complement(join(1466522..1467919,1468003..1468200,
                     1468302..1468716))
                     /locus_tag="MYCTH_110187"
                     /product="eburicol 14a-demethylase"
                     /transcript_id="XM_003658588.1"
                     /db_xref="GeneID:11509125"
     CDS             complement(join(1466777..1467919,1468003..1468200,
                     1468302..1468547))
                     /locus_tag="MYCTH_110187"
                     /EC_number="1.14.14.154"
                     /codon_start=1
                     /product="eburicol 14a-demethylase"
                     /protein_id="XP_003658636.1"
                     /db_xref="GeneID:11509125"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_110187"
                     /translation="MGLIQDLGGPLAEGFSRLGLASQIGVAVGGFVLLSVILNVLNQV
                     LFKNPNEPPVVFHWFPFIGSTITYGMDPPRFFKENRAKYGDCFTFILLGKKTTVYVGP
                     KGNDFILNGKIRDVCAEEIYTVLTTPVFGKDVVYDCPNSKLMEQKKFMKIALTTEAFR
                     SYVPIISDEVKSYFKRSPDFKGQSGIVNICPKMAQITIFTASHALQGKEIRDKFDETL
                     ADLYHDLDMGFTPINFMLHWAPLPWNKRRDHAQRTVAKIYMDTIKARRERGETGAQDI
                     MYHLMNSTYKNGVRVPDHEIAHMMIALLMAGQHSSSSTSSWIMLRLASRPDIMEELYQ
                     EQIKNLGPDLPPLTYEDLAKLPLNQAIVKETLRLHAPIHSIMRAVKQPMPVPGTKYVI
                     PNNHVLLAAPGVSASDEQYFPQPDLWEPHRWEKDHPLAPSMVRNPDEEEEEKVDYGYG
                     LVSKGAASPYLPFGAGRHRCIGENFANLQLQTIIAETVRMFKFRNVDGSDKVIGTDYA
                     SLFSRPLEPANIYWEKRDKQ"
     gene            complement(1469695..1471829)
                     /locus_tag="MYCTH_2294650"
                     /db_xref="GeneID:11512832"
     mRNA            complement(1469695..1471829)
                     /locus_tag="MYCTH_2294650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658589.1"
                     /db_xref="GeneID:11512832"
     CDS             complement(1469798..1471714)
                     /locus_tag="MYCTH_2294650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658637.1"
                     /db_xref="GeneID:11512832"
                     /db_xref="JGIDB:Spoth2_2294650"
                     /translation="MPPTLDLSTNSHTKVVVAPPRINLRRAASYQHDRGPLSSTSSRF
                     SFNHLVFSPPPSPGLPSLSPPAKKPSGRLFGTVRPLRIIRYAIRLLSIVVVFFVALEV
                     LTWLFGEPVPATAPTEAARPVEEAEKETGMVSQQTAPDFPTPMVITDHRGRAKWTVSI
                     PPGSEFPLTMNQYADMCSKCQQVAERTRYLRSHGHGLHQLSLGFGSDSADDFIDVQEA
                     EKAGYLPGPEKPSGSSQEPDAAGGTVCRKSLTFVLESTDAGLGKTLMMLWMAYGIAEK
                     EGRAFFVDDTRWAYGKFTSIFQPPPLPGCSAPPSHEILPCPRHARHLVASAATMDVLF
                     GSLTENADPPSESHDRAQRRAQFSLARRGYEALSRLNEEDSAYVDARIRELNAKRLVP
                     ESNGQRNGLAVGVHIRRGDRHPLELQYRHSYMPLNLYTDTAHQIIETYFNQTGGGLLG
                     GSADDQGAAAAAKEQSIVVLASDDPVVYDSPELVAAATGHTSTSRHHRAQERIKLASK
                     EAIKEVSTRKSVMRKFVDETFGWEGGFFAAMFWNLGVSSAARSTSASATTAALAPTDT
                     TPSAETLRLRSLVGRAYMMDLAVLAGASDVVICTVSAVGCRLLAVMMGWESAIERGNW
                     VNIDGGYGWLGLEW"
     gene            1475181..1475875
                     /locus_tag="MYCTH_2294653"
                     /db_xref="GeneID:11511546"
     mRNA            1475181..1475875
                     /locus_tag="MYCTH_2294653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658590.1"
                     /db_xref="GeneID:11511546"
     CDS             1475528..1475695
                     /locus_tag="MYCTH_2294653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658638.1"
                     /db_xref="GeneID:11511546"
                     /db_xref="JGIDB:Spoth2_2294653"
                     /translation="MFLEFLRGTLQWRPENWKTAKELSDDPWLSSWLATHHCYGVIRV
                     PRSPALASRKV"
     gene            complement(1477483..1481025)
                     /locus_tag="MYCTH_2294655"
                     /db_xref="GeneID:11511690"
     mRNA            complement(join(1477483..1479932,1479986..1481025))
                     /locus_tag="MYCTH_2294655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658591.1"
                     /db_xref="GeneID:11511690"
     CDS             complement(join(1477666..1479932,1479986..1480760))
                     /locus_tag="MYCTH_2294655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658639.1"
                     /db_xref="GeneID:11511690"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Spoth2_2294655"
                     /translation="MSTALPRPSRPSNGPPTIALPALPVNKTRKNTGNLAAPSSKSTP
                     TTPKSSGLRAPSTALLPPASPNPAGSLPQPRSASGVNSAGKTIRKTVSINSFPQPPRG
                     DSRISSLPPSPLSTSAPSRKSRAPTTPNPQLSSATPSFLNGTGEGKSISRQPSTRNSD
                     GLTSVASPPQSRSSSAQDSYSTSATQYDDVNDTAPPKSDSAVSGKRASKADGKGNVIV
                     SVRVRPDLSGHDNAPNPDWVIDGRKSLIAYRGKEGGDYYYDNVFATHDDNYRVYDHIA
                     KRLVRRVMEGYHGTVFAYGMTGTGKTFSMQGTASSPGVIPLAITDIFSYIRETPSREF
                     LLRVSYLEIYNEKIHDLLSMPTGNNPGAQQEEIKLREDSKRGVYATPLKEEIVQSPTQ
                     LLRVIARGDQARRTASTQFNARSSRSHAVVQIVVESRERIPTSGDNKRQGLLPGGVRV
                     STLSLIDLAGSEKAAESKERRQEGSHINKSLLTLGTVIAKLSEQKEGKGGDKDAKHLP
                     YRDSKLTRLLQGALSGNSLVSILCTISIGPGAGPAASATNINETLNTLKFASRAKNSI
                     VSHAKRAEEALGVGGDGNARVLLERYRMEIMELRKELENQAKANSKRELDEERARDAE
                     EERAREREAELRHEEQMLEMQLARTALKERIDHLNRLILSSKSIGVNASGSYSALGIH
                     HRYSQGSIRSSMATSNGTKFGLERTESMTSSASTIGRKSASHRSSGGPEPPALDDEES
                     TGEYGDGTASLASQNRALQADLADKNRYIQTLEKRLLQARRASSSRASIGLSSKGIMV
                     GEDHSVAALIKEKDAEIAELRARLDDKDRMLAALRSAARCRDNADRVESRVESRSEVR
                     TSQILDSNPGPAPTGSPPAAPPSLLRQVSHLRKRTKSVDEMSRMLDEMIQDRVESGHL
                     IRGARGSVRIAPAVASSPLDKPPAIAGRSGSGSSGDSGKVALSPSTSFGPPPSLPPSG
                     PPPPSPQAPPVSRPPIQLQLLSRQRSSFAASEPQKSLALEV"
     gene            complement(1485021..1486686)
                     /locus_tag="MYCTH_2294657"
                     /db_xref="GeneID:11508387"
     mRNA            complement(1485021..1486686)
                     /locus_tag="MYCTH_2294657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658592.1"
                     /db_xref="GeneID:11508387"
     CDS             complement(1485139..1486467)
                     /locus_tag="MYCTH_2294657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658640.1"
                     /db_xref="GeneID:11508387"
                     /db_xref="JGIDB:Spoth2_2294657"
                     /translation="MTLHSVLGIPRVKKRSSSSATKRSSSSATPTWTASLARTKPGTG
                     TTRTSSNKAVQPRDDSSDRYHQRLPNLGPASLPVPLPSLPTSGGTASASAPNPVEIHE
                     HILATMFSPLPGNGTGKGLGSARIAAVLQFRAAVPRVVSVPHLLQALRSCSSSSSSSS
                     SSSPAAAERAIAATVRRGEGRRVRIPTLAGGAAGAELFVRAAELEALVGRCAALREDR
                     VGDRFLAWLGQNPGRERLVEGEGGLGRREVDALVKAGFLTAVNGHGTCGGGSATGGAA
                     LRARPEARYNTVSLETVARAAAGSAAAVGGEGVLHAAGGTGARRLGPAAEEPAGSEFS
                     VAVPGSGVFLKLASAALEHLADLLRRTPYRELPESDLREKWDGGVVGDSDIAQAKKSR
                     GEFAGVMPGRTKKWKEFHGLAFDWVLREAVGAGMVEVFETQTVGRGVRLV"
     gene            complement(1486764..1491042)
                     /locus_tag="MYCTH_2294661"
                     /db_xref="GeneID:11505566"
     mRNA            complement(join(1486764..1488721,1488779..1489325,
                     1489389..1489531,1489581..1491042))
                     /locus_tag="MYCTH_2294661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658593.1"
                     /db_xref="GeneID:11505566"
     CDS             complement(join(1487088..1488721,1488779..1489325,
                     1489389..1489531,1489581..1490610))
                     /locus_tag="MYCTH_2294661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658641.1"
                     /db_xref="GeneID:11505566"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Spoth2_2294661"
                     /translation="MSSPGLGRSWRRSPSFASSHSQEEEPPSASSQLQLSRKTSNDGK
                     LLSSSAGSVTYREPLRSFIHGTVRGRLGEAPCQSLRGRADADNQGPAPLDSAESARSV
                     REETAEIADYFLSDKPDARSSPFPRRAQSASSPKPRPSVESPGPESGPSRSTDTIAEV
                     SEPPSPQDTHEPAGPSMLTTMLKRSPPDKDNFIAPKEPNSHEGGVPAEETDDEEGAPL
                     SRVQTVEYRPLDARPDHSDNTNETSPLLAAAAWERSGGSYGAGDQDHQDADLEGRKSL
                     HRKKWLARTADSLRETGARVVIILPTIGNPKRWDRHLLWENVVVAPIACLPAVVVGLL
                     LNILDALSYGMILFPLGSPIFASLGSAGISMFYVSCIISQLTFSSGSIFKGGVGSELI
                     EVVPFFHNMAGTITEIVGQENPDAVIATTITSYALSSMLTGAVFYLMGKFKFGYLVGF
                     IPRHILIGCIGGVGWFLIATGFEVTARMDGKFSYNLDTLKRLMQADTVPLWIIPLTLA
                     VILFYGQSRITSKYFLPLYILMIPAVFYAVTGALNLLNPDTLRDSGWIFEGPPAGEPW
                     WYFYTLYKLKLVHWGAIAQCIPAMFALTFFGVLHVPINVPALALNTGEDHANLDHELK
                     LHGYSNFLSGAAGSIQNYLVYSNSLFFMRSGGNTRLAGFELALFTFLVMLIGPSLIGY
                     IPVMMVGVLIFDLGFELLLEAVWQPRKKLKPVEYFTVLVIVLVMGTYDFVVGIGVGIL
                     LAFMSLTFQTSRVSAVRASYSGDIVGSTVRRNPTQQHYLRQVGRQINIIKLSGYLFFG
                     TIVGVEDRIRVLISDEEFKRRPIRFLVLDLWLVTGVDYSAAEVFNTISRLLDSKGIEL
                     VVSGVDPEHGLGRNLRAVGLGEDGVEVKLLPELNSALEYCENELLKTLFVNQEDSDST
                     LTTSTANLDVPNQPCALASSAVMLGSSPRRDHLREVARKSLGQVKAKRPTRWQSFKEP
                     LRLMLQIFRDVSDKNEDFWFRAVRYFKRAHHATGTVLFRRGERAEAFYLIESGILRAE
                     YDLPQGWLFESIVAGTTCGELPFFSETNRTATCVVEREAVVWVMDRESWARLQKEEPG
                     VAQELLRISLKLTSERMSVITSYTLTMAG"
     gene            complement(1491944..1493123)
                     /locus_tag="MYCTH_2294663"
                     /db_xref="GeneID:11508945"
     mRNA            complement(join(1491944..1492044,1492117..1492634,
                     1492701..1493123))
                     /locus_tag="MYCTH_2294663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658594.1"
                     /db_xref="GeneID:11508945"
     CDS             complement(join(1491951..1492044,1492117..1492634,
                     1492701..1492733))
                     /locus_tag="MYCTH_2294663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658642.1"
                     /db_xref="GeneID:11508945"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="JGIDB:Spoth2_2294663"
                     /translation="MPMYGDLGNKLVQHAKRTQNLAHLPPYQTELVRAVTREVRDLDK
                     DVASLLEPFQGSFDPSADQATACTLLVNHLSMRRNKRCLLAYHRTRTDKLEELVWKGV
                     DILDFAGQQAGGANGALAAESGGSSSLSPQEEDYVRQYGDLLAAYKGQWTDIDLTGSL
                     EPPRDLFIDVRVLKDAGEIQTEYGAINLTKNSQFYVRQGDVERLIAQGYLQKLG"
     gene            1493873..1496568
                     /locus_tag="MYCTH_2294664"
                     /db_xref="GeneID:11509126"
     mRNA            1493873..1496568
                     /locus_tag="MYCTH_2294664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658595.1"
                     /db_xref="GeneID:11509126"
     CDS             1494003..1496429
                     /locus_tag="MYCTH_2294664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658643.1"
                     /db_xref="GeneID:11509126"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="JGIDB:Spoth2_2294664"
                     /translation="MQARLQLAASTASRRLAAASRGGSLRQPQIPRSLSAAPRITAAT
                     NSLRLLPSVAIRTYSNGRPHPPGGTHRMNLGGEPEKPALEQYGVDLTAKAKAGKLDPV
                     IGRSAEIQRTIQILSRRTKNNPVLIGSAGVGKTAVLEGLALEIVRGAVPESIKNKRVV
                     ALDLGSLIAGAKFRGDFEERLKKVLTEVQQSNGEVILFIDELHTLLGLGKAEGSIDAS
                     NLIKPALSRGELQCCGATTLAEYRQIEKDVALARRFQPILVSEPTVQDTISILRGIKD
                     KYEVHHGVRITDGALVAAATLSNRYITDRFLPDKAIDLMDEAASSLRLQQESKPEDIL
                     RLDQKIMTVQIELESLRKEKDVASKERREKLEADLSKYQEEARALSEKWEKEKAEIDA
                     IKQTQAELDKARIELEMAQREGNFARASELRFGVIPNLEKKLPKDGERPADEGALIHD
                     SVTADDIANVVSRVTGIPVSKLTSGHTERLIHMEDILRESVRGQDEALKAVADAVRMQ
                     RAGLSGENRPLASFFFLGPTGVGKTELCKKLAGFLFSTESAVVRFDMSEFQEKHTISR
                     LIGAPSGYVGYEDAGQLTEAVRRKPYAVLLFDEFEKAHRDISALLLQVLDEGYLTDAQ
                     GHKVDFRNTIIVLTSNLGADILVGADPIHPYQETADGEIDPKVKSAVMDVVSSQYPPE
                     FLNRIDSFIVFKRLSLPALRDIVDIRLRELQERLGDRRITLSAADDVRQWLAERGYDP
                     KFGARPLNRLITTQIGNGLADKIIRGEIKTGDTAVVTVNDDKNGLTISALHGGAGDGG
                     AAEQETAATA"
     gene            complement(1497074..1499027)
                     /locus_tag="MYCTH_2313362"
                     /db_xref="GeneID:11508837"
     mRNA            complement(join(1497074..1497716,1497772..1497837,
                     1497896..1498140,1498232..1498436,1498914..1499027))
                     /locus_tag="MYCTH_2313362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658596.1"
                     /db_xref="GeneID:11508837"
     CDS             complement(join(1497630..1497716,1497772..1497837,
                     1497896..1498140,1498232..1498388))
                     /locus_tag="MYCTH_2313362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658644.1"
                     /db_xref="GeneID:11508837"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="JGIDB:Spoth2_2313362"
                     /translation="MGLGGSKMWSWLSLLMKQKEMRILMVGLDAAGKTTILYKLKLGE
                     VVTTIPTIGFNVETVEYRNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRDR
                     VPEAREELQRMLNEDELRDALLLVFANKQDLPNAMSVAEITDQLGLHSLRQRTWYIQS
                     TCATLGDGLFEGLDWLAQEIKKHN"
     gene            <1499673..>1500535
                     /locus_tag="MYCTH_2122256"
                     /db_xref="GeneID:11508137"
     mRNA            join(<1499673..1499873,1500034..1500429,1500518..>1500535)
                     /locus_tag="MYCTH_2122256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658597.1"
                     /db_xref="GeneID:11508137"
     CDS             join(1499673..1499873,1500034..1500429,1500518..1500535)
                     /locus_tag="MYCTH_2122256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658645.1"
                     /db_xref="GeneID:11508137"
                     /db_xref="InterPro:IPR000348"
                     /db_xref="JGIDB:Spoth2_2122256"
                     /translation="MFLQTAAKLLLSASLLLSSAVAHNIQLPAHGRECFHENLHSGDK
                     MTVTFQVGDREFGSAGNLDIDFWITNPVGGYEVNDKSVSNGDFTFNARHDGKYVYCFG
                     NEHWGASSKEVSFNVHGIVYVSEADAPQDPLEAEVRKLSDMLERVKDEQAYIVVRERT
                     HRNTAESTNSRVKWWNIFVIGVVIGESVFQVWWLRRFFEVKRVV"
     gene            complement(1500514..1503893)
                     /locus_tag="MYCTH_2294675"
                     /db_xref="GeneID:11508405"
     mRNA            complement(join(1500514..1503733,1503821..1503893))
                     /locus_tag="MYCTH_2294675"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658598.1"
                     /db_xref="GeneID:11508405"
     CDS             complement(1501065..1503701)
                     /locus_tag="MYCTH_2294675"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658646.1"
                     /db_xref="GeneID:11508405"
                     /db_xref="JGIDB:Spoth2_2294675"
                     /translation="MGLLPFKLFRSRETRTQQLPLYKEVPAPRTRKAKPRTPRSPVKE
                     RYSDSEDSSDVSDDGNTTDSSTSSSGSSRRTSSSASSAAAPMLSKRRPVAPPRRAPVR
                     RYLYRLPNRVIRFLCFGMMSTIIIFIFILVRASQIENRRMAEGKVEKKPVPPPWEQFE
                     FLTRYYGGVKTILPLADNTPQYPRLEEEGPYNASYPQEKQQQQQQQDAKVPPSKAFVD
                     YPGAGFPKPADGIRECFLDSQNTLKVPSIRYFEGRPHGFPDNILGSYELLSLPGDICF
                     DRYGRYGPYGYGYSVRTGGLGIGEHGDREGSEAVWKSDRRIDWRNIDWAAAQRQCYKA
                     NAERFKPLTVREAPPRGFYIGDGLEIPKLATRQQDDQDQPLATDEEPGSEELPRTAVV
                     LRCWDEFPWREEDIVNLRALIAELSLASGGRYDVHLLVQVRNDARNPVWADDDEYRSR
                     INETIPKEFRGIATLWSETQMLAVYQGIRDLWTRGPDLPVHGSYRGLQMAMQHFAYNH
                     PEYDYFWQWEMDIRYTGHYHDLLSKLELWAKDQPRKGLWERNGRFYIPHVHGSWEDFK
                     QMARVQTEHGTVTADNIWDSVQIANNGGGDGGGGGGSSSSSKLGERLATPKSEQSVWG
                     PLRPDSPADWFEHEDDPEPPTTYERDKYTWGVGEEADLLTLSPIFDPDGTTWKLADDI
                     TGYNETGGKPPRRAQIITASRMSRRLLLTMHRETAFKKHHAFPEMWPATVALHHGLKA
                     VFAPHPVFVDRVWPPEYMARVLNAGRNGASGGGRASVYGEREHNMRGLTWFYNAGFAG
                     NLYRRWLGLRVNNDGGEEFETTADLSKNETSVGTMRGGEGRMCLPPMLLHPVKEVDLP
                     VERGHPQEEEAAPPPPALDPAA"
     gene            complement(1505822..1508633)
                     /locus_tag="MYCTH_2294679"
                     /db_xref="GeneID:11505749"
     mRNA            complement(join(1505822..1506225,1506331..1507554,
                     1507641..1507969,1508046..1508119,1508212..1508266,
                     1508411..1508633))
                     /locus_tag="MYCTH_2294679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658599.1"
                     /db_xref="GeneID:11505749"
     CDS             complement(join(1506006..1506225,1506331..1507554,
                     1507641..1507969,1508046..1508119,1508212..1508266,
                     1508411..1508455))
                     /locus_tag="MYCTH_2294679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658647.1"
                     /db_xref="GeneID:11505749"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="JGIDB:Spoth2_2294679"
                     /translation="MASTMAWRRLAAAPALSRAARNPIRAFSTTRPVARVIANGPLRA
                     KEASPFVSSKYPVIDHEYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVA
                     AQGGINAALGNMHEDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPF
                     SRTEDGKIYQRAFGGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIE
                     YFAIDLIMQDGECRGVLAYNQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDG
                     MAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTA
                     KDLASRDVVSRSMTMEIREGRGVGPEKDHIYLQLSHLPPEILAERLPGISETAGIFAG
                     VDVRKQPIPVLPTVHYNMGGIPTRYTGEVLTVDENGNDKVVPGLFACGEAACVSVHGA
                     NRLGANSLLDLVVFGRAVSHTIRDKFTPGAKLKPIEADAGAQSIETLDKIRNSNGPKS
                     TAEIRLAMQKTMQREVSVFRTQESLDEGVRQITEVDQMFSQVGIKDRSMIWNSDLVET
                     LELRNLLTCAVQTAVSAANRKESRGAHAREDYPERDDKNWMKHTLSWQKTPHGKVELS
                     YRRVIDTTLDENECKPVPPMKRVY"
     gene            complement(1509020..1512552)
                     /locus_tag="MYCTH_2294684"
                     /db_xref="GeneID:11508034"
     mRNA            complement(join(1509020..1509745,1509829..1509868,
                     1509977..1510672,1510730..1510983,1511046..1511134,
                     1511202..1511499,1511564..1511872,1511940..1512169,
                     1512254..1512552))
                     /locus_tag="MYCTH_2294684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658600.1"
                     /db_xref="GeneID:11508034"
     CDS             complement(join(1509089..1509745,1509829..1509868,
                     1509977..1510672,1510730..1510983,1511046..1511134,
                     1511202..1511499,1511564..1511872,1511940..1512169,
                     1512254..1512410))
                     /locus_tag="MYCTH_2294684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658648.1"
                     /db_xref="GeneID:11508034"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2294684"
                     /translation="MVSVSSADTPQDSSQNNKMPPVLSTELPVRAASDPASDPAPKTQ
                     ALTGKQEHYLKRELISEQVKWEISELNSPTALRRFGAPFKSDYGEVSPLDSELPILRY
                     IFVHHVREFPFLDKAKEKEFWQDKLQVFLESFASKHISSSEDRLEETKRRKLATKARK
                     LVELMMVSGIPTSSGFEERIRFSELEIVDANAIDSGVLKTLPEGNYLNGWDVNVAGVR
                     MITVKRKLRSHEHAVFLLRVRRKNAPEHYVGRRFGDFARLHKRLRTELPGKVLPPLPQ
                     KNKTHSTAPGIIGSHSGNESETSSISSASTQIPNSPLPNGCGHQSDTPQRLLSVRDRR
                     SADRISPRNSVDDRPVSPGLPSPKPQETVVIYRENQRISLRAFLRTLLQNPQIAGTKA
                     MEEFLLANPVKLTDEDWDDIARRKHVDKKRVEEQKRFYEVARKRAAELDVYMEQFRQD
                     IVERNGLTMLFQEIRDKETIQDLSLQYQKFAEWLRIEVAATIYHLFLAEDNSPELFAQ
                     AKRIHSLIPYTLVKNAIRIANPAAVMSSILDIFLAQPFGTRSLMQRIFSMTLHDGIRA
                     FQRSIDALGDKIGDPVFVEKLKTYTNADEQIKQVIRDEAADENIDVLVAILRSELVGP
                     ALEPEQIERLYNAYAAFNNAVENVDEELRQGAQLFSYLKQLQKLYLRQRDKAMIVTDF
                     AHFVDDLITVVEKCREQDASADPNQTVQAFIDLCQRHENHFYSFVHQVHTHDNGLFTQ
                     LMGWVEGILEFLRHGPKNGSLDINALFEGAVSSALIDREKAIAEIDKLIAWQEARKKW
                     HHDKTRQKMAAEGGPGDADAVAPPGALTFRSSDFGLDQEDVAEMGYDDDSEEEAEAEE
                     EDEMDPIDAERKRRARRQARLRRNAGEPEKPEVSEVHKLKDNFLAMLRVVLAE"
     gene            complement(1513534..1514924)
                     /locus_tag="MYCTH_2294689"
                     /db_xref="GeneID:11508177"
     mRNA            complement(join(1513534..1514350,1514414..1514924))
                     /locus_tag="MYCTH_2294689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658601.1"
                     /db_xref="GeneID:11508177"
     CDS             complement(join(1513687..1514350,1514414..1514790))
                     /locus_tag="MYCTH_2294689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658649.1"
                     /db_xref="GeneID:11508177"
                     /db_xref="JGIDB:Spoth2_2294689"
                     /translation="MSQNGGDTTKSSSPGRPRHQITRSISEISSPIRLHRRHSYRAGN
                     EGERESRASAPQSAILAVQGKRSFELPRSEGVTPNLTPSASRRTSVLYASADEGMPAA
                     EAPKENVLLNGLSREQQHAAARESGLQRSLAELGSFATTTTKQLDDAYYAFVEKLSAL
                     QGTIIALKELCERSRQLNDRFNTEADDLVTDISAQLDTFRQFEDQQKRIELLQGRIQA
                     GRERIKSLSERVDAVSTRIESWERADREWQEKTRKRLKAIWVVTSVVFFLVLSLFIGF
                     QYVPENAESKTIHVASQGLTSIRDSSGADPEASPSAQKSEPYGNGWSLNRTRSLGQSS
                     QMVDMLRAFDEL"
     gene            complement(<1515472..>1515957)
                     /locus_tag="MYCTH_98838"
                     /db_xref="GeneID:11508176"
     mRNA            complement(join(<1515472..1515612,1515675..1515820,
                     1515882..>1515957))
                     /locus_tag="MYCTH_98838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658602.1"
                     /db_xref="GeneID:11508176"
     CDS             complement(join(1515472..1515612,1515675..1515820,
                     1515882..1515957))
                     /locus_tag="MYCTH_98838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658650.1"
                     /db_xref="GeneID:11508176"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="JGIDB:Spoth2_98838"
                     /translation="MSTTAVTAAATPEGTVTKPLGMRKNGKQWHAPKKAFRPGSGLTP
                     YEQRAKARVAQAAAKAKEKELKEEKEAERKRRIQALKEKRAAKEEKERYEQLAAKMHK
                     KRLERLKRKEKRNKLLNS"
     gene            1518659..1521859
                     /locus_tag="MYCTH_2131574"
                     /db_xref="GeneID:11505512"
     mRNA            join(1518659..1518731,1518794..1518893,1518981..1521859)
                     /locus_tag="MYCTH_2131574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658603.1"
                     /db_xref="GeneID:11505512"
     CDS             1519043..1521499
                     /locus_tag="MYCTH_2131574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658651.1"
                     /db_xref="GeneID:11505512"
                     /db_xref="JGIDB:Spoth2_2131574"
                     /translation="MFLSPPQSPSAPSSPRLAATRPPGHGHRRGGSEFVGGSIRDGEA
                     ITVTNISPTKSDSGIASPSLQPTRPRRGHAHRRSAAISSHDLSSIIVPPPNSTKGGSA
                     PPSPAPPKQFSIQNCSADDQPVDNGNVEPVSAPDLAAHQPNSHVPPSPKPDQTPKSAI
                     RNRVGFSDTLEYIPRPLSLASNDTSSTVTARPGHSVSGSISSVISATNADREVNPFPG
                     SASAQKPSESRPSTAGAIMERTQSAHEQDPNLLSPRRRGSIPLLGSLPSGIPLSPATP
                     SPTRSSKKWSLFGRDSFVSPSPTRTQADSPRSAHSRLSVAEGNSTERAADVLLADFAE
                     SPEPPKPLTKKRSKKKKKVKTWAGSILTRKGKYHYGKKHKRRAPTPTPPRRFEPAEGE
                     DDGTVQMPTETEAPCSQSSENGDWKSWTFPKPAQNQDEDTSYPMIDLDAALGPFNTPL
                     PRNPEWEAAQKAGGLVKKQLHSAAGMSRFTGPGMHYYHRRAESAPELVPFEGGRFGFR
                     RFGSSSSMADVFEEDEEEEEESCKSSINASTPAAGTSTAGKPDDGAQRGNQPSSEPAV
                     APPSAQDSREGSAENNVVASTAEPATTQPAVSKCDETSLAEPVPPFAMEVSGSSPGYA
                     NSGSSTPSPRHVFRPKELAPVEVSPLNLPTASLGPVSPWSLTQSSAFPSPRSPMSYDA
                     QCISTAPSSVTEDNFQSLLMGEPGPEVRISVDDIPSLTSSNSTMTRESLFAQHPQARQ
                     PPLNEQPRPASFTSTAFGRRRSSLASLSRLINSSHGERSKLSIEVPMEREPEKKTKGS
                     KSKRLSRMMQFWKSKGENTR"
     gene            <1522385..>1523112
                     /locus_tag="MYCTH_2037019"
                     /db_xref="GeneID:11508036"
     mRNA            join(<1522385..1522562,1522814..>1523112)
                     /locus_tag="MYCTH_2037019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658604.1"
                     /db_xref="GeneID:11508036"
     CDS             join(<1522385..1522562,1522814..>1523112)
                     /locus_tag="MYCTH_2037019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658652.1"
                     /db_xref="GeneID:11508036"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2037019"
                     /translation="SSALPRSAVRRLLKELDTWTTIESPTEQGIERLGPAGDGEDLLR
                     WEAVINGRGVGCGYENGRWLLQITIPPTYPLHPPQMRFATPIVHANVALQTGEICLDL
                     LKDAWTPAYSVLECVRAVRMLLSAPGIDSPLNVDVAALLRDGDALGARRLVELWVEE"
     gene            complement(<1523954..>1525131)
                     /locus_tag="MYCTH_2106248"
                     /db_xref="GeneID:11508769"
     mRNA            complement(join(<1523954..1523974,1524031..>1525131))
                     /locus_tag="MYCTH_2106248"
                     /product="glycosyltransferase family 62 protein"
                     /transcript_id="XM_003658605.1"
                     /db_xref="GeneID:11508769"
     CDS             complement(join(1523954..1523974,1524031..1525131))
                     /locus_tag="MYCTH_2106248"
                     /note="CAZy_ID 267841"
                     /codon_start=1
                     /product="glycosyltransferase family 62 protein"
                     /protein_id="XP_003658653.1"
                     /db_xref="GeneID:11508769"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="JGIDB:Spoth2_2106248"
                     /translation="MARPMGSVRLKKTSPATLAVGVALCIFIIYFLIGPSTPNFSPSR
                     KAAAAAHHLSPPTSPFRKPTGDKQKQKPPPVAHYNLNNVTTTPNPLENRENILILTPM
                     ARFYPAYWDNILRLEYPHELITLGFILPKTKEGNEATRELQKRITKTQKHGPEKDRFK
                     SIIILREDIDPPLVSQDEKERHKLENQKVRRAAMAKARNSLLYSTLGPSTSWILWLDA
                     DVVETPPTIIQDLASHDQAVMVPNCFQRYWNEEKQMMDERPYDFNNWQDSPTALDMAK
                     KMNPDDILLEGYSEMATFRTLMAYMSREDGRLHEEMPLDGVGGAALLVKADVHRDGAM
                     FPPFAFYNLIETEGFAKMSKRLGWQPVGLPNYKVYHYNE"
     gene            1525835..1527934
                     /locus_tag="MYCTH_2294698"
                     /db_xref="GeneID:11508145"
     mRNA            join(1525835..1526069,1526141..1526210,1526285..1526798,
                     1527116..1527934)
                     /locus_tag="MYCTH_2294698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658606.1"
                     /db_xref="GeneID:11508145"
     CDS             join(1526019..1526069,1526141..1526210,1526285..1526798,
                     1527116..1527644)
                     /locus_tag="MYCTH_2294698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658654.1"
                     /db_xref="GeneID:11508145"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="JGIDB:Spoth2_2294698"
                     /translation="MSITPIITFKAGICDVDQSSKPYKVKPQPTPGYIYLYSEDDLVH
                     FCWRPRSAPLDRPELDLVMVPADGNFVPYDTRTPSHPSSKTNGRIFVLKFASSSQRHL
                     FWLQSKPQGRSGDAAWLSPRDLKIGDIVDRLLQGEEVDVNRELASVRNNNNNSRRDAD
                     DDETMEDVEGHGDSHRRSPGGGGGGAGPDATGGDFREEGEDAREGGADGARAVSNDAA
                     TAVRNFLESLKGAPGLGGINRAEGKAYPLLTDLLDTSTTIPMLEAATDEYVDSLLGYI
                     PPTVLVLAQPGDRGDAIEREPGPESVEAAKQAMSSSQKRDLLKKVLRSPQFSQSLASL
                     TMALRDGGLPSISEALGIAVENGGLVRGGTVPLGGGDAVEAFVEGVKKTVQKK"
     gene            1527936..1529869
                     /locus_tag="MYCTH_2294700"
                     /db_xref="GeneID:11513079"
     mRNA            join(1527936..1528455,1528682..1529869)
                     /locus_tag="MYCTH_2294700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658607.1"
                     /db_xref="GeneID:11513079"
     CDS             join(1528174..1528455,1528682..1529686)
                     /locus_tag="MYCTH_2294700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658655.1"
                     /db_xref="GeneID:11513079"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294700"
                     /translation="MAEAEYWTFPTNPEEFDQDERISYSKLDNKYIAVQDDGTEYEFD
                     EGLRRWIPIVDEALIEEQQKGYIMPNSAAQDDRQELAQGKKRKLDSNDREDSNYSNNN
                     NKARPFKAARRQGNRGPPQPKQNTAVYVTGLPLDATVEEVAELFSRKCGVIAEEIDSG
                     RPRIKMYTDENGNFKGDALIVFFKPQSVDMAIMLLDDTDFRFPVPGAPSNGPKMRVQA
                     ADSSYKKTKYDGENAAGSGEPGTGAGPSDQNSNNNSSSSSSNNNNNNNANNNSSSNQQ
                     RSSQDKAKIIKKTQKLSAKLADWSDDDDPSALREAVNPKYQRVVILRNMFTLDELRED
                     PAALLDIKEDIREECAKLGPVTNVVLYDEEEDGIVSVKFRTREAAEACLRLMHGRAFA
                     GRIVEAYLATGRERFRKSKGDKGGGKGSGGDASDEE"
     gene            complement(1529961..1532433)
                     /locus_tag="MYCTH_2141429"
                     /db_xref="GeneID:11513311"
     mRNA            complement(join(1529961..1530328,1530397..1531879,
                     1531942..1532124,1532226..1532433))
                     /locus_tag="MYCTH_2141429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658608.1"
                     /db_xref="GeneID:11513311"
     CDS             complement(join(1530173..1530328,1530397..1531879,
                     1531942..1532090))
                     /locus_tag="MYCTH_2141429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658656.1"
                     /db_xref="GeneID:11513311"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR013982"
                     /db_xref="JGIDB:Spoth2_2141429"
                     /translation="MADHQRIAIVSVYDKTGLLDLAKGLVQHNVRILASGGTARMIRE
                     SGFPVEDISAITKAPEMLAGRVKTLHPAVHAGILARNLASDEKDLAEQNIDKVDYVIC
                     NLYPFKDTVAKINVTVPEAVEEIDIGGVTLIRAAAKNHARVTILSDPKDYAEFLKELE
                     TGEIKEESRKLYALKAFEHTADYDAAISDFFRKQYAADGKQYIPLRYGANPHQKPASA
                     YVKEGELPFKVLCGSPGYINLLDALNSWPLVKELKKALGKPAAASFKHVSPAGAAIGL
                     PLTADERKVYMVDDIPGIETSGLAQAYARARGADRMSSFGDMIALSDVVDVPTASIIS
                     KEVSDGVIAPGYEPAALEILKKKKGGRYLVLQMDPEYEPSKTETRTVYGINLTQGRND
                     VEISPESFKTIITPKNSGPLPESALRDLTIATVAVKYTQSNSVCYAARGQVVGLGAGQ
                     QSRIHCTRLAGDKADNWWLRFHPRVLGIKWKKGTKRPDKSNAIDLLVSGQLPKSGPER
                     ELFEAAFEEVPPAFTEEEKSEWLSKLTDVVVSSDAFFPFTDNVYRAARSGVKYIAAPG
                     GSQNDLPVFETAEKLGITFVEQNIRLFHH"
     gene            complement(1533351..1536029)
                     /locus_tag="MYCTH_2294705"
                     /db_xref="GeneID:11513313"
     mRNA            complement(1533351..1536029)
                     /locus_tag="MYCTH_2294705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658609.1"
                     /db_xref="GeneID:11513313"
     CDS             complement(1533439..1535709)
                     /locus_tag="MYCTH_2294705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658657.1"
                     /db_xref="GeneID:11513313"
                     /db_xref="InterPro:IPR008313"
                     /db_xref="JGIDB:Spoth2_2294705"
                     /translation="MALPFLTGSRRGRFITLALLFITLVLWFTYQTPLSTVVPHDAFD
                     LHKDPQYPDAAPDVARPPHDPQDHATPEHDHPAQEVEKPKDAASPPLTSTGGDAGEGS
                     EKAESEPRPGESTTSTAAEQTKAPEETENAKETGKAKETGQAKETDEAKKTGTATTAT
                     AAATAEPSVECVDFETLQRQKPGPLSEGRRKFPYVRPPPECRKFRLPALEALIERMRK
                     VIRDPDLFRLFENSYPNTLDTMVKWRGYATRKDEETGETVETDEELTYVITGDIDAMW
                     LRDSASQVYSYLPLLEASDDRDSLASLWRGLINAHARYIIISPYCHSFQPPAESGIKP
                     TNNAAYHQNHPFPAYDPELVFDCKWELDSLASFLQISTAYYRRTGDLAFFAKYSWVDA
                     VEAAVDASAAMRRGTYDEDGRVLPSAWTFTGWTNRGSETLTNDGLGNPVRENGMVRSA
                     FRPSDDACIFQLLTPSNMMWAAYLEQASEIMQGLADGGLHAKAANLTTEMRKLAGGIR
                     RGIALDAVVHHRDFGDIFAYEVDGYGGVNLMDDANVPSLLAMPLWNYTRPAAAPGSRM
                     VRSAKHAARSEEGDDNKDGDAAAAAAGKKTEAEEEEEEEEEEEEEEEKKHDYAKVYQN
                     TRRFVLSTANPYFAKGPALSAVGGPHLGPGKGWPMAAIVAGLTAFEDLAGFETAQERD
                     AAVAEQLFAVLNSTAGTGVVHETVNAWDERQWTRAWFGWANGLFGELVLRIAVDEEKR
                     GVLGSEEGLLGRLWQD"
     gene            complement(<1536513..>1538696)
                     /locus_tag="MYCTH_2037035"
                     /db_xref="GeneID:11508497"
     mRNA            complement(<1536513..>1538696)
                     /locus_tag="MYCTH_2037035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658610.1"
                     /db_xref="GeneID:11508497"
     CDS             complement(<1536513..>1538696)
                     /locus_tag="MYCTH_2037035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658658.1"
                     /db_xref="GeneID:11508497"
                     /db_xref="JGIDB:Spoth2_2037035"
                     /translation="RSPSSQDGDGSSWDRAVAEFASQAEKLSLQHPSETAVGDGVAAE
                     ARFVTPRDPVLVTADGNRLAPVPLEEAHKLNVLREELQHHEPGTVASAGGEDYGISAE
                     GPAPPMKRAVDVAAEKAKERGAKSPDGSLRRAMPPTHTNPLFPPLPLYGPPSLLRNLQ
                     CRVFQISSFFLSLAFLSVIVLGALFTSIGPSLRRLWLRATLRDPDRARPFYAEEVNER
                     KRRLEREREWREGIRSGDDGFTPSEGGPDPIVCDPAYYARRVGLDMESFQVQTEDGFI
                     IELWHVYDPREYRPLSGSDRAAGGPETLERLDQRDPSHNAINGSNSARDESQGNNQKP
                     KFPVLLMHGLLQSSGAYCVNDDASLAFFLCKSGYDVWLGNNRCGFSPRHALLDYSDPR
                     MWCWNIRQMGVFDLPALASRVLVETGFARLGLIAHSQGTTQALVALAKEQRPDLGEKL
                     TVFCALAPAAYAGPLIGKMYFKFMRVISPAMFRLMFGIHAFIPLMMTMHRALHPCVYG
                     WLGYKVFSFLFNWTDARWDRGLRDRMFQFAPVYVSSESMRWWLGRECFARHKCILATK
                     EEWRAEEREDAREREQEQEQQGRGTLSSSSVLARAVRDMEGDEGVRRSEQAAGAYSKR
                     KPRGSTAWYNHQAPPFALWVCGNDALVDGEKLLRRFERGREPHVRVVHSKVIPEYEHL
                     DVIWAMDAPEQVFKEVREVLWKTCDVRDLCRVPKGCEDVEPWVPPD"
     gene            1539344..1544400
                     /locus_tag="MYCTH_2294706"
                     /db_xref="GeneID:11513060"
     mRNA            join(1539344..1539841,1539922..1543321,1543475..1544400)
                     /locus_tag="MYCTH_2294706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658611.1"
                     /db_xref="GeneID:11513060"
     CDS             join(1539673..1539841,1539922..1543321,1543475..1544279)
                     /locus_tag="MYCTH_2294706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658659.1"
                     /db_xref="GeneID:11513060"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2294706"
                     /translation="MAASDATGSVRRRRVRRRRHDKAAVSARLVLDDHIKTDVGVVSE
                     DLFAELFPHLQDSQDEGDRFSSLPTPLHIAIAPWTASHSPESTNWAIVPVTPSTALAP
                     STIQFSPSSLALQSFALNLKQVAPSQLNTRSRSGIEILVLDVAAIELDTVFVNLEGES
                     AKRLENGEGTFFRDHPTTADRGKAPVPFTPEARLTAALRTALRSLKVVHTGDLFPLPL
                     PPHPVTHVPPNPGRIALCEPVAQGILGPNTKIIVSRGRIHSKHSRSSAPMPQSRGLNG
                     TTEDDEDTANDQFYSAAEEGIRTDTATEETDATATDTEFEEPGLEEEEEEDALSDDSM
                     DEMISLQAPTLSSTITSGIGTPSTIGRGRRMNGMSGAASVFSNFTATTARPDRPRGRL
                     FKAQGLVQPIPPDLLHPKPAAVDDEEARIYVDTKDLTRIGCFSGDWVRVEASREPPST
                     GFGAFGLGSFVEQDPDEVNWRSARVYGLPEGYSNRPMARVASSKHDGRRMSFFESQVQ
                     GTSSPTVYLSPVMLANLENPPYLRLAPIKRAMQAKGPQPKSSVPTQPPLAREVILQHV
                     RTPIPVERDVQTAVMAGLKYYFESRLRVVKTGDLIAVPIDTQLGRALQESTAAGDDPA
                     VDDVLGLIASGRPDRGIKYDEVAWFKVGHVQPVKQESAEENEEEDDPWGSVACVDISV
                     AHLEQTGSVTSRVPGTTSNTWPYYLGIKKLPRRHHGPSSPLLAEPERQYVSPLRRKVR
                     ELVAAATSKPAIHLKMPPVAILLVSTQRSIGKAFTASQACADIGLHTFTIDAYDIVND
                     SGAGGSDVKTAGFLTSRAERAMSCGPDCCALLIRHIEALTADRMVSSIKEILADARVL
                     IATTTEVEKVPDGLRALFTHELEMSAPDEAEREGILRTIVDDRGVSLDPEVDLGGIAL
                     KTAALVAGDLVDVVDRALVARQSRLEQLSAKATSDGQPVTVRDVQVAGGPAASGLTKQ
                     DFEVAVEAARKNFADAIGAPKIPNVTWDDVGGLNNVKEAVAETIQLPLERPELFAKGM
                     KKRSGILFYGPPGTGKTLLAKAIATEYSLNFFSVKGPELLNMYIGESEANVRRVFQRA
                     RDARPCVVFFDELDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSGGGEDAGGGVFVI
                     GATNRPDLLDPALLRPGRFDKMLYLGVSDTHEKQLTIMEALTRKFTLHPSLSLRSIAE
                     RLPFTYTGADFYALCSDAMLKAVTRQASLVDAKVRAINADPPAHGLRAPISTAYFFDH
                     FAKPEDLAVMVTEQDFLDAHRELVPSVSAGELAHYERVRATFEGANKDKEKEKEKGKE
                     KGNGKEVGGAPNGAGVPAAARLGLGLGLAGRRTASGASARSAGGKGKGRAGAGGKGKG
                     KAVALGSEDEFDDDDEERGEIEEDGEEEEEEEGEESSQGGSGGYGVRDKGKGKEVAPP
                     IAEASPFFRDGTGSGDEGLYD"
     gene            complement(1544445..1546117)
                     /locus_tag="MYCTH_2294707"
                     /db_xref="GeneID:11509144"
     mRNA            complement(join(1544445..1545443,1545507..1546117))
                     /locus_tag="MYCTH_2294707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658612.1"
                     /db_xref="GeneID:11509144"
     CDS             complement(join(1544610..1545443,1545507..1545773))
                     /locus_tag="MYCTH_2294707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658660.1"
                     /db_xref="GeneID:11509144"
                     /db_xref="JGIDB:Spoth2_2294707"
                     /translation="MASESSETKSYSTDPALYIYTSLTAGSSHIVTATSRLETILRAN
                     RIPFKAIDIATDEKARMLWGRRAGKDASGRQRKLPGLVQMGMVLGDIVEIEEWNEYGE
                     LKDHVTFYYDEYTQPSIHQAPKQPPAGAPKAPSATTASPAPPAPAPAPAPASASASKT
                     TATEKAASAASTAAANVTLPVRSIAEEAAAKAKQVHLQSLRDKVHGKGNNNDNNNNNN
                     SSSNNNNSASTASTSPSSTSATASTKASDATATTTTSSASQGTTAGLQSPTSSGWKAP
                     AGGPAPTQSPTSTSWKPRDVEPPVTELHGAPVERASAAEIAAVEKAEAIREEGEEEKG
                     KEDDVEEDGDEEEGKKKEEGKTGGGEAKGKGQ"
     gene            <1546854..>1547441
                     /locus_tag="MYCTH_2053230"
                     /db_xref="GeneID:11513230"
     mRNA            <1546854..>1547441
                     /locus_tag="MYCTH_2053230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658613.1"
                     /db_xref="GeneID:11513230"
     CDS             1546854..1547441
                     /locus_tag="MYCTH_2053230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658661.1"
                     /db_xref="GeneID:11513230"
                     /db_xref="JGIDB:Spoth2_2053230"
                     /translation="MCLIGLLLPFEREKETRRHKSRSSSHGRSSHGRSERPHRERTHR
                     REKERARDSAVLAEEALARLCLSLEHSLVEERQRWQEQTRLDMSERCRLGLERERTPF
                     EEAPPYSPPNTAPEAKPEPPHPSGQADSSHSRGKDSAGTTYCCRHCVCTRCGSAIIEC
                     PAVPELDATRIGTFTDSGADSRKRQFRSSGGPHKP"
     gene            1548753..1549929
                     /locus_tag="MYCTH_2313370"
                     /db_xref="GeneID:11508983"
     mRNA            1548753..1549929
                     /locus_tag="MYCTH_2313370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658614.1"
                     /db_xref="GeneID:11508983"
     CDS             1549030..1549482
                     /locus_tag="MYCTH_2313370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658662.1"
                     /db_xref="GeneID:11508983"
                     /db_xref="JGIDB:Spoth2_2313370"
                     /translation="MQFKSIFAVLATGLSLVAAQESDSTVTSTQTLTRTVTITECNPT
                     VTNCPGRTSTSTSTTTSTTTTTSSSSWASFPLSNSTSTVGPTASSSFIFTTSTALVVP
                     PSSSGVEVPPSETTSSSPSIPTAAAAGLYVQPAMLLGVLGAAGVALLA"
     gene            1551204..1551769
                     /locus_tag="MYCTH_2294711"
                     /db_xref="GeneID:11508250"
     mRNA            1551204..1551769
                     /locus_tag="MYCTH_2294711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658615.1"
                     /db_xref="GeneID:11508250"
     CDS             1551359..1551571
                     /locus_tag="MYCTH_2294711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658663.1"
                     /db_xref="GeneID:11508250"
                     /db_xref="JGIDB:Spoth2_2294711"
                     /translation="MPFVCQHFSDYTCTNTVEVKDTLCSQCEQGKCGQSGISCSKNRA
                     LYRSETTTDTSTDTSTTTTTTTTTGN"
     gene            1553306..1555602
                     /locus_tag="MYCTH_2294713"
                     /db_xref="GeneID:11505519"
     mRNA            join(1553306..1554241,1554334..1554691,1554778..1555602)
                     /locus_tag="MYCTH_2294713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658616.1"
                     /db_xref="GeneID:11505519"
     CDS             join(1554084..1554241,1554334..1554691,1554778..1555449)
                     /locus_tag="MYCTH_2294713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658664.1"
                     /db_xref="GeneID:11505519"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2294713"
                     /translation="MPPAADPPTLSTTPAQRAPPEVVLPRWQPDSEQTYCPICGTQFS
                     IFVRKHHCRKCGRVVCNACSPHRITIPHRYIVRPPGAPSPLSQGPSLSLLDSQGWYPE
                     FSGGERVRLCNPCVPDPNTAPPQSQAHQQSSQNDPASPGRADSSSSNRWNFYFGAGAA
                     NDPQTRTRSATLQPGPSSSSQPPVPPPHRSNYEARILWGTPPAYYRPTATSQSAPFYP
                     GTAPRYRSMFDVGNRPGPSTIAGPSSSSSSSSASRTFHPPVRRRPQIPEEDECPVCHR
                     ELPPRTLPNFETLREAHITGCIESHSRYGGRPPASAGEDGSSPDGARPGPRRTGMFPY
                     TATEKDCVDSAECSICLEEFEVGVAMARLECLCRFHRACINAWWERHPGRCPVHQHDG
                     FGY"
     gene            complement(<1556208..>1556997)
                     /locus_tag="MYCTH_35909"
                     /db_xref="GeneID:11508608"
     mRNA            complement(join(<1556208..1556264,1556351..1556432,
                     1556663..>1556997))
                     /locus_tag="MYCTH_35909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658617.1"
                     /db_xref="GeneID:11508608"
     CDS             complement(join(<1556208..1556264,1556351..1556432,
                     1556663..>1556997))
                     /locus_tag="MYCTH_35909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658665.1"
                     /db_xref="GeneID:11508608"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Spoth2_35909"
                     /translation="TSHTAINEACQEHGLSPSEFLELCGRAQDAKARAYCPYSGFRVG
                     AALLTRAGDYVVGANVENASYPVTTCAERVAFGTAVVAGAAGPGGFKAVAVATDADTP
                     TSPCGMCRQFIREFCELNVPILMFDKDSNFIVLKLAELLPLSFGPDSMGVPDPAKP"
     gene            complement(<1558007..>1562180)
                     /locus_tag="MYCTH_2106260"
                     /db_xref="GeneID:11511569"
     mRNA            complement(join(<1558007..1558033,1558097..1558281,
                     1558379..>1562180))
                     /locus_tag="MYCTH_2106260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658618.1"
                     /db_xref="GeneID:11511569"
     CDS             complement(join(1558007..1558033,1558097..1558281,
                     1558379..1562180))
                     /locus_tag="MYCTH_2106260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658666.1"
                     /db_xref="GeneID:11511569"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2106260"
                     /translation="MGESSTESSEKAASRPADGENEKKPPTTGGKVDDDGPTKETKDP
                     KARPEREATAADYFRVFTYAKRWDFVLMGTAAIASIGAGVTMPLMNIVFGRLIGEFSD
                     FSNPDAADPDEFSRTIDRMSLYMFALFISRFGLNYINKFCFRLIGIRMSAAIRLHYLQ
                     CLFGQTVHVLDSMPSGAAASTITSTANTLQLGISEKLGTFLEFSSTIVAAIVIAFTYS
                     WSLTLVTASVILFISLVVSVLLPFIIKGQTMLTRADAKGTSVATEAFGTIRMITACGA
                     EARMARRYAKWVAKAKQATQFSSPFLAAQFGAIFFGLYGAFALAFWFGTKSFVEDRIE
                     GIATILIVLMSVMLMVISLERVSTPLIAVSKAMVAAAEFFAVIDAPKPKMGTLKEPDV
                     SADQDIVFEDVHFAYPSRPHKKVLDGLNLRIPARLNTAIVGPSGSGKSTIVGLIEGWY
                     TLHDQYVIAKAVEKDKAKKEKEKAKKKEKKKKKSRGKEDDEDDDEDAAADAPLDVEET
                     GAPVELKGSISTCGRQLGDIDIKWWRSQIGLVQQEPFLFNNTIFYNVAVGLIGTQWEN
                     EPEEVKRRLVREACAESFADEFIDRLPDGYDTQVGDSGAKLSGGQRQRIAIARSIVKK
                     PKILILDEATSAIDVRGERIVQAALERASKGRTTITIAHRLSTIKNADRICVLQNGRV
                     VEEGTHDSLLENERGVYYGLVHAQKLSLGDDTGGDLLHEEDVGAALAREKSAAKSVAE
                     GAKEEAKWAERGLFSGFGKLLYEQRSRFPFYVLALIGAMGAAAAVPVQAYLFAKVVGV
                     FQRTSLQSLMDGATFWSKMWAVLAGGVGASYFLTSLVSNNLEGYIAAVYRQEYFESIL
                     FQPTAYFDKDDNATGQLTARLSSDPQSLKELLGINLMVVLIGIFSLAGALAISFAYGW
                     KLALVALCVTVPIGIVSGYFRLRYELQFNKMNDEVFQESSKFGAESIGAFRTVSALVM
                     EDSICDRYQKLLSGHVVAAFKKARLTTIVFAFADSASLGCQALIFWYGGQLMLKREYD
                     VVAFLVTYMAVIQGAESAGQWLSFGPNAAQAAAAANRILHARETRLRSDATKSEQIPD
                     VDGGIKIELKDVHFKYPTRDVSIFRGLNLTIEKGQFAALVGASGSGKTSIVSLLERFY
                     DPDRGQILFNGKDISEVDVYEYRKLLSLVAQEPSLFHGTIRENLLLGVDPSTVTDEQL
                     HQCCRDASIHDFIVSLPDGYDTNIGSRGVSLSGGQKQRVSIARALIRNPRVLLLDEAT
                     SSLDSESEKLVQAALERVAKGRTTIAVAHRLATIQKADIIYVLGEGKVLEKGSHAELL
                     RQKGVYWHMCQNQALDR"
     gene            <1563740..1566631
                     /locus_tag="MYCTH_2087474"
                     /db_xref="GeneID:11508634"
     mRNA            join(<1563740..1563774,1563837..1563859,1563928..1563987,
                     1564040..1564087,1564228..1564256,1564316..1564379,
                     1564435..1564544,1564822..1564857,1564935..1565166,
                     1565225..1565401,1565480..1565641,1565696..1565717,
                     1565771..1565999,1566054..1566146,1566208..1566631)
                     /locus_tag="MYCTH_2087474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658619.1"
                     /db_xref="GeneID:11508634"
     CDS             join(1563740..1563774,1563837..1563859,1563928..1563987,
                     1564040..1564087,1564228..1564256,1564316..1564379,
                     1564435..1564544,1564822..1564857,1564935..1565166,
                     1565225..1565401,1565480..1565641,1565696..1565717,
                     1565771..1565999,1566054..1566146,1566208..1566444)
                     /locus_tag="MYCTH_2087474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658667.1"
                     /db_xref="GeneID:11508634"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="JGIDB:Spoth2_2087474"
                     /translation="MAPSKTPKFEIKTPKGTRDWSGPDMVLREKIFKTITDVFKRHGG
                     VTIDTPVFELKGKYGEDSKLIYDLADQGGELCSLRYDLTVPFARYLAMNKDVTQIKRY
                     HIAKVYRRDQPAVKKGRMREFGVYDPMIPDAEIIRIINEVFEGLGWHGKYTIKLNSRK
                     ILDGLFQVCGVPDNLIRPISSAVDKLDKMPWADVRKEMVDEKGLAPEVADKIGTYVVL
                     KGKRDLLEKLKQDEALAANPSMQQGFADMDLLFTYLEDFGADHTVSFDLSLARGLDYY
                     TGVIYEVVTEGSAPAVSASGEAKEKQAKKKGGKPGDPEEDRSDDPTLGIGSVAAGGRY
                     DNLVGMFSGKTQVPCVGISFGIDRIFSIIQATQKKKERRNEVEVFVMAFGGGKDFTGL
                     LKERSQVCARLWDAGIKAEFLYKVKPKLQNQFKAAEANGVPFALILGEDELAQGKARF
                     KEMGLPEDHPLKEGELISLDNLIEEVKTRLARKQELDSITQQAEGLKVVGGVKGEDVK
                     APAETAQSTE"
     gene            1568820..1570438
                     /locus_tag="MYCTH_2294721"
                     /db_xref="GeneID:11508083"
     mRNA            1568820..1570438
                     /locus_tag="MYCTH_2294721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658620.1"
                     /db_xref="GeneID:11508083"
     CDS             1568916..1570163
                     /locus_tag="MYCTH_2294721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658668.1"
                     /db_xref="GeneID:11508083"
                     /db_xref="JGIDB:Spoth2_2294721"
                     /translation="MPGLIPLMLASGSRTCSAGPTQSFLRRQSTGYSPGSTSPTTPIT
                     PTVPTVPTYAVRLNPHKRSSLPAPAPAPVIPCTKAEWKKTIAEVKRMYFGKRYRACSA
                     RCLEVLESIKDTSQVEPVYLIYLHFYAATSLEICARPLPSTAAFRATLLQQAYTHFDR
                     ASALINAAEESLLRKFRPGSVGSTRSSSCHSPSGSISSRAWTPDTCITSPTNSVFSFH
                     DPDRRSSHSLHGHGKKVSFSFSENTPLHAGPAEPIIRPDSPTLGFEDAFYHQPGVSAA
                     AEASPPDLRPIKFQEEIELPLPTVPEHEQEEEREEGDESAYHVARAVDRCCEHLSTLR
                     TQLARHSASLAQLLAQQPTPSPDASSPSATTTTQRGCNDRNQDRQARIERLRKSGWQR
                     ERFDPTKYEELCDTVLAELSGQD"
     gene            complement(1571111..1573094)
                     /locus_tag="MYCTH_2294727"
                     /db_xref="GeneID:11505989"
     mRNA            complement(join(1571111..1571639,1571704..1572089,
                     1572146..1572302,1572372..1572579,1572655..1572706,
                     1572842..1573094))
                     /locus_tag="MYCTH_2294727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658621.1"
                     /db_xref="GeneID:11505989"
     CDS             complement(join(1571238..1571639,1571704..1572089,
                     1572146..1572302,1572372..1572579,1572655..1572706,
                     1572842..1572848))
                     /locus_tag="MYCTH_2294727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658669.1"
                     /db_xref="GeneID:11505989"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2294727"
                     /translation="MSFANMLNRLHGQPESYEKKAKYRFGRTLGAGTYGIVREAEGPD
                     GRVAIKIILKKAVRGNERMVLDELDMLQRLKHPHIVKFVDWFESRDKYYIVTELATGG
                     ELFDRICEKGKFTEKDASQTIKQVLDAVNYLHKNNVVHRDLKPENLLYLTKDPHSDLV
                     LADFGIAKTLGTKDEVLTTMAGSFGYAAPEVMLKQGHGKPVDMWSLGIITYTLLCGYP
                     PFRSENVQDLIDECTACRVVFHERYWKDVSQDARDFILGLLRPKPEDRWTSEQALAHT
                     WLSGKNATDHNLLPEIRAYLTRARLRRGIEMVKLANRIEALKAQEEDPENSDMPKDAT
                     SAADQSRLTSSSNANDSSAAGNASGQGGKRNLSKAVKSAIFREVVLAKVREMKEQEQT
                     LKVTEEASKMA"
     gene            1574791..1575831
                     /locus_tag="MYCTH_2074876"
                     /db_xref="GeneID:11509036"
     mRNA            join(1574791..1574851,1574907..1575057,1575121..1575831)
                     /locus_tag="MYCTH_2074876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658622.1"
                     /db_xref="GeneID:11509036"
     CDS             join(1574804..1574851,1574907..1575057,1575121..1575389)
                     /locus_tag="MYCTH_2074876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658670.1"
                     /db_xref="GeneID:11509036"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2074876"
                     /translation="MSVPFAAKRLGKELQKISSSLPPGIELVSADNFEEWLLDIKVLD
                     NNPLYQNQTYRLKFRFSPSYPIEPPEVVFVQLPDRPIPIHPHIYSNGIICLDLLGQQG
                     WSPVQNVESVCMSLQSMLTGNSKNERPPGDEEFVRGNTMRPRDIQFYYHDNDV"
     gene            1575999..1578550
                     /locus_tag="MYCTH_2294730"
                     /db_xref="GeneID:11508532"
     mRNA            join(1575999..1576143,1576238..1576433,1576657..1578264,
                     1578337..1578550)
                     /locus_tag="MYCTH_2294730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658623.1"
                     /db_xref="GeneID:11508532"
     CDS             join(1576066..1576143,1576238..1576433,1576657..1578264,
                     1578337..1578458)
                     /locus_tag="MYCTH_2294730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658671.1"
                     /db_xref="GeneID:11508532"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="JGIDB:Spoth2_2294730"
                     /translation="MAPRAGFDTEQLRDKARKDLLHLLEGVRGKKNLVIEKELAGPLG
                     VVVKASTLRDYGVDNFFFLENKNTDTSQRNVVFVARGESARNAHAIADQIIRLQRESQ
                     SPHEFHIFWVPRRTLLSDKVLEEAGVLGDTNVAELPLFFFPLETDVLSLELSDSFRDL
                     YLAKDPTPLFLLARALMGIQQKHGLFPRIIGKGDSAKRVADLLIRMRQELLADEDAAE
                     ADATGLSPSTTIENVIIIDREVDFVTPLLTQLTYEGLIDEVFGIQNNQTDVDSTIVGA
                     VAQPAGAGTSSAAPSNNGQSRKRKIQLDGSDPLFAQLRDSNFTVVGNLLNKIARRLKS
                     DYESRHSSKTTAELKEFVKKLPGYQAEQQSLKIHTGLAEEIIKYTRTERFNKLLEVQQ
                     NLAAGADPSGQFDAIEELIARDTPLPQVLRLLCIYSCISGGIKTKELDHFRRLILQGY
                     GYQHLLTLHNLERLQMLLSRASPLASMIPMTGSVGAQGTKTNYTYLRKQLRLIVDEVN
                     EHDPNDIAYVYSGYAPLSVRLVQCVLQKQYLLSITRGNSAGGASGAAAGGAQGWRGFD
                     DAVKHARGQTFDEVQKGEDKAVKARALLSGSGEKKTVFVVFVGGITFTEIAALRFLAK
                     QEEARRNFVICTTSIISGNRIMDAAIERGTFEKSNPQAAQQAR"
     gene            1579351..1583477
                     /locus_tag="MYCTH_2294733"
                     /db_xref="GeneID:11513368"
     mRNA            join(1579351..1579813,1579976..1583477)
                     /locus_tag="MYCTH_2294733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658624.1"
                     /db_xref="GeneID:11513368"
     CDS             join(1579491..1579813,1579976..1583159)
                     /locus_tag="MYCTH_2294733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658672.1"
                     /db_xref="GeneID:11513368"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="JGIDB:Spoth2_2294733"
                     /translation="METSPKSRARYFSGSGKGLFKGTRETDPRRSPRTSLASPANPPS
                     PPPSTGSDLEAASKLVRRTAATGSEDIAPEIVVWTEHMNNMTGDSPESATSPTPATPA
                     SEEKTVIPAPASQAPPPAATPSIPVQNGTPLKESSSLSSLSSLSDQFDLSSHAPSGSS
                     KATTPVDHDVLREAPAPGVACPSQSTGTPRRKWDVRPKVSIPSDLPLPEYAMQCVAAA
                     EASRLNPYSLHQEEYLMLRDHISHTQVTTYLNIRNGVLRLWVRNPQIPVTREEAVGCA
                     KDPRWFDVASVCFDWLVRRGYINFGCVEIRPPRKHSKQSESPSRKQRTVVVIGAGMSG
                     LGCARQLEGLFLQYAKQFCSMGEEPPRVIVLEGRNRVGGRVYSRSLKSRPKQIPEHFE
                     GMRFTAEMGGMIITGFERGNPLNILLRGQLGLAYHFLRPETTLYDSNGKPVDLHRDQL
                     VENLYNDCLDRVSEYKFKQPISKLIEGNRDLIDEGKDSSAETHKTIRQAEESAAAQPY
                     AVPVSEQNMAPQVNLVPVSTDRATGKIHTEPGTPGALKAAHKAKLIGWTLKQGVSEDA
                     DIDLEAATKEPNATLGSVTDKVIAQYRSLLDLTAQDFRLMNWHIANLEYSNAINYHQL
                     SLQGWDIDAGNEWEGSHSMVVGGYQSVPRGLMQLPTPLNVKQKSPVSKITYTSDSPTG
                     PATVTCEDGSTIEADFVVSTIPLGVLKHGSVKFEPPLPAWKADAIGRLGFGVLNKVIL
                     VYKEPFWDEDRDIFGVLRNPTNRHSLDQNDYASQRGRFFQWFNVTKTSGLPVLIALMA
                     GDAGFDTEQTCNDDLVAEATDILRSVFGPRVPHPIEAVVTRWASDKFARGSYSSAGPD
                     MKADDYDSMARPIGNLFFAGEHTSGTHPATVHGAYLSGLRAASEVLDAMLGPIQVPTP
                     LILPKDSPPSSSSSSSTSSSSLLGSKRKAGSLETGPSSNSTATKEVTARARLEAYEAR
                     LWEHITAHLGPRPLPPPKPATNAYIFYSKAHYDDARRRLEAGRRSGGKGSGKGGGKPS
                     PNEVRVMSAKMWRDASEEERKPYLEMAEEQKRAYTAALEAWKVAAAEWDGKAEEVRGK
                     WVQENPPPAAEGGPDGDVAGRRRSKAKVESYAELDSDVEMEADGEAGVGPGASDEMDV
                     DSAEDAGGPSRGGKITEVVMAE"
     gene            complement(1583672..1585328)
                     /locus_tag="MYCTH_2294734"
                     /db_xref="GeneID:11513247"
     mRNA            complement(join(1583672..1584046,1584111..1584244,
                     1584302..1584879,1585067..1585328))
                     /locus_tag="MYCTH_2294734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658625.1"
                     /db_xref="GeneID:11513247"
     CDS             complement(join(1583918..1584046,1584111..1584244,
                     1584302..1584879,1585067..1585122))
                     /locus_tag="MYCTH_2294734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658673.1"
                     /db_xref="GeneID:11513247"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="JGIDB:Spoth2_2294734"
                     /translation="MLSRAARPALRAGAAVSSRAAAPTATFATLREIEGRLKSIRNIE
                     KITNTMKIVASTKLTRAQRAMGDSRKYGETSNEVFKSAETKSLEGEGKKKLLVVCSSD
                     KGLCGGIHSGLSRYIRRRSHEDSNFDLVILGEKCRSQLQRTNAKNIVLNFAGVGKDVP
                     TFAEAQAIADQIVQLPGDYSDIEIVYNKFINATSYEPAVITAFNEEAIAASPNFAAFE
                     VDEELLSNLREYTLANSLYWALTEGHACEISARRNAMDNASKNAGEMINKYQILFNRT
                     RQAVITGELVEIITGATASEDM"
     gene            1586220..1589101
                     /locus_tag="MYCTH_2294738"
                     /db_xref="GeneID:11512842"
     mRNA            join(1586220..1586443,1586505..1588133,1588194..1588886,
                     1588954..1589101)
                     /locus_tag="MYCTH_2294738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658626.1"
                     /db_xref="GeneID:11512842"
     CDS             join(1586258..1586443,1586505..1588133,1588194..1588886,
                     1588954..1589094)
                     /locus_tag="MYCTH_2294738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658674.1"
                     /db_xref="GeneID:11512842"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="JGIDB:Spoth2_2294738"
                     /translation="MDESASKARPAPPGVSIRHGPVGDQMGVDSAPNGTVKRKSRSSA
                     GQPVKYKEESDSDDGAPLAKRQKSQHQKAEPDSDDEPIAKKNGSKLPPSVKDTATLES
                     SDDDQPLGTKIAQRRANIEKAAAKEAKSIRADAKTKKATPRKSIKEESDDEPLAKPRK
                     RQSNGVSSVKKTNGVKKEPDSDSDAPIAKKAKKAAPPPKKGKDTAPAKDAKPVKEEPK
                     EESKENSEGEEEEEYRWWDEPKKEDDTIKWTTLEHNGVLFPPPYEPLPKHVKLYYDGK
                     PVDLHVDAEEVATFFGSMLHSTQNVENPVFQKNFFNDFKDILKKTGGAKDLDGNPVDI
                     TEFKKLDFTKIYEHYKAISDAKKARPAAEKKAEKAEKEKLEAPYMYCKWDGRKERVGN
                     FRVEPPGLFRGRGEHPKTGTVKKRVMPEQVTINIGKEAKVPSPPPGHKWKAVQHDNKA
                     TWLAMWQENVNGNYKYVMLAANSAIKGQADYKKFEKARELKKHIDRIRADYTRELKSE
                     VMADRQRATAMYLIDKFALRAGNEKDTENEAETVGCCSLKYEHVTLKEPNTVIFDFLG
                     KDSIRFYNEFTVDRQVFKNLKMFKKPPKEEGDDIFDRLTTSQLNKHLSSYMPGLTAKV
                     FRTYNASWTMSQLLKNLKVEDRTMAEKIKLYNDCNREVAILCNHKRTVGASHEAQMEK
                     LGDRIKGLKYQRWRTKMMMLDLDPKLKKKKGPEFFELDPELDQAWIESHQQFLAKELR
                     EKIEKKFAKDNEKLEADGKQKLPEKELKERLKAVSELEAKFKKENKTNKVEAEGKGVT
                     VEKLTAAVEKLNERIRTLELQSADREGNKEVALGTSKINYIDPRLTVAFSNRFNVPIE
                     KFFSKTLRDKFNWAIQSVGKDSTWEF"
     gene            complement(1589469..1591619)
                     /locus_tag="MYCTH_62175"
                     /db_xref="GeneID:11508451"
     mRNA            complement(join(1589469..1590078,1590243..1591171,
                     1591240..1591619))
                     /locus_tag="MYCTH_62175"
                     /product="glycoside hydrolase family 16 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003658627.1"
                     /db_xref="GeneID:11508451"
     CDS             complement(join(1589842..1590078,1590243..1591171,
                     1591240..1591348))
                     /locus_tag="MYCTH_62175"
                     /note="CAZy_ID 267860"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003658675.1"
                     /db_xref="GeneID:11508451"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Spoth2_62175"
                     /translation="MFLSSRGWRRAAATAVALLSRSTFAQTWSACNPLTSTSCPADTA
                     LGMTIHVDFTEGEVNSFVPSGGVPTYDEDGVSFTVASSGDAPQLTSIFYIMFGRVEVT
                     MKAAPGAGIVSSLVLLSDALDEIDMEWLGADSTEVQTNYFSKGQTTTYNRGQFNPAPN
                     NQAEFVTYTIDWTADRIAWYVGGTLVRTLTFDEANGEYPQTPMQVKFGAWSGGDPSNP
                     PGTIEWARGPTDYSQGPFSMVVRSAVVTDYSTGKRYTYGDQSGTWQSIRSDGGEINGN
                     LGAAGTVSVTASAPAATDSLSPTIPPGGIIGGGTATATDGSTGPSRTVGPIPDGWVMT
                     SEGKVVPIGSSTTLPGAQPSSSLSRELSASPSTAGSGGGETTTLATSTLSTLGGARAP
                     TDAPPESSASTARRGGLLLGLLVLAASALLCW"
     gene            complement(<1592405..>1592998)
                     /locus_tag="MYCTH_2055617"
                     /db_xref="GeneID:11507999"
     mRNA            complement(join(<1592405..1592761,1592831..>1592998))
                     /locus_tag="MYCTH_2055617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658628.1"
                     /db_xref="GeneID:11507999"
     CDS             complement(join(1592405..1592761,1592831..1592998))
                     /locus_tag="MYCTH_2055617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658676.1"
                     /db_xref="GeneID:11507999"
                     /db_xref="JGIDB:Spoth2_2055617"
                     /translation="MDVRPCCQQPSSGVADPISSRRYCVSEVLEIAICSLCSVVMWEY
                     TVQNEMMEKRDGVSGQHNGAEDVAGPSVFRPSPGLMLFSCLVFGCCVSSFTYRRQDQD
                     PFQFVIYLILLGCVAMIGYAVGAHLHLILLGYLPWATCAAMAISISGHSAYRYLKTNP
                     TRPSRDEEKARLWG"
     gene            1593784..>1594858
                     /locus_tag="MYCTH_2136549"
                     /db_xref="GeneID:11512836"
     mRNA            join(1593784..1594189,1594240..1594305,1594383..>1594858)
                     /locus_tag="MYCTH_2136549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658629.1"
                     /db_xref="GeneID:11512836"
     CDS             join(1594044..1594189,1594240..1594305,1594383..>1594857)
                     /locus_tag="MYCTH_2136549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658677.1"
                     /db_xref="GeneID:11512836"
                     /db_xref="JGIDB:Spoth2_2136549"
                     /translation="MEQARPLGSQKARRQKLRHAIKIMACGGMIGTAILFPLADVQGL
                     WFRALTPSIFILSALGFHALHLEPFVRYGRFTVPPALAFLLVAVLAAGSAREELIPWL
                     PLFIASLSLITVAMDDISKRIGLRPASLVGSDDVPSWTSTDTWSNYSLRSVSTQQRPQ
                     SVLGSTLHDPLFFARHGPPSRMSQRTYTNGTDITLSGIAPQLRSHWDAQTLGYFSATA
                     PPNGEHPVGFG"
     gene            1596200..1598607
                     /locus_tag="MYCTH_2294749"
                     /db_xref="GeneID:11508006"
     mRNA            join(1596200..1596731,1596891..1596924,1597036..1598228,
                     1598341..1598607)
                     /locus_tag="MYCTH_2294749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658630.1"
                     /db_xref="GeneID:11508006"
     CDS             join(1596411..1596731,1596891..1596924,1597036..1598228,
                     1598341..1598595)
                     /locus_tag="MYCTH_2294749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658678.1"
                     /db_xref="GeneID:11508006"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2294749"
                     /translation="MRSAIRIGAFRGLPSLNSAPLRPGANGLRNHVPRRLLVPPSAAL
                     HSKSPDCSEALAPAAKLPEAESVPAVTPRERISIADIKERRAKAGRLIAPTAAYSDAD
                     MFKAPTTGKPKAKRWDHYLTEESLSREPCKLKQAAKHLKTPGLISLGGGLPCPEYFPI
                     SSLTLHVATPPDFSEAATLEGGGEDITIGKYDAGFSKPSTTSSPSTAPGTGEPKSEYD
                     LSIALNYAQASGSAQMTRFVTEHVELVGVPPYADWRTCLTVGSTGALEQALRMLLRAG
                     DTLVIEEFSFSTALETAAPLGVGFAGAPVDEEGLLPDGLDALLTGWDAAGRGRGGGRR
                     KPHVLYTVPSGQNPTGATQSERRRRDIYEVARRHDLFIIEDEPYYYLQMHEGPAPPPR
                     TVDDFLDRLIPTYLSMDVDGRVLRMDSFSKVVVPGSRMGWITAPEQIVERFIRHSEVA
                     NQGPSGFSQVILHKLLDERWGHEGYMRWLMNLRLEYTKRRDVMAAACDEFLPKEVVSW
                     NPPKAGMFQWLKVNHELHPHASTKSILDMEEEIFDRCIAKGVLVARGSWFRAEQDKPP
                     SGLYFRTTFAAASPDNMREAIRRLGEAIRESYRM"
     gene            complement(1598873..1601049)
                     /locus_tag="MYCTH_2294752"
                     /db_xref="GeneID:11513304"
     mRNA            complement(join(1598873..1599384,1599562..1600056,
                     1600187..1600697,1600778..1601049))
                     /locus_tag="MYCTH_2294752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658631.1"
                     /db_xref="GeneID:11513304"
     CDS             complement(join(1598958..1599384,1599562..1600056,
                     1600187..1600697,1600778..1600958))
                     /locus_tag="MYCTH_2294752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658679.1"
                     /db_xref="GeneID:11513304"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2294752"
                     /translation="MGLTEALIERASAKSALILVPGLLLAYVIVAIVVRPAWQEIKLA
                     RMPGTRAPRIKSKLPFGLDFLWGAVTSAQKNQNLAFWNKMLGEAGAYTVEGRIAGRRI
                     VFTADPENIKAILATQFNDYGKGEPFHREWRAFLGDSIFTTDGALWHDSRQLIRPQFV
                     RDRVSDLHVFEKHMQILFRAIANGGALDGENQPVDVEAGNGKPVEITDLFFRFTLDSA
                     TEFLLGHDVKSLSHPRQEFADAFGEVQRIQSLISRAGALNGLVPRGQFNRSMKVINNF
                     INTYIERALRLSPEELASKSKSDAGYTFLHALAAYTRDRRVLRDQLIAVLLAGRDTTA
                     CTLSWTVYELARHPDVLQKLRAEILSVVGPTRPPTYEDLKSMKYLQSVMNETLRLYPV
                     VPFNVRLALRDTTLPRGGGPDGLEPVKVLKDTPIAYSTLVMQRREDLYPPPGGAAASA
                     PADAFSPDRWATWQPRPWQYIPFNGGPRICIGQQFALTEMAYVLTRLFQRYDRIDNYT
                     HRHPGLKADIVLQPAEGVRVGLWEARAEK"
     gene            complement(1603276..1605738)
                     /locus_tag="MYCTH_2294755"
                     /db_xref="GeneID:11508412"
     mRNA            complement(join(1603276..1603850,1604002..1605168,
                     1605274..1605738))
                     /locus_tag="MYCTH_2294755"
                     /product="glycoside hydrolase family 20 protein"
                     /transcript_id="XM_003658632.1"
                     /db_xref="GeneID:11508412"
     CDS             complement(join(1603419..1603850,1604002..1605168,
                     1605274..1605423))
                     /locus_tag="MYCTH_2294755"
                     /note="CAZy_ID 267869"
                     /codon_start=1
                     /product="glycoside hydrolase family 20 protein"
                     /protein_id="XP_003658680.1"
                     /db_xref="GeneID:11508412"
                     /db_xref="InterPro:IPR015882"
                     /db_xref="InterPro:IPR015883"
                     /db_xref="JGIDB:Spoth2_2294755"
                     /translation="MWSPSLSSFSVLLAALQPVAAIWPAPQSLTTGSSVLYLNQNIKV
                     TYNGESIPYTYGYVSRELTSKEVVQAGISRTLAGIFESKFVPWKLHKRGSKWEPDLSQ
                     GQQWIKTLEIVQKGKDEPSTFKPLAGQVDESYNLTVSAKGEAKLAAVSSIGVLRGLET
                     FSQLFYQHSAGTFWYTPFAPVSVQDAPKFPHRGVLIDTARNFLPVADILRTIDAMAWS
                     KLNRLHVHVTDSQSWPLVIPSLPEVSEKGAYHPSQTYSPEDVEKIQTYGAERGVEVYF
                     EIDMPGHIGVVSLSHPELIVAYNLQPYQWWCQEPPCGAFKLNNTAVDAFLDKLFDDLL
                     PRLAPYSAYFHTGGDELNRNDSMLDEGIRSNDTEVLRPLLQKFIDKQHARVRAAGLTP
                     ITWEEIPLEWEVDMAKDTVVQSWLGGDAVKTLTSKGYQVIDSNYNFWYLDCGRGQWLT
                     WGNGAAFAQGYPFNDWCGPTKSWQLVYQHDPTAGLTAEEAKLVLGGEVALWAETIDPV
                     NLDTLAWPRASAVGEALWSGRIDPATGQNRSLVEAAPRLNEFRERLVARGVGASPIQM
                     TFCTQGRAEECEFIVA"
     gene            1607753..1609525
                     /locus_tag="MYCTH_2294757"
                     /db_xref="GeneID:11505995"
     mRNA            join(1607753..1608245,1608302..1609525)
                     /locus_tag="MYCTH_2294757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658633.1"
                     /db_xref="GeneID:11505995"
     CDS             join(1607845..1608245,1608302..1609481)
                     /locus_tag="MYCTH_2294757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658681.1"
                     /db_xref="GeneID:11505995"
                     /db_xref="JGIDB:Spoth2_2294757"
                     /translation="MSVEVALGTPLAEALNVAIQGKIAELGWAGPGTEGSAMSEYFLL
                     MLANGKTESEIAAEIAGDLLSLGPDDQTAPAFASWLFQQIGTLSAQLGSQQAQSSDAT
                     DGAKDEPMDGSQDANQDTNMDTSDAPAAGLNAPTGPKAMRNGSGNIRGGREKRLMSQI
                     NRAMDRQQDSVLHRVRNQSGNERIGRGPPSGPRMGVGRQPRTNNARAANVAAGIANMG
                     GMPPQGPAGMNGMGGMHPMNAGGYTQADIFAMMEQQNQMLQQMQQQLMMQQQQQQQQQ
                     QQQNGMGNRGGFGRGKHQFDRGGRGGQFRRGGGHHQHNGHGEHQQPGSEGGQADSGSQ
                     GDVDMAGTKREAPNPEETVCRFNLRCQNKDCKFAHQSPAAPPNTPIDLKDVCSFGAAC
                     KNRKCVGRHPSPAAKAAHQSEQDCKYFPNCANPVCPFRHPSMPACRNGGECKVPGCKF
                     THIKTPCKYRPCTNRNCPFMHEEGQRGTFQDKVWTAEDGRKEHVSERKFANEGPEDLV
                     LPGSGDQAPDAEATEVVI"
     gene            1610236..1612852
                     /locus_tag="MYCTH_2294760"
                     /db_xref="GeneID:11508943"
     mRNA            join(1610236..1610903,1611017..1611688,1611766..1612852)
                     /locus_tag="MYCTH_2294760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658634.1"
                     /db_xref="GeneID:11508943"
     CDS             join(1610325..1610903,1611017..1611688,1611766..1612623)
                     /locus_tag="MYCTH_2294760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658682.1"
                     /db_xref="GeneID:11508943"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2294760"
                     /translation="MYATSLRCTARNPGGNGAKCGPLRTCRRFLSAHVANARRPLRST
                     PPPHHNLRPPAPTTTPALPSSSSPSSSPLSSPSSSPLRPAIPPRSRSQQRRHYAVGNK
                     QHPPQTIAVLGGGLTGLTTAWYLTRLLPEAKITIYEANKRLGGWIETEKAEVKTPDGK
                     VGTVHFERAARMIKPQSAPARVPKWDDLVFYDLVTKLNLTDQLVHAKQDEEAVSGFIY
                     YPDHLVPLPKVTIRLSDPLGALRQLANLAALLFEPLFRDLIPAVLNIFRTRKDPFRMD
                     LFRGRRDMSVGDYYAYRLGSPALVDKLMSAMVHGITGGDVWKLSMGSGFLADQLVPTD
                     DEPITNVPVRSVDYEMMLQLARDKAVFDLASQHLDTSALWFRDGFSTLTNALADALEK
                     NPNVTFVTGQFVTRVEYIEKADKVGVHITRSLMEEPALYDKVVSTIFAKKLYKITDKL
                     LPSLLPTTAVSIMLVNIWYPVPRINFPYNGFGYLVPQALPFEQNPECVLGVIFDSDRE
                     SPLPTPSDPDPAPRGADTVQGTKLTVMMGGHYYTDWPLHVTANTFRAKKAALAAVERH
                     LRLPPELTEQAHASAKLCRDCIPQPLVGHARRMRAAHSELEWTFKGRLAVVGQSYQNP
                     GVLNMLRAARDVAVQIAGREEGAAAEWSVGDTGLERFTRQPKYLSLQRHMLPLRYGSG
                     AFVDESGQVRLREGALGTGG"
     gene            complement(1613399..1617358)
                     /locus_tag="MYCTH_2294761"
                     /db_xref="GeneID:11509137"
     mRNA            complement(join(1613399..1615163,1615217..1616424,
                     1616484..1617358))
                     /locus_tag="MYCTH_2294761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658635.1"
                     /db_xref="GeneID:11509137"
     CDS             complement(join(1613498..1615163,1615217..1616424,
                     1616484..1617200))
                     /locus_tag="MYCTH_2294761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658683.1"
                     /db_xref="GeneID:11509137"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="JGIDB:Spoth2_2294761"
                     /translation="MDSGMHDSTPPDKARGSIVNGVSGDDVPVKSESPTTGNKVVDNG
                     PAIDYSKLGSSLRDVKKEEPPDELQHITEGVMPLSLLLTRLAQFSHMKLQELILELAS
                     KPLPEHTRNGNAKGPINSGINGSVNTANGGAKMPGNVFEDTSPESLDKKTMLLKFIQD
                     LHSRWVKALVITEWARNADEVGKLIDLRIHLAEKLELYNKAFWNMIHVKQEMAFAKVP
                     SPDLKTALEVLSAGAVHWMPDFGYLPKPPLEAQEISHWLNEIEVTLHMRLQLHEYEQI
                     PEPWKQYKIDNGRVTFTVPGEFEVDLTISDEDFGTQFWFLDYRPLFSPAPPKLSDGAR
                     GFIEGRVNKILETEGLPGCYKYLHEMALTAKIGEFTRQAVELNRTGLWAETLRVERLN
                     RALGIQYWVQSSHTQGSESWILLGTHSGKNSEGGSDPNSPSRLVLQWFRDGKKVKDAD
                     IPFDADNISTEKLLTAVISRHIQHLLSTIFNTLQGKPRYARKQGKLALRISDQPGTDS
                     ALTMQLLGKADAVLSIGTWSGNFYFVDRSLIGLEWAHRLNSSRNPATEGPGMLEALRW
                     AYTVRYLRTLPKPADWVILPQAPVPSDEVKRVVYSHAPTTREPFYAMWMRNTRWSAQW
                     FAMMSLSLGGDRWWLIEVTAEGHGLPGFRISTFTELPITPTDLLPPAASLIPKLTKHT
                     ANIMAQIDDLRGLHQQRVPHTASKFRESGSLTTYVLSADMLARQPGSDDASRTTWAAK
                     FIPLAYKGPAPVPISEYRELLADLRSPQRQPARQRVMVEAKVDVTNRSRLQLLERNLD
                     RDVLYDHRAGQFILRLQPDSSSGAIPLLRARMQALDRLVGIVDGLGRGGKHVTPERIT
                     LREVVFSYSAKASAIRAPELSQPDQSSSSDGNTQRSWKVRLGLAGEQGVNVMLEPGNP
                     HLRVLDFLRATANSPQFKKLPSWLLFTLPLFEALERLQISWDAVLAKEQGTCYVFHKS
                     MDWVTIRFALTGAKNRRLHLDIRPRDKGGELTWHVYRPATDTNVNNENDEFNRVLKQR
                     VWSTNGRGFKGLMNGAAATWDDGIGNLLALIDEALQSLAGTPAPPQQAPAQAPQPTQR
                     PQQPQALELQNQQQPQQPQQPQQQQQQQQQQQQQQQPALPLHGSGAPGRFPHPLQQGQ
                     QAQYQQQQQQQQQQLQQARLQQQMHGQAQAQGQQRGGGVGNNNAPVVVLD"
     gene            complement(1618766..1621682)
                     /locus_tag="MYCTH_2074905"
                     /db_xref="GeneID:11508655"
     mRNA            complement(join(1618766..1619412,1619480..1620419,
                     1620474..1620818,1620879..1620899,1620961..1621033,
                     1621224..1621384,1621490..1621682))
                     /locus_tag="MYCTH_2074905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658636.1"
                     /db_xref="GeneID:11508655"
     CDS             complement(join(1619294..1619412,1619480..1620419,
                     1620474..1620818,1620879..1620899,1620961..1621033,
                     1621224..1621249))
                     /locus_tag="MYCTH_2074905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658684.1"
                     /db_xref="GeneID:11508655"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="JGIDB:Spoth2_2074905"
                     /translation="MASNLHSGGSVELKDNTVIVVLGASGDLAKKKTFPALFGLYRNQ
                     FLPTDIRIVGYARTKMDHDEFLRRIKSYIKTPTKDIEQQLEEFCSLCTYVSGQYDKDE
                     SFLQLNRHLEELEKGRKETNRLFYMALPPSVFTIVSQHLKKCCYPSKGIARVIVEKPF
                     GKDLASSRELQKSLEPDWKEEELFRIDHYLGKEMVKNILILRFGNSFLGATWNRHHID
                     NVQITFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPVSFSAEDIRDEKV
                     RVLRAIPAIEPKNVIIGQYGKSLDGSKPAYKEDDTVPKDSRCPTFCALVAYIKNERWD
                     GVPFIMKAGKALNEQKTEIRVQFKDVTSGIFKDIPRNELVMRIQPNESVYIKMNSKLP
                     GLTMQTVVTELDLTYRRRFSDLKIPEAYESLILDCLKGDHSNFVRDDELDASWRIFTP
                     LLHYLDDNKEIIPMEYPYGSRGPAVLDDFTSSYGYKFSDAAGYQWPTTSALGPGNKL"
     gene            1623454..1624592
                     /locus_tag="MYCTH_2313379"
                     /db_xref="GeneID:11508056"
     mRNA            join(1623454..1623588,1623720..1623729,1623869..1623964,
                     1624023..1624123,1624145..1624147,1624186..1624592)
                     /locus_tag="MYCTH_2313379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658637.1"
                     /db_xref="GeneID:11508056"
     CDS             join(1623564..1623588,1623720..1623729,1623869..1623964,
                     1624023..1624123,1624145..1624147,1624186..1624280)
                     /locus_tag="MYCTH_2313379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658685.1"
                     /db_xref="GeneID:11508056"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="JGIDB:Spoth2_2313379"
                     /translation="MPSESGHRLYVKGRHLSYQRGRHNTHPRTSLIKIEGVDDTAAAN
                     FYTGKRVAYVYRGQKEVRGTKIRVIWGKVTRPHGDSGVVRAKFSTPLPARSFGASVRI
                     MLYPSSI"
     gene            1627454..1629670
                     /locus_tag="MYCTH_2294768"
                     /db_xref="GeneID:11508929"
     mRNA            join(1627454..1627952,1628016..1628312,1628367..1628447,
                     1628505..1628624,1628796..1629670)
                     /locus_tag="MYCTH_2294768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658638.1"
                     /db_xref="GeneID:11508929"
     CDS             join(1628294..1628312,1628367..1628447,1628505..1628624,
                     1628796..1629517)
                     /locus_tag="MYCTH_2294768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658686.1"
                     /db_xref="GeneID:11508929"
                     /db_xref="JGIDB:Spoth2_2294768"
                     /translation="MHEAEPAEVAASIGTTFAPLRSIQHKDIWGNPIVDPDRSNPTRS
                     RWERPLETIRSFEAAIDGAYNNRRSMIRPDGSSGRFGHDSYYGSRPSSMMYANRADGS
                     LPDLRAGSVGQRDSYYEQQTGYSGYGPSTQNGRRGWARMASEPHYGSSSRQPPPGGQG
                     DYPIPSNHRSNETVTTASGSGSSAEPAGYQTDPTSSDNSSIERVQSSVPRRQPENDYG
                     IGFSQSAVYQPPSFALGGQTEGANGARGNVGYSNDSNYQVSGVANHSNTPPRVPQKDS
                     GAGILKKPIVNNSSQQARPAQPEKRKSWFARRFSKHG"
     gene            complement(1630145..1630981)
                     /locus_tag="MYCTH_2087521"
                     /db_xref="GeneID:11508981"
     mRNA            complement(join(1630145..1630404,1630517..1630608,
                     1630677..1630981))
                     /locus_tag="MYCTH_2087521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658639.1"
                     /db_xref="GeneID:11508981"
     CDS             complement(join(1630265..1630404,1630517..1630608,
                     1630677..1630789))
                     /locus_tag="MYCTH_2087521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658687.1"
                     /db_xref="GeneID:11508981"
                     /db_xref="JGIDB:Spoth2_2087521"
                     /translation="MATRRIISHEKTILEKDDSIGSSPAANEKSNIAPAVPTSVIMKL
                     LAFTLGMIVIPIGSYYVTVDTLFRGNSTYAGALAAIMANVVLIGYIFAAMAEDQSEQQ
                     GGAAAKEGKKDR"
     gene            <1631534..>1634552
                     /locus_tag="MYCTH_44797"
                     /db_xref="GeneID:11505768"
     mRNA            join(<1631534..1632034,1632087..>1634552)
                     /locus_tag="MYCTH_44797"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658640.1"
                     /db_xref="GeneID:11505768"
     CDS             join(1631534..1632034,1632087..1634552)
                     /locus_tag="MYCTH_44797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658688.1"
                     /db_xref="GeneID:11505768"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_44797"
                     /translation="MEFSSSPPANRRLLSLEDDDDDDDDELTLVTQSPYFTQPTQVVE
                     RPNPQLPPVATSSPKSIVEVPASSPFRPQALQQRRGPLANVMAPAGTTFRPPAQKPLP
                     ITKSAPKREFVMISDDELDAPIYAGGDSSDDDEPSRGDIRPSSFQPRGPKISQVAPEG
                     QAVAKKTIQAAKSASTSSVTSPEKSYVLQKDWVSLSPSSSSQESFESLRRVSPPKPTR
                     RRLVQGRRPRSASPSSPVLSLSQQTPQRAQLIDLVSDDDVGDDYKASKTSSQRGSSPV
                     GGEEEDPFDKRVLNYLNTCDVMQLVAIANVKEDSAKLMVSRQPFSDLEEARRVTISQK
                     KRGKKAAKVSIGDEIVSAVRSYARALDDIDHIIAVCESQADSLKATTSRWNIDLTGHL
                     RSDSKPDDGKPMTPVSVEDSAKLVEVPLRQPKLMEGCTMKPFQIYGLNWLHLLYQNRY
                     GGILADDMGLGKTCQVISLICSIVEDYERNGRSMDTRPWPNLIIVPPSTLANWAAEFE
                     KFAPKLNVTLYQGSQSARDEIAFDIGEDPSSHHVVLTSYSQLSRNDDISNLRRLRPTV
                     AVFDEGHKMKNPKTKVYKDLLRITVTWRLVLSGTPVQNNLMEMVALLQFVEPKLFQDH
                     FENLEALFNQKLSLTAVSKGALLHSERVARARTILEPFILQRRKEQVLQDLPPKTSRV
                     VTCKMDPVQEAIYRDYERRFRKSDSSASDPRVKEGRDNDTNNVWIQLRKSAIHPQLFR
                     RFFKDRDVEKMAEILMKKVPQSELRQPRLDHLINELKALSDFELHLWCRDYECIRRYD
                     LPDKSWTDCAKVKALLELVREYQANGDRTLVFTRFAKVIEILGECLASEGIEYLSLQG
                     NTDVSARQELIDEFNADESIPVFLLTTGSGGTGINLTAANKVIIFDQSDNPQDDIQAE
                     NRAHRLGQTRPVEIIRLISEGTVEELVYKACEKKLELANKVTGWSSVEMTSGEMESAV
                     KSELLRQGVSTPPSGN"
     gene            1635708..1638026
                     /locus_tag="MYCTH_2294774"
                     /db_xref="GeneID:11509151"
     mRNA            join(1635708..1635888,1635947..1637047,1637131..1638026)
                     /locus_tag="MYCTH_2294774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658641.1"
                     /db_xref="GeneID:11509151"
     CDS             join(1635829..1635888,1635947..1637047,1637131..1637988)
                     /locus_tag="MYCTH_2294774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658689.1"
                     /db_xref="GeneID:11509151"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Spoth2_2294774"
                     /translation="MSFLIALWHTLWDVVWFWQARTVSYLFERSKLQEYAHDLRTAST
                     YEQWAEAAQNLDLGLGLDLWRHDPTSKDYDFRLINERLRLIANARKAGDVYELINTLR
                     TGLVRNLGNITSPKLFNCAFAGTKHLIEEYVQQFVEAIQEIVMLPPPPQDERQPTVEW
                     FAPEWEDGELGGSGSSGAGSGFEGGGDEKSAISAAAAARLSKGGMAKATLPTQHLLDF
                     VHDTRQGFGRTALVLQGGAIFGLCHLGVVKALYLRGLLPRIIIGTATGAMMAALVGVH
                     PEEELPRILTGDGIDLSAFAANGRDPEGHNKRVMQSLWTKWATLIRRVRRFQREGYFL
                     DVKVLEECVRANVGDLTFEEAYNRSKRVLNITVVTAGQEGIPTLLNYITAPNVLVWTA
                     AVASNASSTTFYGHRQTKILCKDAHGNITPWAPADTVDFRHWTFASYTDRNAPLQRVA
                     GLFNVNHYIVSQARPYLIPFLQSDMHGPSTSQQYGSIGWDPRQHGSMFAAARTFITRI
                     IGLETRHRLRQLDRLHLLPPLIRRFLVDEHLPGPSVTLVPQVGLTDFVRLLETPTKET
                     LEYWILRGERSVWPAVAALWVRCAVEMELDRAYQEVSRYKAGDLRRKASEIEQLGREV
                     MGANGERLAGAAGENMGVGGGQQLVMTVQRPRAWSISARCPPSAKTVL"
     gene            complement(<1641224..>1641520)
                     /locus_tag="MYCTH_2049886"
                     /db_xref="GeneID:11508191"
     mRNA            complement(<1641224..>1641520)
                     /locus_tag="MYCTH_2049886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658642.1"
                     /db_xref="GeneID:11508191"
     CDS             complement(1641224..>1641520)
                     /locus_tag="MYCTH_2049886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658690.1"
                     /db_xref="GeneID:11508191"
                     /db_xref="JGIDB:Spoth2_2049886"
                     /translation="LFLKYHHFVRVYIDDIIIFNKIEEEYLEYLYTIYKILDKAHIYI
                     GIAKSFIRYLAIRLLRYIINDKGITKTDNHITTFKKLKFLDTLDSLEHYLRMAG"
     gene            <1661663..1662355
                     /locus_tag="MYCTH_75987"
                     /db_xref="GeneID:11508429"
     mRNA            join(<1661663..1661882,1661938..1662355)
                     /locus_tag="MYCTH_75987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658643.1"
                     /db_xref="GeneID:11508429"
     CDS             join(1661663..1661882,1661938..1661984)
                     /locus_tag="MYCTH_75987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658691.1"
                     /db_xref="GeneID:11508429"
                     /db_xref="JGIDB:Spoth2_75987"
                     /translation="MSCIAKRSIKRFVKTEEHIALATTINKLGFEVMPCSFCFSCSLY
                     YYIIESSSRYGKCICRRRLYDGSRVLVSSYYRRIEAPRPVRIRC"
     gene            complement(<1680154..>1683551)
                     /locus_tag="MYCTH_41898"
                     /db_xref="GeneID:11506003"
     mRNA            complement(join(<1680154..1680267,1682156..1682206,
                     1683447..>1683551))
                     /locus_tag="MYCTH_41898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658644.1"
                     /db_xref="GeneID:11506003"
     CDS             complement(join(1680154..1680267,1682156..1682206,
                     1683447..>1683551))
                     /locus_tag="MYCTH_41898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658692.1"
                     /db_xref="GeneID:11506003"
                     /db_xref="JGIDB:Spoth2_41898"
                     /translation="LNNKALMQLFYNGLKEKVKDKLYKYNQPKTLDKYIPSLGIMEPD
                     KIYRTRARKRGRINGTIVKANDKKKRVYVSTSYRTYPGAIDIDIA"
     gene            1706928..1708839
                     /locus_tag="MYCTH_2294775"
                     /db_xref="GeneID:11505820"
     mRNA            join(1706928..1706981,1707193..1708325,1708813..1708839)
                     /locus_tag="MYCTH_2294775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658645.1"
                     /db_xref="GeneID:11505820"
     CDS             1707370..1708002
                     /locus_tag="MYCTH_2294775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658693.1"
                     /db_xref="GeneID:11505820"
                     /db_xref="JGIDB:Spoth2_2294775"
                     /translation="MSSVQVANASADGALAQLEADLNGANRTDTIAGYRPDHKAPSNS
                     STETPGTDDTATLTGLPAPLAPAVAPLPSEPIRTHTPLTSSNMDLHQRELGQLYTGNI
                     KQWAISAGIGSRFQTGGNDDNNNSNNDTMSSSLEHSLLTALTAGGGPGGERSVSGSNI
                     SQGGDWVMVVPPSKTDEDVAGAGMWSTDMPMPPVMATRRASVASSDGGFY"
     gene            1708840..1710929
                     /locus_tag="MYCTH_2294783"
                     /db_xref="GeneID:11505426"
     mRNA            join(1708840..1709339,1709442..1710929)
                     /locus_tag="MYCTH_2294783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658646.1"
                     /db_xref="GeneID:11505426"
     CDS             join(1709190..1709339,1709442..1710593)
                     /locus_tag="MYCTH_2294783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658694.1"
                     /db_xref="GeneID:11505426"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Spoth2_2294783"
                     /translation="MSNTFGLRRLLSLALGASCIAVASCRNHWVDIWASMPQEVEPYN
                     LPNPPYNGTDGVFQNTTIRTTVYVTQDASTIRLQLSNAFGGSDLPITAATIALPANGT
                     AGSPAIRPGTLQYLTFSGSRSFAVPNGALVVSDPIHFPVKAQTSVTVSVYLASGQAGF
                     AITGHPGSRTTSWLTQGDLVSAADVTTPTTQRIDKWFLVSALQAWLPATHGSLAIVGD
                     SITDGRGSTTNGNDRWPDQLVRRLRAAGGKKPLLRPLSVANMAAGGNRVLADSLGPNA
                     FGRIERDVLARSGVRYALVYEGVNDLGTAAPDPVSQAAVGDRLIAAYDQMITRLHGAG
                     IPVFGATITPMCGPGQPYSDPVREAQRQRVNRWIRTSGRFDAVVDFDRAVRDPKNATM
                     LRTEYDSGDYLHLNPAGYKAMADAVDLDLFVRFAGGVYSMV"
     gene            complement(1711019..1714284)
                     /locus_tag="MYCTH_2294784"
                     /db_xref="GeneID:11513282"
     mRNA            complement(join(1711019..1711745,1711820..1712454,
                     1712510..1712674,1712728..1712866,1712923..1713199,
                     1713254..1713366,1713423..1713572,1713637..1713726,
                     1713788..1714284))
                     /locus_tag="MYCTH_2294784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658647.1"
                     /db_xref="GeneID:11513282"
     CDS             complement(join(1711367..1711745,1711820..1712454,
                     1712510..1712674,1712728..1712866,1712923..1713199,
                     1713254..1713366,1713423..1713572,1713637..1713726,
                     1713788..1714194))
                     /locus_tag="MYCTH_2294784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658695.1"
                     /db_xref="GeneID:11513282"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="JGIDB:Spoth2_2294784"
                     /translation="MGSKAADKKRKSRESDSESDDGLGNGLFDGVLSQSEDEEEYIPS
                     DDDGDEDEDDESGSEDSDASEDGEEDDLLSDDIPSDVDGDGEMDKLAKQQGELEITEP
                     GVDPKPKQEEEEEGEERNYRIEKDANGGVRYVYDEIDPVYDSDDTDAKEPVNTIGNIP
                     LSFYDSYPHIGYDINGKKIMRPATGDALQSLLDSIEVPKGWTGLTDLDTGNPLNLTDE
                     ELELVRRVQMGLLPEDLEDPYPDTVEYFTSIEEKMPLSAAPEPKRRFIPSKNEAKQIM
                     KLVRAIREGRILPYKPPEEREREEEEQEEVHFDLWQNEEPRPPNPMHIPAPKLPPPGY
                     DLSYNPPEEYLPSKEEREEWEKADPEDREKDYLPQKYTALRKVPAWDNFVKERFERCM
                     DLYLAPRVRKNRLNIDPNSLLPKLPSPSELKPFPTVVQTIFRGHEGRVRSVSIDPSGV
                     ALATGGDDGTVRVWELLTGRQVWSVKLSSDEPVNTVRWRPTKDAFILAAAAGEDIFLM
                     VPTHASVTPALDQASRDILAAGFGYATNGQQQALPVGKEPPAKWARPGTKLEDEGVLI
                     RITVRSTVKVISWHRRGDHFATVSPAGQRSSVAIHTLSKHLTQIPFRKLSGLAQTAAF
                     HPLRPLFFVATQRTIRCYDLQKLELVKVVQPGAKWISSFDIHSGGDNLIVGSYDKRLL
                     WHDLDLSNRPYKTMRFHSEAIRQVRYHKGGLPLFADASDDGSLQIFHGKVPNDQLENP
                     TIVPVKMLKGHKVVNKLGVLDIDWHPREPWCVSAGADGTARLWM"
     gene            1715013..1716669
                     /locus_tag="MYCTH_2294789"
                     /db_xref="GeneID:11508665"
     mRNA            join(1715013..1715253,1715317..1716669)
                     /locus_tag="MYCTH_2294789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658648.1"
                     /db_xref="GeneID:11508665"
     CDS             join(1715193..1715253,1715317..1716617)
                     /locus_tag="MYCTH_2294789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658696.1"
                     /db_xref="GeneID:11508665"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="JGIDB:Spoth2_2294789"
                     /translation="MDAAERQTSEQPKRRACDECRGRKLACSKEIDGCARCKREGIKC
                     VYSPQKRMGRPRKHRPTEVAAPPTTAAKTTEAPPESVHPFVVPDFQFDGAIGMDLDLS
                     FLDMSNKDMNFLEIVDPNTQFPPRPAQNSLDSGTDSFVKQAETARPPGVFWPMSGNLG
                     DINFDEPPPGPTPQPAPEITAEEVAQMLCGDLESLPSLSPPSATSPSSHASPSEPDRD
                     ISCSCLSSLYLALDSLRTLPKDVPAAMRVARTAAKAAHDTVLCPVCGDPPIDPHAKSS
                     IQAFQSIMMLGALLPSLSNAYMRILTMIDAEAAAADREGRQIRFMLSSYGGLWGWMAK
                     MDSSKCNVRGRLEGVMLDPLLWRLTVRSLLKLDVYGINDCTPGAGGEGAQQPGLKDII
                     AMLEERSRRRHEQLDALVEAGVLKKNQCGVGYVALSSETEKPTCLRIIDIAKRSMDEL
                     VIP"
     gene            complement(1717179..1718652)
                     /locus_tag="MYCTH_2294791"
                     /db_xref="GeneID:11509195"
     mRNA            complement(join(1717179..1717572,1717649..1718142,
                     1718220..1718332,1718425..1718652))
                     /locus_tag="MYCTH_2294791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658649.1"
                     /db_xref="GeneID:11509195"
     CDS             complement(join(1717435..1717572,1717649..1718142,
                     1718220..1718332,1718425..1718585))
                     /locus_tag="MYCTH_2294791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658697.1"
                     /db_xref="GeneID:11509195"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="JGIDB:Spoth2_2294791"
                     /translation="MAQMRGPGSYGIAAPSPFGGPTDDKSAQSPLEAIREQTSKIEDL
                     MDTVSEPIKPYLPAIGRFLIVVTFIEDAIRIITQWTDQLLYLHDYRHIPSGLTHLFLI
                     LNVIAMVTCSTLVIIRKHSEYAVGGLIAVVITQALGYGLIFDLNFFLRNLSVMGGLLM
                     VLSDSWVRKTKAFAGLPQLEEKDRKMYFQLAGRVLLIFLFIGFVFSGQWSIWRVLVSL
                     VGLVACVMVVVGFKAKFSATLLVVILSVFNVLVNNFWTLHEHHPHKDFAKYDFFQILS
                     IVGGLLLLVNSGPGQFSIDEKKKVY"
     gene            complement(<1720330..>1721141)
                     /locus_tag="MYCTH_2114377"
                     /db_xref="GeneID:11505780"
     mRNA            complement(join(<1720330..1720468,1720543..>1721141))
                     /locus_tag="MYCTH_2114377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658650.1"
                     /db_xref="GeneID:11505780"
     CDS             complement(join(1720330..1720468,1720543..1721141))
                     /locus_tag="MYCTH_2114377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658698.1"
                     /db_xref="GeneID:11505780"
                     /db_xref="JGIDB:Spoth2_2114377"
                     /translation="MPGEQFPSETPVPTPTPGQGPPTYSGSDKDDGGSGLSAGAIAGI
                     AIGGAAVLILGATLLYLCGRRGGFDKAYRKSILAPTAAAAAARSGGGGGDGAAGAARP
                     RSPSMVEANYANGPAAIGGGADGLGLGHNPNSPGQATVSTFSGHDVRSSIYAGAGGYP
                     YIGTTPSPPPPGAGTLPPYGFAVVGQPPHGHPAYAGGIYPPPHSSPRAEQKTPFLHEP
                     APVELPSGEPPVPTKPLPPGYKSSQHP"
     gene            complement(1721652..1721978)
                     /locus_tag="MYCTH_2294793"
                     /db_xref="GeneID:11508598"
     mRNA            complement(join(1721652..1721746,1721801..1721978))
                     /locus_tag="MYCTH_2294793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658651.1"
                     /db_xref="GeneID:11508598"
     CDS             complement(join(1721681..1721746,1721801..1721962))
                     /locus_tag="MYCTH_2294793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658699.1"
                     /db_xref="GeneID:11508598"
                     /db_xref="JGIDB:Spoth2_2294793"
                     /translation="MFVRHALGLLAALAVVVAGQDDQNNDPTPTEDSNTPSETSDTSG
                     PATVTIAVGANGHVFTPNEAKANVGDIISEF"
     gene            complement(1723511..1725834)
                     /locus_tag="MYCTH_2294795"
                     /db_xref="GeneID:11508138"
     mRNA            complement(join(1723511..1723741,1723846..1725426,
                     1725502..1725834))
                     /locus_tag="MYCTH_2294795"
                     /product="glycosyltransferase family 57 protein"
                     /transcript_id="XM_003658652.1"
                     /db_xref="GeneID:11508138"
     CDS             complement(join(1723880..1725426,1725502..1725739))
                     /locus_tag="MYCTH_2294795"
                     /note="CAZy_ID 267974"
                     /codon_start=1
                     /product="glycosyltransferase family 57 protein"
                     /protein_id="XP_003658700.1"
                     /db_xref="GeneID:11508138"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="JGIDB:Spoth2_2294795"
                     /translation="MAKPSPSSHKPRRKAKHAVDSPSSFRNSGPIETLSRAPAFPLAA
                     FLWPARGTASQWELLPLILMAVGLFRWAAGLWGYSGFEKPPMFGDYEAQRHWMEITTQ
                     LPISQWYFHDLEWWGLDYPPLTAYHSWLCGKIGSLIDPSWFALFSSRGSHDPTLKVFM
                     RATVIVSEYLIYIPAVVVFVRRYSRLNGVANWSAAVALVAILMQPATILIDHVHFQYN
                     TVMLGFVVASMSSMLAGRNLWAAVFFVAALGFKQMALYYACSVFAYLLGSCVFPRINL
                     PRLIAISAVTAASFAILILPIVLGTLVDVHRGIDSRPDIDGPRPPLPLFQWLADYLDT
                     EAFYYPVVEQLVQMVHRIFPFARGLFEDKVANFWCALNVVVKIKKYPSELLQRGALVA
                     TLISIIPPNLVLFFRPRKELLPLAFAATAWGFFLFSYQVHEKSVLLPLMPMTLLLASS
                     HGLNKTTRAWVGFANILGCWTMFPLLQRVGLAVPYAVLTLLWAYLLGLPPTSLSVYFH
                     EGSSSWTQWATLFVHGSFYLVMALWHVLVQSLRPPPDKPDLWLVANVGVGAAGFSLCY
                     LWCLGRLLLQGEILPRSWFVRKDKVKTQ"
     gene            1726044..1728249
                     /locus_tag="MYCTH_2294799"
                     /db_xref="GeneID:11512963"
     mRNA            join(1726044..1727484,1727548..1727850,1727960..1728249)
                     /locus_tag="MYCTH_2294799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658653.1"
                     /db_xref="GeneID:11512963"
     CDS             join(1726252..1727484,1727548..1727805)
                     /locus_tag="MYCTH_2294799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658701.1"
                     /db_xref="GeneID:11512963"
                     /db_xref="JGIDB:Spoth2_2294799"
                     /translation="MPYPFVLPTTSSFSFSSSFTSESHPSLPLQASTHRGVVRDTLKK
                     YKRLPPASQASSLSTVASTLQTYIPYLLALDAGLSPKGSHSADKPSVTLTATPQIEWR
                     PTLSGSSLPGREPPRVKIHSLEHEILFALSALANTHTLQSRAALQPLYLTTTAPVGTT
                     QRQTAITTATRHLLDAASIYDYLCARLSLSPAAAAQRPPCPDIAPSTLGAMRSLALAE
                     ATLLAVLKDDPYPAAVAQARNPHDTEWMYKSPDVPKVRAHLFARLCLAAAEHASQAAA
                     GLASSSSSSSSSSSLTSSGLGSAGKVNEGLVRYVEDLRRTSRARACRFFGIDAELGGE
                     TGTGIAWLRAGLGELGIERKGDERKGGGLKGLRKEWSEKREDKKVERGLDWGADGGRL
                     EETRVLEMLEAKWVKQNDTMLTQPIPPVGPLLAQMPSGREIHTIKPFHPPVLDSDALE
                     AMRAPPDAPDEVGNYPSSDEDTAVNPIPGAFPGVSGQSRSGTPGYF"
     gene            complement(1729133..1730855)
                     /locus_tag="MYCTH_2294800"
                     /db_xref="GeneID:11508143"
     mRNA            complement(join(1729133..1730363,1730426..1730855))
                     /locus_tag="MYCTH_2294800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658654.1"
                     /db_xref="GeneID:11508143"
     CDS             complement(join(1729362..1730363,1730426..1730689))
                     /locus_tag="MYCTH_2294800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658702.1"
                     /db_xref="GeneID:11508143"
                     /db_xref="JGIDB:Spoth2_2294800"
                     /translation="MSDSEDPVDIADEGADDLFGDGDEALSDAENAVSDREAASEREG
                     READARFHDDHDDHDDEEPRQFREKLVSEVPLYRHRIPRSKDGGLHSLRVPDFIKFKP
                     MEYKSDEWQPSKWDLDNANSENPIPSIMWRRDPATGRMQSNANIYRWSDGSVTLAIGD
                     EHYEIQSKPLAPPSNKPYREVQDAHYYAAAAHLTTNSLLIVGHLTEQYTVRPNKELQD
                     HALERLKADLAGAKRDRSAEMIIVTNEDPELQKKQAELAEKERAKLQRRRETAAARAD
                     GLGGRYKSGGPLSVGDLEGRRGPAAAGRKRGAPGAAKQKRRRPEYDSDDDLPSGTRRG
                     DNYDMDDGFLVNSDEESEAAEEDEEEEEELLDDEEEEEEEEKDDRPRAKRQRTSDPDE
                     DAEGEEDAPTHETSRGRRRRVIQDDDDEE"
     gene            1731048..1733235
                     /locus_tag="MYCTH_2294802"
                     /db_xref="GeneID:11508773"
     mRNA            join(1731048..1731272,1731891..1732300,1732365..1732476,
                     1732535..1733235)
                     /locus_tag="MYCTH_2294802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658655.1"
                     /db_xref="GeneID:11508773"
     CDS             join(1731250..1731272,1731891..1732300,1732365..1732476,
                     1732535..1733072)
                     /locus_tag="MYCTH_2294802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658703.1"
                     /db_xref="GeneID:11508773"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="JGIDB:Spoth2_2294802"
                     /translation="MSNLFSGINARFRGQRSPNSGASSPSPEQQQAQAQAQAQAQAQA
                     QGQHPGNLPQGQPGSQSSSSNLAVKLPPLPTSPSLAETIGMDQASGMVPSAEEVLASY
                     HLPPVKPLWLNANYAKHIVKGNFLTLSAKPKTVEMGEWIAHQVVDHWRMLITFIRLVH
                     DKEEDGTSICNSRRCAKMSAGSNHSFTWLNSRYQPVEIPAYEYLTLVQRYITGKLDDT
                     SIFPTDPAGVSYADNPAFCTPVPESGPDWVGKRSGFPQNFMETCQTIFRQMFRVYAHL
                     YWSHFEDMFCLNLEKSMNSCFSHFILTATTLNLLKKSDLEPMQPLIDLWAALGTFPQG
                     SKAYEIANIAVGQLLIQKAGGPPASN"
     gene            complement(1733277..1734472)
                     /locus_tag="MYCTH_2294805"
                     /db_xref="GeneID:11513221"
     mRNA            complement(join(1733277..1733555,1733707..1734019,
                     1734293..1734472))
                     /locus_tag="MYCTH_2294805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658656.1"
                     /db_xref="GeneID:11513221"
     CDS             complement(join(1733416..1733555,1733707..1734019,
                     1734293..1734334))
                     /locus_tag="MYCTH_2294805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658704.1"
                     /db_xref="GeneID:11513221"
                     /db_xref="JGIDB:Spoth2_2294805"
                     /translation="MAGFPKLIPAFTVQVAIEPPKAISSSLTVVPFLSTGGTIVSEPS
                     YPIKLDAAIEHGADYIKAAPDGRHVRLDVQSTARDAATGSLLRFMYRGKIATTGDAGR
                     VLRGEENAGTTDFGEAFSIVEFEVGSKELAALEEKVYVGSGRFVFEPGKPTIVEYKVS
                     EVAA"
     gene            <1735637..>1738216
                     /locus_tag="MYCTH_90985"
                     /db_xref="GeneID:11505594"
     mRNA            join(<1735637..1735923,1736088..1737848,1737940..>1738216)
                     /locus_tag="MYCTH_90985"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658657.1"
                     /db_xref="GeneID:11505594"
     CDS             join(1735637..1735923,1736088..1737848,1737940..1738216)
                     /locus_tag="MYCTH_90985"
                     /note="Contains conserved domain: COG0598, CorA, Mg2+ and
                     Co2+ transporters [Inorganic ion transport and
                     metabolism]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658705.1"
                     /db_xref="GeneID:11505594"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="JGIDB:Spoth2_90985"
                     /translation="MELSKKQSHPDMAASASDQASHPPPPSAPAPRRRKNHRGGRRKK
                     QRRKSFAAPADEIAQDNVNEGVLEDASQRFYARPGGNLSTTSIESESLLDHRADSDEE
                     DEGAPLLSSPVFPRRDTFGGYGSADASRKNGPPSHSGSSKASSARGRQPADSYNVNYP
                     PSVPGSPALHPTNRMSMSFGDVLLRDEIDRRETSTTRGSGDEGGRPSPSDRRKTIALQ
                     AEEDVCFPQDGLSELGDEEPSTRDRDSASRQRTRRRCGKWPDLSILDEWSRFEKEGRS
                     EERRVKRITEPQLIDGRLRPVHRGWFQAEEAAPYRFTYFNEELPSTIHSQTISELVQP
                     GGTFRDLFMPDPPILSDTSDGEEEQEQELDLFQVLGGQSGDPRIPARQPSLAATSQEF
                     ERKTSTNSEATRTGPGGCAPSDLKSPDASKPAQNGKPSKALKYGDRPVWWLDVLSPTE
                     AEMKVLSKAFGIHPLTAEDIMMQEQREKVELFRNYYFVNYRSFDQDRASEKFLEPVNM
                     YVVVFREGVLSFHFSVTPHPANVRRRIRQLRDYLILSSDWISYAIIDDITDAFGPLIQ
                     NIEDEVDDIDYAILQMHSEEDHALREERRRLNEKCDASAEVRSAEAGRDMLRRVGDCR
                     KKVMSLYRLLSNKADVIKGFAKRCNEHWEVAPRSEIGLYLGDIQDHIVTMTSNLSHYE
                     KILARSHGNYLAQINIRMNERQEQTADVLGKLTVLGTIVLPMNIITGLWGMNVWVPGQ
                     EYEGDLKWFIAITTGLILFGVACYLIAKRVYNIV"
     gene            complement(1738418..1740229)
                     /locus_tag="MYCTH_2294810"
                     /db_xref="GeneID:11513040"
     mRNA            complement(join(1738418..1739588,1739675..1739793,
                     1739890..1740015,1740081..1740229))
                     /locus_tag="MYCTH_2294810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658658.1"
                     /db_xref="GeneID:11513040"
     CDS             complement(join(1738932..1739588,1739675..1739793,
                     1739890..1740015,1740081..1740132))
                     /locus_tag="MYCTH_2294810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658706.1"
                     /db_xref="GeneID:11513040"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294810"
                     /translation="MSTRQPSRVVFVGNIPYGLTEEQITEIFSGAGRVLNFRLVYDRE
                     TGRPKGFGFAEFPDYDSAASAVRNLNDYEIMGRKLRVDFSNETVSDDDNRDRDGAAGA
                     GGINYSNNPGATNGSGSSASNPSATSGGSSSLPPLPQGKDLPPGVSCTDAISRTLNTL
                     PPAQLLDILQQMKALATSDPARATELLTQAPQLSYAVFQALLIMGLVSPDAITSVLET
                     GAAAPTQAPAPAPASAPAATIPAPAAYGTVGATGTPPVPGGYAPPPAAPAPAPGPAAQ
                     DPEALMRAVMELPQETIDQLPETERQQIMALRTSYAAQMRR"
     gene            1740803..1742157
                     /locus_tag="MYCTH_2294811"
                     /db_xref="GeneID:11506028"
     mRNA            join(1740803..1741527,1741616..1742157)
                     /locus_tag="MYCTH_2294811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658659.1"
                     /db_xref="GeneID:11506028"
     CDS             join(1740913..1741527,1741616..1741936)
                     /locus_tag="MYCTH_2294811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658707.1"
                     /db_xref="GeneID:11506028"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="JGIDB:Spoth2_2294811"
                     /translation="MSNRSPFEDYANRIRAAARAGGRAGFGPGGGFPGGSPRGLGGGL
                     AGLLLLGGGALLFQNALFNVDGGHRAIKYRRISGISKDIYGEGTHFVIPWFETPIIYD
                     VRAKPRNVSSLTGTKDLQMVNITCRVLSRPDIQALPQIYRTLGQDYDERVLPSIVNEV
                     LKSVVAQFNASQLITQREMVAKLVRDNLSRRAARFNILLDDVSLTHLGFSPEFTAAVE
                     AKQVAQQEAQRAAFVVDKARQEKQAMVVKAQGEARSAELIGDAIKKNRAYVELKKLEN
                     ARAIAGLLQEAGGKNRLLLDSEGLGLNVFDQTERK"
     gene            1742456..1743653
                     /locus_tag="MYCTH_2294813"
                     /db_xref="GeneID:11508477"
     mRNA            join(1742456..1742777,1742895..1742949,1743094..1743176,
                     1743282..1743653)
                     /locus_tag="MYCTH_2294813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658660.1"
                     /db_xref="GeneID:11508477"
     CDS             join(1742767..1742777,1742895..1742949,1743094..1743176,
                     1743282..1743366)
                     /locus_tag="MYCTH_2294813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658708.1"
                     /db_xref="GeneID:11508477"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Spoth2_2294813"
                     /translation="MLIKVRTLTGKEIELDIEGSDQVSKIKELVEEKEGIPPAQQRLI
                     HGGKQMLDDKTADDYSLVGGATLHLVLALRGGL"
     gene            complement(1743912..1745792)
                     /locus_tag="MYCTH_2294814"
                     /db_xref="GeneID:11505717"
     mRNA            complement(1743912..1745792)
                     /locus_tag="MYCTH_2294814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658661.1"
                     /db_xref="GeneID:11505717"
     CDS             complement(1744037..1745629)
                     /locus_tag="MYCTH_2294814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658709.1"
                     /db_xref="GeneID:11505717"
                     /db_xref="JGIDB:Spoth2_2294814"
                     /translation="MTEPRAAAHVTNGFRPALETCLGPRSLADMCLRVALNNVRHIQS
                     LGNLPPQYTGPILRHVKTAEQLHQLELNSDDIYDQTAAHWMRIIKDKFPELASQHNFV
                     PQKRKSWHKVYDKYEKLQEEQIAAATEKLKQGLAAQTQQQQSRKSTIISSKESVGLRR
                     PKAKPGYSLVSKKQDFFSKTRTQLRMEAGRFRTNPLASRTSQIKKAPAAMIEEARIKS
                     QPSLVPPPPPLRPDLPSKPTAVGSGGITSREEKEARLLQVKNAGRTKPEAGENVLRFS
                     DDEDDEDTKLNEDDDLFGDFADPEFDDVSNGSQSQKAVASSASSPSRTASIKPLLVPE
                     QPTKHLRDPVKVGDKQPVKRRRSVEEADAEQPTKHRRSHEETTTPMLSASNKASTLPS
                     LAPQQSAKRRPKGLSAAPGANKGIAFKPASRAVINPAIKTVPKPASKEGAESKPSSRP
                     AVNPSTGSRSHRGVPMTAPSASRSRSASTSGDELTADHGRRATRCGSQDPVESLSGLP
                     VRAMQPANRYPILRPSPKLKNS"
     gene            1746695..1748237
                     /locus_tag="MYCTH_2294815"
                     /db_xref="GeneID:11508581"
     mRNA            1746695..1748237
                     /locus_tag="MYCTH_2294815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658662.1"
                     /db_xref="GeneID:11508581"
     CDS             1746958..1748163
                     /locus_tag="MYCTH_2294815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658710.1"
                     /db_xref="GeneID:11508581"
                     /db_xref="JGIDB:Spoth2_2294815"
                     /translation="MASWGLLDDKEETELHKSRLLNVEEKPFKRITKRLNTLHSITTA
                     RARQAPTPPPDSNGTSQQQRDGTPAPGSSDDSTLPDLAQLKEDITIDFAAFDSSIARL
                     QFLLTANERERERYAAERERIVAASHAVRDNTAQLRVQLEQARATLAQRREFDALADA
                     ITSNPSLRPRAEQEANLRKLRDEIAELEAEREAYGVTWHERREQFARIMEESMRLRRL
                     IRDEKEEVERREGMDDDEVGATPRPSGTGSREGSPKPDAGLAPKSAPESGDAEGTPRP
                     VSVGGRSPARDSPAPGQDAHSLTAKRAIATDASFSQVGSQVGSQIGSQVGSQVGSQMG
                     SQMGSRAGSREGSVERQDQGSAEEGEDIEMGETKDNEQEPGSPLTPPAADDAPQIVVN
                     GEGESMDTT"
     gene            complement(1748238..1748917)
                     /locus_tag="MYCTH_2294816"
                     /db_xref="GeneID:11508614"
     mRNA            complement(join(1748238..1748504,1748569..1748917))
                     /locus_tag="MYCTH_2294816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658663.1"
                     /db_xref="GeneID:11508614"
     CDS             complement(join(1748313..1748504,1748569..1748748))
                     /locus_tag="MYCTH_2294816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658711.1"
                     /db_xref="GeneID:11508614"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="JGIDB:Spoth2_2294816"
                     /translation="MAPPTPLAIATQAVNRLVKEESYYHKEQANQEKRIKKLEEDIQN
                     NSPELDSNAEYILKQEKTALEETKAVFGPLRKRIADAVQKLEEQIAISESDGTGSEEE
                     LEKAKAALESGQKVAQATESS"
     gene            1749834..1753477
                     /locus_tag="MYCTH_2294817"
                     /db_xref="GeneID:11508013"
     mRNA            join(1749834..1750241,1750304..1753085,1753146..1753477)
                     /locus_tag="MYCTH_2294817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658664.1"
                     /db_xref="GeneID:11508013"
     CDS             join(1750124..1750241,1750304..1753085,1753146..1753236)
                     /locus_tag="MYCTH_2294817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658712.1"
                     /db_xref="GeneID:11508013"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2294817"
                     /translation="MDNAFAKSIDQVLDTLGVNRATGLTDEQVTRLRAKYGKNAIPEE
                     PPTPLWKLILEQFKDQLVLILLGSAAISFVLALFEDEGGWSAFVDPIVILTILILNAV
                     VGVSQESSAEKAIAALQEYSANEANVVRNGQTHRIKAEDLVPGDIVDVTVGARIPADC
                     RLISIESNSFAVDQAILTGESESVGKDCHAVISDDKAVLQDQVNMLFSGTTVVTGHAK
                     AVVVLTGSNTAIGDIHESITAQISEPTPLKQKLNDFGDQLAKVITIICVLVWLINIPH
                     FSDPTHGNWTKGAIYYLKIAVSLGVAAIPEGLAVVITTCLALGTRKMAAKNAVVRSLP
                     SVETLGSCSVICSDKTGTLTTNQMSVSKIVYLNDDGSDLEELDVEGTTFEPKGDIKFQ
                     GQVLRDLTQESATVLQMTEVAALCNDARLDYHSHSATYSNVGEPTEGALRVMVEKIGP
                     CAPADCHPQDRVHYASSWYEKQYKRLATYEFSRDRKSMSVLVQNGQEQKLFVKGAPES
                     IIERCTHAVLGRHGKRVPLDRKLADLLLKEVVEYGNRGLRVMALARREQVNGEPLLHK
                     ARTSTEYAALEQNLTLIGLVGMLDPPRPEVPAAIQKCKGAGIRVIVVTGDNRNTAETI
                     CRQIGVFGPDEDLTGKSFTGREFDNLSPSEQLEAAKNASLFSRVEPAHKSRLVDLLQS
                     LGQVVAMTGDGVNDAPALKKADIGVAMGSGTDVSKLAADMVLADDNFATIGVAIEEGR
                     SIYSNTQQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSF
                     NPPDHDIMKRQPRKRDEALIGGWLFFRYLVIGTYVGLATVAGYAWWFMFYSGGPQISF
                     YQLSHFHRCSSEFPEIGCQMFTNDMAKSGSTVSLSILVVIEMFNAMNALSSSESLLTL
                     PVWKNMVLVYAIALSMALHFALLYIPFLQTLFSILPLNWTEWKAVLAFSAPVVLIDEG
                     LKFIERTFFVSSSTRKLPKAKKDQ"
     gene            complement(<1753518..>1754174)
                     /locus_tag="MYCTH_2055659"
                     /db_xref="GeneID:11508416"
     mRNA            complement(join(<1753518..1753661,1753740..>1754174))
                     /locus_tag="MYCTH_2055659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658665.1"
                     /db_xref="GeneID:11508416"
     CDS             complement(join(1753518..1753661,1753740..1754174))
                     /locus_tag="MYCTH_2055659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658713.1"
                     /db_xref="GeneID:11508416"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Spoth2_2055659"
                     /translation="MVGKDCVAIACDLRLGLQALTVSNNFPKIFQYGDHVFLGLTGLA
                     TDVSTVADLFRYKVNMYRLREERHIAPRTFANLVSTTLYERRFGPYFVNPVVAGLEPK
                     TGAPFICGFDSIGCIDFAKDFIVSGTATEQLYGMCENFWEPNLGPDELFETISQALLN
                     AVDRDALSGWGAHVYIIEKDKVTKRLLKGRQD"
     gene            1755298..1757129
                     /locus_tag="MYCTH_2294820"
                     /db_xref="GeneID:11513074"
     mRNA            1755298..1757129
                     /locus_tag="MYCTH_2294820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658666.1"
                     /db_xref="GeneID:11513074"
     CDS             1755359..1756927
                     /locus_tag="MYCTH_2294820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658714.1"
                     /db_xref="GeneID:11513074"
                     /db_xref="JGIDB:Spoth2_2294820"
                     /translation="MSAHVEVVATDFRRVKVKVTPGTYLIDVLGEACKKLNLRSDQYE
                     LKYVETGSGRPSTSYLTNGRHKQKLVDLSCPYRTSGLGPGAKLELVQKSKSASVVSIA
                     LDVNGQRYTKKLPSNMSLWKVLRQFEGAEKGLNITGRGVPVGTNSGQLYHEAPVVNIM
                     GREYAAMEELQKTLSQCGINSGSIVLRVTFKLTERTLYDAMQEISQYLDDVETGVSKP
                     EEKSEAQAMPVTDETMTDAASVKDAPKPEASAPTSSEEAAPSVPAEASTAGEPMDVDE
                     APASTSATTNPLQPTGVFSAPTSSTPKAAHTQEDDSVYEPTIAHAQLRQQQLQQRAQN
                     TRLKSDAELAAEAAEEAAKLARITKVEVKVRFPDQTSAVWTITPEETGAFLYQAIRNI
                     MNHPAAPFRLILPGPKPVSIQETDTKLIAGYRLKGRREMLNLLWDDSVPPAVRKEPFL
                     KGSVASKAMEVVVPEIPQGVGDEGEKGSTGAGAAGPSSAQQQARRDGGKGRDNLDSEA
                     VKKKLSKFLGLGKK"
     gene            complement(1757130..1758485)
                     /locus_tag="MYCTH_2294821"
                     /db_xref="GeneID:11505752"
     mRNA            complement(join(1757130..1757415,1757499..1757580,
                     1757982..1758082,1758288..1758485))
                     /locus_tag="MYCTH_2294821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658667.1"
                     /db_xref="GeneID:11505752"
     CDS             complement(join(1757332..1757415,1757499..1757580,
                     1757982..1758082,1758288..1758341))
                     /locus_tag="MYCTH_2294821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658715.1"
                     /db_xref="GeneID:11505752"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="JGIDB:Spoth2_2294821"
                     /translation="MAKETERTGLARGLNKGHKTTARVNKPRPSRQKGKLSNRTQFVR
                     SLVKEVVGLAPYERRVIELLRNGKDKRARKFAKKKLGTFNRAKVKIEELQRIITESRR
                     AGGH"
     gene            1759766..1760835
                     /locus_tag="MYCTH_2294824"
                     /db_xref="GeneID:11506086"
     mRNA            join(1759766..1760346,1760411..1760835)
                     /locus_tag="MYCTH_2294824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658668.1"
                     /db_xref="GeneID:11506086"
     CDS             join(1759976..1760346,1760411..1760564)
                     /locus_tag="MYCTH_2294824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658716.1"
                     /db_xref="GeneID:11506086"
                     /db_xref="JGIDB:Spoth2_2294824"
                     /translation="MLSIVLIIATAIQLAVALPIYKIPPALSRVAHFCILPQEFVIKD
                     FQIWNPQADNNRSTTINFHYLDDSVMPAIDTKCYLNQISVNVGAKKSLAPRYACDDAL
                     VEFMWTNGTLTVIERACPQETLTRPHEATGVLKPKLNCLETIRNSTIGPGIACSSTPD
                     VILGAFVSLRPTLN"
     gene            1761065..1762829
                     /locus_tag="MYCTH_2294825"
                     /db_xref="GeneID:11505689"
     mRNA            1761065..1762829
                     /locus_tag="MYCTH_2294825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658669.1"
                     /db_xref="GeneID:11505689"
     CDS             1761323..1762720
                     /locus_tag="MYCTH_2294825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658717.1"
                     /db_xref="GeneID:11505689"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="JGIDB:Spoth2_2294825"
                     /translation="MHLNRLVWLPLCALTIGANANPSIARRNQQHQPPSQEVLNDWYN
                     PHPQGGNHPGKGGDGSEEGGLEGGGLEGGGGGGGGGVSAALFSSLERTSRLVDITYCV
                     GTAGTGIAPPFSCLSRCKDFPSLRLVRTWNTGVLLTDSCGYIAVDHGHGHRYGMEEET
                     EEEETRVGTENGRGAREIVVAFRGTYSITNTIVDLSTAPQEYVPYPAPPGDGNGDGNG
                     GGGKCHNCTVHMGFMASWRNAREVVIPALKAARERYPGYRVHLIGHSLGGAVAALAAL
                     ELRLGLGWRDVVVTTFGEPRVGNAELADYINRAFGLGVRDGDGAGEEVAYRRVTHAGD
                     PVPLLPLSEWGYQAHAGEIYISKPDLPPAPEDLRLCHGNNDPRCLSEAETPDWLSWVL
                     GWMKSGRIRGEAEALLGLGRWFPARLQLWQLLFAHRDYFWRLGLCVPGGDPADWGREK
                     YNLTVDGARDEIRDL"
     gene            <1764792..>1765975
                     /locus_tag="MYCTH_2114395"
                     /db_xref="GeneID:11505690"
     mRNA            join(<1764792..1764803,1765028..1765377,1765468..1765555,
                     1765625..>1765975)
                     /locus_tag="MYCTH_2114395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658670.1"
                     /db_xref="GeneID:11505690"
     CDS             join(1764792..1764803,1765028..1765377,1765468..1765555,
                     1765625..1765975)
                     /locus_tag="MYCTH_2114395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658718.1"
                     /db_xref="GeneID:11505690"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="JGIDB:Spoth2_2114395"
                     /translation="MANETFLARLCEQAERYDEMVTYMKEVAKLGGELSVDERNLLSV
                     AYKNVVGTRRASWRIISSIEQKEESKGSEKHVATIREYRQKIENELEKVCQDVLEVLD
                     ESLIPNASTGESKVFYHKMKGDYHRYLAEFASGEKRKVAATAAHEAYKSATDVAQTEL
                     TPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIM
                     QLLRDNLTLWTSSDNGEPEGAVEPPREEKADAPKEADGQAEEPAPEQA"
     gene            complement(1767294..>1769572)
                     /locus_tag="MYCTH_2141471"
                     /db_xref="GeneID:11512947"
     mRNA            complement(join(1767294..1769037,1769193..1769319,
                     1769415..1769446,1769542..>1769572))
                     /locus_tag="MYCTH_2141471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658671.1"
                     /db_xref="GeneID:11512947"
     CDS             complement(join(1767743..1769037,1769193..1769319,
                     1769415..1769446,1769542..1769572))
                     /locus_tag="MYCTH_2141471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658719.1"
                     /db_xref="GeneID:11512947"
                     /db_xref="JGIDB:Spoth2_2141471"
                     /translation="MEWCFYLYGNSQDLYPEYQPAWNSTEAGVIGVRPKTVLGIIGWL
                     RDRLVSDRNSGRIASWDKPVPYYLETMDISSHASPRSLPNPQNPAPLALSDFIAQTAP
                     CSDVTGPTDEPAMSRSATRPSGPADEPKQAPVRDEARVKTPQQPPHEIQPQETKAPSS
                     AQEEDSPPPTDWLATRQQLLSRRSQGKKADWIRGWSQAVSSHGDETYCACSRSIENGA
                     ANHRGRKAKTSVQLADNVRAILQRAGSPSSNSKSKLATPSTPEPREVCPYCSRPPSPP
                     PSSTAGGRGNSSSRASSKLHSPGSAARAVGKRFSRLLMRVRWLSSSPRASKSATAAAA
                     ARNARNPGICCSSSDNVVWPENCQPLWVTTRQGQSRCLARPASQPLSAPVQEMGVGIM
                     GTPQKSRGLMMRRPRPLREGGYFARRRRSWARILPDISIRGAGARRRLEAPLSPSTSS
                     SSLSDLAGVLESNGDLARPGLSRSMSRLQRAAALLQRTTARSKD"
     gene            complement(1769919..1774814)
                     /locus_tag="MYCTH_2294830"
                     /db_xref="GeneID:11508093"
     mRNA            complement(join(1769919..1771606,1771663..1771882,
                     1771937..1772472,1772526..1773824,1773877..1774814))
                     /locus_tag="MYCTH_2294830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658672.1"
                     /db_xref="GeneID:11508093"
     CDS             complement(join(1770268..1771606,1771663..1771882,
                     1771937..1772472,1772526..1773824,1773877..1774517))
                     /locus_tag="MYCTH_2294830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658720.1"
                     /db_xref="GeneID:11508093"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Spoth2_2294830"
                     /translation="MDYSAPSAALWPGQPPSPEKSSQILIREYPHRAIAIASNSHALI
                     LRHSATASEGFGNGFLASVSSGRQRPAASDSNVSKCMVEFSPTSGNLLNDYRPLTPRP
                     IYGTLGLISIERDVFLCVITQASRVATLRPGETVERIEAVQFFCLNSSEYDDVVSPDP
                     YDVDSDAALGYGQGLSRRETPTEQHPCQELQKLLGNGTFYYSTDFDVTNRMQDRPADA
                     ADFDIDNFDESFLWNSYMIQPLVLFRSRLQKAEREALDASRILTSAIRGFCRSWAIPQ
                     SAAPLSAAKTGLPSYLTIISRLSCRRAGTRFNSRGIDDDGNVANFVETETIYWSPSGV
                     VFSYAQVRGSVPVFWEQAAGLLPNQQKITITRSADGTQPAFDKHFSELEQAYGAVHVV
                     NLLSATKPGEYELTTLYRLGIQNCPLSRQVGNQSRDHALLRETEYDFHAETKGPQGYV
                     AANEIRRYIEHSADGFAYYLAQESDDGEQLGGGLNGHKKARYVVVLQQEGVFRTNCLD
                     CLDRTNLIQTIISQMAVESFLGHRGERAPSDFWSRHANLWADNGDSLSKIYAGTGALK
                     SSFTRTGKMSLAGAIADVRKSATRLYYNNFADKARQITIDTLLGRLVGQTPVVLFDPI
                     SDYVAGELQRRSTEFSSNEKIHIFVGTFNLNGRTDGINEDLSPWLCPPELGSVQPEII
                     AIGFQEIVELNPQQIMNSDPSRKQLWERAIKSTLDRHYNREGDDKYVLLRSGQLVGAA
                     LCIFVKASVLHNIKNVEGSVKKTGMSGMAGNKGAVAIRLDYANTPICFVTAHLAAGFA
                     NYEERNRDYATIDQGLHFQRNRGIADHDSVIWFGDFNYRVGLGLEAAKDAVKRRDLDR
                     LFENDQLNLQMVAGLAFRFYSEARITFMPTYKYDIGTDEFDSSEKARIPAWTDRILRK
                     GSNLRQLAYNSAPLRFSDHRPVYALFECTVNIVNEKLRDKISREVYDRRKAEVGGGTA
                     NLAQNESDDEDLIGYDAIEPGLPPASSDRQKWWLDNGKMAKSSINPPKPDNPGSQIIL
                     NPKRPTNPYAPTDEPDWVSVPRSESRLSSFSSMSTSPYEHVNHSTLLSSSASSSAPRK
                     LPPPSEPSALSTKVGRMQISEDSKSLQGDGAPPPPPPRRQATMGTGPTTSPSPSSVQP
                     KRKPVHQATPAPPVGPKPGALQEQPAKQKTAPPVAKKPAHLAAPTSSASSASRSFTSD
                     ATVNGLKGSASDLLRQSATNMNGSLFELSRSNTSPPARDGIERGHTPPLQPSRRTNSS
                     AGGVTPSRMVAAGGIPLVGLAGPSDRKPQLPARKPTTPSSAVSIQKQAPPPPPAPRRT
                     PAIDLLGDDEAIEVSGWEALKPSS"
     gene            1776039..1778674
                     /locus_tag="MYCTH_2294835"
                     /db_xref="GeneID:11505377"
     mRNA            join(1776039..1776314,1776371..1776586,1776650..1776753,
                     1777147..1778349,1778405..1778674)
                     /locus_tag="MYCTH_2294835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658673.1"
                     /db_xref="GeneID:11505377"
     CDS             join(1776243..1776314,1776371..1776586,1776650..1776753,
                     1777147..1778349,1778405..1778573)
                     /locus_tag="MYCTH_2294835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658721.1"
                     /db_xref="GeneID:11505377"
                     /db_xref="JGIDB:Spoth2_2294835"
                     /translation="MGDFTNFGGTDEENAEIKRLNADVEADPDNFENWEKLIRACEGL
                     EGGLNRNSSPQALATLRDSYDRFLLKFPLLFGYWKKYADLEFNISGPESAEMVYERGC
                     ASITNSVDLWTEYCSFKMETTHTPHLVRELFERAASHIGLDFLSHPFWDKYLEYETRQ
                     EAQDRIFAILNRVIHIPMHQYARYFERFRQMAHTRPLEELVAADMLARYRAEVEAEAA
                     QFGVQKTELEIERDIRAKIDASFYLIFQRTQEETSKRWTYEAEIKRPYFHVTELDHSQ
                     LANWRKYLDFEEAEGNYQRIVCLYERCLVTCALYDEFWLRYARWMSAQDNKEEEVRNI
                     YLRATTLFVPISRPGVRLQFAYFEEMCGRVDVARDIHAAILTKLPDCVEAIVSWANLQ
                     RRQSGLDAAIEVYKAQIDSPVVDIFTKAALVTEWAFLLWKVKGSVEEARTAFAKNVEW
                     YADSRHFWQKWLEFELEQPTNAELEAQHAERVKNVFAEMRTKSRLSPGVKQELGQVYL
                     TYLQQRGGKQAMKEFLHIDRELFGPQSISPITKAKLSKETAGLPGLDEATRAKAERRF
                     YNYYQLHMDPDPNAQGPASFE"
     gene            1779905..1781787
                     /locus_tag="MYCTH_2294840"
                     /db_xref="GeneID:11513412"
     mRNA            join(1779905..1780012,1780176..1780656,1780734..1781107,
                     1781174..1781787)
                     /locus_tag="MYCTH_2294840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658674.1"
                     /db_xref="GeneID:11513412"
     CDS             join(1780176..1780656,1780734..1781107,1781174..1781386)
                     /locus_tag="MYCTH_2294840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658722.1"
                     /db_xref="GeneID:11513412"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="JGIDB:Spoth2_2294840"
                     /translation="MATATRTFTRALRTSARPAFAAAPRVAFRQAGRRFYSSEPAPKS
                     SSSAWIWAAGAAAAGAGGWYFLNNQSSATPQVFKPKYEDYQAVYNEIANRLEENSDYD
                     DGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEADHGANAGLKAARDFLEPVK
                     QKFPWISYSDLWILAGVCAIQEMLGPQIPFRPGRQDKDVSACTPDGRLPDAAQGQDHL
                     RNIFYRMGFNDQEIVALAGAHALGRCHTDRSGYSGPWTFSPTVLTNDYYKLLLDEKWQ
                     WKKWNGPKQYEDKKTKSLMMLPADMALVQDKKFKEWVQKYAADNDLFFRDFAAVITKL
                     FELGVPFPENTERWVFKPVNA"
     gene            1782134..1783393
                     /locus_tag="MYCTH_2294844"
                     /db_xref="GeneID:11508657"
     mRNA            1782134..1783393
                     /locus_tag="MYCTH_2294844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658675.1"
                     /db_xref="GeneID:11508657"
     CDS             1782205..1783275
                     /locus_tag="MYCTH_2294844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658723.1"
                     /db_xref="GeneID:11508657"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="JGIDB:Spoth2_2294844"
                     /translation="MAAARVPALRHLLSCQPRVLHASNQRRWAQVHDVRFLATTQQPR
                     NVIEKYREKLDRKAREEGHPDIESLRAAYADKIKNLRKETDTVTAPLRGATPGAQAPP
                     PPSSSSSSPPPPQSASSSTATQPSQEQQQQQQQQQQQQPRKSSSSPTGLKPLSEILDL
                     PKASALPQAELTAIWRLRHAARPNSLCAVIPAATFAAMEAMARTHPQFVLPVPHPEQG
                     AEMHFLQWTWDPPTRSATVLFTQLAEYKARGEFAAPHTTVTHYKDLMDRGGGDGDGAA
                     AGQPGVVLMQGTVLEDRGVKVADAQWLVMCLQRFYGGWDGSGGEAGKERAEERRRLLE
                     WFGKGDTRFSVEKLMEEAERMG"
     gene            complement(1783394..1785610)
                     /locus_tag="MYCTH_2294846"
                     /db_xref="GeneID:11508602"
     mRNA            complement(join(1783394..1783844,1783908..1784082,
                     1784183..1785094,1785160..1785610))
                     /locus_tag="MYCTH_2294846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658676.1"
                     /db_xref="GeneID:11508602"
     CDS             complement(join(1783513..1783844,1783908..1784082,
                     1784183..1785094,1785160..1785408))
                     /locus_tag="MYCTH_2294846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658724.1"
                     /db_xref="GeneID:11508602"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2294846"
                     /translation="MPYPSTFPPLDIPEAVDLWTLLLGDRHRDFPVTKEILTCGETGR
                     SYTWADLRSASIEFGKGLKALWEWKKGDVLAFYTPNSIDTPILTLGALWAGGTVSPAN
                     PLYTVDELAFQLRDSGAKGLVTQPAHLATALAAAQKANLPPDRILLLGPNRDPSGRIR
                     HFTSIRSPGSAGHDDARPPIHPRTDLAFLVYSSGTTGLPKGVCLTHRNMVSNVLQASY
                     VEGSQWRSRGGPDGQGDKQLGVLPFFHIYGLTCGVLMSVYEGWQLVVLERFDMERALR
                     AIERYRITFAYVPPPVVLAFSKHPAVDGYDLTSLKVLHSGAAPLTRELTEAVWNRLRV
                     PVKQGFGLSETSAVVCCQVVDEWAKFMGSVGKLMPNMEAKIVGEDGREVADGEEGELW
                     LKGPNVFPGYFKNPERTKEAFSPDGFFKTGDVFRRDKYGNFYCVDRLKELIKYNGYPV
                     PPAELEGVLISHREVADACVIGVEDAAKATEVPRAYVVLRDGVKASETKAQELADWVA
                     TQVAPHKKLRGGIRFVDQVPKSPSGKVLRRIMRERAKEEQRRSGAKL"
     gene            1786485..1787397
                     /locus_tag="MYCTH_2294851"
                     /db_xref="GeneID:11505506"
     mRNA            join(1786485..1786885,1786950..1787397)
                     /locus_tag="MYCTH_2294851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658677.1"
                     /db_xref="GeneID:11505506"
     CDS             join(1786709..1786885,1786950..1787306)
                     /locus_tag="MYCTH_2294851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658725.1"
                     /db_xref="GeneID:11505506"
                     /db_xref="JGIDB:Spoth2_2294851"
                     /translation="MYFKAAVLFSLLASSFALPTGSVDRTVKRGVLSVQDYSEFQVSD
                     GVAGNALAEVNAKFPIDTSNLASVSDEDLEILKAARKTAEAAETKAGGFNEAIKAAGG
                     TKTTDGQALQNGKIKNKVLKLQLQVLALQIEAAKGKDTAAKLAEEQKKLDKNVQLDKE
                     AAGQRSQSVNFQGTSQP"
     gene            complement(1788425..1790267)
                     /locus_tag="MYCTH_2294852"
                     /db_xref="GeneID:11509117"
     mRNA            complement(1788425..1790267)
                     /locus_tag="MYCTH_2294852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658678.1"
                     /db_xref="GeneID:11509117"
     CDS             complement(1788662..1790110)
                     /locus_tag="MYCTH_2294852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658726.1"
                     /db_xref="GeneID:11509117"
                     /db_xref="JGIDB:Spoth2_2294852"
                     /translation="MTKLRRGLVSLPLRTLSFPAVRALLVCGFLWLLAFTYGRLFLWR
                     DPHSAYFRSEGVYDLDYSAARQAEARAFLQQVSAEVTADTKAHGGAGKTNADGAAAPE
                     PRPKAGPTPVVCAAFATVRRDGDVARQYLADAVGSMLAGLDPRERAAIHVKLLFANTD
                     PAQHPDWKAPWVDALIDDASGYRGLTDLERAGLRKAEEERDVQLKGNFDYLYLLERCL
                     KDTDAPFIAVFEDDIIFSADWAARTLRGLQYLVRDHQKAEGDKDWLYMRLFYTETHLG
                     WAAEHDWWYNHLPLTLVMAAAGSALVLVLLRLAGCGPRLRLDWATIAVVSLVVAPGFT
                     ALAFMAGKHNLPLPGYSLHHNVPFGPPDSALAAGVAPMDKNACCTQAIVFHRPALPAL
                     IKNLRKRERGQTDSMIEEYCDATGFKRFALREQAVQHVGLVSSRGMRVVDAKSVWAFW
                     FEANKPAAVEKSHRKMLEEIDWAMFDRLAAGG"
     gene            <1791075..>1793024
                     /locus_tag="MYCTH_98907"
                     /db_xref="GeneID:11512793"
     mRNA            join(<1791075..1791321,1791633..1791792,1791869..1792935,
                     1792993..>1793024)
                     /locus_tag="MYCTH_98907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658679.1"
                     /db_xref="GeneID:11512793"
     CDS             join(1791075..1791321,1791633..1791792,1791869..1792935,
                     1792993..1793024)
                     /locus_tag="MYCTH_98907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658727.1"
                     /db_xref="GeneID:11512793"
                     /db_xref="JGIDB:Spoth2_98907"
                     /translation="MASPIGYLIHPDPSSQPQKPASQTLPGITSAHSPLAVTSSPASA
                     SRFPTTSLASSVPEQRGARNLPGDHNRTQPLYQCADCLRQVCSKAFARADLLKRHRAN
                     HQDGNGSKRRRINSDPSASRVGQACTACAKARVKCTRCKNRGLACEIPVSEDAAAYMA
                     HLSANRVGHTESTPESCCSVSSSLGQAEDPIPVGSTSFPYVQSASPEDGKDGTGTPAY
                     AAYDKGAEFHTVGAPSGPTSQSNFGSIRSHPGGDLQYVGQEEAARAQFPDFLRDVLYD
                     QSLGSPIKSSESQGPMLDFYDDVNLDFNEFDFNMLNYWIPDPPSDMSTQVANPEDPVG
                     MTEMRSTLAKIWTESPWRWTPGTTDSRFTEQPNLPLPFADANSTKIHENRAAGRRVAK
                     EALRPSCRDKILAIVLSTCRETSMANRVASSFPATDTIDSWINIFLAAHMCQVSSWIH
                     YGSFSLNSQWPEWLAVAAASGAVLTAVPAFRRFGLALQEAIRTAIPERVSH"
     gene            1793099..1794866
                     /locus_tag="MYCTH_2294854"
                     /db_xref="GeneID:11508851"
     mRNA            join(1793099..1793188,1793240..1793467,1793518..1794866)
                     /locus_tag="MYCTH_2294854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658680.1"
                     /db_xref="GeneID:11508851"
     CDS             join(1793343..1793467,1793518..1794709)
                     /locus_tag="MYCTH_2294854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658728.1"
                     /db_xref="GeneID:11508851"
                     /db_xref="JGIDB:Spoth2_2294854"
                     /translation="MMRYRGRFGRSAYPDIVIHPSDKGQVLEEKWKKWHQLESWKRLI
                     FHAYLRDAQVSMTQLNNPSMSYAELTLPLPYSRDLWFARSAEEFKARYIELGANSARP
                     PCLGDLFRDFNALSNHIPRLDMPFAISIFLHAFWSLIWEYRQLASIYGPTVTANAHSN
                     TTSLLLDSRRAELTTQLKSFHQHLQIYRTRHPTLLRDFFPLLLLLFHFLLFNLHAPLP
                     ELQLFSGKEGEDQARRVYPALRGWAGSADARRAMWHAAQVLKAARAFPKGTLQDFWGV
                     AVCHAVLGVWGWGIVNRASPTSSSSSTCSSSSASGRVKGGGNGSEQWQAGGEDESSVV
                     YLDGEDESGEPMQEPAVRAWIEHGQGRPAIHGLQQKQQQQQVHGDGQRRVQPCLFEDS
                     RACAGIAQGILRANFAGVYDPLPTMTENIIVVLKQLEKAASAVGMG"
     gene            complement(1794867..1796223)
                     /locus_tag="MYCTH_2294858"
                     /db_xref="GeneID:11509061"
     mRNA            complement(1794867..1796223)
                     /locus_tag="MYCTH_2294858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658681.1"
                     /db_xref="GeneID:11509061"
     CDS             complement(1795023..1795799)
                     /locus_tag="MYCTH_2294858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658729.1"
                     /db_xref="GeneID:11509061"
                     /db_xref="JGIDB:Spoth2_2294858"
                     /translation="MLVNGRPPPPPPPPPPPPPPPPPPPPTSEPPTSEAAAPAIRAPC
                     RRPQLHTRKNHDTYNGILHIPRSTHVQTMIATTTTTTTERSRSYLVTLHYPANRACEL
                     RRSDADVLALRRGLATAGCAAAVPRTRRERSGSGSGSGAGADGESSDRSRSRSRSRSR
                     SRSSSGSGSGGGGGRKKSREAIATRAATVTTAAAGGCACSCSCSCCRCPCGSEGADAR
                     LAREVNDLLREALHKVGKGNGPVRPVIERFLRRRIEDCGG"
     gene            1797528..1799841
                     /locus_tag="MYCTH_2294860"
                     /db_xref="GeneID:11513414"
     mRNA            join(1797528..1797993,1798086..1799841)
                     /locus_tag="MYCTH_2294860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658682.1"
                     /db_xref="GeneID:11513414"
     CDS             join(1797685..1797993,1798086..1799444)
                     /locus_tag="MYCTH_2294860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658730.1"
                     /db_xref="GeneID:11513414"
                     /db_xref="JGIDB:Spoth2_2294860"
                     /translation="MALQAAYKQFLASPNSSSLADDASLHYVTTTTSFAGATDIIKHL
                     SSVRNKIKKLKQDPLFAIENHHALALEVDTTLEFVTSGGPYLPGLDDNFLADRTVHIA
                     VTHIVTFNGDGKITQIRQSWDQGALLKQLEVIGRSGANWPIRDSKEQINLIAKCAKGD
                     GAAAAPAEAQPTRSRGSTNAMRDPHASLDLFAPREELESNPEGVISPYAGRRPRQRSF
                     TEILGDEPVEDPASPSSGRERSQSPSKAIAPKIGAGKHFTPMRIFDADENDNPPAETP
                     ERKPSERVVRPDPKKYQHFEFDDGSENPEPPAPKPATKPGPERKSIHGSSWSFDDFTT
                     PQKPVALRGGHRARDIRHWGPDNELLENTPAPNAQAAKPRRDAEAHFELIDDGPEREV
                     PRNTNRAPRGAMHNEGLHLYDNRLHPEDGASPEPAPVPLGKITNLKDRHKDFEPHFEM
                     TDESPHHAAPPEPAKLPEDRKKAVRMMESSWTPYDESPLSRKENDDPNAKRPPTERGI
                     AIAGDGMGGRKGTTRGWLHGEDDEEPLPTTRKGVRGPPTKSDNFWDF"
     gene            complement(<1800233..>1802628)
                     /locus_tag="MYCTH_2055845"
                     /db_xref="GeneID:11508795"
     mRNA            complement(join(<1800233..1800523,1800614..1801439,
                     1801533..1801742,1801818..1802025,1802166..1802306,
                     1802397..>1802628))
                     /locus_tag="MYCTH_2055845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658683.1"
                     /db_xref="GeneID:11508795"
     CDS             complement(join(1800233..1800523,1800614..1801439,
                     1801533..1801742,1801818..1802025,1802166..1802306,
                     1802397..1802628))
                     /locus_tag="MYCTH_2055845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658731.1"
                     /db_xref="GeneID:11508795"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2055845"
                     /translation="MANLRAKEESLGQSSILSIRGPSSFGGRSGIVDEEEEEAVHPFR
                     RWLDSFRRDPGLHVTPPSVLNTTAAAAAAAAQGGGVPRGRGRGRGHYFDLHAANVGTA
                     NTLLSRELKGRHLQMIAIGGSIGTGLFVASGKALNTGGPASLLIAYLFIGCMLYCTIQ
                     ALGELAVTFPVAGSFSAYSTRFLDPAWGFTMGWNYALQWLVVLPLEIIAASITVGYWN
                     RNLNPSIFITIFLFAIVVINLFGVKGYGEAEFVFAIVKITAIIGFILLGIVINIGGFP
                     DDGYIGGRYWHDPGAFNNGFKGLCAVFVTAAFAFTGTELVGLAAAETANPRRSLPTAI
                     KQVFWRITLFYIASLTLIGLLVPHSHPRLLGAKSAADASASPFVIAIESAGIAVLPGV
                     MNSVVLIAVISVGNSAVFGSSRTLAALADQRQAPAILGYVDRRGRPLVAILVASAVGL
                     LGYLADLDQEPDVLNWLLAVSGLSSLFTWGSICLAHIRFRKAWRAKGRSLGELAFRSQ
                     VGVAGSWLGLILNVLVLLAQFWTAAWPLPHPLVATGDGGMNGGGAAAVPLDSPRDVAQ
                     NFFLQYLCAPIVFAFYIAYKLWYRTRIVRIDEMDVDTGRREFNLPILISRELDERRAM
                     PRWKRLYRFLC"
     gene            complement(1803477..1806187)
                     /locus_tag="MYCTH_2294863"
                     /db_xref="GeneID:11513383"
     mRNA            complement(join(1803477..1805010,1805102..1806187))
                     /locus_tag="MYCTH_2294863"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003658684.1"
                     /db_xref="GeneID:11513383"
     CDS             complement(join(1803497..1805010,1805102..1806014))
                     /locus_tag="MYCTH_2294863"
                     /note="CAZy_ID 267990"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003658732.1"
                     /db_xref="GeneID:11513383"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Spoth2_2294863"
                     /translation="MNVRDPFNLRNGTLNRPPIATWKANRNYNLQYSSASPLQHIIRA
                     AATATQSAAADLRDKASEVVHSAQQAFTEAAATTLDLDLEKAAHLEPGPEAKPEVEPK
                     VEAKAKAREHHRRESARPTHTARAPADSPSRQELAPKTERGQAQEQDMSFAIPKNVPS
                     FSSPQRQLEDQLWAASSRNRQRSSLVGNVQGFLSPGSRAGLPMYKDKPYMYPPGRGGG
                     SYAWRRPLYRRKRTTCALLLLVVAGLAWWTGLFAGQQARVGGGLSWSGWLAQETGGEA
                     NAAEWAKRRERVVEAMELSWDAYERYAWGYDEFHPESKKGRQMAPKGLGWIIIDSLDT
                     LMIMNMTSRLTHAREWLSKSLTWDQDQDVNTFETTIRMLGGLLSAHYLSTEYPDMAPI
                     SDDDPGQPGEDLYLEKAKDLADRLMAAFDSPSGVPYASVNLAQYKGIVSHADLGASST
                     AETTTLQLEFKYLAKLTGEKEYWDKAERVMKLVDDNGAKDGLVPIFIYATTGKFQGEN
                     IRLGSRGDSYYEYLIKQYLQTNKQEPIYQEMWREALQGIRKHLITYTEPSRFTIVGER
                     PGGLGGDLSPKMDHLVCFLPGTIALAVTGGLTEREARKLPTWTEQDEADMQLARELMH
                     TCWGMYKFMATGLAAEITHFKIDNPPLPESAPHKAPDEFDPSPDAEWRKDFEVRPFDS
                     HNLQRPETAESLFYMWRITGDIKYREWGWEMFKSFMNYTAVADNGGFTSLSNANKIPP
                     VTRDNMESFWLAETLKYFYLLFSPNDLLPLDKIVLNTEAHPFPRFDMGPLFSTGWQRK
                     PRDKEGRIIE"
     gene            1807654..1808801
                     /locus_tag="MYCTH_2294864"
                     /db_xref="GeneID:11505636"
     mRNA            1807654..1808801
                     /locus_tag="MYCTH_2294864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658685.1"
                     /db_xref="GeneID:11505636"
     CDS             1807900..1808646
                     /locus_tag="MYCTH_2294864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658733.1"
                     /db_xref="GeneID:11505636"
                     /db_xref="JGIDB:Spoth2_2294864"
                     /translation="MQQERHLASSEFRSYPYLTPEEFTEVCHHLERRYCQARLGVQRR
                     RWMLDTFRAFNTADFTFGPEYGTYLVIRRPLDAVRDDEGLSSCMGAFSLGEETGGEDD
                     DSEMMEAEEADQVRYAALVQSGDVPPCMARGEKEEKSLNALQANHVQLDDRDYLPHGA
                     RPRPRVRYEIILHPTYQVPCLWFNLQDLPADEDPLNIDTVFRWLVPDEYKAPLRASVG
                     RIGGISLDVRRPTLPFASLLIFVICHVLMS"
     gene            complement(1808802..1809767)
                     /locus_tag="MYCTH_2294867"
                     /db_xref="GeneID:11508760"
     mRNA            complement(join(1808802..1809277,1809332..1809767))
                     /locus_tag="MYCTH_2294867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658686.1"
                     /db_xref="GeneID:11508760"
     CDS             complement(join(1808957..1809277,1809332..1809613))
                     /locus_tag="MYCTH_2294867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658734.1"
                     /db_xref="GeneID:11508760"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2294867"
                     /translation="MAARAPPPGLPAKVASVPPNQTLYVTNLPSAKIQKEDLRTALYM
                     LFSTYGSVLDVVALKTMKMRGQAHIVYKDIQTATQAMRALNGFEFFGREMKISYAKSK
                     SNIIAKLDGTFKIPAASSAARVEVTDLQQSIFNAPVPGAPTTTAPSLPSKPSGGDQPM
                     TDAAATESRGVKRPREEDKEEEQGEESDQDVAMEEESDDE"
     gene            1809978..1811847
                     /locus_tag="MYCTH_113886"
                     /db_xref="GeneID:11508478"
     mRNA            join(1809978..1811137,1811283..1811847)
                     /locus_tag="MYCTH_113886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658687.1"
                     /db_xref="GeneID:11508478"
     CDS             join(1810084..1811137,1811283..1811323)
                     /locus_tag="MYCTH_113886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658735.1"
                     /db_xref="GeneID:11508478"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_113886"
                     /translation="MAAPEVHHLFHNPIADHSFSADRQTLAVARDTTVELYGRVGNAF
                     KLKDELKGHDKTVTSIDIAPNSGRIVSCSQDRNALVWEPTPQGYKPTLVLLRINRAAT
                     FVRWSPSETKFAVGSGDRLIAVCYFEEENDWWVSKHLKKPIRSTVTTLAWHPNSVLLA
                     AGSTDAHARVLSSFIKGVDARPEPTAWGERLPFNTVCGEYMNNSAGWVHSVAFSPSGD
                     ALAFAAHDSSITVVYPSAPEQPPRAVISINTQLLPFMSLLWNGEAEIIAAGYDCEAFR
                     FNGGIDGWQLTGAIEAKGRPGGLGSQREESALNMFRQMDLKGKVKDDTQLKTTHQNTI
                     TMIRPYETAGGSVRKFSSSGVDGRVVIWTV"
     gene            complement(1812286..1815719)
                     /locus_tag="MYCTH_2294870"
                     /db_xref="GeneID:11513382"
     mRNA            complement(join(1812286..1815196,1815260..1815719))
                     /locus_tag="MYCTH_2294870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658688.1"
                     /db_xref="GeneID:11513382"
     CDS             complement(join(1812467..1815196,1815260..1815559))
                     /locus_tag="MYCTH_2294870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658736.1"
                     /db_xref="GeneID:11513382"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2294870"
                     /translation="MEALSPRDANAQRPPRAHELKTKAAAQLKTSKDKEHPPPPPNNV
                     VEPPSSDCKDGVVYQVGKLLGKGGFAICYEGKAAGASKRVALKIVKSKMPTKMEQKFQ
                     TELQIHSKMRHQNIVQFHRAFTFENCTYLVLELCPNGSLMDMVKRRKGLTEAEVRFYT
                     VQIAGAIKYMHAKGIIHRDLKMGNIFLDKYMNAKIGDFGLAALLLTGKDMQVMRRTTL
                     CGTPNYIAPEILEKGKKGHDHMVDIWSLGIIVFAMLTSKPPFQSSTTDEIYRRARDRD
                     YEWPSPETSSKVISQEAKDLVATMLQDAEKRPDPDTIVAHPFFTSGYMPVASEINYKL
                     REAAPENPAFYEPLNSQTQSLNLRNVQEMCRECGVGPWSQSQLVFRKIWREMAEEEQN
                     GLTPVIPLAEGVVYRPFDEVKNEQKLQARLAAQQMERQSSQVSDQTYETTSLGDSELR
                     SSTEGALSQKPTTGLLLRAPPQSFAAQQRAQHRPTSTTGISRSKTVTEPAARTVALRP
                     RPGRETAPAESQPSSEEVVPVSRTTTRTLRSQVTSTRTKANGTSEENAPPLRRSASTR
                     EKRQEERLSLFSPSEYQEKVPGTQPDVVLERLQKLQAELERALNARTMALMSSRDKTP
                     APPHIVVKWVDYTNKFGLGYVLNDGSVGCILRSIPAPDGPNPGMLPPACLLVHGAEQH
                     CMRKDDPTYSARHQIVPMKEGIYFYENNGEEGISRVRVPPENFMLPVNPDGTVGKLSA
                     GRDIYDHRKRERIVLWKKFANYMIAYGREMDNNGLTQSRESGEAEPAIRVPTITDPTA
                     APPDVVTFYQRFGDVGCWMFADGHTQFNFPDHTKIVLDPAGVWCHFWHLPQDAARRLE
                     ETGSLAESALDDRSVLSYPLQTLLNFAKPPSTGSSSSSSSSAAPAAGSGRRRPVIPPE
                     LRDIPAANQFRKKIEFVRDVVREWTANGGLGNSDLSRERRLRWTGVRETRGVPIPAKH
                     VWVTIGARGGDERLAAMVDPRRPGIIGEDVDERRRDR"
     gene            1816373..1817464
                     /locus_tag="MYCTH_2294872"
                     /db_xref="GeneID:11505706"
     mRNA            join(1816373..1816548,1816609..1817464)
                     /locus_tag="MYCTH_2294872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658689.1"
                     /db_xref="GeneID:11505706"
     CDS             join(1816483..1816548,1816609..1817187)
                     /locus_tag="MYCTH_2294872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658737.1"
                     /db_xref="GeneID:11505706"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="JGIDB:Spoth2_2294872"
                     /translation="MVALPLFKLASLFVRHVSKYGANHIKHQAHEHPRFRAFAARYGQ
                     LIHQLNMRLSVAVLRNKDAEQRAKEKAEAPTVKTEEQVKKEEEHLAKYGTTARATLKE
                     PSGSVWRRKFRPLPEAKAVDLFADVIGDTFILAVAGALVTYEYWRSSQKPDRNKEMIE
                     ELQRRMEELRIKEEELEAREKAQQERVQLIEEALKAFKDPKTKRPLLETPTAAA"
     gene            1821823..1823628
                     /locus_tag="MYCTH_2313396"
                     /db_xref="GeneID:11513384"
     mRNA            join(1821823..1822167,1822254..1822570,1822635..1823628)
                     /locus_tag="MYCTH_2313396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658690.1"
                     /db_xref="GeneID:11513384"
     CDS             join(1822110..1822167,1822254..1822570,1822635..1822694)
                     /locus_tag="MYCTH_2313396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658738.1"
                     /db_xref="GeneID:11513384"
                     /db_xref="JGIDB:Spoth2_2313396"
                     /translation="MGRLIKNHWARLIVLSAAMYQVAAAVESYFWPKIFWDFLTKTLD
                     PAVRPIPVLQTINLIFGMILLAWEWPLSFIAGLSIHRSLEARLAFLPLTALAAAMIYQ
                     GTNAAIYYVIGLGVYFWAYSEGEMICAKPWTLPQRTPRGPRV"
     gene            complement(1824705..1826366)
                     /locus_tag="MYCTH_2294878"
                     /db_xref="GeneID:11513379"
     mRNA            complement(join(1824705..1824937,1825397..1825520,
                     1825748..1826366))
                     /locus_tag="MYCTH_2294878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658691.1"
                     /db_xref="GeneID:11513379"
     CDS             complement(join(1824869..1824937,1825397..1825520,
                     1825748..1825917))
                     /locus_tag="MYCTH_2294878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658739.1"
                     /db_xref="GeneID:11513379"
                     /db_xref="InterPro:IPR015301"
                     /db_xref="JGIDB:Spoth2_2294878"
                     /translation="MTRGDVNHVKVHYRGDNTDEDFLVFLDSVEDYKKWQTDRSVPLA
                     QVVSSFKVFTTHRHGAQGLLGGASKAMLENEFGTSKEDEAVLKILEKGSLQEFEMAER
                     QGRRNDSNGEFVGMMGKR"
     gene            complement(<1827633..>1830145)
                     /locus_tag="MYCTH_2055546"
                     /db_xref="GeneID:11505493"
     mRNA            complement(join(<1827633..1828015,1828074..1828307,
                     1828359..1828593,1828649..1828867,1828928..1829134,
                     1829200..1829523,1829582..>1830145))
                     /locus_tag="MYCTH_2055546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658692.1"
                     /db_xref="GeneID:11505493"
     CDS             complement(join(<1827633..1828015,1828074..1828307,
                     1828359..1828593,1828649..1828867,1828928..1829134,
                     1829200..1829523,1829582..1830145))
                     /locus_tag="MYCTH_2055546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658740.1"
                     /db_xref="GeneID:11505493"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="JGIDB:Spoth2_2055546"
                     /translation="MLSTCGEREEHSGNAGSSLGDEPVDQSHCQPEPRSAKPFQKWMK
                     TLHKRVLRQQEALGYDGSPVTGPHGTWGGHSLAMGPSRRRHSSSESSSFAFVAAAKSA
                     SISMASASLWTRSWKTTNRSSHGRRTERSSRASMSGPRVSEDSYRSERQGPVDPGVVE
                     RALQRRRILEELISTEENYIGDVQFLMNVYVTILASLPSSPPGLRASVNRNLTDVVEL
                     HEEILGELRRVVPDSEYAQLDSAIKRVESNSSTRGHRRWRSLDVIPEGRDRVPWLSDL
                     PGMAAEPQTAAEVAKIFSKRMNRFFIYEEYGARYELMIKDIAAAQRTFPGWASYQKGL
                     EILASSLNSANNRDDHQSRRRALTIDDLLVKPIQRVCRYPLLFSELLKHTPVIDCPYS
                     HMIIDNTLVRLREATAEINRATNDSRTKSALEKTWILRDRLRFPDQQLDAATKNRIRL
                     FGHIRLCGALHVCWQTKDGVSGQYMVALLFRDWLCLATAGRSDQIYTIQVCIALGNIK
                     VEEVDNGRGLQCHTARHSWKIVFLCDNQLYELILTACSPKEELEWRARLRSSEPNDNP
                     DGQDQTLSDIFGFLALNIKAMGTVFRKPGTIARKVSIHRATTIGPKSPLYQVILKNTS
                     AAKEGPTVSSNPSINRSQSLLTTNSRIPVLAPARAERARLEAMLADVWTRDVLPFPGI
                     TARARSEHLVRASASSMMRKLSAVNITGGFTRRSASSVSL"
     gene            1831690..1832731
                     /locus_tag="MYCTH_2294886"
                     /db_xref="GeneID:11505462"
     mRNA            join(1831690..1832006,1832061..1832133,1832189..1832523,
                     1832583..1832731)
                     /locus_tag="MYCTH_2294886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658693.1"
                     /db_xref="GeneID:11505462"
     CDS             join(1831854..1832006,1832061..1832133,1832189..1832523,
                     1832583..1832711)
                     /locus_tag="MYCTH_2294886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658741.1"
                     /db_xref="GeneID:11505462"
                     /db_xref="JGIDB:Spoth2_2294886"
                     /translation="MNNLHAPTVPSGPTTAPATNGNASQLTIAELQRKKDILEGELRA
                     LGGVLESHGVDMNTSLLTPDGFPRADIDVAQIRTTRARIIRLRNDWKDLMALIEKRLH
                     EHFASIADNDDEPAPPVSADNAAVRDSVPETLDQPFAKVNTVSDNSPAAAAGLKPGDL
                     IRNFGYVNINNHDGLKKVAECVQGNEGRNILVKISRSSGAARPQELRLTLTPRRNWGG
                     RGMLGCHILPL"
     gene            1833425..1834967
                     /locus_tag="MYCTH_2141486"
                     /db_xref="GeneID:11509023"
     mRNA            join(1833425..1833497,1833609..1833718,1833835..1833927,
                     1833990..1834143,1834204..1834409,1834475..1834967)
                     /locus_tag="MYCTH_2141486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658694.1"
                     /db_xref="GeneID:11509023"
     CDS             join(1833653..1833718,1833835..1833927,1833990..1834143,
                     1834204..1834409,1834475..1834603)
                     /locus_tag="MYCTH_2141486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658742.1"
                     /db_xref="GeneID:11509023"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2141486"
                     /translation="MAAQPNVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYMATLGV
                     EVHPLGFTTNYGPIQFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPN
                     WHRDLTRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPF
                     LWLARKLVGNNALEFVAAPALAPAEVQVDKALLEQYEKEISDAANAPLPDDDDDL"
     gene            complement(1836212..1839638)
                     /locus_tag="MYCTH_2294895"
                     /db_xref="GeneID:11508701"
     mRNA            complement(join(1836212..1838632,1838693..1839218,
                     1839330..1839638))
                     /locus_tag="MYCTH_2294895"
                     /product="glyoxal oxidase like protein"
                     /transcript_id="XM_003658695.1"
                     /db_xref="GeneID:11508701"
     CDS             complement(join(1836246..1838632,1838693..1839218,
                     1839330..1839383))
                     /locus_tag="MYCTH_2294895"
                     /note="Predicted extracellular protein containing 4 WSC
                     domains and a glyoxal oxidase (copper radical oxidase)
                     domain."
                     /codon_start=1
                     /product="glyoxal oxidase like protein"
                     /protein_id="XP_003658743.1"
                     /db_xref="GeneID:11508701"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="InterPro:IPR009880"
                     /db_xref="InterPro:IPR015202"
                     /db_xref="JGIDB:Spoth2_2294895"
                     /translation="MRASPSSRTLLASLALSSLPLSFGQLSIPTDLPDSWEYQGCYTD
                     VPGRTINSASYADGTNMTNAACLSYCASKGFPYAGTEYSVECFCGTTLASSSAKVADS
                     ECNMPCSGAPSEPCGAGSRLSLFHSSAVTGPAANPGVNDFTHLGCYAEGKTGRALTYN
                     PGLPGADMTVAKCTAACRAANYILAGVEYGGECYCGNTIANGGAPADSGCSMVCNGNS
                     TEFCGGPDRLNVYSYKNQYEPTATSTTGAGSTSSSSVPSATGLPEGWSYQGCWIDGKQ
                     GRILPYQLPDSQTNSRAACANACAEAGYTVSGTEYAVQCFCGDAIHNGGVETDEADCS
                     TPCPGAPGEKCGAGDRLSIVSRGPPKIYAPPAPIEKIGDWEYQGCAEDNINDKRTFFW
                     QIFFNDIMTPEMCLDRCAEFGYHAAGLEYGQECYCGDPANMATHGATFRPESECNVVC
                     AGNSTAICGGLARLTTYFWIGTPFYSWDFPQDWRAGKYEFLVDGVNIPLITHETITGK
                     VSFISKGATGPGNETGAYEFDPATLEFRELHIKTDVFCAASVTLPDKAGRQLNVGGWA
                     GEATYGTRLYWPDGAPGVPGTHDWQENVNVLHLQAGRWYPSVLVLTNGSVMVVGGLIG
                     SNDAATPSIEILPYTGTPPLYMDWLDRTHPNNLYPFLCILPGGGIFVQYWNEARILDP
                     VTFDTVKTLPDAPGAPNDPKGGRTYPLEGTAVLLPQKYPYTDPLGVLICGGSTEGPGN
                     ALDNCVSIYPEADEPEWQIERMPSFRVMTCMAPLPDGTYLIANGALHGVAGFGLGVGP
                     NLNALLYDPSKPLGSRITVAANTTIARMYHSEAITLLDGRVLISGSNPEDGVNPEEYR
                     VEVFLPPYLLAGKPRPTFTLENRDWAHGQTGIPFTLGSPARNGDITATLLGSVASTHG
                     NSMGARTLMPRVSCRGTSCTVDAPPTANICPPGWYQFFVLDGGIPAVGVYVRIGGDAG
                     QIGNWPQAPDFSVPGV"
     gene            complement(1843390..1845682)
                     /locus_tag="MYCTH_2294897"
                     /db_xref="GeneID:11512918"
     mRNA            complement(join(1843390..1844134,1844294..1844807,
                     1845375..1845682))
                     /locus_tag="MYCTH_2294897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658696.1"
                     /db_xref="GeneID:11512918"
     CDS             complement(join(1843486..1844134,1844294..1844807,
                     1845375..1845513))
                     /locus_tag="MYCTH_2294897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658744.1"
                     /db_xref="GeneID:11512918"
                     /db_xref="JGIDB:Spoth2_2294897"
                     /translation="MADAGQQSRPSFSGFWKKSAEVLGLKRFRFVESNSGKSKSKNND
                     SSGNQDATASGNPTLDKAQRRRAQVRRAQTQHRQRKADYVRHLEKDIARIRDMIEAAE
                     QDTRALLNENKILREQLLQTVGKGPSPMSLDQGVALWNEMPQPSQLSSGLLQESGTVT
                     IALGFDEVLNAPAFYVSSPSPSCNPHQPASQRTSPPDAGDFPDLTPAQTQAAINFILA
                     LEHICRAHFLPCLYDPNIDASTPIFGFEESGHTLMATSVALRNAPEHIFDAVARTDCA
                     LFPNPGPPPVMCPIPQASPATTTPATAAAATTAARTTATNMTTTLTQPATADGMPNEK
                     GSGSDGDGDAGLSWTTTTLTLRSLRGLASSLVPDSAELAPVQAWFELAGRFGVARLAD
                     RAVLDALKRELAGAVRCPHFGALIDRASFESAVGRVLGTPT"
     gene            complement(1846269..>1848830)
                     /locus_tag="MYCTH_2141489"
                     /db_xref="GeneID:11511562"
     mRNA            complement(join(1846269..1846698,1846757..1846830,
                     1846894..1847046,1847110..1847134,1847199..1847393,
                     1847453..1847550,1847616..>1848830))
                     /locus_tag="MYCTH_2141489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658697.1"
                     /db_xref="GeneID:11511562"
     CDS             complement(join(1846305..1846698,1846757..1846830,
                     1846894..1847046,1847110..1847134,1847199..1847393,
                     1847453..1847550,1847616..1848830))
                     /locus_tag="MYCTH_2141489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658745.1"
                     /db_xref="GeneID:11511562"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="JGIDB:Spoth2_2141489"
                     /translation="MTTLSSVARSPAPTVNSSPIKPILRKPTSVLGTRSRSENLEDAD
                     EDEPPTKRQKKTVVFNEDLNIVKEISGKSLEDAKKEVKQALEGHSRGDDEDYDNLKEI
                     FSPTPKKRRRVDDDDEDEDEDEEDEEEEEAGAAKPHDLIVYVVALTGYAPLLGRSCSG
                     LLRSVLRCSWLERDENFARAYIQLLAALSSVQGSLFTQVLTMMVDKFTETRHTSSVRG
                     FAPVDPETKRKWLHIGLKYLLELFPAGQHLILNLVSTKFPYTEASKAVHMEYIDHLLR
                     LKAARPELERDIMELILSRLVKLDVEMSLDLENDDDETTRAVLRQLEAPDAKNEDEDD
                     DSDADSVLSDDDGLNEQAKRVLMIKSKLETMDAILDLLFSIYNPVFEDPDSPDAIEAF
                     QDLLSDFSNVILPHLKSRHTQYLLFKFSMKSTQLMEMFIGTLFNLAFESNRPPVVKQA
                     AVAYLASFTARGARVQSDQVKMITQTFLDYMDHYRAVHTSCRGPDVRRYSQYYAYFQG
                     LLYIFCFRWRDLIDQDLLPSNLDWDDPASFIGRDLPWMTGLRSRLQANIGSKLNPLKC
                     CSPIIVDEFARLAHHLRLIYIYPQIEKNKSVHLSQFFTGSYATGGALRDTGLEFDDEK
                     WTHLEACFPFDPFQLPVAKRWLDLENSYVAWRPMALLDRDEDGDVDDDDEDGENDEDE
                     QDDSDFEEGIRGDGGVVSSFQEDTATDEEGGEGYD"
     gene            complement(<1849886..>1850933)
                     /locus_tag="MYCTH_41855"
                     /db_xref="GeneID:11505459"
     mRNA            complement(join(<1849886..1850077,1850134..1850267,
                     1850339..1850449,1850774..>1850933))
                     /locus_tag="MYCTH_41855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658698.1"
                     /db_xref="GeneID:11505459"
     CDS             complement(join(1849886..1850077,1850134..1850267,
                     1850339..1850449,1850774..1850933))
                     /locus_tag="MYCTH_41855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658746.1"
                     /db_xref="GeneID:11505459"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Spoth2_41855"
                     /translation="MSDSPQSNPKDVEQGAPSGDDEGQMNDPQDPHSTGLGYEFEVKE
                     QDRWLPIANVARIMKTALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKT
                     VNGEDILFAMSSLGFENYAEALKIYLSKYREVCQSQSNRGENQQNRPSSQGYGATGGS
                     NPAGGFGAGLPGQQEGGDTQSYNLYGAQPGHNGTGTEY"
     gene            complement(1853395..1854446)
                     /locus_tag="MYCTH_2313405"
                     /db_xref="GeneID:11508948"
     mRNA            complement(join(1853395..1853768,1853840..1854032,
                     1854205..1854295,1854350..1854446))
                     /locus_tag="MYCTH_2313405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658699.1"
                     /db_xref="GeneID:11508948"
     CDS             complement(join(1853736..1853768,1853840..1854032,
                     1854205..1854295,1854350..1854386))
                     /locus_tag="MYCTH_2313405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658747.1"
                     /db_xref="GeneID:11508948"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="JGIDB:Spoth2_2313405"
                     /translation="MASQTAAAKRQQDLQVQYTTYKNTLQQIAQKIGDVEQEAEEHKL
                     VLETLEPLPGDRKCFRMINGVLVERTVKDVIPALRTNAEGLKKVLDDLVKQYKAKQDE
                     LDRWKKKNNVQVVQS"
     gene            <1854671..>1854975
                     /locus_tag="MYCTH_98929"
                     /db_xref="GeneID:11511691"
     mRNA            join(<1854671..1854704,1854767..>1854975)
                     /locus_tag="MYCTH_98929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658700.1"
                     /db_xref="GeneID:11511691"
     CDS             join(1854671..1854704,1854767..1854975)
                     /locus_tag="MYCTH_98929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658748.1"
                     /db_xref="GeneID:11511691"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="JGIDB:Spoth2_98929"
                     /translation="MHPLLFTKDNAGCEQLMAALEECHAKGFIWKAAGMCNDAKQQLT
                     ECLRAERLKNQSLNRNSVQDKRSKIRQKWKEIDENS"
     gene            complement(<1855243..>1856105)
                     /locus_tag="MYCTH_2114422"
                     /db_xref="GeneID:11505683"
     mRNA            complement(join(<1855243..1855436,1855512..1855533,
                     1855675..1855770,1856085..>1856105))
                     /locus_tag="MYCTH_2114422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658701.1"
                     /db_xref="GeneID:11505683"
     CDS             complement(join(1855243..1855436,1855512..1855533,
                     1855675..1855770,1856085..1856105))
                     /locus_tag="MYCTH_2114422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658749.1"
                     /db_xref="GeneID:11505683"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="JGIDB:Spoth2_2114422"
                     /translation="MAEVALWGLELPSYVLAALTATGGAVGYARTRSRPSLIAGTAVG
                     FLYGLGGYRISNGEPYGVELSLLASIVLGGSAFPRAIRLRKPVPIVLSLLAAYGLVTF
                     GDAFRRGL"
     gene            <1858399..>1861725
                     /locus_tag="MYCTH_105777"
                     /db_xref="GeneID:11509010"
     mRNA            <1858399..>1861725
                     /locus_tag="MYCTH_105777"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658702.1"
                     /db_xref="GeneID:11509010"
     CDS             1858399..1861725
                     /locus_tag="MYCTH_105777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658750.1"
                     /db_xref="GeneID:11509010"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_105777"
                     /translation="MSSTYTYYPAPGCSNTTATSRDKVGQPRNTTTQDFQHLSPFSPQ
                     VGSSSSSPGFSIHTPPDSVFTDFTDADDPFFGVDFNAPGVATPSFLQDDVQPIDGSGA
                     LADGSGVLAAPAESQHVNHAASYLPLSPDKTPSLPGGSPNSQLKEEAASRGVFPDLVQ
                     TSVAPQNLSLTHESTAASESKQHGGPQLTPRTNDSANPSEDGVAPAATMQSPLVTVSH
                     WDRDHNSSISESRDAEAAQTRGSPTFSTARDGTGRWIPDHVTGQSGLPPTARSDAQVE
                     SINDLAAQRDMEQRKQEIDEWLQRSTHSSDNTPPDPPDVEDDGIPQKEIPLGDMTENK
                     PIPGQTYFRETGGGPLTREDLEIMRQGRPWEDAPIPFSISQSNSTPYQPETSNAAILK
                     YQRMCQDNDSIVSRAATWGTRRLSLPSLIDTEVQITGNLFKKLSIGRGEARRPSILGN
                     IRSLVRRPSNSGNKRSRAEHEDASSSVTESSTEKKDTQAKLAPPSPKPGWAKKQSVPS
                     INTAFVDVGSRIASIGTTHARTSSVSATPITSPKSPSGLSLSVKRPLRFRSKSETSGI
                     VDLWKRSGGPPVPNTKVHAAPEADEDEEDEDDLYEEGDVKNDSGNLIDEITPTIAGFQ
                     QHVVRLNPMLNTPGHYLVDRIAHQQMIRYKNLLNLRVKHLQAVAAGNCQCGSTCVDSG
                     GSANILDSKGEQRGLDPPSSRFDGSDGDITPVEGLINQDSFPQGIPMPRTTSLPAEFE
                     CQLCFTAKKFQKPSDWTKHVHEDVQPFTCTWERCREPKMFKRKADWVRHENEGHRHLE
                     WWTCDVDDCRHKCYRRDNFLQHLVREHRFAEPKIKTKAAMKRAAGGIDPTWAKVEQCH
                     HETDALPQSEPCRFCGKTFPSWKKLTVHLAKHMEQISLPILKLVAKKELDEHTIISPV
                     QDPPPRQFPHDFSDKQDQHRAFGPSLTIPQSGPMAYPHHGPPLGMYPLAPPTQGYHAA
                     GLYSPNFDSLSHGIAQTQISMPPMAHHQPHQQHQGFQSLNSQAAFPELPTTSAGAYMS
                     TPPQASPNYMTMAPDLEPFPTLSMDALGLGLQNPTGVAEQLPYGNGGLAVEQQQQQFT
                     PQGSVSPYGPSPNMPQGGFF"
     gene            1863865..1866984
                     /locus_tag="MYCTH_2313408"
                     /db_xref="GeneID:11505704"
     mRNA            join(1863865..1864693,1864748..1866331,1866405..1866984)
                     /locus_tag="MYCTH_2313408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658703.1"
                     /db_xref="GeneID:11505704"
     CDS             join(1864393..1864693,1864748..1866331,1866405..1866820)
                     /locus_tag="MYCTH_2313408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658751.1"
                     /db_xref="GeneID:11505704"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="JGIDB:Spoth2_2313408"
                     /translation="MKLPARAALTWALLASAVSAVDVLETVGFSSCNSNPSVSVERVD
                     IKYNNDDKTVTFDLAGTSNKEQKVTAVLKVTAYGQDIYSRSFDPCEKSTFVEQLCPVP
                     AGNFAARGTQKIPAEFADMVPSIAFQIPDIAAMATLELHSKDSGESVACIQSQVTNGK
                     TASVPAVSYVAVGVAGAALVLGGISAAGAVFGGGGAAAGGGSAAGGTSTPSPTFTEVF
                     SWFQGMAMNGMLSVNYPNVYRSFTKNFGFSVGLVPWTDLQVSIDNFRAATGGNLTENS
                     VEFLRNATLVYPDGSAQTTQQGLLRRAADQFVHLAARQIETSINGTLDEADPHETAAQ
                     HTVRAAVSGIQGYVQQLSIPSGNTFMTILLIVAIIIAAIVVGILLVKVVLEFWALFGS
                     FPKSLAGFRKHYWGSIARAVTSLILLLYGVWVLYCVFQFTRGDSWAAKLLAGVTLFLF
                     TAVLAFFSWKIWSTARRLKKVEGDVSSLYDDKNIWVKYSIFYESYRRDYWWLFVPTII
                     YMFAKGVIIAGADGHGMVQTSGQLIIEAIMLILLLWSRPYERRSSNIINIAIQVVRVL
                     SVVCILVFVEQFGIAQTTKTVTGVVLIAVQSALTGILAILIACNAFIACFKMNPHRKR
                     RKELEKLQQRDTLTPLDARNSLLLKGSKTAGSDDSSSISLPNKPGFTPLVSVRTDNSA
                     ADVPEKYGNGTNNKRTSRFQEVNPSRENLLTGAAPLGGNAAALDLRQPTLPDLGGGYG
                     GPGSGGQGQAGGYDGYGNYRGAYRRW"
     gene            1867526..1869746
                     /locus_tag="MYCTH_2294923"
                     /db_xref="GeneID:11508836"
     mRNA            join(1867526..1868008,1868107..1869248,1869351..1869746)
                     /locus_tag="MYCTH_2294923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658704.1"
                     /db_xref="GeneID:11508836"
     CDS             join(1867770..1868008,1868107..1869248,1869351..1869517)
                     /locus_tag="MYCTH_2294923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658752.1"
                     /db_xref="GeneID:11508836"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2294923"
                     /translation="MSELQKKWAKARITTAMHTMAPPPSLTDLGEPDEDRYSSYSTGS
                     VPNTPQDDDSSSASSVSSTGTVIPSPGRALFARPQGFPNRSLDPIPWTAYFERELFLP
                     SPDGSITYHAYLTSPAPAAGPGKVGGPLFVTHHGAGSSGLSFAVLGAEIRKRLPTAGI
                     LSLDARGHGSTTTTATAGTAAAAATQREGAIEDLSLSTLASDLLAVMMLTKAAMHWPS
                     LPPVILVGHSLGGAVVTEFASVLLPSIRSGLAPAPPGTAVTTTTTATTTNATAAAART
                     NLDLDVLGYAVLDVVEGSAMDALQSMHAYLATRPAGFESLRDAVEWHVRSRTVRNAVS
                     ARASVPGLLVQTQHPGHGPGGAGSAEGGHGTGLGQEGGGEGGGRVPGVPVDDGRGGGR
                     QGQGQGGGGSGKADKPWRWRTDLAKTQPFWEGWFTGLSKKFLGGRGGKMLLLAGTDRL
                     DTELTIGQMQGKYALQVFPEAGHFIHEDLPEKTAMALVDFHRRNDRSTLVLPPKVSDL
                     LAQGKKV"
     gene            complement(1869694..1871753)
                     /locus_tag="MYCTH_2294926"
                     /db_xref="GeneID:11508190"
     mRNA            complement(join(1869694..1869850,1869973..1871216,
                     1871342..1871753))
                     /locus_tag="MYCTH_2294926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658705.1"
                     /db_xref="GeneID:11508190"
     CDS             complement(join(1869976..1871216,1871342..1871618))
                     /locus_tag="MYCTH_2294926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658753.1"
                     /db_xref="GeneID:11508190"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="JGIDB:Spoth2_2294926"
                     /translation="MATTAETPVSAATAATAATAATAATTATTAAGATETAPPTTATT
                     PAATALPRVPIPPRGVDYRGKLVLAPMVRSGELPSRLLALHYGADLVWGPETVDHSLI
                     GATRRVNPRTGMIEYTRQPSHAYSPANSAARNNSNDSNDNDNNEAGAAESVIYRLDPE
                     REKGKLVFQLGTSDAERAVAAARVVAADVAGIDVNAGCPKPFSMLGGMGAALLRAPEK
                     LAGILEALARDITPAFGIGISVKIRLLETPAETEALVRRLVRTGITGLTVHCRTTPMR
                     PRERAVRGQLAMIRRVCHEAGVACLMNGDVESRDHADLLVREFGVDGAMIATAAEKNP
                     SCFRSRADGGLAAWPEVARRYLRFAMEVENRAANTKYLLAQIIPGKALAYRDVQRGRS
                     YSDFAQALECDEEMRAMAREADRVLGLGEFEPKRGPKQKNKQQQKGQQGEQPSGQQQE
                     SKKRKRGQDEEEEREGGEGGGEGGEQQAKAKDESAKRPEVAAEPAPVAAPAAIAV"
     gene            <1872317..>1872965
                     /locus_tag="MYCTH_2122366"
                     /db_xref="GeneID:11505773"
     mRNA            join(<1872317..1872393,1872470..>1872965)
                     /locus_tag="MYCTH_2122366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658706.1"
                     /db_xref="GeneID:11505773"
     CDS             join(1872317..1872393,1872470..1872965)
                     /locus_tag="MYCTH_2122366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658754.1"
                     /db_xref="GeneID:11505773"
                     /db_xref="JGIDB:Spoth2_2122366"
                     /translation="MLPALRHSTEPRAVSCALRHMRFLAGLERQTRQPADVLERILRH
                     SRHPEDVAENISVVEIDPRIRRIRCRQPALACNTLRTLRNLSPPAKTYRVRDAPGPAR
                     LRLLNRAAPFARKGVRIAVDEADPSPVGCLATRMGRPRGVGEALARSSQVAAGERASK
                     LSDYLATTTSSMSLHQNIKHPTSQSFWLVR"
     gene            1875699..1880384
                     /locus_tag="MYCTH_2294928"
                     /db_xref="GeneID:11505445"
     mRNA            join(1875699..1876623,1876715..1876747,1876831..1877657,
                     1877754..1878020,1878129..1879628,1879714..1880384)
                     /locus_tag="MYCTH_2294928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658707.1"
                     /db_xref="GeneID:11505445"
     CDS             join(1875837..1876623,1876715..1876747,1876831..1877657,
                     1877754..1878020,1878129..1879628,1879714..1880280)
                     /locus_tag="MYCTH_2294928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658755.1"
                     /db_xref="GeneID:11505445"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="JGIDB:Spoth2_2294928"
                     /translation="MSGESPLAVVAAVIRSLATDPTTTPPAVTNACPSVRLPGPDTVE
                     KIELERELAALVTRVQQLEARANSAAANVFPDTPNETSDSPFADDRGRPRPRFPSHLS
                     RNGFIDEALEGLREHVDDQSKLLDSQRQELDGVNAQLLEQKQLQEKALAIIEQERVAT
                     LERELWKHQKANEAFQKALREIGEIVTAVARGDLSKKVRMNSVEMDPEITTFKRTINT
                     MMDQLQVFSSEVSRVAREVGTEGILGGQAQIEGVDGTWKELTDNVNVMAQNLTDQVRE
                     IASVTTAVAHGDLTKKIERPAKGEILQLQQTINTMVDQLRTFASEVTRVARDVGTEGI
                     LGGQADVEGVQGMWNELTVNVNAMANNLTTQVRDIIKVTTAVAKGDLTQKVQAECRGE
                     IFELKKTINSMVDQLQQFAREVTKIAREVGTEGRLGGQATVHDVQGTWRDLTENVNGM
                     AMNLTTQVREIAKVTTAVAKGDLTKKIGVEVQGEILDLKNTINTMVDRLGTFAFEVSK
                     VAREVGTDGTLGGQAQVDNVEGKWKDLTENVNTMARNLTSQVRGISTVTQAIANGDMS
                     RKIDVEAKGEILVLKETINNMVDRLSIFCNEVQRVAKDVGVDGIMGGQADVAGLKGRW
                     KEITTDVNTMANNLTAQVRAFGDITNAATDGDFTKLVEVEASGEMDELKKKINQMVYN
                     LRDSIQRNTQAREAAELANKTKSEFLANMSHEIRTPMNGIIGMTQLTLDTDLTQYQRE
                     MLNIVNSLANSLLTIIDDILDLSKIEARRMVIEEIPYTLRGTVFNALKTLAVKANEKF
                     LDLTYRVDSSVPDHVVGDSFRLRQIILNLVGNAIKFTEHGEVSLTIQKATTVPPGNPG
                     EYAIEFTVADTGIGIPADKLDLIFDTFQQADGSMTRKFGGTGLGLSISKRLVNLMGGD
                     VWVKSEYGKGSKFFFTCVVRLANEEISFIAKQLNPYKGHQVLFLDKGRTGHGPQIAEM
                     LKGLGLVPVVVDSEKSPALDRVRGRGSAPYDVIIVDSIEDARRLRSVDDFKYLPIVLL
                     APVVHVSLKSCLDLGITSYMTTPCKLIDLGNGMVPALENRATPSLADNTRSFEILLAE
                     DNTVNQRLAVKILEKYHHVVTVVGNGEEAVEAVKRKKFDVILMDVQMPIMGGFEATGK
                     IREYERSLGTQRTPIIALTAHAMMGDREKCIQAQMDEYLSKPLQQNHLIQTILKCATL
                     GGQLLEKNRERELARAADAVTGGRRDNPALAAAYQSAAAANNNASNNASNNNSSSRTS
                     SSSSSSSSDNSSNSTRPPLSTRSVTAAESLTSAIDSPSLVTADQDDPMDRTHSSLSEP
                     DISTAQ"
     gene            complement(1881919..1884142)
                     /locus_tag="MYCTH_2294934"
                     /db_xref="GeneID:11505987"
     mRNA            complement(join(1881919..1882863,1882936..1883169,
                     1883248..1883302,1883460..1883645,1883765..1883798,
                     1883873..1884142))
                     /locus_tag="MYCTH_2294934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658708.1"
                     /db_xref="GeneID:11505987"
     CDS             complement(join(1881926..1882863,1882936..1883169,
                     1883248..1883302,1883460..1883645,1883765..1883798,
                     1883873..1883991))
                     /locus_tag="MYCTH_2294934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658756.1"
                     /db_xref="GeneID:11505987"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="JGIDB:Spoth2_2294934"
                     /translation="MSQSLKAIFGELGISQYLDAFLEQGFDTWETILDITESDLDALG
                     VKLGHRRKLQRRIANSRGIAPDASLVSPTQAAIEDLKLQDGIHPEPPAAEGRETVGTV
                     VTKRKYRRHPKPDENAPERPPSAYVLFSNKMREELKGRNLSFAEIAKLVGENWQNLSA
                     AEKEPFEARAQAIKDKYLADLAEYKKTPQYSQYQAYLREFNAKHGSPSQDKDASKRVR
                     LSGHGGQGRGSPGAITTRTSRSGSGANSRRGSPPTSARQRISSVISSDSQYTSSLAPS
                     TSITSPEDSAFSPTESNPDQQHAMNRSPPIKLEPKEQSPLLSPRHASQRDDQGREQSS
                     MHRHLPSLSDLFDGQGLPGTMRQPSDPSGYRFPGAHITGSPGRPLGHRGADARSPPMT
                     NGTEHRYSDDSSSSHPPFGLPRPSVDGPLPIHALLDSMPEPTFRSHQPAPLQPPNTHL
                     ATEQNHNPSPVHQSPSSGSGRQIINGTFVFLFSRSIEIVYSVTELGAQRLPSPSLGVA
                     PLALSLFYQRVSN"
     gene            1888467..1889366
                     /locus_tag="MYCTH_2294938"
                     /db_xref="GeneID:11508512"
     mRNA            1888467..1889366
                     /locus_tag="MYCTH_2294938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658709.1"
                     /db_xref="GeneID:11508512"
     CDS             1888754..1889131
                     /locus_tag="MYCTH_2294938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658757.1"
                     /db_xref="GeneID:11508512"
                     /db_xref="JGIDB:Spoth2_2294938"
                     /translation="MGAVHQGRFFLLLCLAAQIAGYETHSTRTRTERKIYAIRTYSRA
                     KKRGWYGSADGLVFYYTRGEQTASTLEANLTSLENKLDEILAALGVSAADLDALDEQE
                     KEPRAGQERENEKGASKGSGESA"
     gene            complement(<1889601..>1892601)
                     /locus_tag="MYCTH_76096"
                     /db_xref="GeneID:11512817"
     mRNA            complement(join(<1889601..1889909,1890018..1891010,
                     1891068..1891718,1891793..1892405,1892513..>1892601))
                     /locus_tag="MYCTH_76096"
                     /product="condensin complex component cnd2-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658710.1"
                     /db_xref="GeneID:11512817"
     CDS             complement(join(1889601..1889909,1890018..1891010,
                     1891068..1891718,1891793..1892405,1892513..1892601))
                     /locus_tag="MYCTH_76096"
                     /codon_start=1
                     /product="condensin complex component cnd2-like protein"
                     /protein_id="XP_003658758.1"
                     /db_xref="GeneID:11512817"
                     /db_xref="InterPro:IPR008418"
                     /db_xref="JGIDB:Spoth2_76096"
                     /translation="MPRIAQGPRRSGSRVTSGSLLASPFKSPVKIPLNDDAQEKAQRS
                     HGRKAAHEAQINQLRAAATSTPRRSSTSFNDFQNAETPGSSPRTPRRRRSVNYTTILD
                     DDEQLVVGGKAVTPMKRVPILANFEEWMKMATDNKINAANSWNFALIDYFHDMSLLKE
                     GDGVNFQKASCTLDGCVKIYTSRVDSVATETGKLLSGLADSRDNKRKGRDGDEEEDEE
                     EEVDEDGNVRKKPKKKTQRSSEATLAPSFASLQLKKLELEFAVDPLFKKASADFDEGG
                     AKGLLLNHLMIDSQGRIVFDSSDDAEDAAEAASKSRTRDEGENVNGEEGDEDLLMTDR
                     DETPAPERSKEQGRKDEEEEEDVEIDVPGLGARFFPDLNILDSLDVCPSLKTFDLGDP
                     SGSLDIPFLRAPDDWRDQDKEKTPGPGGIGDKSGMFIDEENPLGFDDEDGLGTFDLGA
                     DMMRVYDAGLGMGDGAAADGEGDGADLLDSGNGDFAISMTHAQKADRVHEDILSYFDQ
                     ALQKNWTSAEHWRIRKIKDVNKPTEPTRQRKEKQPFEIDFAAPLDPAVAEAIYTQASS
                     NAAISLAKKDWKSKSRNLLPDDKHFSSKQLLSLFLKPKARMGRRRVLGSGSRIGNVDS
                     QRQQNDVPEGEMDEAFWASQKAPLQSADHHHASSPDDEGLPQGDYDANFFQDDGLPFA
                     GGGGRDDDDDDDDMDEFADARDHFSPEAGGPGMMTDVGMTGAFGGLTVTNPADLAFGT
                     MLVTQNRRVRPEYVQYARVAKKVDVRRLKEEIWKGMGFERPDDENQAAANNNNNSRLM
                     TPTSPEKSTTSTAPGTEADPTLKFTDVMNDLQRVYPKPVMDDISTSFCFICLLHLANE
                     KGLVIEKTEGLDELLIRKDWTAEITEGE"
     gene            1893620..1896945
                     /locus_tag="MYCTH_2294942"
                     /db_xref="GeneID:11508756"
     mRNA            1893620..1896945
                     /locus_tag="MYCTH_2294942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658711.1"
                     /db_xref="GeneID:11508756"
     CDS             1893777..1896749
                     /locus_tag="MYCTH_2294942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658759.1"
                     /db_xref="GeneID:11508756"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="JGIDB:Spoth2_2294942"
                     /translation="MRRRFGARPVVAAALLVATIAALALFQSARGTILGARDGHGRPV
                     LGARDMTYYYPADADCRNVHNAADQCAFALANCEDDEAGLIHYISFYYCTLGGAKPVA
                     FAILALWLALLFTTIGIAASDFFSVNLSTIASVLGLSESLAGVTFLAFGNGSPDVFST
                     FAAMASNSGSMAVGELIGAAGFITAVVAGSMALVREFKVNRRPFVRDIVFFIVAVSFT
                     VVFLADGELHLWECFTMIGFYLFYVAVVVGWHWFTSRRRRQRMRDAAARAHLYSPSAR
                     GSDELEPYRDEPDEDEAAPVGRRSGNVSEPADIGMLERAPRIEVDAVSPPGEDEERRE
                     MHVAAEMASSMRVNRPRWGRSNTTITPIRPSLLGVLEFRSVLSSLQKERNMHLALLPA
                     RSHSHQPAAADLPDSRGRPRNKTLPAQAPPRMERALSYGNEPLNLDNSGLVRPGSSTV
                     PHTRSNSASRTADGLLAPPVVPAVPAGQDISSPPKQPQQLLNIRIPSPSGRSSGQSSP
                     STSPFPRLSESPAALTPVHQELSAFSFPAPMDPGRQRFPGLEDQEEQPKPVRWWPYSL
                     LPAPHVFLATIFPTIQGWKQKTLWDKMVSLASVPSVFLLVTTLPVVETESPDDDDDDD
                     DDDDGGDPEDDIGDPPAPGHPGNIAPALVVQDGAAEIRPETEWQAYRRRARAASLKSP
                     FSLSPSSLSLDNHPQPAAALTVPAPGSAPHPAPIPPPMPAASATFPPTSSDKPASGGW
                     NRWLVAVQLFTGPLFVVLVVWANTADDMVEPRRALVRMVLYSLLVSLCLLAGLLATTT
                     ASQKPRYHFLLCFLGFIISVAWISTIAGEVVGVLKAFGVILDISEAILGLTVFAVGNS
                     LGDLVADVTVARLGYPVMALAACFGGPMLNILLGVGIGGAWMGIAKAKRKQRKHPGTE
                     LRYKPYRIQVGGTLMISAITLLLTLLVLLIAVPSNRWIMSRRIGWGLIGIWTVGTVVN
                     LVVEMTGTLADVSGGLTS"
     gene            1897563..1899150
                     /locus_tag="MYCTH_2294943"
                     /db_xref="GeneID:11508591"
     mRNA            join(1897563..1897986,1898157..1898611,1898736..1899150)
                     /locus_tag="MYCTH_2294943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658712.1"
                     /db_xref="GeneID:11508591"
     CDS             join(1897897..1897986,1898157..1898611,1898736..1898988)
                     /locus_tag="MYCTH_2294943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658760.1"
                     /db_xref="GeneID:11508591"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="JGIDB:Spoth2_2294943"
                     /translation="MASYPPLAEREIKNTIVLFDVDGTLTPARLSASPEMLSLLSRLR
                     QKVAIGFVGGSDLVKQQEQLGGPGVDVTTLFDFCFAENGLTAYRLGEPLPSNSFIKWI
                     GEDQYKELVRFILHYIADLEIPVKRGTFVEFRNGMINVSPIGRNATVSERNEFEKYDK
                     EHGVRKAFVEKLRERFGHLGLTFSIGGQISFDVFPTGWDKTYCLQHIENEAKRPGGVH
                     YTTIHFFGDKTFEGGNDYEIYNDPRTIGHSVTGPQDTIDELKKLFNL"
     gene            complement(1899378..1903531)
                     /locus_tag="MYCTH_2294947"
                     /db_xref="GeneID:11513115"
     mRNA            complement(join(1899378..1899899,1900017..1900705,
                     1900789..1903531))
                     /locus_tag="MYCTH_2294947"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658713.1"
                     /db_xref="GeneID:11513115"
     CDS             complement(join(1899388..1899899,1900017..1900705,
                     1900789..1903376))
                     /locus_tag="MYCTH_2294947"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658761.1"
                     /db_xref="GeneID:11513115"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="JGIDB:Spoth2_2294947"
                     /translation="MASRSRDVPDEELFMSRPRPTEDCDSPTVEPLRIFRPQSPAADK
                     GSSRPKYPAPPSSSSSAAGSASAAASKPGIASLPPLPSFPFGASSSAAPLPYPDDDNK
                     AQSKPQPKASRLPYPDVESKPSPPGGRVYSPPPASSSSSSPAQNDSFPRPTVSTGEKK
                     TGLAERRGAAPKPLQSPVSPGTDDEDTGGLFAKPLRNPASAAPAPKISNAYQQKPYYP
                     PPGGGASQAAPINRISSTASNSTTRASRGSPPPPETPVVEPGTIPGGGIEARYAAAGI
                     SGTATLNSLQTPSAAAQSRLAQYGSQAPAAQPQQPQPRPWTPTETPGQQPFGPPTVYQ
                     GAEVVSNPTPPPQQTPAFNLPKNPNPTTQVPAGSALQVSVLEQDFQRMQASTPPPAYT
                     SVNPNAISKYPDEKQRPTQPHPSSSVPTTTAAAAATTITATTAAAPIAAASASASNAN
                     PLASPNPVSSPTPQKQSPAGNTATTIPAHNAGHPALAQDNKLAPGQNGQPALTHTPSL
                     LAAAQSPPPLPEGWIAHLDQNSGQYYYIHLATQATQWEFPTGPTPLNHDIAPLSPTAS
                     TYGNPLGSPFLGGGKAGLASPMFQAQGHPGYAESIMSVSASVAPTMAGFTGPPPSAGV
                     EMYKVMPTNGVYFGPYLRYVNMDLEKGIWYGSILLVTDAPQPPTIHVHLSVDLSPNPR
                     QLIPQSIYQHQRWVFYKYEMDLQMSEQGTERWTYAVTSHLGCTRYEFVVAGRYETGWR
                     IIAHSGNDFSPSTNQNERAKLGGVGFMWKDILQKNVECGGFHVQLGLGAQIYGDRLWR
                     ELPLLKQWLSMQGRENRKNAPWTARHQEEVSHAYFHYYTSHFDQPYMREAFAQIPHIL
                     QIDDHDIFDGFGSYPDYMQSSAIFKGIGRIAIDMYLLFQHHTTVEILRNVSSDMDLFT
                     ITGSGWHFVKYLGPAVVVVGPDCRSERTLTRVMAGPTYQGIFPRVATLPPSVQHCIWM
                     ISVPVVYPRLETVETLANTFATGKKAVNTTYNILGKVTSSVAGVVGGKEVVQQGFKEV
                     KKAVGKTGLMGSVLNQFGDIDIAEELKDLWTHESKDLERTYLIRTLQGIAQQKGIRMT
                     FLSGDVNCAGAGLVHDPSHPSDHKTMYQIIASPVVAAPCSNYMLKMLHNNKLLYVPQN
                     GHRSTHEVSDTKEDMMEIFHTDASGAAREHKKLMARRNYVAIVAYDPDAIAGGQLQGP
                     QGVQGGLKPGYAASVASGSQSGLSKLSLAVDFVVQGDGPYQTTTKYGPVIVPHLEYGH
                     "
     gene            complement(<1905249..>1907087)
                     /locus_tag="MYCTH_2106347"
                     /db_xref="GeneID:11506048"
     mRNA            complement(join(<1905249..1905491,1905547..1905821,
                     1905938..>1907087))
                     /locus_tag="MYCTH_2106347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658714.1"
                     /db_xref="GeneID:11506048"
     CDS             complement(join(1905249..1905491,1905547..1905821,
                     1905938..1907087))
                     /locus_tag="MYCTH_2106347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658762.1"
                     /db_xref="GeneID:11506048"
                     /db_xref="JGIDB:Spoth2_2106347"
                     /translation="MSLQRVSSIETFTTIPTNGSRPRRTSDASTRARKLTFNPLPQRW
                     DPPTTLDQLAAVGAFKVPKWKRLHKLAHDSLSSQPLTLFSVQVIVGVASCFFGAGIVF
                     GYAAIKPVLRAEGAYRRICAAQNGSPDAVDTCADMHLNLMFTVAAVATNVAALPVRAI
                     LDHLGPRVCGLLGSLSLATGALLMAFENRLEFDALLLGYFCLALGGPFTYISSFQLSN
                     AFPRRSGFILALLTGAFDASSALFLAYRIVYEKTDGAFGHRRFFLGYLLVPAAIALLQ
                     MTLMPSQSYKTVGELVEEIEAPIHAVAEPAPYDRVDEETALLQEEERRHRADVIEGIQ
                     NLLGSSKADAQTEREEHVNKLSGVWGVMHGYTAWEQIKSPWFILICLFTIIQMTRINF
                     FVATVRSQYESLLGSHEGAVPLNNFFDVALPLGGILAVPFIGTVLDHTSTPTVLAALV
                     FFATAIGVLGVIPRSPPGRLRQRHPVFGFETFGTVYGTVIALSGVLNFAQEGLDWLFE
                     RRFGGDPVPVNVLLLLLGLAVGVTLVGFVCSKARLIARQRVPEGETP"
     gene            complement(1907940..1909805)
                     /locus_tag="MYCTH_62332"
                     /db_xref="GeneID:11506047"
     mRNA            complement(1907940..1909805)
                     /locus_tag="MYCTH_62332"
                     /product="histone deacetylase phd1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658715.1"
                     /db_xref="GeneID:11506047"
     CDS             complement(1908063..1909553)
                     /locus_tag="MYCTH_62332"
                     /codon_start=1
                     /product="histone deacetylase phd1-like protein"
                     /protein_id="XP_003658763.1"
                     /db_xref="GeneID:11506047"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="JGIDB:Spoth2_62332"
                     /translation="MDVSAYQYRPPKPNYLPHNIEADDPIVEEYAVPLGKADDRENAI
                     FFNKMKFAAQEYGIVRPKGYRVSYHATPEMEKHHFGQTHPMKPWRLTLTKSLVTSYGM
                     PFAMDNYVTREATYEELNAFHSSDYLDYLSTATPEDQPQDIDNSDKEVKYNLGGSDCP
                     LFHGLYNYCSMSAGCSLDAARKITNNQSDIAIAWGGGLHHAKKYEASGFCYINDIVLA
                     ILQLLRIYPRVLYIDIDVHHGDGVEEAFYSTDRVMTVSFHKYHPETFFPGTGALEDNG
                     PKSEHNPGAHHAINVPLQDGITDEQYENLFQSIIGPINERYRPSAIALQCGADSLAGD
                     RLGRFNLRVQGHGACVRYCKSLGLPMIMFGGGGYTPRNVARAWAYETSIAIGADTRIP
                     ETIPEHAPWREHFIHDTLFPTLEQSMNEPRHNRNSDKRLREIVAHVHEQLRFVSHAPS
                     VQSTIIPPDLGPIRDDVEARLKEESEEKDGGLRKIQEEGLGQEGEF"
     gene            <1910625..>1912103
                     /locus_tag="MYCTH_105786"
                     /db_xref="GeneID:11508651"
     mRNA            <1910625..>1912103
                     /locus_tag="MYCTH_105786"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658716.1"
                     /db_xref="GeneID:11508651"
     CDS             1910625..1912103
                     /locus_tag="MYCTH_105786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658764.1"
                     /db_xref="GeneID:11508651"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Spoth2_105786"
                     /translation="MPRDDLSIDFVRKMPPAEPLDPALILDEFINRTQNLAEELRFLQ
                     EEIADKDRQYDKLVREIEERDGRIQKWIKAHGSHHPNPKEEEYRATIRKNFELAEQLS
                     NEKIALTQKLQQNLDKHTRQLDMQIKMLYDRGEPGFTDPDELPSLLRPSAANATNGTG
                     GPRGANAANAISSALNNIPQARAANAQVRSAQTQQQVSASAPATPAASMIMNRQARES
                     SAGPATKRVPRSNSGLGTLPATSSGLARHSSLGPGTPKGAQTAAGVQRAGSAGPRATS
                     KATLAGGVRKAGTPSSAGGRKKGTPAAGAGVQKSGLSRVKRAAKNSPSSAAESELSDA
                     ESASDDESDTRTGGRGTPAASLSRSASNQAAASLPTGGAGAGNRDSSLHNRTPSGTSS
                     YPNGNNSNGADRNTAHPRSPHPGRGIKEEDVDMIDVEDDEAGDDRKYCSCQNVSFGNM
                     VACDNDQCPYEWFHWGCVGLKSEPNGTWYCPECSEKLKRKGS"
     gene            complement(1912747..1915639)
                     /locus_tag="MYCTH_2294959"
                     /db_xref="GeneID:11508654"
     mRNA            complement(join(1912747..1914121,1914175..1914251,
                     1914315..1914410,1914945..1915082,1915136..1915169,
                     1915435..1915639))
                     /locus_tag="MYCTH_2294959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658717.1"
                     /db_xref="GeneID:11508654"
     CDS             complement(join(1912831..1914121,1914175..1914251,
                     1914315..1914410,1914945..1915052))
                     /locus_tag="MYCTH_2294959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658765.1"
                     /db_xref="GeneID:11508654"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="JGIDB:Spoth2_2294959"
                     /translation="MAAQGVKSALPTHLKPGTNDDTEFAKRHHGKTRSHMAFENTSTN
                     IAAAQMRNALTNLAETVKDPEQKKLFETEMDNFFTLFRRYLNDKAKGNEVSWDRIAPP
                     AEGQVVDYDDLPNSEAVQFLNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSV
                     RQVEYLNRTYGANVPIVLMNSFNTDEDTAAIIKKYEGHGVDILTFNQSRYPRIYKDSL
                     LPVPKSFDSPLHDWYPPGHGDVFESLYNSGTLDKLLERGIEIIFLSNADNLGAVVDLR
                     ILQHMVESGAEYIMELTNKTKADVKGGTIIDYEGSVRLLEIAQVPKEHVNEFKSIKKF
                     KYFNTNNIWMNLHAIKRVVENNELEMEIIPNGKTIPGDKKGESDISILQLETAVGAAI
                     KHFRNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTVKHGQLQMSANRFGDAPLIKLGSD
                     FKKVSDFQKRIPSIPKIIELDHLTITGAVNLGRGVTLKGTVIIVATEGQTIDIPPGSI
                     LENVVVQGSLRLLEH"
     gene            1917637..1918955
                     /locus_tag="MYCTH_2294962"
                     /db_xref="GeneID:11505957"
     mRNA            join(1917637..1918374,1918433..1918955)
                     /locus_tag="MYCTH_2294962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658718.1"
                     /db_xref="GeneID:11505957"
     CDS             join(1917847..1918374,1918433..1918570)
                     /locus_tag="MYCTH_2294962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658766.1"
                     /db_xref="GeneID:11505957"
                     /db_xref="JGIDB:Spoth2_2294962"
                     /translation="MGSTTQDLPYWQVNVPEHLRTAECPDFLRNISDKDRGIISTPDS
                     EYQRDSWAVVQQKVAQNRLELFQRVPSDLRRYLAYTWKLRQDYGSVMNFILSERLGWT
                     LPITPRGRPFEFDDDVKVLRNDWPYGIDERIVHLVVWTKFALEEDPETGDLTDAARAE
                     IDAYVRKKFSRMRPDHVIWFKNWASLKSVKSVEHFHVMLFDPDMEFVNEITNGDVPLC
                     DRE"
     gene            <1922814..>1924693
                     /locus_tag="MYCTH_42937"
                     /db_xref="GeneID:11505659"
     mRNA            join(<1922814..1922969,1923092..1923550,1923664..1923871,
                     1924002..1924356,1924501..>1924693)
                     /locus_tag="MYCTH_42937"
                     /product="glycoside hydrolase family 7 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658719.1"
                     /db_xref="GeneID:11505659"
     CDS             join(1922814..1922969,1923092..1923550,1923664..1923871,
                     1924002..1924356,1924501..1924693)
                     /locus_tag="MYCTH_42937"
                     /EC_number="3.2.1.91"
                     /note="CAZy_ID 267970"
                     /codon_start=1
                     /product="glycoside hydrolase family 7 protein"
                     /protein_id="XP_003658767.1"
                     /db_xref="GeneID:11505659"
                     /db_xref="InterPro:IPR001722"
                     /db_xref="JGIDB:Spoth2_42937"
                     /translation="MYRQVATALSFTSLVLGQQAGTLTEEIHPSLPIEVCTAPGSCTK
                     EDTTVVLDANWRWTHVTDGYTNCYTGNAWNETACPDGVTCAANCAIDGADYEGTYGIT
                     TPSDGALKLNFVTKNQNGQNVGSRVYLMKGDDKYRLFNLLNKEFTFDVDVSNLPCGLN
                     GAVYFSEMDEDGGMSRFEGNKAGAKYGTGYCDSQCPQDIKFINGEANTEGWGGTDGNS
                     GTGKYGTCCAEMDIWEANSDATAYTPHPCKVNEQTRCESEEECGAGDNRYAGLCDKDG
                     CDFNSFRLGNKEFYGPGMTVDTSKPFTVVTQFITDDNTDTGALKEIRRFYVQDGTVIP
                     NSQTVIEGVDPTNSITDEFCEQQKTAFGDTNYFKTVGGLSAMGKSLEKMVLVLSVWDD
                     HAAAMNWLDSNYPTDGDPSKPGVARGRCDAEAGLPENVEAEHPDASVTYSNIKIGAIN
                     STFTAA"
     gene            1926722..1955161
                     /locus_tag="MYCTH_2294970"
                     /db_xref="GeneID:11505503"
     mRNA            join(1926722..1932897,1932965..1937388,1937461..1937599,
                     1937695..1938084,1938179..1938256,1938341..1945572,
                     1945642..1953156,1953437..1955161)
                     /locus_tag="MYCTH_2294970"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658720.1"
                     /db_xref="GeneID:11505503"
     CDS             join(1926822..1932897,1932965..1937388,1937461..1937599,
                     1937695..1938084,1938179..1938256,1938341..1945572,
                     1945642..1953156,1953437..1955005)
                     /locus_tag="MYCTH_2294970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658768.1"
                     /db_xref="GeneID:11505503"
                     /db_xref="JGIDB:Spoth2_2294970"
                     /translation="MREHRRRSPESTRRRRAERRRSREQLAAAAAAALAERAPVSSRS
                     HRRARADSSSSSTSSTSSTSSSLMNISRKSRFGIRSFFASSSVKKVKKRRSFRRKNTS
                     SSSVDSDLAYGTGYISRSSFERQQAKYQQRLQNQHQHQHQHQHQHQHQHQPPYHAQQD
                     PQPSQHSHSHPPHHSQHPQHGPYPSQPGASPSHHPPEQDPLFGPDGRPALHRAQTDEE
                     ILALGRRLSDLARAQNLRDLERAGKKRPSRLVAGAAALSEFNRQGSHGHASRGLSSSK
                     PHARHEESDTEWESASDSDSDSESSSDVDSNLVYGPTPKFSDPSLPIDDRSQSRPTKA
                     PVIISQPPPESIRPPHRKSSAVDPAMFGPVNSLRGYVDTPCGFRPGDYPPPSHSQTDL
                     RAPPYEPIPQSESASIEARPMRNVYPVPTTDAARFEAAPSSSGVSVPLAGPAAPSTPT
                     RRDKTGERDDDGALYSNRSEPVPIQAPKPRVPVSPRVLEDRRAAVEREQQAQQGSPRE
                     RRSKRARDSDRRSAVETVVSGALSAVVGAAAGAALAGVVEDRRDKRRDERDFDRRDER
                     RGCDDRHARPAPDWRSVADTAPVVPPSPAASATSNAIGQRELDELRAKEASLREERLR
                     YEREAQRHREARERLEAEERRRQEELEGRRRQEELDARRLRDNPELADMYERRVREAR
                     EIRYKEERRSRDEQRAARSEHERMARSAEKKRDREEKRKLESADYQEERSREREERRR
                     LKGKDVVAAVDDDERGRSHASSKEVVPPPGPEERKPGGLEPEAAKPSREQRRAEREKT
                     RRMLEEIQRQIELEKKRLAELDAGREPPPATERAEPGPSTSRNDGVDPFQYQVADDAF
                     PTPAYSPPQRSITPVIYTVEREPEWAREEATKDDEPEEERLSRRCSFEREQREAQASA
                     SETRHSAIPDEDGAVERARSRSREPPRPRDREPVRDPVQEEANRLYRESRISQRMAEE
                     EMRSHTPSPTSSVVDKYEDTEDLAEDPIGRIVTPPEMKRPPPKSKYDGPNADVRIDNI
                     ITPHDLHKFLAPPADASGLGPVMMPVFKSRDPSCERERPMLNLVLPTPRTSPSLEKMK
                     ARQAAAQAAADDAPSEDEKRTEERKPHVIIDRHGQVVEVPEDYATGRAVETDSRDSSQ
                     ERPAIRFKFAGRKKSAWGSLIAAAVAAAAVKSKGKKPGDAEKAVEDKGSDAAEADKDK
                     PRDAEPVSERKPEETAAPEAHPSAEAVPESAAPAAVPEPAQVVPDEALPDTQPEPAAP
                     NVSQEPSTPPRWSRVPYEFDDEPPQVGPKPSSPHSSSQMPGSFEEDIEFTATLAAGLQ
                     SSGFNPDIVIQDPTYRRRDSPPGSDEPRYVPPSCETVTDLGMESSHQDGTAGGPDAPL
                     LERVAPVEGSSAAEQSEKPGGEDDDTAPATEVVEPSAEAFVADADDEWSTRSLTESKK
                     PESDHPGSFDSTTYSGPSSEVSVASSGSGKKRKSSRRKSTKDAYEIPEQGEPPDRPGD
                     SFQWIDREVSSVVSDPTGKTNGGGGGHHDTKSVVSLPTNGTGEHREQPTKHNGHGEEE
                     DSFLGNAGTFGAGAGYAGAVAVAAAAQLSRPNATQDSVEEEEVQPFRRARSISYSSQT
                     VDPEIVQREIKPAIDPQYGDLLPLPPSEPGSPKFLNNLSAEEHSFPSLPDSDEESPPP
                     PHLQQTRPRRATVAHTHARRRSAIETPKTPSRTAVPVQFRIGRGSVPSSPVFFRFSPM
                     HSPVAPGNPDTPGSASPRRSRVNRPTSWDSTRDFKPLYLLEKTAAGSAAHGAAGPAQS
                     EEYPELPPSEPSSRESPGPEFAEREDDLDYLGVGLRVAAGMGASAELLQALRIDTTGK
                     GLDVGAGESGFGELLGSGDTTPRAAVPPPHKFDAPPRELSTEGENVHPTEEQQQQQQQ
                     QLVKELETLPPLPDSPADSPTWSPPSPDATAQAPAAAPVFESLESLPALPDSSPASPR
                     VRSLPPAPAPPVDDDGEPEHLLPLPESFLPTSPPLAPLPPTSARLPANEDLEKLPALP
                     ESRSSSPVMAPRESSPVSPNLPPFGLATAEFVTVVESDNNQLPPLPESGTSSPLRPAL
                     AALTGSELAGAVELGESRTAELTSAATQAVSWELDELPPLPESQTASPVSSKAFRTPT
                     QVSADDGLESLPPLPRSRPLSPVQEAPTPVVEPLMRPATTPEHVEELPAAQGPGFGHD
                     PKNLPPHPESRPSSPTEVELAPNDTVEPLYLLAPAESPIENAASTQEQGLVVDLEGLP
                     PLPESRPSSPIEEETGSREVADLQSAIEEPVSTQNPGLATDLDELPPLPENRPESPAQ
                     RDVPAVENVTSQLAPVASSDERKAEPNLEDLPPLPEPRPGTPEQPPASQAALEEGAST
                     APATTQTDRAPIVEVFRPGFSQESTIQARDFAIMPSQDLPSSQVYQPPLTYEELKEKG
                     FHKRIPSPLPTGSNDKQEDWDPAEKSRSNLLGPAAAAVAAATASGLVVAHMRHDDSTP
                     GPQGLDYDRLQTPGYDKAESVSSFNEDASTVAASEAPTYLSGSTFYDAQHDTGKLEDS
                     PPRPGTLAYLLSKRGQKSQVQEDDWSAVGSSSPSRKGKTRSLLEPEPTIGVQDKRAPG
                     EASDVRSQEGPGQGSSISAVEAAKATGPSEYEPFSGARKRGKKLGSRKEVSWTEPAGE
                     TQQPSHAGESLSEPVTFRSTVEPGMTAGEPKQHPTSEKSVSDPAGFTYRSDARESTPT
                     LGKRGKKKKRDNGPDANLEGPGSADRIPDPVREPHPAATLHEVARGASPPQHVGPREL
                     SGSEGDLPRSCDAVETSPAEPAAEEGPGSRPASSAAADAEAKEQGQRDRGLQEAHAAP
                     AEPAKPKKSLWGPSFSMLPSIAGGVGSLFGRGKRNSAQAQAQTRDAERREVQGQLKAE
                     LPRDTGLPTQENDQKQQYNTAVESMEMPKPPLRPPSVGESNSQIPDVGHATGVHEPPD
                     SDKSGADTASCAPDTAVWIPNEHGPSPEISTPGAVDGVTPSDAARLEAVVVDSADRQR
                     GGPEGEQPDKSAPRSPGQSQTFATSDETQHPTVDDAAVATDAGDQPTEAMGKKGKKQQ
                     QQQRKDAPKDTPKGETTTTTTTPPQESTQKAATPPAPEPPAVHEAGQQDVVPGQHTNP
                     EPTASTEPGSVTAHQAGDDDTSAEASGKKGKKSKSKKKKQAAAEPEADATAAPEPAVA
                     EAAPEPSPSENQAPAESSEVVDSSSPSVEAPQDAAPPEPAHASKKSKKKKKKQAGQDG
                     SEAPAEAAADHQGTLAPVEEPALVVDSPPVENASASASQGDSGSLPPEEVVEPSSTGS
                     KKSKKKKKRGSQSPEETETRESPAQVPSPEAASPTTPADTPGEPDLQAPETTTEPAEA
                     AVESTAAAAEPEVDTPKDSEAEKTVSFNIDEQPTSLGDNTIQEDAPSPIQDASDPSTT
                     GQGKKEKKKKRQSVSFAEPLEEHLGSAKPRGEDDSKNDINNNNNRSRSSSSSNEKTED
                     SKDSISELSTVSPQSGDSVDERPAQPETQIPSAHEPTEPLGSRSPDPSPENEALSNVV
                     GQDAQQSATSDETQADTEVSEEKLPSEESAAVGAETNPPASSPKKSKESKKKRNSLSD
                     PETGPAAMQQQTQPIPGEQGDNAERAPEAAAPEAAAPPEATESTTEPLPSGAASAEPA
                     PITAALAAEQQQHEPLVDREPDLEPIASQLQDNKKDGLSTSRSAVDETQSSVQQDTAA
                     QSSEASGVNIAAPPSPIETSDEAQPGHTVHEQPSSSSDPEPQPDSASQDMAREEDRSP
                     YSLLNKTKRKRKKPKADAEPWPMGSPELPVAQPPEIPPSFESREFDRVFGTQLSTVEE
                     VTEPPSECAESDGRSLMSNDDNRSVQRRRSVVSESSRTISSLGGSETTAGALADDESG
                     EPRAYSLKRAAAKREKKDKTAKKKRKSSVWDEPWPSSEASGAEEFAEPLTEGEGEEKA
                     IDEAQPVPPEGEGEGEGVVDEAQVPPVEGTEEVPPDVVPPEETPVEKEMPREDGSTDD
                     VPPPSDSAVAPESETAAAQEEAAEQLAAEQPEKPPADNDAVPAALTEEQEPALRAETS
                     QPPQEPEAQAEPEVAVGKKSKKGKKKKMASQTLESKPEPESESKPEPEPEPEPAIQAE
                     EAAAAKAEPSPAEDAPAETNTQEPSPISAEQPAEQAEQAAEQPAEQVADEPAVEAPPP
                     TKKSKKDKKKAKKAAKEQIEAEAQPSAEVPVPEETAPVPEEPVPAEESVPAPVEEPAP
                     AEEPQVAQEPAQLEEPLPTNEPVPTEEPHAAEEHAAVPQPEQEATTQPEEETAKPSDA
                     DAQAEAPVQPAAEPEEAPLSRKKSKKDKKKKKGAAVQQDSQPTSEAPVSVAEEPTPFA
                     GEAAAAAEEPAPAAEGPTLAAEESLPTVEEPAPSSAEPTSPSQAEVQELAQEVSEPVV
                     ETAREAQPVDVPTETLDAPAEEASPAQSKKSKKSKKKKKGAAHPEPEPEPAPEAPEAP
                     AREPASPPSAELEPPAKETPEDTAETAQEGSERTAEPPAEAAQETPEPAVETAQEASE
                     PALEPIAGAVQETPEPTVEPAQEPSEPTEGHAVEAAEETSAVGPAQEAPEPTAEGPAE
                     AAQETSPPAAEPAQKDDAQPVVAPVEEAAAEQAPTKKGKKKKKGKGSKNVESGSASGT
                     ATPAVEEPAAVTEPKPTVADPSQENTEHEPAAPKSVQEEPTATSDVVQESTEPQAVVH
                     EPTQEPDVAAVVEVPAQPVEKAQQSPEQSQPEPEPAPKEPPTETVSGVPAGGKKNKKK
                     KKGKGSKSLDNELPSGTATPPAEETTTPAEPTSAEPTTPVEEQPAPTAAPETTSAEEP
                     QQAPEPTQASETVNVDEIPAQIPEEIPPRPQESQPQPESVQEEVAVAEEAQDTPAKGK
                     KSKKKKKGKGAKAAAESEPASPADTTPAQETPAVVEEPSVAAGEPAPATEDSATATVE
                     EPRAAAEEAAPATDEPAPATDEPAPATDEPAPATDEPAPATDEPAPATDEPAPVIEEA
                     AVVVEEHTPVTEESGQGDQPAVPSETEAAPVVEATPPVPEPVRQETRPEEPQEAPASK
                     KSKKKKKGKGSQVLEPQPEPEPAASPAPLEEQPVTVEESAPIAEEATAAITESAAGEP
                     EVPNVPSAPVPDVPSSPVPEVPGEPPPEVPSEPAPEVPSEPTPEPPSDPVTERPASVP
                     EQAPEETSALPTKKSKKDKKKKKGKGPQTPEPEPQADTTSAAPSEEQSPVEEAAPAAE
                     EPVPTAEESTPVAGESAAVLETSAPLVEAPPPIVEEPSSAVQEPEVTVPMSAEEASPV
                     TDASQQQESQLAEGTEPQTKKSKKKKGKKGKGKASEPEAEPVNEPKSEPAAEINPPSS
                     EETVNVAEDAAPAPPSEERVVPTEEKTAPAEGPSAPAAAPEEVVPVSETTQPEAKAED
                     EPVVVGGKNKKTKAKIAALMSIFEPGPAAKPAPTVKPRPALRDSLPSDKPAPADEPVP
                     AEQLPPVVEEPVTAEQPAPVAEGVKPDVQESVAMDTPTPALEGVPAVHTDESSAAIQE
                     QPEAVPEPTSTPEEPKPEPAQQEVPADQETPAPTKKSKKDKKKKGKGTKVPESEPSAP
                     QAPTFAEESTPTEQPTTSQEPETEGPAEPSTEPVAAEKPAPPVVEEPAHAVVEEVKPA
                     EPRLAAQPEPEQAPDVPSKKSKKKKKGKGSKTVEPETSGASTPAVVEESVPVPEEPTP
                     AKLEVETPAEKPAETAELLRPEATEAVPSPDAGETIAASEAAEQSTSTATDEPSFPSE
                     TSRDQQDGGLDLPTKPVESEAASEPVAPPLEEPVVPEEPTIQEPVPEPAPIEETSSEQ
                     PAPVTVEEVAPTPEVSQDVQHEQSSESQTKKKKGKKGKKAAAEPETVSPPAPSSAPEP
                     SPIAVEEPVPAQESPPLESQQPPVDEPTVETSPTVPAEAPAPGSLQSSQPEVVSDIPA
                     KKKKKKKGKTASLEPAPEPVSDPAPPATEEVVAVAEEPPTSTGEDAKPAPEPSQPLDE
                     PTIEQPTSSVPVEEPHSTPEAPPESAAGEEPSQPSNESEAPASEVPVREPPANEEPVE
                     DTTRDAVRTSAEAQTEQVSDQPSKKSKKKKKKGSKASDSEPASGTLTPAQEPEVQEAA
                     PVVEQPASIQETVGTSEEVQTTSGDIEQGPAPAETEPAQAAEPTTLAEDPAPVVPDVN
                     EGTEFQKAVSDSLEATQPETPANESSAVSAKQSKKAKKKKKGKGKDAEPEPEKPSAEQ
                     LSSSVPEPETTEPANTPAADHDAGAPEPILVEEAQGAQDQDTTRDLPENKQPEGQPEV
                     QKEVQPEVQSEVQPEVQLEAQPEVQPEAQPEVQPEVQSEVQPEVQPEVQLEAQPEVQP
                     EAQPEVQPEVQSEVQPEAQPEVQPEVQSEVQPEVQPEVQPGEAHETVSSEAQPQVAQG
                     EPITKSKKDKKKKKGKNKIAEPQPELEPTNPSVPEEPTPEPTDDAIPLEPAVAREELP
                     PADAPETPQEVPSGIPLESQPEEATETAQPDMQPAEVNEPAQADTQPEEAQVSPAKKS
                     KKDKKKKGKNKTAATEPEPQPESEPLSSPPPDALDSPDPNAPASVSVEDTTSAQVEEH
                     IEEPAPDVSGSLEQRAPQEMPQDAAEDAPVAPTKKSKKDKKKKKGKGPESTQPEPEME
                     LAVEPTPETLAEPLPEPAPETAPEPASESTVIPEAEAPLPTTVEDPTVAADKDAAPSA
                     QEPLQQPIAEASHVPQQQQPEQIPEEESQDLLAAPAKKKGKKDKKKNKAAALVSMPEF
                     ETTSQPSTDSSRDVVRDVVPSPEPAPEPEPTSAPEPAVAEPAESQIPVAVESEEVPAS
                     EAQQPAQESSSGVADAQSKELDTAVEQQPQPEEAQDAPIKKGKKGKKGKKNKAAEREP
                     IPEPAPELAAEPTPEPAAELVAEATPETAAESAPEPATEPAAEPTPEPATETAAEPAP
                     EPAAESAPELATEPAAEPTVDATSEPTSQHEPAAEPPLPDSAVEPEQAGTESQELAVS
                     VPAVQEEATQEQTGEAITEPSGVQPQDLGATPAEQPEEALGVSVKKGKKKKKSKNKTA
                     SPESEPDTAPMSGPVSASASEFVPDASPTGDVQEHIKPETDASLAAVAPDQEPTSHEV
                     SQEPTPEGTGTHSGEADSSSVPQQQAEETQDAPVKKGKKDKKKKSKNKVAVPESELEA
                     VAAPAPALESTPEVMAESEPKGTPDQPISGEDAPNPSVSVEENISADGPAQETTTEIL
                     DAQTRDLGSAAEPQPQPEETASVPAKKSKKDKKKKGGKGKATAPEPEPAAEASPIVEA
                     PATETSAPVVPEPETLTLRGVTDEPAVEAATEAAPMPEPESTTEPVVEVITEPGTDTV
                     VEVAAPASEVVIEVPTPTEPAPETVAEAAPESSSEPVVESVAGPPAGPVPEPITEPAT
                     EPVTEPIAEAGQEAQVEPEVAPAKKAKKDNKRKGSKQLLSEPAPEAEALSTCQDEIVE
                     APTEEVEAVQETCIPDAPTEEAIQGESKADDNLSTESAKKSKKGKKKGKQAGLEPETE
                     VPAAEAEPVLDVHEPRDVSLDDEEAVYGGPSREDGETSPIKETELGDVEPGEASSVLP
                     GKKPKKKKKKGKKALEPLMGSEDVAGTAAEEASTAPGPLQDEAAPLAQEAPAQVDEAR
                     GPETVQTEETPETSVQVRKGPAPEGVQTEEAPVEEVEATPAQVESDPVPETVQVEETP
                     VQVEKAPIPEAVQVEEAPGPQEEGQQIKEIPPSSESVQVDDESAPMPEPVQTEEPTAR
                     ELVVEESTPGAADGAAAAEAAKEEEVVEFTGKKSEKDKKKKKKGKKTDSAITSGSETP
                     QSQEEPSIADVGPAAALGTAITAGVALAGDEAPTPKEAAEDDSGLVGRESRKDEKEEE
                     EEEEEEGGSPVATTGDEATPEASWSKQQVQTETEKQAEVAEGGPTATIEETGADMPVD
                     KMPSSRRQTPGVEKVEMQPAVSRAGRSPSLGPATIGLGLITNPPEPYPEDGPSPKLLS
                     GVHQAPFSLDAQLEAAQQADRETGPSREGRRMTHEPPFEYDTKRKKVKTEELEATEIS
                     EPVISAREVEACLGEDKGSGEEVKRDVVVVEEVEDEGGVSALPPGAPLPEGGAPLRPA
                     EKYGDEQERQEGEQGSTGVVVTEQEKQAGEEVLGVEHATMEVDQREQKEMGVEQEEHG
                     EPAEPKAERSTEERADDEEASMVVESLSGPGLGRMDSETIPRSLREPSAAGELYEEEE
                     KKKGKERRERTASPEPTMQRAFSFPDDIADEEVFRTRKMEEEEAEDKKVDEAEAAAAA
                     ADEPVRLPPPSSFAEFMRSQTSLPPVQEELSDSEPRERETEQEQQQGERTKARATTWQ
                     HKRGSLEVPDAPEPQRDSGFSSGSGHLSQPLGGGHEALRDSGVQGRSASPRNSGEREI
                     GDWDGETREVGRRIAGGSSSSPSPSPPTPPPTTTLPTTTMTTMTTTTTMTTMSGQRGS
                     GQRGSGQRGGQRGFGAVVGPDTPTPRLHEPSPPPQTPEPEKLLVSKKRASVASLRSSP
                     TDHNTGQSPRPADPAARRVPSNTSVARLRTPELPASRPDSPGSAIGLASRRGTTPPLQ
                     LRRMDKRASGDLRAVSLSQSQSQSQSQSQSQSQSQRDSRVWVLAAADQHQQQQLQSSP
                     LPTTTAASAAAAAAAASSTTSASRAAAYSTTPVANEGRVRAKDMTDVYDGYGEGRIGS
                     PRSPTRPHSMRRRQSMQVLELEARVEQLLAENRMLAEARAQAESSHSHRTATALAERE
                     AEIESLKRMLKEANEVIDRLKQTNEGLRSSTSAIAVKHREDLRRAEADHAQTARELDS
                     ARASAAQLARAAQEKDAEIARLRAQLDASTAQIRELQQQILDQARPVDDPDFLDPHDI
                     DYFDHRCQQLFAHVQQWVLRFSKFSDMRACRLTSELSDEKLIDRLDNAVLDGSNVDTY
                     LADRVRRRDIFMSVTMAMIWEFVFTRYLFGMDREQRQKLKHLERQLVDVGPPHAVRQW
                     RAVTLTLLSRRPSFKKQRDQDTEAVVQAILDTLSKVLPPPSNLEDQIQSQLRRVVREA
                     VGLAIEMRCQRAEYMMLPPLQPEYDDTGELTETLSFNAALMNEASGTPGQTNEELEAA
                     NATVRIVLFPLVLRKGDDLGKGEDEIVVTPAQVLVATSHTSRRGSPASSAAAGKGVGR
                     MLTPVSDAGGASLEARSLAGDKSPKGSVKGGAGLHSDLSMEGGPGGYL"
     gene            complement(1956843..1957264)
                     /locus_tag="MYCTH_2294977"
                     /db_xref="GeneID:11508172"
     mRNA            complement(1956843..1957264)
                     /locus_tag="MYCTH_2294977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658721.1"
                     /db_xref="GeneID:11508172"
     CDS             complement(1956957..1957175)
                     /locus_tag="MYCTH_2294977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658769.1"
                     /db_xref="GeneID:11508172"
                     /db_xref="JGIDB:Spoth2_2294977"
                     /translation="MFFDTSHNSRRGVLANIYAAFAETATKMWAYARCMTRRPGTAIV
                     IGTCAATTALSNKGRGREEKSRLTLLFT"
     gene            1963415..1968516
                     /locus_tag="MYCTH_2294980"
                     /db_xref="GeneID:11508343"
     mRNA            1963415..1968516
                     /locus_tag="MYCTH_2294980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658722.1"
                     /db_xref="GeneID:11508343"
     CDS             1963700..1968457
                     /locus_tag="MYCTH_2294980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658770.1"
                     /db_xref="GeneID:11508343"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="JGIDB:Spoth2_2294980"
                     /translation="MDHGSPQDEPLSRFGSSSDSLDHLGNSDRHDRDHNHDQSHHSPR
                     STRKQQQLQYSDRLADLRLHYVPDPHSSSADVDAPEHDPQAPDDVVDPADFYRSYQSV
                     QQRGTAERAGSAGNVSSPVKDPMAPAVISSPRQPPSLRSNGNGTTPKHPAVPVSHRNA
                     LRPGQRSISNPVDSRSGNLGTGGTRPAATADGRRGIAGSTPPSVKDLKKKFDQPASQS
                     ASGTRKTIPRASTRDTASTGAIGKSPGAGSGATSQGAPRTWATRDTGRDPGKGSGTRS
                     AQRPKPAAEDQGSGTSQSFASRISRPRPVGSATAKPSKSTAQSAPHRQNGLLFGEILP
                     EQHDSVTPGFGIESARPRTSESSISDPVRRQMRTLSDPDIEPPSPTDWYRAVSPPTAQ
                     QTTDRHASNTPRTQHSRAHSDLAGSKLTLARPDYGAGRPDAEFPISPTSPTSPTSRLP
                     ILARRVNDASSHGSPVSTRSNSPSTFGKHSASSGRTSRQHGPLASRARTPTTSSAPRL
                     SSRTSSSTRKPPPSNLSTTQSSSRLNAYVSIPPPKLSPTLRSSRPRQSVATATTAASR
                     MRAAERGSSPLRQPQRPASRTEDLTSRRPKVSVGAIDFAQRRETIKLAYSKSIRETQA
                     REARQAAAEKRKRELAAVAEAKAEAEAATSTATAAANAAADAAPTPPKTAGGHREATA
                     EQKVPEIELQQAEKGTSSTAQAPTEEFHARPDSLRLEIPGSFPGSGSPLGEPDGVPFS
                     AVSMTSAVTEFDTEVQTDPPRQEIPKSRSTDDDAPEGAAAPSQAETAPQPGTTEQLPE
                     QTVAAPALHRRASYRSPFDDEGDEQDSISIKISLDPSSLTKPQASPEVTPTRATFESQ
                     PETPPAPPPVEEEDDEYVPRPYTFSDNYKTTVTILGPEPDFRPSHKEPPRATTSQTGV
                     SQEDEPPTTSAPDIVVPEASRMGGACFGEPQVEIENLDRIEDFYTGPRLRDNIAALRD
                     PTLASSDPGTPFDARPPSAECRRLSDASHTLAVPGLLAPGNRSSQHSAWTDFSFGSED
                     RDAGHPSSASQLHRAGLHDDGTSFRAVPSTGDLSTCASSVGELVQSPESPALERPGTS
                     SFSTIPELAGGQQRLPEPANAGTFTPLSNGSDTGGVAPLPERDPPRPPPSERGYERDG
                     AFDLAQSRPGSYAYSHEGNLPEPVSSPQSLSQLRLDRDPSRVSVGEAPYDGQIPLTEK
                     EKEEQQRLRQRQLVIRELIDTEDAFVRDMTVVEEIYRGTAEACPNLDSKTVKLIFRNT
                     DEIIAFHTALLAEFKEGAASVYTPKGKRSPQPMPDGKESDPTAANYFSFSANRPEKDD
                     EKDRLTAIGSVFIKNIEQLKAVHEVYLRSSDSSSKRLVQIQEDETVMLWLNECNEVAK
                     ELTSAWNLDSLLIKPMQRITKYPDIITHLLKYTPEDHPDRESLINARAQVIGAIDEIN
                     KTKKNFELVGQIVSNRKRKESDVRTGIARAFGKRVDKLQVSAAAKPAEDSEYQRLQQQ
                     FGDDYLRLQVVLRDVEYYTRNVATYVHEFLQYLSSMELVMRLQPSRDYAHLESKWVQF
                     NVSMRDIEKIALERHVSAVHDSTILYLIFFFIC"
     gene            1975699..>1977645
                     /locus_tag="MYCTH_113912"
                     /db_xref="GeneID:11508095"
     mRNA            join(1975699..1976222,1976387..1976441,1976512..1976591,
                     1976677..1976945,1977022..1977322,1977396..>1977645)
                     /locus_tag="MYCTH_113912"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658723.1"
                     /db_xref="GeneID:11508095"
     CDS             join(1975909..1976222,1976387..1976441,1976512..1976591,
                     1976677..1976945,1977022..1977322,1977396..1977645)
                     /locus_tag="MYCTH_113912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658771.1"
                     /db_xref="GeneID:11508095"
                     /db_xref="JGIDB:Spoth2_113912"
                     /translation="MHQPPYPPSQAQPLPSDMHSRSHQLPYPPPQVPQLPSMPPPNTQ
                     YQDSVPMTGPGALQPGKPGDAPQPPSSQSQERAPLTPEQRRQQELNLKPYSSEDDQGR
                     VYSLDVVQQPQRARMCGFGDKDRRPITPPPCVRLIVRDAKTGKEIDCNEIEHTMYVLN
                     VDLWSEDALKEVNLVRHTTATPSISSTSPASYAQIEQASPAYSHMVPPGRDMAYSQQM
                     AYHPPPGQPVSPYGMQQSYGQGFVSPNGASYQPPNQYYPQADLQGLGQLVTSPYGPPR
                     VYDPQYGGMPQRMSISGNPPSGMFTRNLIGSLAASAFRLQDTQDKIGIWFILQDLSVR
                     TEGCFRLRFSFVNVGAPGSSGNGSINVGKAPVLASVFSDVFQVYSAKKFPGVCESTAL
                     SKCFASQGIKIPIRKDNPNKNSNQDDDDYD"
     gene            1979807..1981014
                     /locus_tag="MYCTH_2294987"
                     /db_xref="GeneID:11508652"
     mRNA            join(1979807..1979987,1980138..1980341,1980515..1981014)
                     /locus_tag="MYCTH_2294987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658724.1"
                     /db_xref="GeneID:11508652"
     CDS             join(1980142..1980341,1980515..1980845)
                     /locus_tag="MYCTH_2294987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658772.1"
                     /db_xref="GeneID:11508652"
                     /db_xref="JGIDB:Spoth2_2294987"
                     /translation="MASHFQSSGRGGAGNIVDSSKSPQLKPEDLQTPTLKTSMVTTGR
                     GGTGNFAAGLDAEEKRRRQDVEPVVRRDSHGAMHIGRGGTGNVVKTGGAEDGAPLARM
                     RSPAPPAADKDKDNKDKEKTATGPPGSTKENGRGDDDDDDDDDKDVAVPAAGSQPASE
                     EIGWAEKGKNFLLGKK"
     gene            complement(1983091..1985217)
                     /locus_tag="MYCTH_2294991"
                     /db_xref="GeneID:11505468"
     mRNA            complement(join(1983091..1983573,1983650..1984046,
                     1984108..1984643,1984712..1984753,1985085..1985217))
                     /locus_tag="MYCTH_2294991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658725.1"
                     /db_xref="GeneID:11505468"
     CDS             complement(join(1983491..1983573,1983650..1984046,
                     1984108..1984643,1984712..1984753,1985085..1985139))
                     /locus_tag="MYCTH_2294991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658773.1"
                     /db_xref="GeneID:11505468"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="JGIDB:Spoth2_2294991"
                     /translation="MADQFPSLKNDLILRAARGEKVERPPIWVMRQAGRYLPEYHEAK
                     GGRDFFECCRDPEVASTLTLQPIDRYDGLLDASIIFSDILVIPQAMGMVVEMVDKKGP
                     HFPNPLRSPDDGQYAELLKRDVDVAKELDYVYKAITLTRKKLQGRVPLFGFCGAPWTL
                     FCYMVEGGGSKIFKETKSWIYKYPEETKALLQKISKLCVEYLALQVKAGAQLIQVFDS
                     WAGELSPSSFKKFSQPYLEYIARHLPSRLKEMGLERVPMVVFPKGAWYALDAACDMGY
                     DIVGLDWLHDPAQAVKTVGDRPIVLQGNADPGVLYGSHAAITEAVKEMVEGFDWANRR
                     KGWIVNLGHGITPFVNPDDLRFFLEEIHRLTKTEGQ"
     gene            1985382..1988004
                     /locus_tag="MYCTH_2294994"
                     /db_xref="GeneID:11513373"
     mRNA            1985382..1988004
                     /locus_tag="MYCTH_2294994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658726.1"
                     /db_xref="GeneID:11513373"
     CDS             1985578..1987767
                     /locus_tag="MYCTH_2294994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658774.1"
                     /db_xref="GeneID:11513373"
                     /db_xref="JGIDB:Spoth2_2294994"
                     /translation="MTPPASQCRRALQRQIVPSKDSVWITDGLLASAFERYCRVSRTW
                     NRKASNVPGPLESQRRLGRRRMGDASTWHCPPTPPSWAFLVPLNLTEWTWKPPTLASA
                     RENNRPRHESPAPASASASARVDPASLLPQWLRGPVPRQLAESAVDSTSAELSDPSQS
                     SSIVSPRPAPYAALLGGFRWAAAHADDDRLASYTGKLCSQLRQRIMLGELPPDDISLL
                     AKEMWDTLDSRLQGSALGHRLSLSFCRAIVSGLTSSKVFSPALMDAQFWNALLFQIAK
                     LPASDTLCNLFVKVMTAMPASHRPRVSQGVLAVLGCLFSAWNRATAAVGGCDTRRLLD
                     IGILPELYEKQRKISALPPCLRQAITISDVLQGATPDETKQLLSAAHRVVLREAAAWK
                     MQNDGRALRYSWLYMLARNPHVNQDFLFDAAASLCGESLKHVQPLSVVEVSSLLLTQW
                     ASRGYLRAPKDVYRAYRRHRGKRDEAALAALFLAIFSRGDGETRKGLYLSAWKLLAKL
                     RQKDYVIQSLTFDALTGKLPVRMLEDLACTSGDHIMAIRLRDLWSNHVVTDDRQPQWY
                     PGVFDRYAEDIVRDPRIPAKEIWRVLDIGKLERQGVTTKQRMLRHRGTFGERRAVVVE
                     KASRAFMNAPHLSNRAALRHVSRSFAFLKAVRGKVPDFIIQDLYRLVTKDLWENKPGR
                     TKRLLWFLRIIERRHGLEFAWSCRLALRRWRARLMQKLVSHRGGRPF"
     gene            <1991652..>1994750
                     /locus_tag="MYCTH_98955"
                     /db_xref="GeneID:11508633"
     mRNA            join(<1991652..1992470,1992527..1993051,1993265..1994578,
                     1994652..>1994750)
                     /locus_tag="MYCTH_98955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658727.1"
                     /db_xref="GeneID:11508633"
     CDS             join(1991652..1992470,1992527..1993051,1993265..1994578,
                     1994652..1994750)
                     /locus_tag="MYCTH_98955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658775.1"
                     /db_xref="GeneID:11508633"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_98955"
                     /translation="MNAHCWFHPAHSTALRRDQGAHGTTPSQHTVSMVQHPGGVRSPE
                     VIYSASSELQRHSLATAVTSAHTTSPIPVMSGGGEAGRSDGQTSEPNHDEEDVGGLGL
                     SSIIAPASQKPIRRRMRMITSCLECRRRKLKCAKTHPCLNCKKFQRECVYLGPNLDEA
                     SQQRLTEIKEKVGCLERQLERDVAKGATARRNGNNSIKGPDLHNERFVADDVDDDLSE
                     ERDLQITPMVTLDLTYDDCSDGNGTDDLIDLGVRVGKMRITERIGGLNRPRISEEIQA
                     GISGTQSSFYGAPGSFASDEPQDPAELPDFLKPGESYLAPSSGFMFGQFTESPALLEL
                     LPPRELGHRLMRRYFEAVHPIARCVHRPSLEAIYASFWNDVGHYIEPRASVQAIVFAA
                     WFNAAVSADDTFCRDYKCTRAQLVQHMKIATETALSKAGLLSTTRFETLQGFVMYLLC
                     FLDIRTCEAQGPKPAIRREDYDTKMPVNCDEDQLTLHSTAWPEPAEAWTPVLLSIMRF
                     EINEMMRNIWTDRRKLEIGKTTLMAMITRVENFRKRMLEKYSRMLDDKVPDQKYAKLV
                     VELLLFRLHVMVLHPFHSNTANPLPPKLDGLLVTSGILIIEIAIRLESNPMFRGWAWY
                     LGAYQQYQIALLLATEIYYRPNRREAERIWPCLDWVFRLDPNAPRQQKIIQILTEIAS
                     KTSVYMSLRKVRAPMSINRAVPGKQAVKESPPSQLAEPLPPPSQSKKLSFHQPDAGVI
                     SDLKAEYATCAPPLPSAGAPVTPSLPGTADLLATPFLPPSSSSMGIMIPPQQQQQQQQ
                     EYPQYQHHHQQQQQVKLPPQTHMVFAGVTNGEALWSLPPQLNGSGSPEIGSDGGSIAG
                     QPQLHGTMAAPTSGLPQPPPIMNMIQELDWEALHQMFPMDPQTGELSFATFVDSGTGS
                     TGQW"
     gene            complement(1995261..1997305)
                     /locus_tag="MYCTH_2294996"
                     /db_xref="GeneID:11513024"
     mRNA            complement(1995261..1997305)
                     /locus_tag="MYCTH_2294996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658728.1"
                     /db_xref="GeneID:11513024"
     CDS             complement(1995348..1997099)
                     /locus_tag="MYCTH_2294996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658776.1"
                     /db_xref="GeneID:11513024"
                     /db_xref="JGIDB:Spoth2_2294996"
                     /translation="MAANLVSPGHVASGSDQQPFNLGVYYQKQYRAAFRAALEAGEVR
                     PLVIPWSFVGSFFLPLLYLSIPHVNRPWLYHMRWLVAAAVIYLNVRLLQTTSAINEAV
                     AYATGLLAAWGTINALRLLIFTRPQWDAARVERRPRRPGVGLKEGMEKQTAMVSPDES
                     VGTSLAHSEYFWQPFPATGSLLARLGWTADLITAFRGAGWNCSISSIPHPPFPPKKAL
                     EGEPVRLDLVPLASRTGTARSSTYASFLRSRLLEFSLSYLTIDLLTTTIRRDPYFVLG
                     PDYRLHSYPLPAFYSRLPFPQLTISFLLRSLPALAGIIAGLHLYYSFLQLTIVFPLRS
                     LFGVRAELWQHPSLFGGFVPSVLDRGLAGFWGGWWHQTFRAGFVAPARWLLRQHGRVH
                     HHHHHHHHHHRHHNQSHTSIRENKTARMLLKSFLAFTLSGLVHSAGGHTSVPETTRFW
                     TPIVFFVLQPVGIILQAAAASLAKRLASSVLARSEATAAAGHGAPKKRIPRWLCRTAN
                     LLFTTLWLHLTAWGLIDDMSRAGVWLFEPVPVSPFRMMGFGAPGNTDWWRWDGVGYGL
                     GWYTVRGGRWWESGVTL"
     gene            complement(1997306..2000339)
                     /locus_tag="MYCTH_2294998"
                     /db_xref="GeneID:11513025"
     mRNA            complement(join(1997306..1999889,1999987..2000339))
                     /locus_tag="MYCTH_2294998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658729.1"
                     /db_xref="GeneID:11513025"
     CDS             complement(join(1997512..1999889,1999987..2000071))
                     /locus_tag="MYCTH_2294998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658777.1"
                     /db_xref="GeneID:11513025"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR005303"
                     /db_xref="JGIDB:Spoth2_2294998"
                     /translation="MAGLDGQANAGYNARIESFRDDEYPMLNGSIYLDHAGTTLYPKS
                     LMEDFARVMTSALLGNPHSASASSQLSTARIEDIRLRVLRFFNADPAAFDLVFVANAT
                     AGIKLVAEALRAAPCGFNYAYHQASHTSLVGVREEAHDSVCLDDDKVDKWLSGDCPFG
                     NDRDDRPVLFAYPAQSNMNGQRYPLSWAARVRCAGRKTYTLLDAAALVCSAPLDLSQA
                     DTAPDFTVLSFYKIFGFPDLGALIVRREAEEAFNSRKYFGGGTVDMVVCLKEQWHAPK
                     TQFLHERLEDGTLPIHNIIALDPALDVHKRLFGSMRDVASHTSFLAKRLYRGLRSLRH
                     GNGKPVCVLYSCDPESVGDGLGSGPVIAFNIRDGLGSWVSLAEVEKLASLKGFHIRTG
                     GVCNPGGIASALGLEPWEMKQNFSSGFRCGTDNDIMAGNPTGIIRASLGAMSTIADVD
                     SFVAFVAEFYRDTSPILAPPQLETLPSGTRLQIHSITIYPIKSCGGFRIPPGVEWEVR
                     PEGLAWDREWCLVHQGTGQALNQKRHPKMALIRPSLDFEKGQLRVIYAGHTSSHVSRE
                     VSIPLSKIPSLFSASFSSSRLPRVCGEEIQAQTYSSPIINRFFSDLLEVPCLLARFPA
                     GGQGKSMRHSKAHLQKHQLEQPPPTTGPGLPGSFPPSPPDSDVEKAVSRRILLSNESP
                     ILAITLPSVDALNREIQAAKPGTKEISAAVFRANIVIAPAAPDTSITPYAEDSWSGVK
                     IGQQQLMFEMLGACRRCHMVCINQETAEKSEEPFVTLSKTRRFDGKVFFGVHMCYSEG
                     QGRKSPMVRVGDVVVPEWRREE"
     gene            2000592..2002929
                     /locus_tag="MYCTH_2294999"
                     /db_xref="GeneID:11513359"
     mRNA            join(2000592..2000749,2000813..2001013,2001066..2002929)
                     /locus_tag="MYCTH_2294999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658730.1"
                     /db_xref="GeneID:11513359"
     CDS             join(2000701..2000749,2000813..2001013,2001066..2002762)
                     /locus_tag="MYCTH_2294999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658778.1"
                     /db_xref="GeneID:11513359"
                     /db_xref="JGIDB:Spoth2_2294999"
                     /translation="MATTTLGKRTRSSKQEEPPLSLDYSSKRPRRTPRKLSGKEDTSI
                     LDKENQENEQPESGSQGDAEPTPTKCHSRRDSVVSGTRSSHVGPVTPSTPRHYDVYAR
                     STTTPRHRVMSVGRLSRRMTPQTPLTPSTIQTVYHQARQLFSRSADPGQLIGRDDERA
                     QLHKFLERCTSSRPGGCLYVSGPPGTGKSAMVNRITEEVASSSETIRKACINCMSIKS
                     SKDLYIALLDQLCGDGDMAENDVAESLQKLFFNKKGTDVFLVVLDEVDHILTLDSQSL
                     YRMFEWSLQPTSRLTMVGIANALDLTDRFLPRLKSRNLKPELLPFLPYTAPQIKRIIT
                     ERLRTLAPEGSAADFIPFFHPAAIELCSRKVSSQTGDLRRAFEICRRALDLVESETRL
                     KHENEIKDQLLQQSPSRKILGENRNLASGVQSPGAQQLQRSLQHLTATTAPRVTIAHL
                     NKVTAAAFSNGPSQRLKTLNLQQKAALCSLMAIEKRNRSAQAAAAAVQTPSSATPTTP
                     SSRTRPVATAPTVKTLYDSYCTLCRQDSLLHPLSSSEFREVISSLETLSLITPVDGKT
                     GSFVGLQGGSVVGATTPGTPKRTRRKKDVFFGGFGGTGIGGGGLTADEQRVASCVGER
                     EMEAAVEGLGAGILRGILSGEALD"
     gene            complement(2003400..2005611)
                     /locus_tag="MYCTH_76126"
                     /db_xref="GeneID:11513340"
     mRNA            complement(join(2003400..2004672,2004734..2005611))
                     /locus_tag="MYCTH_76126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658731.1"
                     /db_xref="GeneID:11513340"
     CDS             complement(join(2003618..2004672,2004734..2005430))
                     /locus_tag="MYCTH_76126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658779.1"
                     /db_xref="GeneID:11513340"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Spoth2_76126"
                     /translation="MRRFATRAASASATTGRLAQLSSSPPRSAFLASSLRMASSGKSA
                     SATAVRRLHATAQHLRPAAAPVGLASTATNYPTTHDKIAEVQDTPYFIDNKFLQSKTT
                     EFIDLHDPATNNLVTRVPQNTDEELKAAVASAQKAFETWRTTSVLHRQQIMFRFVSLI
                     RENWDRLAASITLEQGKTFADAKGDVLRGLQVAEAACGAPELLKGEVLEVAKDMETRT
                     YREPLGVVAAICPFNFPAMIPLWCIPIATVTGNTLILKPSERDPGAAMILAELCQKAG
                     FPDGVVNIVHGAHRTVNFILDEPAIKAISFVGGNKAGEYIYARGSANGKRVQANLGAK
                     NHAAVLPDCNKNHFLNAVVGAAFGAAGQRCMALSTLVMVGETKEWLPELAERAKALSV
                     NGGFEEGADLGPVITPQSKARIESLIASAEEEGATILLDGRGYKPPKYPNGNWVAPTI
                     ITNVTPQMKCYREEIFGPVLVCLNVDTLDEAIDLINANEYGNGVAIFTRSGPTAESFR
                     RRIEAGQVGINVPIPVPLPMFSFTGNKKSVAGGGASTFYGRPGVNFYTQLKTVTTLWS
                     GSDAISKKADVAMPTHS"
     gene            complement(2005866..2008480)
                     /locus_tag="MYCTH_2295005"
                     /db_xref="GeneID:11505526"
     mRNA            complement(join(2005866..2006707,2006772..2007556,
                     2007616..2007898,2008021..2008480))
                     /locus_tag="MYCTH_2295005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658732.1"
                     /db_xref="GeneID:11505526"
     CDS             complement(join(2006204..2006707,2006772..2007556,
                     2007616..2007898,2008021..2008167))
                     /locus_tag="MYCTH_2295005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658780.1"
                     /db_xref="GeneID:11505526"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="JGIDB:Spoth2_2295005"
                     /translation="MKFNVAAAAASAAFLVGGVSADDQKVLKDETSSVAESATKSAPE
                     VPTFTPTKLKAPFLEQFTDDWEERWKPSHAKKDTKGSEEEWAYVGEWAVEEPVVYKGM
                     EGDKGLVVKNAAAHHAISAKFPKKIDPKGKTLVVQYEVKLQGGLECGGAYLKLLRDTK
                     ALHQDEFSNATPYVIMFGPDKCGHTNKVHFIFNHKNPKTGEYEEKHLSGAPPAKIVKT
                     SELYTLIVHPNNTFIIQQNGEKVKEGSLLEDFSPAVNPPKEIDDPKDKKPDDWVDEAR
                     IPDPDAKKPDDWDEDAPYEIVDEDATQPEDWLVDEPLTIPDPEAQKPEDWDDEEDGDW
                     IAPTIPNPKCAEVSGCGPWTKPMKKNPAYKGKWTPPYIDNPAYKGPWAPRKIKNPDYF
                     EDKHPANFEPMGAIGFEIWTMQNNILFDNIYVGHSVEDAKKFAEETFFKKHPVEKALE
                     EADKPKVEDKPKSPSDLKFLDDPKTYIKEKLDLFLTIAKKDPLEAIKFVPEVAGGLAA
                     VFVTALALIFGLIGLGSSTAPAAKKVAADAKEKGKEAKDKAASATATGADNAKEATKR
                     TTRSQS"
     gene            2009352..2010651
                     /locus_tag="MYCTH_2295009"
                     /db_xref="GeneID:11512877"
     mRNA            join(2009352..2009704,2009797..2010327,2010399..2010651)
                     /locus_tag="MYCTH_2295009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658733.1"
                     /db_xref="GeneID:11512877"
     CDS             join(2009550..2009704,2009797..2010327,2010399..2010492)
                     /locus_tag="MYCTH_2295009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658781.1"
                     /db_xref="GeneID:11512877"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="JGIDB:Spoth2_2295009"
                     /translation="MTPPSTGGQAAENNDHLVQSDNPDHPANLIPSLCAKFWTLGWVT
                     GTGGGASIRDSDLVYIAPSGVQKELMKPSDIYVLSLAAQAQSLDRRNRVYLRSPPNYK
                     PSQCTPLFLAAFTKRRAGCCIHTHSHWAVLVTLLLEKEGPGKDREFRINNIEQIKGFG
                     RGFEKTGNLGYHDTLVVPVIENTAHEEDLTEFLEEAMDKYPDTYAVLVRRHGVYVWGE
                     NVHKAKTQCESLDYLFQLAVEMKRLDLPWITEIEPVKPRRP"
     gene            complement(<2010748..2011753)
                     /locus_tag="MYCTH_2141513"
                     /db_xref="GeneID:11505980"
     mRNA            complement(join(<2010748..2011146,2011277..2011753))
                     /locus_tag="MYCTH_2141513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658734.1"
                     /db_xref="GeneID:11505980"
     CDS             complement(join(2010748..2011146,2011277..2011498))
                     /locus_tag="MYCTH_2141513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658782.1"
                     /db_xref="GeneID:11505980"
                     /db_xref="JGIDB:Spoth2_2141513"
                     /translation="MRVASILLAAGLAAFVNAQSTTSGGNAPSTTQDAAQAAASSAQA
                     EVLRCLEACKAGDVDCQSHCITVPSPNDAQVNATNTCVAACPQGKGSEADTEAYRQCV
                     GRCIGENYYTSSAGTPRPTGSTGGGSSSGNGNSGSDNDNDNDNDNDNGGDNDSDSNSP
                     SGTSGNGASRTSTGSAAATSSGAAAMIGASSGVIGAVGFMAAVLAL"
     gene            complement(2014040..2015158)
                     /locus_tag="MYCTH_2295015"
                     /db_xref="GeneID:11508050"
     mRNA            complement(join(2014040..2014780,2014856..2015158))
                     /locus_tag="MYCTH_2295015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658735.1"
                     /db_xref="GeneID:11508050"
     CDS             complement(join(2014240..2014780,2014856..2014980))
                     /locus_tag="MYCTH_2295015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658783.1"
                     /db_xref="GeneID:11508050"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="JGIDB:Spoth2_2295015"
                     /translation="MDIDDILREVDPTSHTVPQEKRDLQELTRAWIAERSAPELLPWP
                     ADGLFERINDNIKRQIEKVEEMTGDMDPKTNFALIVIQTELERYRYLVRSYLRARIAK
                     IDRHTLHYLSTDDLRARLSEMELAYATRHQALLHNHYLSSFLSSFPPNLQNLNDASAG
                     ISMIETPDLESAVFIRVLKNTLVQGRGVDTDEAVDAEESDIMILRWADAKPLVEAGSA
                     ELV"
     gene            complement(2017968..2018313)
                     /locus_tag="MYCTH_2295017"
                     /db_xref="GeneID:11505685"
     mRNA            complement(2017968..2018313)
                     /locus_tag="MYCTH_2295017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658736.1"
                     /db_xref="GeneID:11505685"
     CDS             complement(2018011..2018301)
                     /locus_tag="MYCTH_2295017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658784.1"
                     /db_xref="GeneID:11505685"
                     /db_xref="JGIDB:Spoth2_2295017"
                     /translation="MGGGGKGPETYTENGRTWVNEIMTWSSRREGLVIQRAPPRLRSY
                     KLRLARQRQSRSVTTPPPSLPGPRNSMSLLTSLRQEEPPPEAEYMFSPKHRH"
     gene            complement(2018749..2021694)
                     /locus_tag="MYCTH_2295019"
                     /db_xref="GeneID:11505430"
     mRNA            complement(join(2018749..2020982,2021045..2021694))
                     /locus_tag="MYCTH_2295019"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658737.1"
                     /db_xref="GeneID:11505430"
     CDS             complement(join(2018964..2020982,2021045..2021554))
                     /locus_tag="MYCTH_2295019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658785.1"
                     /db_xref="GeneID:11505430"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="JGIDB:Spoth2_2295019"
                     /translation="MGFSKKPTDNRTADSTPASASAPEDPSSNSSGSFFSRLTLPLRP
                     RTRYIADFHIRPAEPHRNYGAGDQVKGAVVLTVVKPVRITHLVVSLHGYMRVYKGPNV
                     PANEPIIDPAEPLSTSSRGSRQKHHGHGYVRLFQDEQTLSGDGRLDPGKYEFHFNLLF
                     PSSGLPSSIDFERGTISYMITATLTRPTSIGSKTSPKTSCERKVYLVEQLDIGNLAPP
                     RPRTIYLEPISKRSKRKRQPVVGEKCSAPPEPPAPVSDPDSARANENSTEGSLSVIGD
                     DLEQDATSNSTNPRNLQSDVRSVSSESAVSGCTAQSRTGETNTFVPTAPPMAGKKGPT
                     VKERTITATIELPKGGCLRGDVVPIKIFVQHIRRITSLHGVIVTLYRLGRIDSSPPSL
                     SKDLPEGKARRLEKEDYYPRSKTGLGGLSLTSAGSCSVFRKDLSQAFAPLIIDPDTLT
                     ASLTASVRVPEDVFPTIKGAPYDMISFKYHVEVIVDLGGKLASQLHAIKGSGTRMSPV
                     AGPLGVGGNPYEGTHAAMTTWGTNIIDTDSLRRQKGVICVVFEVVVGTADSSRLRAKA
                     PMKPAPSVHSVSVQEAEVHDRDTHGKQPSPADAGLDSSYPPEDRAQDYVPSPHAPPHQ
                     PYPYWDAVSPQPPPVTPYIPPPDIPDEASLTEKERIRLAEQRLLPSQPPEASVASSST
                     SHFVHGENIYDADDQFPTPMEGPSHASHATTTPNLTQQHLFGAPSAPTLEDLSPAPEG
                     AHATEDKQELERRRLLAEASAPPEFPEDYDIGGSGGGGAAAGPSAPSAPDLQPSAPIL
                     EDEDSYGPHYAYGSAAAAAAAETAPAPIHGHVAQPEEPLPKYER"
     gene            2022860..2025385
                     /locus_tag="MYCTH_2295020"
                     /db_xref="GeneID:11513026"
     mRNA            join(2022860..2023854,2023994..2025385)
                     /locus_tag="MYCTH_2295020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658738.1"
                     /db_xref="GeneID:11513026"
     CDS             join(2022989..2023854,2023994..2025242)
                     /locus_tag="MYCTH_2295020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658786.1"
                     /db_xref="GeneID:11513026"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2295020"
                     /translation="MRDITELPHDLFLLVIWYLPPQTCICCRAVSRRWHAAFTSPDIA
                     LLLLRWNFPRCRELRLAAAAAAPLSTLSASVPRNLRAELANVAEQPRNWSSTFAEVAR
                     RYFHLNKGRPRVVEKLELAQSSRENGSAFSFRCVAPWNRFLRLNDKVCNFHYPDPVWW
                     YSQEDGLLVYPAAIDAVPEDWDGYIYHLVDLATAYRFHVPFDTRSKHIRRVRLAHGVL
                     IFEWAEALPYHQLNDREVVHRHFVTAFDVIREPSRTASGAPWTVKFRSEWKLHFLGLP
                     LNQSDRFFSTHTDTHYAVYFWQPNRSLYQDDPIEQLAVWDISSPSPYRPSEDPKGDKR
                     PVANRTPSLPTGLWNGHHSAGTSSIYGLTDSSVDMKPSRRASLAEATAGPQVIRRMAW
                     RELDFYGLRQRATPRLRSLALDSQSVYVIEEEHRWAAGQHSSLTPPRVHLVRSTGIPV
                     IPAPTPSAQKPYPIAARSTSDLNAAAGQDNLEPSTLDNIIGGPVHGPIWVDSCGANGD
                     VNMNFCWRVADANGTDRPRATSGGAWLRPTSDHGQEDPSDQLHPRAIENPVGWPWSLG
                     ETVSSKPTFASESNRWPGWAPCWRHEDFPYLTVTEMVDFAAGVRVAARRCFMLETLSA
                     HVKPTVTFEATGPSATDQGNGDAGSATRRSSSGGAVPARSNEVYFPDHMWSELVAKGH
                     IAGDERWIVGEDEQGRITVVRF"
     gene            complement(2027081..2029520)
                     /locus_tag="MYCTH_2295025"
                     /db_xref="GeneID:11512976"
     mRNA            complement(join(2027081..2027685,2027754..2028788,
                     2028851..2029520))
                     /locus_tag="MYCTH_2295025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658739.1"
                     /db_xref="GeneID:11512976"
     CDS             complement(join(2027384..2027685,2027754..2028788,
                     2028851..2029187))
                     /locus_tag="MYCTH_2295025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658787.1"
                     /db_xref="GeneID:11512976"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR012941"
                     /db_xref="JGIDB:Spoth2_2295025"
                     /translation="MRLADPLLQRGVRVYDIAFWRSTADEPLHRLGREIHYPPVIDVL
                     DPYLLLVHQGMVESLFIEDLKKRGVEVRRNTAFDSYSVCENKAGPLQVNCRTNVTQER
                     RSLLTQYLVGCDGAHSKVRKSIPEAKPVGLSQPMVWGVLDGELVTDFPDIWSKTLVYS
                     QEHGSILIIPRERNMTRFYIELKTSPRADKSQFGQEFVMQRAKEIMAPFEVGWKYIEW
                     FGRYQIGQRVASRFCDSHRRAFLAGDASHTHSPKSAQGMNTSMHDAWNLCWKLNLAVR
                     GLAKPALLESYEQERRKIALDLVNFDYEHANQIAGGDAVALAENFRTNVRFISGIGAE
                     YGENAINMPASQSWVMGEAKPGCLLPPAKVTRYLDSNPVDIQLDIPMLGQFRVYLFMW
                     DVHQSRIFLETFCQAIASSKSLISQLSAAASISYAKQPRAPAPEDIYLRPERYTAVSH
                     LFTFALITTMPKADIEITDLPPLLQDSRWTFYLDNVPELDTRGSLCTNKWLGSLGPGE
                     VAIVNVRPDGYVGSIGRWDSSIDESGEEAAQWMDDYYSRFLQVPASVQV"
     gene            complement(<2032697..>2035196)
                     /locus_tag="MYCTH_43573"
                     /db_xref="GeneID:11513371"
     mRNA            complement(join(<2032697..2033974,2034048..>2035196))
                     /locus_tag="MYCTH_43573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658740.1"
                     /db_xref="GeneID:11513371"
     CDS             complement(join(2032697..2033974,2034048..2035196))
                     /locus_tag="MYCTH_43573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658788.1"
                     /db_xref="GeneID:11513371"
                     /db_xref="InterPro:IPR007342"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="JGIDB:Spoth2_43573"
                     /translation="MATARALSRAVAPALSPKHLLRQRLLTSRRFTTSQTRPHQDALK
                     SILKISPEVTAALAANRPVVALESTIYTHGALSDDLNLEAIVRSHGAVPAVCGILAGV
                     PTVGLSRAEVETMVREGAKKASRRDLAFLNARGGILGEKGGPHGGTTISGTMVLARLA
                     GIRVFGTGGLGGVHRGGESSMDISADLTELGRTRVAVVSSGCKGFLDIPRTLEYLETQ
                     GVLVSTFADGKTGGVDFPAFWARDSGVPSPSTVSDEREAAAVILAQERLGIESGLLFA
                     NPIPEEFAIPRKEMEEAIETAVREADEKGFTGNANTPYVLGRIRELTRGRSVPANKAL
                     VQANVARAAKIAVELAKLMDGSPVTPVIKTSSSPATREQGNVAAAHKPEPVDVLVAGS
                     VALDLSCDYVGGSGAAGGSSKAVSPALHTSNPSTISQSVGGVGHNVALAAHRVISGEA
                     KVRLYSMVGDDIAGSTILSTLQGSGLDTSCVRRLGREQHPSARTAQYVAVNDADKNLV
                     MAMADMDIFSAHSYPDDWSATVAAAKPKWLVVDANWSEAGIRAWLRAGADHKARIAFE
                     PVSAAKSRRLFAPVPSSQKAAAPSVSGSASPPQRPLGVYPHASVDLCTPNQYELLAMY
                     EAARQNGYLEHDQPWFEVLDAFGIVRGARDRFVDIASADIADAGIPVQSVNLLPYIPT
                     IVTKLGARGALLTAVLGRDDPRLRDPAHARFVVSRCLNDHPHVGGVYMRLFPAAERVS
                     DPASVNGIGDTFAGVLVAGLAMGGRLEEGLVDVAQRAAVMTLRSRESVSEEVARLRGD
                     LRRAVEASLR"
     gene            2036772..2037914
                     /locus_tag="MYCTH_2295033"
                     /db_xref="GeneID:11513028"
     mRNA            join(2036772..2037151,2037276..2037914)
                     /locus_tag="MYCTH_2295033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658741.1"
                     /db_xref="GeneID:11513028"
     CDS             join(2036825..2037151,2037276..2037572)
                     /locus_tag="MYCTH_2295033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658789.1"
                     /db_xref="GeneID:11513028"
                     /db_xref="JGIDB:Spoth2_2295033"
                     /translation="MTTFFPHTIDFIEVALDVSANGRLQLPPYPEDSRSMIYNISIFM
                     SSYETGRNFTITNGTASANNASLGDIMFQEPGSTVKHVKWTWPDCLVGDGGEEQGLGD
                     TDRGVYNISIRQSFRLNGEDHYTVFDLPISVTNSIPASDERPSCDALDNPLLDPEQIL
                     ESADASVPVMFAPGDATSVETTANGAASRKGGIAWLGLAGLVGALVI"
     gene            2038007..2040168
                     /locus_tag="MYCTH_2295034"
                     /db_xref="GeneID:11506087"
     mRNA            2038007..2040168
                     /locus_tag="MYCTH_2295034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658742.1"
                     /db_xref="GeneID:11506087"
     CDS             2038104..2040044
                     /locus_tag="MYCTH_2295034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658790.1"
                     /db_xref="GeneID:11506087"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2295034"
                     /translation="MSRRRQNQQDELFSDEGSFANFDDEVLSSSDDDDDDDDEDDLAQ
                     KRRAALLDKDSDEEELERFVLGSKETFRQQLFRDDFLPAVTDAKALVKTAAEDEDATG
                     HEHVSDSMLFTLDTGADSDDGLEVAPPAAAQQAPQAEEGEEAPAWVDSDDERLTVSLA
                     GATRLRKLRTTEAEDIVSGTEYAKRLRQQYLRLYPLPEWAKDATAGPKRRRRRSSAGS
                     DSLSDYSDMEVDSDGESIEAPLPLDAFLRDANSFAAPTSSRDGSSRKRRKLRPETIDI
                     QRTRDIPDAHKAAVSSLAFHPRRPILLSSSTSSVMYLHHIDPSAHPTPNPALTSVQVK
                     RTDLRRAAFVGPDGDEVVFAGRRRYFHSWNLASGVVNKVSKIQGHQKEHRTMERFRAS
                     PCGRYLALAASDKKGGGMLNIVSVATMQWVAQARVDGRGGVADFAWWSDGQGLTIAGK
                     DGQVTEWSMATRRTVGIWRDEGSIGGTVLALGGRNGPAEIGGDRWVAVGSNSGVLNIY
                     DRNELVVKHKSSSSSSTTGAGTGPAANNKQQQQQQQQQGTGPAVEIKKLPEPARTFEQ
                     LTTSISVVAFAPDGQLLAFGSYHKKDALRLVHLPSCTVYRNWPTDQTPLGRITAVAFS
                     PASDLLAVGNDVGKIRLWEIRG"
     gene            complement(<2040294..>2040751)
                     /locus_tag="MYCTH_2114467"
                     /db_xref="GeneID:11512809"
     mRNA            complement(join(<2040294..2040479,2040611..>2040751))
                     /locus_tag="MYCTH_2114467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658743.1"
                     /db_xref="GeneID:11512809"
     CDS             complement(join(2040294..2040479,2040611..2040751))
                     /locus_tag="MYCTH_2114467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658791.1"
                     /db_xref="GeneID:11512809"
                     /db_xref="JGIDB:Spoth2_2114467"
                     /translation="MGRKKKSRVIVQEFDDYFGTGTLQDWQRLCRDVGLSGDLPSISQ
                     CRKALKTVHVNIHDLLEAVKHGKQPQRFPNVQKLVHYTMRTGRFFPKDKVKEMGPVKA
                     LMRRIL"
     gene            2043404..2048376
                     /locus_tag="MYCTH_2295037"
                     /db_xref="GeneID:11505538"
     mRNA            2043404..2048376
                     /locus_tag="MYCTH_2295037"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658744.1"
                     /db_xref="GeneID:11505538"
     CDS             2043756..2048267
                     /locus_tag="MYCTH_2295037"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658792.1"
                     /db_xref="GeneID:11505538"
                     /db_xref="JGIDB:Spoth2_2295037"
                     /translation="MGDAFPRLEPAHADRHMDMERERALLSPVFEEQSGPPTAPAPAL
                     VVHVDIRFTDPVIRSRYCRNYGSSPGFQATNKICRGLVRRIERCSEELITRKDSGALD
                     LFKGDTYERKPQRFEMTFRVVRRGKGEWAERTYRSYQKQPLTVAHTREVTLAVHRMIG
                     LFLRRHDKDFRWLDSPVPEADSDQSESASSSFGDGSLSLLSVPASRFIEATQTFESLP
                     GYSIDLCFRSRNPQRQVPTFERRTKVTSTQTTPLTLLMSEDLLWRVLQFANQGLDAKR
                     RELDDYLQGCRLPDHDHAHPEDETVELSIRVVNRLGPAHDPVQKSIRGKFALFRHPEA
                     RDCETFFCELERHLSRVRDEADATLNGLNDFELRIVELKGVGWTLREPAKFTVGPEAS
                     YGRRTIRAALDRIQTGVGDVIRGHNIAIHIAAHKRGHLVLDKAIVAHEKRGRPKETFA
                     SHEDAQEAFVTRLRARIQKDIDKVFEDSCSIDDIPEDEDDYFSARPITPQQPESAVFD
                     GPSPRCSPSSVRSSPAKRPALANLQVSPRPRAQRVFSLSRRSTESVRSIDYLTTARDG
                     SVHGSSRPSSVASEHVPPPHEPGQPESPLPDTRGLLLAAAEIKPTRAFSLVSRRSSVG
                     TRVSSASTLAEDHQTVGAKGSGHQTVTETTLEQQLPEQLPDRGQAVESMTSSDDGPSL
                     GPSPLGISFGEATPVASSATAPADQQADARSTESKHAPPVSSPGTFVDAQENVGSSMP
                     GKDIKSNLAGAPTGLPRSRVDDDFSTAPSTPELSTGSSSPRQSLPITPGDKDAVLRHV
                     YPESEPEGGVVQLHPETVPEPDCKEDGNRPAEDESPDCQQASPQLAAGQSLTAEEPGH
                     APGDASTQRMPGDPASDLSRQTPPDAVCQQGHTSRPSTPSPEHKLAGSPEKPEGQSEV
                     QTTHLGAELAAGPDGRSPLASCFPTAESEVQTSDPGQEPAHASSELPISSSQGEPVQG
                     RLESPLAPEEPDAHRSEPAAEDKAMGNGPDDVTGALVAGESKAAGGPEPAAVLVVAEV
                     ATGMAHPGTESFLEPGQVDANGEQVPKVVDAWTEVDGIGLAPGNEVAGGPEPSATVQQ
                     QQQQQQQAEEEEPAAEENACRGIDSAEKSDHLGDDASTEAPAPEIVSDGDPRETTGAE
                     TDAAPDVNEASTGDKLDAPTQNLVIGVPDFEGKATEPEAVSHVRMDGVGVQDPSGLKS
                     EIDVDAEDEASGGLRGKAFGPEIRVNGISGALGDHAAELDTTDVCTEPGAPGTNPRDK
                     CAAVATCANELSPSGPDTSGSSAETGKAADAGSSAETSSLAEPATVERPTPEAAPPSP
                     APQATKDQPDLLAPSPDVSTLCNLSPVPTRSSISSDAASFFANSSTIPAFRNSVDTIR
                     PSTDEPRQRPAGAEQLLSHADGSDSRPQTAGYLGVGLRRGSRFVEVGLRGALGDVEAR
                     RRMSLPLQRCLSPDGEAREKSRPSAPASEAGAGDGGRSGDGQSVLPRMILLLAGAVAV
                     GKIVKKAAE"
     gene            complement(2048757..2050511)
                     /locus_tag="MYCTH_2295038"
                     /db_xref="GeneID:11505662"
     mRNA            complement(2048757..2050511)
                     /locus_tag="MYCTH_2295038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658745.1"
                     /db_xref="GeneID:11505662"
     CDS             complement(2048869..2050299)
                     /locus_tag="MYCTH_2295038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658793.1"
                     /db_xref="GeneID:11505662"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="JGIDB:Spoth2_2295038"
                     /translation="MSSFELLQERLAALQETTAQLRELIDRLANVQFQPGSVPLSTSD
                     EDNVATELSTEITQILREEEEDLELLQEEIIDLRSGRPGSEAEHRKARLKDGAQRLQA
                     ELRDCRSSFRKAQLSARRSLEAAQKLERDLLLASYITASASASSSAILSNPDSSSSPP
                     DSQPQPGATTPTPQPQPPPPLSSEEARNQLLTPRGRRRQQQQQLGKKYRGGTGTGAGD
                     DEADAAVAASSDITQALQRTHALIAGELAKSAFAARTLAESTAALAELQRSYEGLDGL
                     LARSRDLLGALLSSQKSDTWYLQAALRLLLATLAWLLFRRFLYGPLWWLVWLPLRTGW
                     RLTSKGVAYLGADGGGGDGSSSSSSATMAVVVPGEGGEQGGRPKTVVVGVGEEGAVPT
                     VRVGRGETSEEGKQGEEDGSMVDKVGRMVEDTLNRRDEEEKEEEKEEEAANRTAREDP
                     EDRPNPKKRMWEEDVGEGAGRVRDEL"
     gene            2050613..2051445
                     /locus_tag="MYCTH_2295039"
                     /db_xref="GeneID:11505697"
     mRNA            join(2050613..2051049,2051148..2051445)
                     /locus_tag="MYCTH_2295039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658746.1"
                     /db_xref="GeneID:11505697"
     CDS             join(2050869..2051049,2051148..2051263)
                     /locus_tag="MYCTH_2295039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658794.1"
                     /db_xref="GeneID:11505697"
                     /db_xref="JGIDB:Spoth2_2295039"
                     /translation="MITRFITDVTTRFNPFSPRSRSARLFLSFLPPTARSSGMNITTQ
                     LLPRTSKEPSTLYIKFKDGKEMNLDCENMGIKSIVEEVDRHSRMLQKEADLAEA"
     gene            complement(2051585..2053271)
                     /locus_tag="MYCTH_2295040"
                     /db_xref="GeneID:11513343"
     mRNA            complement(join(2051585..2051764,2051851..2052278,
                     2052378..2052497,2052581..2053271))
                     /locus_tag="MYCTH_2295040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658747.1"
                     /db_xref="GeneID:11513343"
     CDS             complement(join(2051623..2051764,2051851..2052278,
                     2052378..2052497,2052581..2052766))
                     /locus_tag="MYCTH_2295040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658795.1"
                     /db_xref="GeneID:11513343"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="JGIDB:Spoth2_2295040"
                     /translation="MASSPYTVRKVGAPYTLDHRVYIEKDGVPISPFHDIPLYANQEQ
                     TILNMIVEIPRWTNAKLEISKDELLNPIKQDTKKGKLRYVRNCFPHKGYLWNYGAFPQ
                     TWEDPNSIHPETKAKGDNDPLDVCEIGELVGYTGQVKQVKVLGVMALLDEEETDWKVI
                     VIDVNDPLAPKLNDVEDVERHLPGLLRATNEWFRIYKIPDGKPENQFAFTGECKNKSY
                     AMDVIRECNEAWEKLITGKTAASNIATTNLTVAHSTSRVSPDQLPPLPQNQDLPPAPI
                     DASIDKWFFISGASA"
     gene            complement(2054093..2058922)
                     /locus_tag="MYCTH_2295044"
                     /db_xref="GeneID:11505733"
     mRNA            complement(join(2054093..2055244,2055346..2055924,
                     2055989..2058922))
                     /locus_tag="MYCTH_2295044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658748.1"
                     /db_xref="GeneID:11505733"
     CDS             complement(join(2054270..2055244,2055346..2055924,
                     2055989..2058625))
                     /locus_tag="MYCTH_2295044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658796.1"
                     /db_xref="GeneID:11505733"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Spoth2_2295044"
                     /translation="MSTASRSLYHPNRRLGSVQSVQSVQSVQSVQSVQSAQDRDRHSR
                     TLSRARAGTVSYDDAYSYALRIAYLRYILQPRKKRKEYISAPKPRPHPRVHTSSITEL
                     VKELVPTGSTSVKLPSGFRHSLEKRMSGVLQGIERLPGFSDAAVKRTFAEAYTAFTAK
                     EFQKSIDKDRKVEPLVLIFYSAASKAQGRGKSPEDHSWKVLVDRHLAMFIRLLSNILK
                     DKGDIELVTRLNTLEKKLMSNDQSLYLDTGQEDHSYVEVDVPLSYEVKDMPMVQLVAK
                     IFGVTHSQAQTDIDRNMSAWTEEAALKDYKSYQFRLAAGMAGTLRKQDFDLDEAYEEW
                     RAGEAPHLATIFSEILTARPDLKGGSGGGTDKPLPVRHSMYEDQAYAELSRMLSNPES
                     PAPSVDASFGFRPPSVDETSSIRTVDEPSYTFIPPDPRAVYKVILQYVVSYDQLHSDT
                     SAAPLSEETANFLTELAVRWRIPQFSRHVAFVEVTTRKFLDQELPPEQLYACLDLVKE
                     RLEEPKKPVPIQMYTLGLSDIELTKWTIIDFAGYQQSLRDLHDALLRDLFALLMRCYE
                     PKPPTVGVVMALLNNHVYPDPTFTQRPEDAADFAQQLDNGLRQQAAKVYRDFLDHHIP
                     RSQREWDFGHVVNLGKAVVELAERIKKRYRKNPEIMGVSPFKALVETILPSFEEDCHE
                     IIKRVLQTSKETGIEIAIEDGFDLYKELVGIRKMHAQALPDKAFAFDIEDLLGAFVWR
                     WIKNVDDRMPGFIEEAIKHDMFKVRTRHEGDIPTDDERHSVSIIDVFTMFTQTVDQLL
                     QLEWNNEVHQARFMTALAKSFAAGIGRYCEIVGRQFEKEMDRRSEQEAAAAQRTTQEK
                     LFQYAKDAWNTKEKIEPFQFYPQSFVKFNNIEWAMQALDRLEKRMNVDACAELLNKID
                     APKQPVRRRKYVFTVKIVEGEELKACDPNGFSDPYVVLCDEYQKRLHRTRVIPRNLNP
                     RWDESVDISVEGPLNLIATIWDYDMFGDHDFVGRTSLKLDPVHFSDYLPREFWLDLDT
                     QGRILIRVSMEGERDDIQFHFGKAFRHLKRTERDMVREVTSKLSMHINTSLSHEALRN
                     LLNKGITASMANLWKKRQSQTASVTPAEVENAIQPLFTYFDENFAIMKQTLTDATMMA
                     VMTRLWKEVLLAIENLLVPPLSDKPSTQKPLTQAEMDIVYRWLELLFGFFNARDHETG
                     EILGVPADVLKSPKYHELASLNFFYFDTTENLIRTSERMAAANAQRAQQQAQQAQKQL
                     QSSHRLSAPSPGMLGVPSIGGASGAGTVPFGSLGTIRRGKSIMMSRNLGTMRKAKEEK
                     RKEAQADPSDDMILRILRMRPEAAGYLKERQRQKERMAAAQAAALIVRQSVNQGLTGG
                     GPAFGGALYGRTGVMPKR"
     gene            <2060864..2065314
                     /locus_tag="MYCTH_2141524"
                     /db_xref="GeneID:11509143"
     mRNA            join(<2060864..2060927,2061092..2061201,2061275..2061713,
                     2061840..2063199,2063256..2065314)
                     /locus_tag="MYCTH_2141524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658749.1"
                     /db_xref="GeneID:11509143"
     CDS             join(2060864..2060927,2061092..2061201,2061275..2061713,
                     2061840..2063199,2063256..2064573)
                     /locus_tag="MYCTH_2141524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658797.1"
                     /db_xref="GeneID:11509143"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Spoth2_2141524"
                     /translation="MGNVSSVPDEGAALYLKDQNRSNPKRRTAINIVPNAFPATRVSP
                     SRSSGDLTPIEFVLDPEPPSHGAGPSFLLKLANDDELVFTFTFIIRRSQSVVHNPVGG
                     VDTVTPIDTQINGLTFVFASTPREVENLVTREFHADPNLHKNANVALVGSYSTEGSPS
                     VTFDWTWRWKPPKHTEDRGGGWRNSCSVGSLKLLPFATIADISHNTSSHLSQPNSPTP
                     LLLSAPPKVRVVSAQSLESQISTIPEHEEIASPQHVGSEPSNAPPPAPPAPKEPIKVD
                     VSCPRPGEDLTLPDDGPVFRATMKALEQKTGNMRMQMKRLIKKAEYVYQTQQEANDAF
                     ASFMDALKEVSATNANAVQPAIEHYFDKIAREILSYERQNTTNMQKIVIDPVNKLYQM
                     DIKQAEAKKRDFEEESKEFYAYVSRYLGQRHDSVKAKQSDSKYQTKRKNFELKRFDYS
                     SFMQDLSGGRKEQEILSHLTKYADAQAKCFLSTAKRVDELIPQLEALSTEVQEADKEY
                     QYQRREREEKRRLLEKSNSAYAEPEQPLTASGPVLAGGHSNGTQPNSETEMGRADSTG
                     SQLRPTRSINSSNSPSTADLSRSTGGLGQQAVTSPAHNSKFKGIRDLEERDPNQAIQS
                     DKDAPNRKEGLLWALNRPGGHVDPRNLNKQGWHKFWIVLDQGKLSEYSNWKQKLDLHM
                     DPIDLRLASVREARNADRRFCFEVITPQFKRVYQATSEEDMYSWITAINNALQSAVEG
                     RTFKDKPSTAHSDLGFNGVDIGSMLVGKSSSVSHGSHSSSAIPFRRTTVGARPSTSRG
                     ANFEDKPDKLLQMLRENDQGNCWCADCGSSNKVEWVSLNLAIIVCIECSGIHRSLGTH
                     VSKIRSLTLDTTSFTPDIIELLLLVGNRVSNMVFEARLDPAMKLTPQANREQRLKFIS
                     AKYVERAYVEPISATLSRFATPEETLLAGIKRNEIQQILYALALRANPNVTDKSRGTH
                     AIYLALAAADPAPPSPVPSQSLAPQTPTVERVVPFPVAELLIQNGAEIPDSLPQVPLS
                     MAAQAYIEMKRGRKAAIDGSGSYDSSPSAATAMSSQNDKVQRDRDSRLQKRVSAGGRL
                     AKTPIPER"
     gene            complement(2065779..2068288)
                     /locus_tag="MYCTH_2295050"
                     /db_xref="GeneID:11508192"
     mRNA            complement(join(2065779..2066292,2066356..2066725,
                     2066802..2067397,2067470..2068040,2068136..2068288))
                     /locus_tag="MYCTH_2295050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658750.1"
                     /db_xref="GeneID:11508192"
     CDS             complement(join(2065883..2066292,2066356..2066725,
                     2066802..2067397,2067470..2068040,2068136..2068183))
                     /locus_tag="MYCTH_2295050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658798.1"
                     /db_xref="GeneID:11508192"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2295050"
                     /translation="MAPRAEGSHLKRSRVSGSPTDEQDSQKKPRRSQRLSQRADRDVL
                     KTPVQNKNQLPSPVTNLASENTTEYDKEVTATPPQERPSQAAARRADDAHSQGLAFSS
                     PPQDTQAFSQQDFDPNAPLVEGVDEVKEGVWGYLLPLDNLFLRGPYVFKNKETCTSPA
                     APAEPAAAAVTKRGSRKKQATPAKQQDQNDNSPTAGGHLLGRHPTCDIIVNDGEVSNR
                     HCLFFVENKRDEKVVVLTDLSRNGTYVNGARLQRNDRRELREGDEISVTSASAGFIFR
                     YPKSRRGKPFAQQYTLRHELGSGHFAQVFLCCEKSTGDCYAVKRFTKRPDGEEKSKYD
                     GLHQEVAMLMGLSHPNILCLKETFNEPEAVYVVLELAPNGELFHYITVHTKLTEAETR
                     KVFIQLFDGIKYLHDRDMVHRDIKPENILLMDNDLTVKIGDFGLAKIVGEASFTTTLC
                     GTPSYVAPEILANSKSRKYTKAVDIWSLGVVLYICLCGFPPFSDELRAPDFPYDLGDQ
                     IRKGLYHYPSPYWDPVSDLALDLIDNMLVVNPEHRYTVDQCLMHPWITQKPPGVNDST
                     NGLVSGLAGLDVSRRTPFRERTLISSINTCVVTDRVPAGAGRPDVKVYSKNPKGPTAA
                     PPTARREPRPDDNRDPAEFIKMGGKGDQELYDNDDGSRYL"
     gene            <2069568..2071730
                     /locus_tag="MYCTH_76163"
                     /db_xref="GeneID:11511542"
     mRNA            join(<2069568..2070502,2070567..2071730)
                     /locus_tag="MYCTH_76163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658751.1"
                     /db_xref="GeneID:11511542"
     CDS             join(2069568..2070502,2070567..2071308)
                     /locus_tag="MYCTH_76163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658799.1"
                     /db_xref="GeneID:11511542"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_76163"
                     /translation="MATNAGHGNSASRGADEATAAAEGKGTEKPKPPVRSSLPPGPRT
                     PYDFHDAWSPPAIPKKPIDSQDSPISDSEAEPDLEPVSYRTPSPVSYNRWIDAYHNKH
                     TQDVLKGATDYLEFYGTKKPRVTGLVISKMATPQLIFVDGTFAELAQELADYIQIGEQ
                     VKPYLAKEQNEEALQLIVQASHVLNSVPEKDFTGAYNLLIHLVLQSKDPKKHLPTVCG
                     NLQKPITSSPAHGFTLAANALSTVFNLLEQNNPLRFNVMLQIVRFIRQHGQFELLKPR
                     LKNLEGWFTAWDTDEDDQRRLYVEVSDAAAEAGDDEESYHYLIKALGTFDRDDQEEIT
                     SEEAQKLSLKAVRMAITHPTRFDFQDLRALPSVQALGDSHPVYSQLLDILTEQDLEDY
                     NDFKDEHEGWIEKEKLDNEKLQRKMRLLTFASLAASTPNREIPYSSIAKALQIPLEDV
                     EMWTIDVVRAKLVEGRLSQQQKVFLVHRTTYRVFGEKQWRELATRVDQYKSIVDHLLA
                     VLRKGQADVESQREREQQELERKLANAGISGGHGGDRRRQQQKPRTDEDD"
     gene            complement(2071814..2073411)
                     /locus_tag="MYCTH_2295056"
                     /db_xref="GeneID:11505670"
     mRNA            complement(2071814..2073411)
                     /locus_tag="MYCTH_2295056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658752.1"
                     /db_xref="GeneID:11505670"
     CDS             complement(2071884..2072525)
                     /locus_tag="MYCTH_2295056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658800.1"
                     /db_xref="GeneID:11505670"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="JGIDB:Spoth2_2295056"
                     /translation="MPPTTANTSGTTPAFSPADVTVLFVLGGPGAGKGTQCSRLVRDY
                     HFKHLSAGDLLRAEQDRPGSQYGQLIRDCIKNGEIVPMEVTVALLENAMRETIDTTGT
                     KKFLIDGFPRKMDQAVKFEEVVCPARLVLFYDCPEAEMERRLLERGKTSGRADDNAES
                     IRKRFRTFVETSMPVVDAYDREGRVVKVDATATPDQVYAATKEKLKQALGDKF"
     gene            complement(2074344..2077158)
                     /locus_tag="MYCTH_2313432"
                     /db_xref="GeneID:11508062"
     mRNA            complement(join(2074344..2075893,2075983..2076120,
                     2076182..2076789,2076856..2077158))
                     /locus_tag="MYCTH_2313432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658753.1"
                     /db_xref="GeneID:11508062"
     CDS             complement(join(2074799..2075893,2075983..2076120,
                     2076182..2076409))
                     /locus_tag="MYCTH_2313432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658801.1"
                     /db_xref="GeneID:11508062"
                     /db_xref="JGIDB:Spoth2_2313432"
                     /translation="MGLEEKKRPAALNLTPARTMSATSVSSTDSNSTSSSLAKPPRTP
                     RFAEATAVHSPVEPQKMPFSDRPQESQAQPGDSPLKSAMKVPGTPGRALQNPLSPTFR
                     EEQILEDKEKATEKEQARDLKIKIRVRMAKFALRGVNFSCSLIILAMISSSFAIFNAT
                     KHLPAMSGLPPWAENTNAWPQKVVLACSCVSLLICIAVFVGYCRGGHRRAEKVGVYYT
                     LFAVGWFIFSMAMWAMAAGVLQVSRNNSNNKDMWGWACVENRRSTLFQDKVDYALVCR
                     LQDWTLICIIIELVVEVISITLYSIIFYRYWSKRKLRKSMDMRDKARSDLYLAQLRTQ
                     SAPNTPGFGPKSPAFSQYALSPRFPPSAYKSLNDIDEDASPFTPGGNRLIVPQSSFSP
                     AQAGFKLQAPPAKANPATPATPKAGYKPPTAADLSPSTATAVAPAPPVHVNEPAPVAE
                     GEQQYEAVPIPGAYAGQVIKSPPPVQTTFNLPGRSD"
     gene            2077721..2077976
                     /locus_tag="MYCTH_2295064"
                     /db_xref="GeneID:11508508"
     mRNA            2077721..2077976
                     /locus_tag="MYCTH_2295064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658754.1"
                     /db_xref="GeneID:11508508"
     CDS             2077739..2077909
                     /locus_tag="MYCTH_2295064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658802.1"
                     /db_xref="GeneID:11508508"
                     /db_xref="JGIDB:Spoth2_2295064"
                     /translation="MSTKGKRESEGNGARRGTITCGWAARGRRRRAHADHLPSGPPMI
                     DARFLWPWIAPN"
     gene            2082051..2084203
                     /locus_tag="MYCTH_2075102"
                     /db_xref="GeneID:11512847"
     mRNA            join(2082051..2082772,2082856..2083842,2083900..2084203)
                     /locus_tag="MYCTH_2075102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658755.1"
                     /db_xref="GeneID:11512847"
     CDS             join(2082252..2082772,2082856..2083842,2083900..2083930)
                     /locus_tag="MYCTH_2075102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658803.1"
                     /db_xref="GeneID:11512847"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="JGIDB:Spoth2_2075102"
                     /translation="MASNGDKYGNDIESDTDSGNESQVDAHDSDNEVAERPVKPALKK
                     TAPPAPTVQRPPLPPQTDPKDLDIKALNPLTPEIIARQATINIGTIGHVAHGKSTVVK
                     AISGVQTVRFKNELIRNITIKLGYANAKIYKCDNPECPRPTCYRSYKSEKEVDPPCER
                     EGCSGTYRLLRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLA
                     AIEIMKLDKIIILQNKVDLMREEAAKQHYESILKFIRGTVAGKSPIIPISAQLKFNID
                     AINDAIVNTIPIPPRDFSMDPHMIVIRSFDVNKPGAEIDELKGGVAGGSILHGLLKLG
                     DEIEIRPGIVSRDDKGNLKCTPIFSRIVSLNSEANDLKYAVPGGLIGVGTRIDPTLCR
                     ADRLVGFVLGLKGRLPEIYSEIEVNFYLLRRLLGVRTADGKQAKVDKLAKNEVIMVNI
                     GSTSTGAKVVAIKKDAAKLQLTSPACTNIGEKVALSRRIEKHWRLIGWATIAAGVTLE
                     PSSS"
     gene            complement(2084107..2086375)
                     /locus_tag="MYCTH_2295068"
                     /db_xref="GeneID:11508934"
     mRNA            complement(join(2084107..2085132,2085295..2085629,
                     2085727..2086128,2086203..2086375))
                     /locus_tag="MYCTH_2295068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658756.1"
                     /db_xref="GeneID:11508934"
     CDS             complement(join(2084368..2085132,2085295..2085629,
                     2085727..2086128,2086203..2086275))
                     /locus_tag="MYCTH_2295068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658804.1"
                     /db_xref="GeneID:11508934"
                     /db_xref="JGIDB:Spoth2_2295068"
                     /translation="MSSRRNSLTPPERRDIVDPGAHELAEASDSEEHYSDARSGPITP
                     ARASPIPKTRVERVDDKPAYGEVPGTQAYRLREEDAAPDEIAIIPDADAAPEPEQIPR
                     SPTPGGYPVPKTVVEEAPDAEGSVTHPGNRQRRKSDAHPDLVVKADGTVEQGEAATDP
                     PLPSPSSLNAPATSSRTRRKSSSAMKRSPLSPGLPAAESAVCTEDADDDDSGDEFDDF
                     EEGGEDGDFDDFEDGFQTPAQQQQQQQPQQQPQQAPQPPPPPSAPAAPSLSFPIPTFD
                     DLSPSEITTLTEPYLAALFPSPLQQPPLPAPSAGENPVFLTPRSASLWSQLVAPPPLQ
                     PPDWIRSRIRRLFLVSLGVPVDLDEILPASSKQKKLVLPSLHRTTSSGSLRRASSDSR
                     GPAAKGAGSASASASTGEGGGRDSLSAGGDPTSASSSSRRRKKADGSGRQPSPERSFD
                     LVSARQMCMLTDAALSGMTDAELRAHIARLEAMQETAQGVLAYWQKRTDEKIGDREAF
                     EGVIENLVKHARKVRK"
     gene            2087035..2089868
                     /locus_tag="MYCTH_2295069"
                     /db_xref="GeneID:11508679"
     mRNA            join(2087035..2089117,2089233..2089868)
                     /locus_tag="MYCTH_2295069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658757.1"
                     /db_xref="GeneID:11508679"
     CDS             join(2087153..2089117,2089233..2089424)
                     /locus_tag="MYCTH_2295069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658805.1"
                     /db_xref="GeneID:11508679"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="JGIDB:Spoth2_2295069"
                     /translation="MAFSFGTPASSAASGQSTTSTAPASGGLFGGTSGSTSSPFSFSK
                     PATSGSSTPQASGGLFGGSSTTTGQTGSLFGNAGATSTPSTTASTTGTSLFGQTTGAS
                     TGGGLFGGAKPSGGLFGNTSTPASGTATPTGTPSLFGNKPATTTSAPATSTPAATTGS
                     LFGSTTTTAPSGGSTTATTGGLFGNTGGSGLFGSTTPSTGATSGQATPSKPLFGGAGS
                     TTPAGAPPADASKPSGGLFGGGLGTTKQAAAPASSTGGLFGQSTTPASTSAQSQSGSN
                     ATAGTSTLFGAKPSQTPATGSTPSLFGGAQTGAATSGTSTPATTAPATGAKSLFGGAA
                     GTTPATTAAPATSTPAATTTTTTTTAPPSSSATTTPSLFGGTTAATTAPTTSTPAAGG
                     LFGSKPATTTAPASSSAAPAASGSLFAKAASATGPATTTASTSAPAATATTAATTAPT
                     TTATTAAPASGGLFGGAKPAGTSAAPAQDSKTTTTAGLSASTMGPASQLPRLKNKTMD
                     EIITRWATDLSKYQKEFKEQAAKIAEWDRMLVENGEKIQKLYTSTYEAERANAEIDRQ
                     LSNVESQQEELGAWLERYEADLNELFAKNGITATGEQAAGPDQERERTYKLAEKLTDR
                     LDEMGKDLTKMIKEINDMSSTLSKGNKPDDPLTQIVRVLNGHLAQLQWIDSNAAALQA
                     KVLAAQKASGSMGTSVSGPETDAAESFYRSYRGGYK"
     gene            <2093612..>2094759
                     /locus_tag="MYCTH_91076"
                     /db_xref="GeneID:11511686"
     mRNA            join(<2093612..2093620,2093765..2093797,2094388..2094627,
                     2094673..>2094759)
                     /locus_tag="MYCTH_91076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658758.1"
                     /db_xref="GeneID:11511686"
     CDS             join(2093612..2093620,2093765..2093797,2094388..2094627,
                     2094673..2094759)
                     /locus_tag="MYCTH_91076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658806.1"
                     /db_xref="GeneID:11511686"
                     /db_xref="JGIDB:Spoth2_91076"
                     /translation="MTKYLAKTRKPKPNVEFDFYILEEAKNTLIDGYIYVTADVINEL
                     ALKMLLGTDFITAYSVKIDFVKGIYTFRSLANIKVYGDVVKKNPKPISQKIVETYFIL
                     LPNTTPEDKCFYFTASRDGV"
     gene            <2095729..>2096052
                     /locus_tag="MYCTH_2050269"
                     /db_xref="GeneID:11505424"
     mRNA            <2095729..>2096052
                     /locus_tag="MYCTH_2050269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658759.1"
                     /db_xref="GeneID:11505424"
     CDS             <2095729..2096052
                     /locus_tag="MYCTH_2050269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658807.1"
                     /db_xref="GeneID:11505424"
                     /db_xref="JGIDB:Spoth2_2050269"
                     /translation="FVRVYINNIIIFSKTEEEYLKHLYTVYEILDKAHIYIGVAKSFA
                     GYLAIRLLRYIINGEGITKTDDRIATFKKLKFPDTLDSLEHYLGMAKWLRKGILWFDA
                     KARPL"
     gene            <2096276..>2097441
                     /locus_tag="MYCTH_91077"
                     /db_xref="GeneID:11513276"
     mRNA            join(<2096276..2096349,2096613..2096665,2096795..2096851,
                     2097287..>2097441)
                     /locus_tag="MYCTH_91077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658760.1"
                     /db_xref="GeneID:11513276"
     CDS             join(2096276..2096349,2096613..2096665,2096795..2096851,
                     2097287..2097441)
                     /locus_tag="MYCTH_91077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658808.1"
                     /db_xref="GeneID:11513276"
                     /db_xref="JGIDB:Spoth2_91077"
                     /translation="MAIMLLPSNLRAIRIKRKFLVGIFPFNLNIFYILGTLNIVPNEL
                     VLSDKFRARIITSYSKDLPTVGTLWSLEGHALADTLYTVTCKFSKKKLLVAGRRIYTA
                     KEWATVLLRT"
     gene            2102833..2104262
                     /locus_tag="MYCTH_2295071"
                     /db_xref="GeneID:11505943"
     mRNA            2102833..2104262
                     /locus_tag="MYCTH_2295071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658761.1"
                     /db_xref="GeneID:11505943"
     CDS             2103134..2104102
                     /locus_tag="MYCTH_2295071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658809.1"
                     /db_xref="GeneID:11505943"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2295071"
                     /translation="MSFVRQLLSLHPSPLRASPLRASPLSRHSLAHLRSISTTPRLQD
                     KTVNRGRVAIVTGAAQGIGRAIALRLAQDGYHVTVSDLPALQPQLDSLVSEIVTATSE
                     GSSERRVRAHAHAADVTSPAQVSALVRASADALGPLHTMVANAGIAQVKPLLELTEAD
                     WDRMMAVNVAGVHHCFQAAARQMILQEEFAGEIRGRLIAAASIVAFKPFALLGHYSAS
                     KWAVRGLSQAYAMELAPHRITVNAYAPGIVDTGMWELIDEGLGQIKGKGVKKGEMMKK
                     YSDDLIALGRTSVPGDVAGLVSFLACPDANYVTGQTFIVDGGIIYT"
     gene            complement(<2104576..>2104860)
                     /locus_tag="MYCTH_2040280"
                     /db_xref="GeneID:11505388"
     mRNA            complement(<2104576..>2104860)
                     /locus_tag="MYCTH_2040280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658762.1"
                     /db_xref="GeneID:11505388"
     CDS             complement(<2104576..>2104860)
                     /locus_tag="MYCTH_2040280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658810.1"
                     /db_xref="GeneID:11505388"
                     /db_xref="JGIDB:Spoth2_2040280"
                     /translation="TLRQLHNDMQWWFRASNHDVKIVILTKFDHRQHYILVEKWEEEI
                     SYPQGAITRSQAAAISQQNVLEPVKRQSITISRDETTNPVSYNIINRGALV"
     gene            2105846..2106732
                     /locus_tag="MYCTH_2295074"
                     /db_xref="GeneID:11511666"
     mRNA            join(2105846..2106228,2106296..2106732)
                     /locus_tag="MYCTH_2295074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658763.1"
                     /db_xref="GeneID:11511666"
     CDS             join(2105917..2106228,2106296..2106538)
                     /locus_tag="MYCTH_2295074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658811.1"
                     /db_xref="GeneID:11511666"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="JGIDB:Spoth2_2295074"
                     /translation="MTIFLNPFRTPARTGAEWFSVGLASSFPDVSLDIDGKENVSENE
                     ARLCGSHGPKATPGCKVFHVPKEDPSQRTEVDLPVDDAAQDLTDQVLVFQYRGKFHAI
                     DHQCPHSSYPLSQGIPFDIEDFGIVLSAGLTCPKHNWSFDLFSGRSDRGNYKLRVWEV
                     ELRDIEGVQTDDKEVWVRRKPRIG"
     gene            complement(2106733..2107212)
                     /locus_tag="MYCTH_2295075"
                     /db_xref="GeneID:11508476"
     mRNA            complement(2106733..2107212)
                     /locus_tag="MYCTH_2295075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658764.1"
                     /db_xref="GeneID:11508476"
     CDS             complement(2106785..2106952)
                     /locus_tag="MYCTH_2295075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658812.1"
                     /db_xref="GeneID:11508476"
                     /db_xref="JGIDB:Spoth2_2295075"
                     /translation="MWTDRAGSLSRPTETNMVWLDLAGAGVTVEMLNDLGMRKGILLA
                     GPRIVLQPSDR"
     gene            2107447..2108613
                     /locus_tag="MYCTH_2295076"
                     /db_xref="GeneID:11512915"
     mRNA            join(2107447..2107644,2107731..2108613)
                     /locus_tag="MYCTH_2295076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658765.1"
                     /db_xref="GeneID:11512915"
     CDS             join(2107537..2107644,2107731..2108450)
                     /locus_tag="MYCTH_2295076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658813.1"
                     /db_xref="GeneID:11512915"
                     /db_xref="JGIDB:Spoth2_2295076"
                     /translation="MKYHTSALAIDTLASASAVSIEERQGNSGTGPFAPAGYYTSDGL
                     EGHSFYAPQNIPSDAKLPVMLWGNGGCSADATGQAPFLTELASHGVLVIASGTPGNGG
                     STTADMMTQSIDFITSNAGQGEWANIDASRITAAGWSCGGIEAYAQIWDDRVQSIGIW
                     SSGLLDNHMAANDFTKPVFFFLGGPCDIPYGNGERDYAAMPAGMPKWKGNLDVGHGGT
                     YTEPNRGKFGVIGGYWVEWIMRGDASAADYLTGDGAKNDGWSVEFADLENLNVIPIE"
     gene            <2109152..>2111615
                     /locus_tag="MYCTH_42071"
                     /db_xref="GeneID:11505609"
     mRNA            join(<2109152..2109303,2109371..2109841,2109951..2110034,
                     2110128..2110706,2110800..2110992,2111130..>2111615)
                     /locus_tag="MYCTH_42071"
                     /product="glycoside hydrolase family 51 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658766.1"
                     /db_xref="GeneID:11505609"
     CDS             join(2109152..2109303,2109371..2109841,2109951..2110034,
                     2110128..2110706,2110800..2110992,2111130..2111615)
                     /locus_tag="MYCTH_42071"
                     /EC_number="3.2.1.55"
                     /note="CAZy_ID 267846"
                     /codon_start=1
                     /product="glycoside hydrolase family 51 protein"
                     /protein_id="XP_003658814.1"
                     /db_xref="GeneID:11505609"
                     /db_xref="InterPro:IPR010720"
                     /db_xref="JGIDB:Spoth2_42071"
                     /translation="MASLSLRALLGFVGATAAVTVTVASSGGHATSPYMYGIMFEDIN
                     QSGDGGLYAELISNRAFQNESLKSWSAVGDSTLALDTTTPLSWALPRSVRVKGGKGKA
                     GLRNSGYWGIDVKHTDTYTGSFYSYGEYRGSFTASLVSDITNETLAITKIKSKSVANA
                     WTKHEFKLHPTKSAANSNNSFVLEFRPSHETELKFNLISLFPPTYNNRPNGMRRDLME
                     KLRDLKPSFLRIPGGNNLEGNFAGNHWNWSATIGPLIERPGRMGVWGYENTDGLGLVE
                     YMHWAEDLGVDVVLGVAAGLYLNGDVVPEEELDFFVQDALNELEFLMGDVSTPYGALR
                     AKLGYPRPWKIKFVEIGNEDNLWGGLDSYKSYRLRAFYDAIKAKYPDIFIFSSTDEVV
                     YKKSGRDYHKYTRPDYSVSQFHLFDNWTAEHPVLIGEYATIQNNTGKLEDTDWDAPKN
                     AWSNWIGSVAEAVFLLGAERNADKIWGTAFAPLFQNLNNYQWAPDLISFTADPADTTV
                     SVSYPIIQLFSEHRITHTLPAASPDGFGPLYWAAGRGGLGGGGGGGGGGGGHVSSSSS
                     SYILKVAVYNSTGSEDVPVSVRFEGLPKGSPATLTVLTAAGSDPWAKNTPGRPDAVNK
                     TIQHLRAGKHGEIDFSLPDLSVAVLVARGK"
     gene            2113204..2115315
                     /locus_tag="MYCTH_2295083"
                     /db_xref="GeneID:11512866"
     mRNA            join(2113204..2113433,2113924..2114004,2114069..2114375,
                     2114434..2114675,2114737..2114807,2114862..2115315)
                     /locus_tag="MYCTH_2295083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658767.1"
                     /db_xref="GeneID:11512866"
     CDS             join(2113944..2114004,2114069..2114375,2114434..2114675,
                     2114737..2114807,2114862..2114972)
                     /locus_tag="MYCTH_2295083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658815.1"
                     /db_xref="GeneID:11512866"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="JGIDB:Spoth2_2295083"
                     /translation="MGHEDAVYLAKLAEQAERYEEMVENMKIVASEDRDLTVEERNLL
                     SVAYKNVIGARRASWRIVTSIEQKEESKGNTTQVALIKEYRQRIESELAKICEDILGV
                     LDKHLIPSAKTGESKVFYHKMKGDYHRYLAEFAVGERRKDSADKSLEAYKAATEVAQT
                     ELPPTHPIRLGLALNFSVFYYEILNAPDQACHLAKQAFDDAIAELDTLSEESYKDSTL
                     IMQLLRDNLTLWTSSEAEPPAAGQAEAPPAEESKAEPSAEEPKAE"
     gene            complement(2115317..2116433)
                     /locus_tag="MYCTH_2295088"
                     /db_xref="GeneID:11512917"
     mRNA            complement(2115317..2116433)
                     /locus_tag="MYCTH_2295088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658768.1"
                     /db_xref="GeneID:11512917"
     CDS             complement(2115383..2116108)
                     /locus_tag="MYCTH_2295088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658816.1"
                     /db_xref="GeneID:11512917"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="JGIDB:Spoth2_2295088"
                     /translation="MSIPATNPTYYEILNLSPSALTSLDEPAAASLIKRAYRRALLRH
                     HPDKKSSTSSSPSSLPSSSPASAPGYTIDQISTAYATLSRPALRQAYDRSLLVLQSQR
                     HRPSSLAPSSATESPGGGGGGGGAADFQTGIETVDLDDLDYEEKGRGRDSETTWYRSC
                     RCGNPRGYQFGEADLEDAADLGELMVGCADCSLWLRVCFAVLDDDDDGQDEKGGEKRE
                     QHAGKGSGDGMKPVLLNSGEVAA"
     gene            complement(2116435..2117390)
                     /locus_tag="MYCTH_2295089"
                     /db_xref="GeneID:11512887"
     mRNA            complement(join(2116435..2116713,2116778..2116838,
                     2116919..2117390))
                     /locus_tag="MYCTH_2295089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658769.1"
                     /db_xref="GeneID:11512887"
     CDS             complement(join(2116678..2116713,2116778..2116838,
                     2116919..2117313))
                     /locus_tag="MYCTH_2295089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658817.1"
                     /db_xref="GeneID:11512887"
                     /db_xref="JGIDB:Spoth2_2295089"
                     /translation="MAAAATKHIQLALALPARLRTFLARYPPPSILPAGANPETYKTA
                     YQEETPNPFLPMKHPVTGRWHEPKYSLRRQAELVKMAREHGVEELLPYTPKGTETRLR
                     KRVELGLRVKGTGVGQKVKGHKHERQLAAKMEKRRQAMLEMPALIREWKEVGKRNWTK
                     FPK"
     gene            2117551..2120079
                     /locus_tag="MYCTH_2295090"
                     /db_xref="GeneID:11508262"
     mRNA            2117551..2120079
                     /locus_tag="MYCTH_2295090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658770.1"
                     /db_xref="GeneID:11508262"
     CDS             2117689..2119812
                     /locus_tag="MYCTH_2295090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658818.1"
                     /db_xref="GeneID:11508262"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2295090"
                     /translation="MDKRRLPPDLPALLRQREAERAAAAKPRFIPKKERERLAAEKAA
                     KEEEERKRREESLIARRQSSTNGTNGDANGHGNGRSTPHDIPTGPKAMRHAGDGAADH
                     GHAGKRRRLNDEEEKRAEMERKDAAELRARYMGPEVNQSTFSAKKKRKRTAANKFNFD
                     WDPEDDTSRPYDPIYADRPEPLYKLTGYENTDEMVLRKAEAIRRADPETGEERAKKLL
                     EQHERVKKIAERKNFGKHWSEKKLEEMKERDWRIFKENFGIATKGGSIPNPMRSWEES
                     NLPRRLLDIVHSVGYDEPTPIQRAAIPIALQARDLIGVAVTGSGKTAAFLLPLLVYIS
                     ELPPLTEYNKNDGPYALILAPTRELVQQIESEARKFADPLGFTVVSIVGGHSLEEQAF
                     SLRNGAEIIVATPGRLVDCLERRLLVFSQCCYIIMDEADRMIDQGFEEPLTKILDALP
                     VANEKPDTEEAENSQLMSRYLGGKDRYRQTMMYTATMPPLVEKIAKKYLRRPAIVTIG
                     NAGEAVDTVEQRVEFIAGEDKRKRRLQEILGSGQFKPPIIVFVNIKRNCEMVAKDIKS
                     WGFSTATLHGSKTQEQREAALASVRNGQASVLVATDLAGRGIDVADVSLVVNFNMPSS
                     IEAYTHRIGRTGRAGKSGVAITFLGNEDADVMYDLKQIISKSSISKVPEELRRHEAAQ
                     SKPTRGGGKKLEESGGFAGKGASWQ"
     gene            2121138..2122575
                     /locus_tag="MYCTH_2295092"
                     /db_xref="GeneID:11512922"
     mRNA            join(2121138..2121434,2121521..2122575)
                     /locus_tag="MYCTH_2295092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658771.1"
                     /db_xref="GeneID:11512922"
     CDS             join(2121312..2121434,2121521..2122465)
                     /locus_tag="MYCTH_2295092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658819.1"
                     /db_xref="GeneID:11512922"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2295092"
                     /translation="MEPATPQHGALKPFPETASAPVHLKPRVAALDAVEDILYGSIAG
                     VVGKYIEYPFDTVKVRLQSQPDHLPLQYKGPLDCFRQSVRADGFLGLYRGISAPLVGA
                     ALENSSLFFWERLGRAAIYASGYSPRDQPLPLSALWITGAFSGTMTSFVLTPVELVKC
                     KIQVPREADNGSGSGSGSGSGGGGSAAKAAPLRPISVIRDIWRHQGLRGFWHGQLGTL
                     IRESGGCAAWFGSKETVTKLMREWNVRAARTEEERARARQADALPLWQQAVAGASAGM
                     SYNFLFFPADTVKSRMQTTPLGGSAAQQRTFAGEAAALWNQAGLKGFYRGCGITVLRS
                     VPSSAFIFMVYDGLKKYLPMQ"
     gene            complement(<2122894..>2123708)
                     /locus_tag="MYCTH_98992"
                     /db_xref="GeneID:11508041"
     mRNA            complement(join(<2122894..2123220,2123343..2123480,
                     2123550..>2123708))
                     /locus_tag="MYCTH_98992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658772.1"
                     /db_xref="GeneID:11508041"
     CDS             complement(join(2122894..2123220,2123343..2123480,
                     2123550..2123708))
                     /locus_tag="MYCTH_98992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658820.1"
                     /db_xref="GeneID:11508041"
                     /db_xref="InterPro:IPR004307"
                     /db_xref="JGIDB:Spoth2_98992"
                     /translation="MTTYIPSLTLPDAVFNNVPASILLPIALGSAVGYATRRMDMRPP
                     PRCFPHVMTESLTLNQPPLRPPAAVFPPVWTTLYGLMGYAAHRAFSLGTSPFNSPGTV
                     SAARHGATLYTIQLGINLAWMPLFYGLNRPVLATIDVATLFGINSYLAWLWATKVDNL
                     SGWLLAPYVAWLGFATYLSFGTGYLNNWDLSPTSAARAGKGEGKKNA"
     gene            2124896..2128235
                     /locus_tag="MYCTH_2295096"
                     /db_xref="GeneID:11505423"
     mRNA            join(2124896..2125267,2125421..2127405,2127488..2128235)
                     /locus_tag="MYCTH_2295096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658773.1"
                     /db_xref="GeneID:11505423"
     CDS             join(2125150..2125267,2125421..2127405,2127488..2128063)
                     /locus_tag="MYCTH_2295096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658821.1"
                     /db_xref="GeneID:11505423"
                     /db_xref="JGIDB:Spoth2_2295096"
                     /translation="MDSYHRESARSPGDRWSGRDDTRIKDERGDSFYRNGRSPDRSRR
                     RSRSPPAVDRYEPRARGRDDYAGTRDRDDRSRRSPHPVIDRYVPGQDSALPQSLNNPL
                     PDPLKLSYQVGFSWFGEWWRANERIKEEKERLKSGRRREPERPRGPREAQEEREKEKA
                     KIQAAYDKYKEDLQAKMAHAFVKQHKEEQWFKERYVPEVRDPFRQQLNEQRLGAYARW
                     EQDLASGVFDDFSLEGIPKSESNGAGGAAEKEEGEATAANEVLGVGDLVPAQPTEIRD
                     ESLDQPTLLIKTIAPSVSRQNLEAFCKEHLGEGEGGFKWLSLSDPNPSKRYHRIGWIM
                     LHPAPEAPIPEEDEGAGDEDGESKPAAPVSTAEKALEAINGKTVKDELRGDFTCHVGV
                     HNPPSHPRKKALWDLFSAPERIHKDLQLATELVTKFEGDIGSDLNANRLIEDHVDRLR
                     DEGKLQPAVPVTSVKRPKKQRERTITLDQSMDMEREEGDEEMAEDGEDDEEEGMVDDE
                     VDDIDLLVEKKRLDLTIEYLRRVFNFCFFCVFESDSVHELTRKCPGGHLRRPRSTLSS
                     AAKAVAEASANGDPFPSKKRKDEEVEEGEAPEEDRKFRASSKAEQQLQRAYNWVKTFE
                     DKINQILHPETVDLRKLGGKPVEDAVNDELGKYVKQEDEHKWRCKVPECTKLFKEEHF
                     WRKHVEKRHTEWLEKLKEEFQLINAYVLDPAHIAPSRTDANSNGHFPQSNGQQPTGTP
                     RGFNLQNYAMNSMLNFPGFPMAMFPPGMMGGSGAGGANPLPNPASWHAGTGVDDRGAG
                     AGPIRRGGGMSSGGGSRFQNRFGPYDRRGGNSRYGGDGGGAMGGGRGRGGPANRWGDG
                     AGVAAVGPREAVQGRTLKSYEDLDQVSGGGGGELNY"
     gene            complement(2128367..2130696)
                     /locus_tag="MYCTH_2295097"
                     /db_xref="GeneID:11508350"
     mRNA            complement(join(2128367..2129512,2129611..2130266,
                     2130325..2130376,2130439..2130696))
                     /locus_tag="MYCTH_2295097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658774.1"
                     /db_xref="GeneID:11508350"
     CDS             complement(join(2128670..2129512,2129611..2130266,
                     2130325..2130376,2130439..2130495))
                     /locus_tag="MYCTH_2295097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658822.1"
                     /db_xref="GeneID:11508350"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2295097"
                     /translation="MATATATKASGGGGNAAFRDKEKPLAVRSSNIVAARAVADAIRT
                     SLGPRGMDKMIRSGKGETIITNDGSTMLKSMSVMHPTAKMLVQLSNAQDVEAGDGTTS
                     VVVICGSLLGAADRLLSKGIHPSVISESFQRAAAAAVQVLHDMSQPIALTDTAALLQA
                     ANTSLSSKIVSQYSNLLGPMAVNAVTKTIDLKTADNVDLKNIRIVKKVGGTIEDSELV
                     DGLVLTQPVIKSAGGPVRMEKAKIGLIQFQLSPPKPDMENTISVNDYRQMDKIVKEER
                     MYLLEMVKKIKKAKCNVLFIQKSILRDAVNDLSLHFLQRLGILAVKDIERDEVEFICK
                     STGCKPIADINSFTEDKLGSADLVEEVQSAGSRMVKVTGTKSAGKTVSVVVRGANSLI
                     LDEAERSLHDALCVVRCLVKKKALIAGGGAAEIEIASQLSKQARALTGTEAICWKAFA
                     DAMEVIPTTLAENAGLNSIKVVTELRHRHELGEKNAGVSIKSGGISANIAKENVLQPL
                     LVSTSAIELAAETVKMILRIDDIALSR"
     gene            2130847..2133020
                     /locus_tag="MYCTH_2295098"
                     /db_xref="GeneID:11505502"
     mRNA            join(2130847..2131067,2131150..2131241,2131295..2131409,
                     2131471..2133020)
                     /locus_tag="MYCTH_2295098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658775.1"
                     /db_xref="GeneID:11505502"
     CDS             join(2131065..2131067,2131150..2131241,2131295..2131409,
                     2131471..2132580)
                     /locus_tag="MYCTH_2295098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658823.1"
                     /db_xref="GeneID:11505502"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2295098"
                     /translation="MPSATGANWEKYRKNFADDEIEEKKITPLTDEDIQVLKTYGAAP
                     YGAAIKKLEQQIKEKQQSVDEKIGVKESDTGLAPPHLWDTAADRQRMSEEQPLQVARC
                     TKIIPDEKDESKSKYVINVKQIAKFVVQLGERVSPTDIEEGMRVGVDRNKYQILLPLP
                     PKIDASVTMMTVEEKPDVTYGDVGGCKEQVEKLREVVEMPLLSPERFGNLGIDPPKGA
                     LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
                     IIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDARGNIKVMFATNRPSTLD
                     PALMRPGRIDRKIEFALPDLEGRANILRIHAKSMSVERDIRWELISRLCPNATGAELR
                     SVCTEAGMFAIRARRKVATEKDFLSAVDKVIKGNLKFNSTAAYAQYN"
     gene            complement(2133021..2134742)
                     /locus_tag="MYCTH_2295100"
                     /db_xref="GeneID:11508605"
     mRNA            complement(join(2133021..2134235,2134302..2134742))
                     /locus_tag="MYCTH_2295100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658776.1"
                     /db_xref="GeneID:11508605"
     CDS             complement(join(2133461..2134235,2134302..2134384))
                     /locus_tag="MYCTH_2295100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658824.1"
                     /db_xref="GeneID:11508605"
                     /db_xref="JGIDB:Spoth2_2295100"
                     /translation="MPSVAQESPTVQSSKKRRRDDNDHQMHPAQNSPRGMYADKTFHH
                     GDFFHPSTPLAARKSLALPLGKRPRAAVEADFEADGELMRHLPYYSPSREFRQEEQHH
                     PHQDYAQAEQRTRSEKISTTTSSGTSSHTSSALLMSRCHICSRKPNKKSDLDSFADCQ
                     GCGQRTCYVCIRECLGWGLGSGAPTGSVQTQTEPSYQLAATLSTTSATGTPVEEGEAS
                     FTMLDADDKDQQQQPQHAQSEGGTLPAQEQGWMTGSKHRQVVCSRCCVERGEDGEVVC
                     LGCLPFVEG"
     gene            2135317..2136957
                     /locus_tag="MYCTH_105822"
                     /db_xref="GeneID:11505371"
     mRNA            join(2135317..2135462,2135617..2135640,2135706..2135762,
                     2135820..2135947,2136011..2136957)
                     /locus_tag="MYCTH_105822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658777.1"
                     /db_xref="GeneID:11505371"
     CDS             join(2135425..2135462,2135617..2135640,2135706..2135762,
                     2135820..2135947,2136011..2136111)
                     /locus_tag="MYCTH_105822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658825.1"
                     /db_xref="GeneID:11505371"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_105822"
                     /translation="MSRANKLGPEVNRALFVKNLSYNVTPEELFDLFGKYGPIRQVRQ
                     GIASNTKGTAFVVYEDVLDAKQACDKLNGYNFQNRYLVVLYHQPDKMNRTKEDLDARK
                     ENLERLKQQHGID"
     gene            2137793..2139323
                     /locus_tag="MYCTH_2295106"
                     /db_xref="GeneID:11509090"
     mRNA            join(2137793..2138487,2138569..2139323)
                     /locus_tag="MYCTH_2295106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658778.1"
                     /db_xref="GeneID:11509090"
     CDS             join(2137981..2138487,2138569..2139237)
                     /locus_tag="MYCTH_2295106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658826.1"
                     /db_xref="GeneID:11509090"
                     /db_xref="JGIDB:Spoth2_2295106"
                     /translation="MTPATTTTSITAAPATTAAALSSSIPTSIPTPDPGALTAGPPRP
                     GECSLLGSFAIFVQLALGGLALLSLVYKRWRERPQRPVKIWFFDVSKQVFGSVLVHGA
                     NVFMSLLTSGKFSIEADASAVAHGRVVRRAVLEGVFGRGGIIGARGEEGEGYVPNPCS
                     FYLLNLGIDTTLGIPILIFIVRLLTRLVALTPLGSPPQSIQSGNYGTPPNAWWWLKQS
                     IIYFCGLMGMKLVVLVLFMMLPWLPRVGDWALGWTEGNEKLQIVFVMMLFPLIMNALQ
                     YYIIDSYIKKQEALAADGNAGAGAGESVVYEELAGSDSEADSDETDDEDDARKSLNTG
                     RDSPLRMERRDSVTRRRSSRDAEYDPAADGDSQTVIGSNSSHVSSRGTLPKELLPTE"
     gene            complement(<2140660..>2142822)
                     /locus_tag="MYCTH_76199"
                     /db_xref="GeneID:11508528"
     mRNA            complement(join(<2140660..2141945,2141987..2142230,
                     2142329..2142459,2142525..>2142822))
                     /locus_tag="MYCTH_76199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658779.1"
                     /db_xref="GeneID:11508528"
     CDS             complement(join(2140660..2141945,2141987..2142230,
                     2142329..2142459,2142525..2142819))
                     /locus_tag="MYCTH_76199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658827.1"
                     /db_xref="GeneID:11508528"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Spoth2_76199"
                     /translation="MARCQMTLLFPIVCLVSALVSAQYSGYDYGFDVKKRVKRQLGQR
                     SAMVVQDKTGSEIQVRQEIRQLEQDHDLWTLYILGLSMLQYTDQESPVSYYGLAGIHG
                     MPHQTWGGMGPVTGNENTGYCTHSSVLFPTWHRAYMALYEMIATFWPDSERQRYESAA
                     RRFRLPYWDWAASPPPGQSVLPESIGGSPFIDVNGPNGLQRIANPLFSYQFNPLDQKA
                     FEFPPSQWNIWTRTLRSPSSGGPDAQSNNTLVALNLDRSRASIAQRLYDLFSHNDNYT
                     LFSNNAVGGQAESVESLHDTIHSLVGGVGPSQSVPQPGHMTYIQWSAFDPVFFLHHCM
                     VDRIFALWQAIHPNTWVPSSQALLDSYTIRRGQSIDSGTALTPFFSNDNGTFWTSDGV
                     RDHTRFGYTYAELLRGPVTGSSNNTLLAASQIRIVKQAVNRMYGSFSPAFFFLEELRI
                     QGGAAVVGAGFRNNHRKTAPLHGLLESKIFVAGSNGNRYYEWKVDVCVGRNGSQGILG
                     GDGIDGSSISFFLGDLSSLNNLLNDTHVGTMGVFTSARLSQHEPAGGHDVPISGSVPL
                     TAALVKKICEGELAGLASGHVVPYLKRNLKMVMRGTQREVVAGTDDKKICETLLSLRI
                     VSSVVEAPWSEDELPKWGEERVEFDVC"
     gene            complement(2143643..2147711)
                     /locus_tag="MYCTH_2295109"
                     /db_xref="GeneID:11508164"
     mRNA            complement(join(2143643..2146973,2147039..2147711))
                     /locus_tag="MYCTH_2295109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658780.1"
                     /db_xref="GeneID:11508164"
     CDS             complement(join(2143740..2146973,2147039..2147509))
                     /locus_tag="MYCTH_2295109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658828.1"
                     /db_xref="GeneID:11508164"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="JGIDB:Spoth2_2295109"
                     /translation="MAPEPTNTSWDHEYHTIRREKLFRNPPTDRTAYPALQLAVDPHI
                     ESFNALFRTDGRPSLLDHALAEIGTKTFLDGDERAAPAGRNKLTIRYKSVTLQKSQVP
                     PSNKFAKRREIFPAECRERHVSYRGKLTAVFEYRINDGEPQEFVRELGQMPIMVKSNK
                     CHLENNPPALLVQRKEESEELGGYFIINGIEKIIRLLLVNRRNFPLAIIRPSFANRGS
                     SYTQYGIIVRSVRPDETSQTNVLHYLNDGNVTFRFSWRKNEYLVPVMMILKALIETND
                     REIFEGLVGPPNSKGIENTFLTDRVELLLRTYKSYGLYTKTQTRAYLGQKFRVVLGVP
                     DTMSDYEVGTEFLRKVVLVHLGCVDVTEEQDLDKFKMLLFMCRKLYALVAGDCAVDNP
                     DAVQNQEILLGGFLYGMILKERLDELLSVSLKAALRDYLRRNPTLSFTSSSFAKDFPI
                     SIFRRTNENLGNALEYFLSTGNLQSPSGLDLQQTSGFTVVAEKLNFLRFISHFRMVHR
                     GSFFAQLKTTTVRKLLPESWGFLCPVHTPDGAPCGLLNHLAHKCKIMTESVDVSAVPG
                     VAMELGVNDYSSAATSESVVVMLDGRIIGWCTPKAAKAVADTLRRWKVEGGHGIPVLL
                     EIGYVPPSRGGSYPGIYMASQPSRMVRPVKYLPLGKEDFVGPHEQPYMSIACTEEEVI
                     PGDSTHVEFDPTNILSILANMTPFSDFNQSPRNMYQCQMGKQSMGTPGAAIRYRTDNK
                     MYRLQTGQTPIVRAPLHNTYGFDNFPNGMNAVVAVISYTGYDMDDAMILNKSAHERGF
                     GHGTIYKTKKISLKDDTRTRTSKTITRMFGFAPGSPVRASDREMLDEDGLPYVGRLVR
                     EGDILCAWHTVSADYSGQLINRDGITHWERYKEAEDAFIEEVRVIGSDSGNEPLQTIS
                     IKLRIPRSPVIGDKFSSRHGQKGVASQKWPAIDMPFSESGIQPDVIINPHAFPSRMTI
                     GMFVESLAGKAGALHGLAQDSTPFKFNEEHTAADYFGQQLIKAGYNYHGNEPMYSGIT
                     GEEFACDIYIGVVYYQRLRHMVNDKYQVRTTGPVVPTTGQPIKGRKKGGGIRVGEMER
                     DALLAHGTAFLLQDRLLNCSDYTKAWICRDCGSFLSVQPTVSPFIGKRRQVGTVRCRN
                     CAQRLDQIEGLDLMKLDGEIWEDGQGVQWIGGENTTMVVVPGALKFLDVELAALGVKM
                     KFRVDTKDAIRRGPLRATAPKTLPSVAASA"
     gene            2149955..2151558
                     /locus_tag="MYCTH_2313446"
                     /db_xref="GeneID:11505473"
     mRNA            2149955..2151558
                     /locus_tag="MYCTH_2313446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658781.1"
                     /db_xref="GeneID:11505473"
     CDS             2150707..2151090
                     /locus_tag="MYCTH_2313446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658829.1"
                     /db_xref="GeneID:11505473"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="JGIDB:Spoth2_2313446"
                     /translation="MKRVQRGHVTLKCWDLGGQPRFRPMWERYCRNVNAIVFIVDIAD
                     LDLLPVARDELHSLMSQPTLEGIPLLVLGNKSDLPNKLSVDELIDAMDLKNVAHREVS
                     CYGISAKEETNLEAVLQWLMRFANR"
     gene            complement(2152585..2154032)
                     /locus_tag="MYCTH_2295112"
                     /db_xref="GeneID:11513358"
     mRNA            complement(join(2152585..2153458,2153537..2153551,
                     2153623..2153822,2153883..2154032))
                     /locus_tag="MYCTH_2295112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658782.1"
                     /db_xref="GeneID:11513358"
     CDS             complement(join(2153294..2153458,2153537..2153551,
                     2153623..2153822,2153883..2153934))
                     /locus_tag="MYCTH_2295112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658830.1"
                     /db_xref="GeneID:11513358"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="JGIDB:Spoth2_2295112"
                     /translation="MATTQAVQVFGKKKNATAVARCVQGKGLIKVNGKPLKLFAPEIL
                     RAKLYEPILLLGTDKFADVDIRIRVAGGGHTSQVYATRQAIAKAIVAYYAKYIDEHSK
                     NLLKTALIQFDRSLLVADPRRCEPKKFGGRGARARFQKSYR"
     gene            2155131..2156217
                     /locus_tag="MYCTH_2313449"
                     /db_xref="GeneID:11508128"
     mRNA            join(2155131..2155296,2155357..2155485,2155558..2156217)
                     /locus_tag="MYCTH_2313449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658783.1"
                     /db_xref="GeneID:11508128"
     CDS             join(2155247..2155296,2155357..2155485,2155558..2155870)
                     /locus_tag="MYCTH_2313449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658831.1"
                     /db_xref="GeneID:11508128"
                     /db_xref="JGIDB:Spoth2_2313449"
                     /translation="MAPFPEKVAELAKRADGCGPGRYRDFDGDCHYYSTWYHWGRWVF
                     AGLAILLILIIFAALLRNSRRRRRLGRQPLYGTGWMAPAPPPYYPPPPQYSPHDQGVP
                     PPPGGYKYGEGGGYYGGNQPNNGYYGGNQEGIQLQPPQNAYHRATDNDYAPPPGPPPK
                     PAN"
     gene            2157968..2159842
                     /locus_tag="MYCTH_2295119"
                     /db_xref="GeneID:11508830"
     mRNA            join(2157968..2159565,2159645..2159842)
                     /locus_tag="MYCTH_2295119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658784.1"
                     /db_xref="GeneID:11508830"
     CDS             2158247..2159428
                     /locus_tag="MYCTH_2295119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658832.1"
                     /db_xref="GeneID:11508830"
                     /db_xref="JGIDB:Spoth2_2295119"
                     /translation="MHAGFNAGSTASPLSKGPGFPQYAEFDAGGKKDEDALPQMPSWE
                     GAEQKKVLVEEEAVEMSALKKPETGGEAARPMSPHSSRSPVNRSPYGPPGGGPGSGGY
                     HAASTVDYDGPYAQDAPAYNHPGVAYGEAEHGYGAGGFAMGPERRSPQAFNNVGYGGY
                     SNINNYGQARDYPGSGRQGSYDNYGAAHQQPYDSYDNFGGPQADQGYGIARHQTPSRE
                     LNNASPFPGDSRRSPAPQSPYGPDARRSPAPQGPYGAESRRSPGPAAYGGSPPYGGGP
                     DPRRSPAPQGDYGSRRSPAPRQGPYGGARSPPQRQYSNNGMHSPVGGVGGFGSNGPTP
                     LRNEGGFDFTSGYSRPPVERSAAASPVNGPGGYRQPSPSAEFGGGGGGGYSGYQPYKP
                     A"
     gene            2162459..2166575
                     /locus_tag="MYCTH_2295120"
                     /db_xref="GeneID:11505643"
     mRNA            join(2162459..2162742,2163099..2163868,2163949..2166575)
                     /locus_tag="MYCTH_2295120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658785.1"
                     /db_xref="GeneID:11505643"
     CDS             join(2162730..2162742,2163099..2163868,2163949..2166312)
                     /locus_tag="MYCTH_2295120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658833.1"
                     /db_xref="GeneID:11505643"
                     /db_xref="JGIDB:Spoth2_2295120"
                     /translation="MSSSNTQSSPEIARKAVPSGSTSSYTSPTSTTDTAPTVTTGTAR
                     TSTSEDSKSSSPFESTTGSTARSLSPIEQSSPLFDIGPLTSSPPREDEPRKAPAVPTS
                     PPPAPPAVLTNVRTPSRIPTLTSTEATPPDRTRADRSPSPEGPPSMAKPQPNRLQPRH
                     LSPNPNARGRSVSAQPPASREVEADGSRAVSNPLESRSLSKPSSEGSPPAAPDKRKRK
                     SWFPGVRLRANSDSSKPKIPRAWVMSPDNQVDYNTAPLVNGEKVPELWNEAGNVLVYL
                     HPKESNRGPCFKVPDHVFSSSARLVELLVTEMMAATSTSQGAGYFDVAPVEGPVTEGH
                     LYLPLGNTDLERLVAARNLFALLTHQPLVGTTENGTLFAAVLQVAGLLRRFNFSSFDG
                     SSFGEPVDTAFDFFMDRTGIADLRRSREKTLEALILAEQMKSWNLYNEAFAHAVGKYE
                     SILELKSPLYERISVSTRQRLDRAHLDLVNRLAGVNARLEAFEFPSLFAGTASSTSTE
                     EYKNVKFKEWRNSFSKMRNFVLGYYKGLFGNWPPRARSKKNYFSQSGLNRECLKILYS
                     DCCALYDLLVDRQSMTPRVIGEGYEEPEEDKKDKKEKKAEDASISALRKILSEFDKSS
                     PPVLPPIPFDVPKLPSMTAIYENFHELPAKKQAKYSKALQPHELQLMLIKSRNIDTET
                     LSMPFLLAYKDFELREAKGVNPADLPDQRIGYWLFLYVVLQSLPMLVVDAPGLRYTEG
                     VEYFLCEAPQGNPPWTDEAGQTRKMWFQTGNSNVVELSADVVMFSVEGTYMRSHCWLA
                     AKEWDAASSSGAPPVGAPPLAAFRDMNPSGASPPSRPPSSSSSTNGNTSARTTHQQQQ
                     QYHHHYSSTNSGNSSPHLRPRAGSMTTNDRARQAFRASMAIGLEPLPMPAAPPGFERG
                     SRVMSIGSLSSGGGGSAGRLSPAFGSPAFGSPAFASPGPAAGGGEMYQLGLRASRSAA
                     NLGQLAGPAGAGAGGISSQLRKSSYGGLGPSNLGPGGGGGEGGGPGGNEPLAKGSTFE
                     DILKGMDGKEKKKKKLFF"
     gene            2168371..2170440
                     /locus_tag="MYCTH_2295124"
                     /db_xref="GeneID:11508142"
     mRNA            join(2168371..2169254,2169317..2169431,2169487..2170306,
                     2170364..2170440)
                     /locus_tag="MYCTH_2295124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658786.1"
                     /db_xref="GeneID:11508142"
     CDS             join(2168733..2169254,2169317..2169431,2169487..2170091)
                     /locus_tag="MYCTH_2295124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658834.1"
                     /db_xref="GeneID:11508142"
                     /db_xref="JGIDB:Spoth2_2295124"
                     /translation="MSDNADRFMLDVVMESVPHRDIDAQETASSSASAEDCSDFFDFD
                     AYYNPGVETDVTTPPSEGEPADGSLPLAQGTTLAKNPSHAEDTPMPDAPAQESQSLNL
                     WPQLSGPQPPRDKVIFLESSPSPQPSGEMSPKRPPQVRSASGQRTRVIKDLDKTNKVR
                     ERGACYHCKINKKGCDDAEICKECSKRFEKKPSCSKRACIRKPLKEMIPPKLGRWNWA
                     NPSLLMPGRNQFEAGAESVFCSLSVNGPYLELRASRFALANERQDGVQSFQGVGIMPS
                     DLPSDENIYLWMERQILAENKPRFEAYMDKLLVGLASQQRARPQPWARQIPEQLVLET
                     LRMRCMCKVWSAKQLFLEQRKAQISPFDIRFASMKDSLRLLAGRRISELERKITEDLE
                     KYLGRKEPTSTHPMILVVKCK"
     gene            complement(2170714..2173346)
                     /locus_tag="MYCTH_2295128"
                     /db_xref="GeneID:11505412"
     mRNA            complement(join(2170714..2170828,2170892..2171255,
                     2171306..2172820,2172900..2173346))
                     /locus_tag="MYCTH_2295128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658787.1"
                     /db_xref="GeneID:11505412"
     CDS             complement(join(2171057..2171255,2171306..2172820,
                     2172900..2173006))
                     /locus_tag="MYCTH_2295128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658835.1"
                     /db_xref="GeneID:11505412"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="JGIDB:Spoth2_2295128"
                     /translation="MGSLVDIVTLENLEQKLFRWDPSSSSHLYALVDMGSNGIRFSIA
                     DLSPPRARQLRCIYRERAAISLFDALGGPSLLFPEETIKLVSQTLARFRSIAVDDYDV
                     PPSQMRIFATEAMRRAENATTMLEAIRSACPGLPVYVLAPPVETLFGSVGARSGFVDV
                     KGLFLDLGGGSVQMTYLDTYARPRESSTSPEVAAALAGQSLPFGAAHLTSVLDSSDAE
                     TQASEISRLRDSMSEAFRTLCAKFPSLATDAAEAQRGKAGEGEATAGIDVYLCGGGFR
                     GYGSMLMNRHPIQPYPIPSIGGFTVSGHLFGRTKDLLEFDKSFEGKIFGMSKRRRAQF
                     PAIVAVVDALISAVPRIRSVTFCSGGNREGALMMSLPTEIRHSNPLSHCGLVLRKHVP
                     FQPVPDAAPVEVVLDALRSAFPPDLNLASTTTIFGLRIDALYAEQIWSQLGCDAETNA
                     SAALHNAISYPDLPGLTHLARAVLGVTTCARWGASLAPVDEPLYKNLRALMDAADPDA
                     TFWADYTGSVTSAMAAIVRGWPKARGAIQDKIRFRATAQHHNPIRVQLEISVNPDAAM
                     GVGPDVIHETFRGLKKHRRSGREVSVTVQPLVKESSVLSG"
     gene            2176356..2178518
                     /locus_tag="MYCTH_2295130"
                     /db_xref="GeneID:11513127"
     mRNA            2176356..2178518
                     /locus_tag="MYCTH_2295130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658788.1"
                     /db_xref="GeneID:11513127"
     CDS             2176474..2178414
                     /locus_tag="MYCTH_2295130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658836.1"
                     /db_xref="GeneID:11513127"
                     /db_xref="JGIDB:Spoth2_2295130"
                     /translation="MNPHSGPATLPRGFKCPEYEAPRTPEPFPQTDDVQIPSAPRPRL
                     KLRRRVVSQLSAPTQHFLASVAAADVPIPSIEEPEIAADDYDTNATCPFPEFRYEPDE
                     GDMNFLRPQGRGLPAPKTPAPEFESSLPTSQYPNWTIDSISSVESTPEPDYESSRPST
                     SRSTQTSASSFSRFSLASEDDHYDNYDVEEESKDKDNCPLTPNEVVPLRDPAGLRGKA
                     RKAPWTKAMSDHLWSTFMLYLQDPKVTPFRMGKGCIPPHGVCLRVAREAKRSWKGSKA
                     WSTPTNSGEDRKSGSATPTAESSGTFIQWPHTCAATRAHLRELCRLKAGSWTNNYKFT
                     SRNITPFTQAAARHWNRRSTPARSPAPFATRDMSLSLAMSTSESMQPNGPLAQLAASH
                     PEPPEPTRSPPLAGQTLRTFEGEPSFAERRRLGSPFNASSYGPSSSGSLAAVLGLTGS
                     IPRRQSQTVGPRRTLQSPVRLSRSGTQKRRHTQSGVPRKRPSIGSDLWLDPSFGAAST
                     TTTTTSCNSEKAAATSSRSNKISIPKIPSVPTLSSSASMPNVGGQRDDSVLLPPPRLG
                     SPFTGESTNFSFPHRAHRMHQGASIDLGVLGRPFATVQHFSPPSNSPSTRNSLADRLA
                     YIDQRLSELRQRDTHHQPESPL"
     gene            2179491..2180956
                     /locus_tag="MYCTH_2295132"
                     /db_xref="GeneID:11513014"
     mRNA            join(2179491..2179752,2179893..2179944,2180026..2180956)
                     /locus_tag="MYCTH_2295132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658789.1"
                     /db_xref="GeneID:11513014"
     CDS             join(2179627..2179752,2179893..2179944,2180026..2180846)
                     /locus_tag="MYCTH_2295132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658837.1"
                     /db_xref="GeneID:11513014"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="JGIDB:Spoth2_2295132"
                     /translation="MVSFLRGWRGQFALAALFFIALASPAAASIGDQLPEFKECVEIC
                     KHENCGPGAEQQTAIPLHRRLLLWTCPAECDYTCQQIITAARQSRDPPQPVVQFHGKW
                     PFRRFLGMQEPLSVLFSLGNLAAHYYGLHHQVRPRIPAAYTMRPFYVFLARLGMVTWL
                     LSAVFHTRDFPITEQLDYFGAGASVLYGMYYAAVRIWGLDRPGNRRRLRAWTWFCGML
                     YACHVAYLRLWRWDYTYNTLACVVCGVVQNGLWSWFSWRRYRQTGETWAVWPGVVVMW
                     VLMAMSLELFDFPPLWGSLDAHSLWHLGTIAPAVLFYQYVTLAETALRRFCADGSS"
     gene            complement(2180961..2181717)
                     /locus_tag="MYCTH_2087754"
                     /db_xref="GeneID:11508821"
     mRNA            complement(2180961..2181717)
                     /locus_tag="MYCTH_2087754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658790.1"
                     /db_xref="GeneID:11508821"
     CDS             complement(2181066..2181686)
                     /locus_tag="MYCTH_2087754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658838.1"
                     /db_xref="GeneID:11508821"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Spoth2_2087754"
                     /translation="MSLTEATANPPPSQENSFPPPVLTLSKCILRPIHPMDAPAIQRA
                     CNSPVMAKYMSYRFPSPYTIEDAHRWIGIASSFRVPGSPDILPSLVICDPATNEVVGS
                     IGIKTKEDVEEFSFEIGYWIREASWGKGIMTEACRAYCKWLFEMYPKVNRLEADVFEG
                     NYASVKVLERCGFVHEGTKRKAGTKHGRVFDIWVYGLLREECELLN"
     gene            2182401..2184281
                     /locus_tag="MYCTH_2295135"
                     /db_xref="GeneID:11509107"
     mRNA            join(2182401..2182871,2182931..2183111,2183174..2183936,
                     2184024..2184281)
                     /locus_tag="MYCTH_2295135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658791.1"
                     /db_xref="GeneID:11509107"
     CDS             join(2182679..2182871,2182931..2183111,2183174..2183936,
                     2184024..2184197)
                     /locus_tag="MYCTH_2295135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658839.1"
                     /db_xref="GeneID:11509107"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="JGIDB:Spoth2_2295135"
                     /translation="MPAKSRFTRLDAFTKTVEDARIRTTSGGIVTIVSLIVVFFLALG
                     EWSDYRRIVVHPELIVDKGRGERMEIHLNITFPRIPCELLTLDVMDVSGEQQHGVQHG
                     ITKTRLRPLSEGGGDIDSKEIVLHSRDEAAVHLDPNYCGECYGAPPPNNAKKPGCCNT
                     CDEVRDAYAQASWAFGRGEGIVQCEREHYSEKLDAQRNEGCRIEGGLRVNKVVGNFHI
                     APGRSFSNGNMHVHDLKNYWDSPTKHTFTHTIHHLRFGPQLPESLTQKLGTKNLPWTN
                     HHVNPLDDTHQQTDDVNYNYMYFLKIVPTSYLPLGWEKTWAGFRERHSAELGSFGTSP
                     DGSVETHQYSVTSHKRSLAGGNDAAEGHQERQHARGGIPGVFFSYDISPMKVINREER
                     AKSFLGFLAGLCAIVGGTLTVAAAIDRALFEGTVRLKKLRSKDL"
     gene            2185912..2188191
                     /locus_tag="MYCTH_2295138"
                     /db_xref="GeneID:11513122"
     mRNA            join(2185912..2186106,2186203..2186509,2186584..2188191)
                     /locus_tag="MYCTH_2295138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658792.1"
                     /db_xref="GeneID:11513122"
     CDS             join(2186073..2186106,2186203..2186509,2186584..2188087)
                     /locus_tag="MYCTH_2295138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658840.1"
                     /db_xref="GeneID:11513122"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Spoth2_2295138"
                     /translation="MATSVIVVGGGLSGLSAAHTIYLAGGNVTVLDKQGFFGGNSTKA
                     TSGINGALTRTQIELGIQDSVKQFYDDTLKSARDKARPELIKVLTYKSAAAVEWLQDV
                     FNLDLTLVSRLGGHSQPRTHRGHDAKFPGMAITYALMQRLEELAETEPHRVKIIKKAR
                     VTSLNKEGNTITGVQYEHDGQTKTLNGPVVLATGGYAADFGEGSLLKKHRPDTYGLAT
                     TNGSHATGDGQKMVMAIGGNGIDMDKVQVHPTGLVDPKDPGSKWKFLAAEALRGEGGI
                     LLNADGDRFCDELGHRDYVSGMMWKEKDKGKFPIRLVLNSKASKVLDFHTRHYSGRGL
                     MKKMTGRELAKEIGCTPEHLQQTFQTYNAIAEGKQKDPWGKRFFHNMPLDINDDFHVA
                     LMEPVLHFTMGGIEINEKAQVLNKEKKPFEGLFACGELAGGVHGANRLGGSSLLGCVV
                     YGRVAGDSASNYLFQQALKGSAGAARLGQIALHIDPSTPGKISVEWAGAGGNEAPRAQ
                     AVPASAPAAKKETEEKPFSIPDKEFTMEEVAKHNKKDDLWVVVKGVVLDLTNWLDDHP
                     GGPQALLNFMGRDATEEFEMLHDDEVIPKYAPSQVIGRVKGQEVTLKV"
     gene            2189251..2191821
                     /locus_tag="MYCTH_2295141"
                     /db_xref="GeneID:11508828"
     mRNA            join(2189251..2191189,2191246..2191384,2191443..2191821)
                     /locus_tag="MYCTH_2295141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658793.1"
                     /db_xref="GeneID:11508828"
     CDS             join(2189347..2191189,2191246..2191384,2191443..2191536)
                     /locus_tag="MYCTH_2295141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658841.1"
                     /db_xref="GeneID:11508828"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="JGIDB:Spoth2_2295141"
                     /translation="MSHPPPKHLDLRSKSQASVSRPLRSPRLHIAGEVPPELSPLDAF
                     ALQSRLLAKQLEDSAKQGRRMSRLPPLTDDSPLIVQGRSDYFRSLSQDSGSEEEHPPL
                     QNVGLGLKTDIDDDVANRPRSMHPRLSQIPPTPDNSIPVPAVPNWSNTDPLKAKQPSA
                     PAPDEGFFGVGARRERSPSPMGTGPSQRQAEGRSATQDSLPCHSPGAGVSVTSSPDPP
                     AQSSFDAAGLVPPRPMFTKRSSSLNSSPLESTDEEGISTMSTSLHSMDSRKFSSSSSV
                     FSPAQPSFQRSPSVASDASGLPRPQFNFSRPLSRAGTPSVEAPARQASSDSHNSSLAA
                     DDTVCTPRSFTSEASREPTVDEGTGAAPSYIYSKFSLPRGKPVQRSSMILLNDPPARS
                     SMEQAVSPTSNAAHPGIGHPPPSPPARPPSSSENHQSDASRPSDEEHRGRSLGSHMND
                     AAAGKSLASASTSDSASTIKASKSVHSVAPTMSDLSAEEHVNKAIALHESGALQESTW
                     HLRHAAKQGHPTGMLLYALACRHGWGMRPNPREGVEWLRKAADSASLEIADEEDQVRE
                     GKKVDVAERKTHKAQFALSIYELGVSHMNGWGIEQDKALALRCFEIAASWGDVDALAE
                     AGFCYAQGIGCKKDLKKSAKYYREAEARGMNMVGNSWIHKPKYNDDNDKQPRSKSKSR
                     KSIFSRKKD"
     gene            complement(2191980..2193393)
                     /locus_tag="MYCTH_2136659"
                     /db_xref="GeneID:11508175"
     mRNA            complement(join(2191980..2193031,2193131..2193393))
                     /locus_tag="MYCTH_2136659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658794.1"
                     /db_xref="GeneID:11508175"
     CDS             complement(join(2192339..2193031,2193131..2193256))
                     /locus_tag="MYCTH_2136659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658842.1"
                     /db_xref="GeneID:11508175"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Spoth2_2136659"
                     /translation="MPGFDFSNYNRNAALHARGVPLPKATSTGTTIVGCIYDGGVVIA
                     ADTRATSGPIVADKNCEKLHYIAPNIWCAGAGTAADTEFTTSLISSNLELHALSTGRK
                     PRVVTAMTMLKQHLFRYQGYIGAYLVVAGVDPTGTHLFTVHAHGSTDKLPYVTMGSGS
                     LAAMAVFETQWKPSLTQEEAVKLCADAIEAGIWNDLGSGSNVDVAIITAEKTTLRRNY
                     IKPNERAQKLKSYAFPKGTTAVLDEKIIHKEDLSKFVTVHELTEQSGDVMEVDA"
     gene            2193880..2198636
                     /locus_tag="MYCTH_2295145"
                     /db_xref="GeneID:11509100"
     mRNA            join(2193880..2194125,2194188..2194857,2194907..2196553,
                     2196611..2198636)
                     /locus_tag="MYCTH_2295145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658795.1"
                     /db_xref="GeneID:11509100"
     CDS             join(2194024..2194125,2194188..2194857,2194907..2196553,
                     2196611..2198535)
                     /locus_tag="MYCTH_2295145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658843.1"
                     /db_xref="GeneID:11509100"
                     /db_xref="JGIDB:Spoth2_2295145"
                     /translation="MAFGFGGSSNTMLGASAGGAGVTQGNDLEVIQTESLGFLSIAGD
                     AKVQLTSKWSPAPAPTASLLSIASRKGLVAAAGPDAVHIATTESVRKAFEGEKNGDSE
                     VRSFTPQAKVPFPIRISQLAFTADEQYLVLSAESGGGLAVYDVQALTQGATQPAFEIS
                     TNGETLRALIPNPMPESANFCAIVTNNGNLFMANLAERQLVSGSNGPTLRSQVSSAAW
                     STKGKQLVAGMADGSIYQMTPDGAEKAHIPKPPNLGDYHVALVSWLENHVFLVVHNPT
                     NGQDPSVFHLITRQQPPGGTPSFTFQKLADPVEPFVSDKVPHHTVLRLKDFPPNLQDL
                     LLVSSTATESVGLLSRSKTPLATDKPAESITNVFTTTELADDSKRAQLPMSEDLTETY
                     PIGAALDLSSKNKVYKPIPADEIEFSPGPLPGLWLLNNEGVLSAWWIVYSESIRGGTT
                     YPGIASADAAPSVFAAPAPASTAPSAFASPASKAPTFGSPSSVTPAFGGPSALGAKPS
                     PWSTAASSSTAPAFGSSSFGSSAFGNKPAAPAFGQPSGLALGQKVSPWATGSTSGATP
                     AFGQSGFSSAGASAGKIFGSAAPASGGFANFASKGGFAGLASASGGSSIFGSKPGAPL
                     TSSAPEVSMDTDTAFPPPAAKTDKPAFGASPFVLGTTFKADKSTADDNDKPKEDGKSL
                     FGSGFGLSLDDAAKKPAAPESKDMDMESTTPPPVEEKPKSIFSQESTTPTTTPAPQRV
                     DFKSTTPASGPGLFGSKPTSASSLSNIFGAPKPAASIFGTPKVKQEEGDKADLSKIPE
                     APLPPDTTISKPPAKTEDAPLPPDFLGKPVKKEPISEAAPLPPDSAFTKSKPEAKEEK
                     PSTTPPEEAPLPPDFLAKPPAKEAPTLPSVPDSTSEGPSEEEQEEEEGEEGEEGEEGE
                     EGEEEEYESEAASEGSGIDVAKDLSPTTGFSRQTPGVTPQSSFGGMAGSAFSTISRTE
                     ADQSRPLFGDISKNAPPLFPKPAPLLQSPRSPSPVRGPQRSNLLRPSEPGRSLSAPGV
                     ASQLLGKKTLPAQSALGYSAGQRAQVDPNVQAQRKLAEKKRAEEQVLVDPEDQGIQQI
                     LQSKLEPTLQMHEFFAVRSKIEPLNPGREEVPGACETLWRDINRMIDILGLNSRSLQS
                     FILGHSTQFKEGGRTKEDLENMDDWVLVEASELGAVLDDEMARCAKGRIQDVQAAEDA
                     IKGFARDLAKLRAKEEDMRKIISTHIDPDQLAVAKSLPLSAEQATQQNELRRSYATFT
                     RLLAETEEALTMLRTRIASAGGASGKTPVPTVDAIIRTINRMTSMVEKRSGDIDVLES
                     QMRRLRLGSVGPGNGTPGPRSREGSPFATPQQQRRSLLLSSPEKDGSASSRLRESMAS
                     SVASYGGRGGTPLSSSVSSLSSPRKKLSMYTAEEKRELRARQANRRGALQMLRNSLAK
                     AGPNVSRLRDD"
     gene            complement(2198674..2200817)
                     /locus_tag="MYCTH_2313457"
                     /db_xref="GeneID:11511573"
     mRNA            complement(join(2198674..2199940,2200037..2200311,
                     2200394..2200478,2200540..2200817))
                     /locus_tag="MYCTH_2313457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658796.1"
                     /db_xref="GeneID:11511573"
     CDS             complement(join(2199170..2199940,2200037..2200311,
                     2200394..2200478,2200540..2200551))
                     /locus_tag="MYCTH_2313457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658844.1"
                     /db_xref="GeneID:11511573"
                     /db_xref="InterPro:IPR000133"
                     /db_xref="JGIDB:Spoth2_2313457"
                     /translation="MAWTIFRIAADLSHITAKCILVFSIHRNRSSEGVSLLTQLFYAL
                     VFVTRYTDLFEESFAWNYFFKVFYLLSSFYTIAIMRFVYPRTREREVAWKLSALILTG
                     SLFLSPFIMLIFDPSRMWGFREWLWVFSQVLESVCVLPQLLLLRQTTVPTVITSFYIV
                     FLGSYRGLYLINWILKELDTNMRKPNPISVIFGVVQTALYLDFAWVYWSRQRVKLRNG
                     GVVDADDLSRGWLLRRIFGSKRFARDIDGADANDDDEENAFNHHHVHGGGSVRPKWGS
                     RGISISADEGVLEHERERGRALADDDDDDDDNDEEHGVTASLDPDAKMRDPDELARAL
                     DEEDDEDPAGAAAPGSSASQQKKGKELHTDANGMPSGVRNDEWDDD"
     gene            2201397..2204151
                     /locus_tag="MYCTH_2295152"
                     /db_xref="GeneID:11508392"
     mRNA            join(2201397..2201682,2202018..2203476,2203551..2203721,
                     2203831..2204151)
                     /locus_tag="MYCTH_2295152"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658797.1"
                     /db_xref="GeneID:11508392"
     CDS             join(2201591..2201682,2202018..2203476,2203551..2203721,
                     2203831..2204070)
                     /locus_tag="MYCTH_2295152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658845.1"
                     /db_xref="GeneID:11508392"
                     /db_xref="JGIDB:Spoth2_2295152"
                     /translation="MLEISISVSSFPSLKSPRQRLLKNPKSNSPRQQQQQQQRQRGPL
                     SSIISATKRLSFDPSPSPPPPERTTPTARRQTRQTHQQQQQQFPEEMEVTESPADAPG
                     SGRRRPLRLGAGTPVVGSSTLLQKVVDHAGGEGGEDQSELHPHQLGNSSPIERRVATR
                     GRTKGRRVGVERRAAAAAAATATAAGDGGATTDAAVSPSAGRGAGRSAMPGFGGLLGK
                     PAQIKQPLARGQSSSGPMEEEGREEEAAAAEEDDEDEEEEEEDNIVEDSLNRSEDGEE
                     QGVQEEEDQQEEGAQEIGDREAAQLLGRKRPRRSLPAPSPELGSGAAEESPLPKRRRR
                     READSPAQQQQPVRKARVGRPAKPSRQQHPPSSPSQQPEPETQAQPKPRRQPKAKKQP
                     RKPRAAEDGDGDGDGDGDDEGPSGSVAVTVQRFRKPQGAGDAAAESDDEPGAKALRGD
                     IPFANRGGVNAVDVLSTLCEELIEAYMGKLEERGRAAEDAATRREQKTMYRALEAFRE
                     ELRTRLLEHTIALDTLHALRKRVRAAQKERLALRDEILRIRAEREQVALRMDAIRIRH
                     EATSKKALRHMSLSSAMHDIDMAVEKGLAAPELSPAEQKKADLANLELLISRVADQAC
                     TKSDGGGALKQIKEFNGFLERAAAVLERR"
     gene            complement(2204152..2205409)
                     /locus_tag="MYCTH_2295153"
                     /db_xref="GeneID:11507983"
     mRNA            complement(2204152..2205409)
                     /locus_tag="MYCTH_2295153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658798.1"
                     /db_xref="GeneID:11507983"
     CDS             complement(2204232..2205326)
                     /locus_tag="MYCTH_2295153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658846.1"
                     /db_xref="GeneID:11507983"
                     /db_xref="JGIDB:Spoth2_2295153"
                     /translation="MGWFDGWFGGSDNSSSDPLRRLDPKLREFLERESPVKYNAPPTS
                     KTAAAPPQQAQQQPPDQAAQPPTTTATTNATTNASDSAVEQQEQPRVPPQSLFPDGRY
                     AHLWKTYRPLAEIEAETKSDNEKLTDVIEAFKERRGLIGRAALENCAEEQVEWSRCMK
                     SGSWRARMTMCRDEVHKFERCYNAQSRLLKALGYLSVQGRSPEVDEDIQMRADELYHR
                     MLDQEREAEKARAEGREVPAFKPLFDDDDDNNNSNSNSNNNNGGRRGDTAAAGAPSSE
                     AAKVPEPSAATLASWKEKLEKLPPEEREAEEKALRAEHRAKAEMAMQIQKLWEEQAKE
                     REARKAEGKETIMDKFASLAASWRGPKSSS"
     gene            2206718..2207458
                     /locus_tag="MYCTH_2295154"
                     /db_xref="GeneID:11513081"
     mRNA            2206718..2207458
                     /locus_tag="MYCTH_2295154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658799.1"
                     /db_xref="GeneID:11513081"
     CDS             2206842..2207435
                     /locus_tag="MYCTH_2295154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658847.1"
                     /db_xref="GeneID:11513081"
                     /db_xref="JGIDB:Spoth2_2295154"
                     /translation="MILSANVSLTVLLAAAAQHVVAAPQRNSNGTARQAPSNEDGNGN
                     GIVRVQTVANPAPAPSAIPSEVLASQQSSAAAVASAVAAANEAAAASGLKELPGLQAD
                     ESPASLLPLPALANGDAITPPAGADSSTTVTPGPTEVASQSDVAETQSLEGGLRQLPG
                     LGAGAASPSSLAPLPTPPSVDTSVSHVGRVEGIHPVD"
     gene            complement(2209044..2210636)
                     /locus_tag="MYCTH_2295155"
                     /db_xref="GeneID:11512962"
     mRNA            complement(join(2209044..2210208,2210305..2210636))
                     /locus_tag="MYCTH_2295155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658800.1"
                     /db_xref="GeneID:11512962"
     CDS             complement(join(2209138..2210208,2210305..2210499))
                     /locus_tag="MYCTH_2295155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658848.1"
                     /db_xref="GeneID:11512962"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2295155"
                     /translation="MASSTKIFSLEGRGLKLDTAEDLEPHIADLRAMADVEEVHLLGN
                     TLGVGACKLLGEVLATKKSLRVANLADIFTGRLLSEIPEAISSLLTSILNLPNLNTVN
                     LNDNAFGLNTQAPLVAFLAEHVPLQHLYLNNNGLGPHAGILVADALSELHAKKEAARK
                     AGQQVPDLETVICGRNRLENGSMTAWAKAFKLHNKVKEVKMVQNGIRQEGISHLLKEG
                     LRYATQLEVLDLQDNTFTLLGARALAAVTPGWTELVDLGVGDSLLGAKGGVVLAKALK
                     KGKNTKLKILRLQYNEITSSGVKALAEAVEEALPALRKLELNGNKFTEDDESIIALQD
                     LFEARKEKQAGDVVVEDEWGLDSLSDLEEESEGEEEEEEEEEEEEVEPEERAEKLVKE
                     AEEAQQEPVAQRKDKEVDELAEKLGKAEI"
     gene            2210929..2212687
                     /locus_tag="MYCTH_2295158"
                     /db_xref="GeneID:11508695"
     mRNA            join(2210929..2211757,2211838..2212687)
                     /locus_tag="MYCTH_2295158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658801.1"
                     /db_xref="GeneID:11508695"
     CDS             join(2211253..2211757,2211838..2212400)
                     /locus_tag="MYCTH_2295158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658849.1"
                     /db_xref="GeneID:11508695"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2295158"
                     /translation="MTRPDSPIEDSPLSSMASSEDEFPDEVTEVLDDGPPPKRLKITA
                     RSNTPSAVAPEPEAEPDPLEGMSDVSSDTDGDVPSSPVNARQDEDDFQEQITVCAWEG
                     CKTGDMGNMDKLVEHIHNDHIESRQKKYTCEWVGCSRKSMPHASGYALKAHMRSHTRE
                     KPFYCYLPECDRAFTRSDALAKHMRTVHETEALRPSDPVPKSMQAATGKSKNLKIIIK
                     TPQSHASGQDDAVDDASPGDESSGDMFTPLTQEQGFSPEELNMPLERLVKLCRLQVKW
                     AEEEGEQLRAECKLWEDLYKQEWLEKEVLLDQVVQSEQAWQKRQKALLEGDADVAPAG
                     NGEAAPADASASREEPVTADA"
     gene            complement(2212791..2213818)
                     /locus_tag="MYCTH_2087774"
                     /db_xref="GeneID:11505952"
     mRNA            complement(join(2212791..2213272,2213348..2213600,
                     2213658..2213818))
                     /locus_tag="MYCTH_2087774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658802.1"
                     /db_xref="GeneID:11505952"
     CDS             complement(join(2212974..2213272,2213348..2213600,
                     2213658..2213663))
                     /locus_tag="MYCTH_2087774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658850.1"
                     /db_xref="GeneID:11505952"
                     /db_xref="JGIDB:Spoth2_2087774"
                     /translation="MDSVSTYSAASLAWLAIQATTLIVWPSLISTLLRADGPAQGAPY
                     GVANSNASLEQYFARSLGLAQLALGSLLLVLSGALPLDSPANPPDNTSNPTPSASAAV
                     LLTTLYHAAAAFYAYTRYHATRGLTAYLLGCLASSVLAAYGLGVLLFAGDRNRRVSRR
                     TGADKSTSGWPFKNAEADKKKKKRS"
     gene            2213982..2216088
                     /locus_tag="MYCTH_2295162"
                     /db_xref="GeneID:11505633"
     mRNA            join(2213982..2214115,2214195..2216088)
                     /locus_tag="MYCTH_2295162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658803.1"
                     /db_xref="GeneID:11505633"
     CDS             2214295..2216067
                     /locus_tag="MYCTH_2295162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658851.1"
                     /db_xref="GeneID:11505633"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="JGIDB:Spoth2_2295162"
                     /translation="MSAILSADDLNDFISPGVACIKPVETLPAQPPSSSEQPQSLEFE
                     VILDGQQPSATGASTNAPAQISLTDCLACSGCVTSAEAVLVSLQSHNEVLSMLDSAPA
                     LRITRDSDGGSYGAGKFKVSGLEDPAAKLFVASVSPQTRANLAAACGGGVTARQAGWM
                     IEQLLMGPAGLAAGGKHGNGFTWVVDTNTAREACLVLGSDEVLGRREGQGSSDSPTPP
                     VLTSSCPGWVCYAEKTHPYVLPHLSRVKSPQALMGTMLKTALSRLLGIPPDRIWHLAV
                     MPCFDKKLEASREELTDAVWAGSGKPGKGVRDVDCVITSKEVLMLAASRGVDFFGLPK
                     SAPVQQPEFPDPTIQRFLFPAQHRKQVREEGTSGGNLHYILHDVQSRHPGSRIQMARG
                     RNADVFEYSVVKPSGEAAFKAARYYGFRNIQNLVRKLKPAKPSRMPGGKPVGSARRPG
                     SKSAGLDYAYVEVMACPGGCTNGGGQIKADDQVIIDRKGLGEKPGPDEQKAWLAEIDE
                     AYFSGDEPDAAHGIGNGNSTGLVAGISPSHIRDTLAHWEDITGIQLDRLAYTSYREVV
                     SDVGKPVSDTERVVQLAGKIGGGW"
     gene            complement(2216088..2217281)
                     /locus_tag="MYCTH_2295164"
                     /db_xref="GeneID:11508859"
     mRNA            complement(join(2216088..2216814,2216876..2217205,
                     2217263..2217281))
                     /locus_tag="MYCTH_2295164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658804.1"
                     /db_xref="GeneID:11508859"
     CDS             complement(join(2216109..2216814,2216876..2217045))
                     /locus_tag="MYCTH_2295164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658852.1"
                     /db_xref="GeneID:11508859"
                     /db_xref="JGIDB:Spoth2_2295164"
                     /translation="MSKGGRVPDVWEDDDWEVLADRAAKEEPPKPEPQAPMTRAERLA
                     KHAEEQRRLWQSAEAPDDPPFLPTMADQVPLTMPFKTPIKVLSRKPAPQVLAKRDPVT
                     GLEQLTLKEDEDDEGEEKKQQQPQESPEEIRKRQQRELEEKQRRYEEARAKIFGDSNP
                     SSGQSSPRTGTPPSGGGEGRQGHRGRGRGRGGRGRDQDNSRQDRRQQNNQRQNNQQQN
                     NQQPGPTRELFDPGYSPKPGFNLQKRGDSYSQSGTDTRSNIPREEDQVIRAPRGPDGS
                     GRGGFGFARRGRELG"
     gene            2217298..2218072
                     /locus_tag="MYCTH_2295168"
                     /db_xref="GeneID:11505842"
     mRNA            join(2217298..2217453,2217521..2217700,2217784..2217973,
                     2218038..2218072)
                     /locus_tag="MYCTH_2295168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658805.1"
                     /db_xref="GeneID:11505842"
     CDS             join(2217556..2217700,2217784..2217929)
                     /locus_tag="MYCTH_2295168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658853.1"
                     /db_xref="GeneID:11505842"
                     /db_xref="JGIDB:Spoth2_2295168"
                     /translation="MNSDDLMSDPAHPANHSSDSKGGVWNTKKFRDEYEMYKNRLQDQ
                     RFSVAEYPDPLSPRPPHPKQYPSGTSPELERKLQELIAQVKAGRGVSGSSAA"
     gene            2221770..2225284
                     /locus_tag="MYCTH_2295173"
                     /db_xref="GeneID:11505660"
     mRNA            join(2221770..2221834,2222362..2222488,2223077..2223549,
                     2223606..2225284)
                     /locus_tag="MYCTH_2295173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658806.1"
                     /db_xref="GeneID:11505660"
     CDS             join(2222471..2222488,2223077..2223549,2223606..2225061)
                     /locus_tag="MYCTH_2295173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658854.1"
                     /db_xref="GeneID:11505660"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2295173"
                     /translation="MSYFNQSGASTPSRALSLAQPSHGEEQEGSRQKSGNGIDRTAAS
                     TPTPPGAQAPAAKGKLTIKVTEARGLRKCQAPYVVVVFQRSELISSGPRPTEDDDEAA
                     INAVATGGMPMKRQGSDSGRPMAIPMRSRQSSNTSISDFNTFRNRNTRRSFTNPKWDA
                     EAIFDVVDSDKLVDISVYGRGQSGEEFLGHVDFQAVTTEKEPPVRGWFPLKGHADTMA
                     ENAPTGEIYVESFYQRTEQKHFGPEDFQILRLIGKGTFGQVYQVRKKDTKRIYAMKVL
                     SKKVIVQKKEVAHTVGERNILVRTAMADSPFIVGLKFSFQTPSDLYLVTDYMSGGELF
                     WHLQKDGKFEEKRAKFYIAELILAIQHLHENDIVYRDLKPENILLDANGHIALCDFGL
                     SKANLTKNDTTNTFCGTTEYLAPEVLLDESGYTKMVDFWSLGVLVFEMCCGWSPFYAE
                     DTQQMYKNIAFGKVRFPRDTLSLEGRNFVKGLLNRNPKHRLGAINDAEELKQHAFFAD
                     IDWDALSKKLITPPFKPQLKSDTDVSYFDPEFTNALNTNGSLNERAAALAKGYATSTP
                     LSPSVQANFQGFTFVDESALDDHMRDRFSKDEDEGMDDADGKADDDWDDLNDVDARSS
                     HRMSGVVRGSNNDEQLFGASGFDM"
     gene            complement(2226779..2227893)
                     /locus_tag="MYCTH_2295174"
                     /db_xref="GeneID:11508770"
     mRNA            complement(join(2226779..2227145,2227483..2227576,
                     2227699..2227893))
                     /locus_tag="MYCTH_2295174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658807.1"
                     /db_xref="GeneID:11508770"
     CDS             complement(join(2226880..2227145,2227483..2227576,
                     2227699..2227716))
                     /locus_tag="MYCTH_2295174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658855.1"
                     /db_xref="GeneID:11508770"
                     /db_xref="JGIDB:Spoth2_2295174"
                     /translation="MISRASGARKAVAAVSRLATRNAVPMRTFMAPTVSRRADFVQEL
                     YLKELKAYKPTPIKESDAVGQVATFNLPKAPKSPEEADLASSLKEYEEMAVEVEGQEG
                     AAAGQPAPAVQDWLVEEEEEPHH"
     gene            complement(2228029..2229907)
                     /locus_tag="MYCTH_2295176"
                     /db_xref="GeneID:11505458"
     mRNA            complement(join(2228029..2228775,2228843..2229702,
                     2229764..2229907))
                     /locus_tag="MYCTH_2295176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658808.1"
                     /db_xref="GeneID:11505458"
     CDS             complement(join(2228431..2228775,2228843..2229702,
                     2229764..2229806))
                     /locus_tag="MYCTH_2295176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658856.1"
                     /db_xref="GeneID:11505458"
                     /db_xref="JGIDB:Spoth2_2295176"
                     /translation="MKAFGCPLLPAALLAAAPAVSEPVWYCPPGSGGTCYSIAIPVSS
                     ARAGSGNIYFRIKAPTSLQWVALGTGEGMVGANIFLMYQDGKGNVTLSPRLGVGHSEP
                     MLDTSSTAARLTLLAGSGVSEDGSTMTANVACSNCESWDGGEMSLQSSSSGWIGAWRQ
                     GPSLATTDRATTIDQHDNVAQFRVDLTKATVSADSNPFLSTGTDEGGDGSEPGAGPDS
                     GPGSDPGSSGGFTQISGSSKPAVLVAHGIIMALVMGLFYPLGSTIMPLIGKWWVHAAW
                     QAVAFCLMWAGFGLGVVAGRRILGDPWNETHTVFGAVVICLLGIQPVFGILHHLHYLK
                     VQRRGLISYVHIWWGRILMVLGVINGGLGLKLAGEEDGPVVAYSVISGVVFLGYLGYK
                     LCRFFRHGTSETHKMAGEAPAAA"
     gene            complement(2232570..2234465)
                     /locus_tag="MYCTH_2295177"
                     /db_xref="GeneID:11505764"
     mRNA            complement(2232570..2234465)
                     /locus_tag="MYCTH_2295177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658809.1"
                     /db_xref="GeneID:11505764"
     CDS             complement(2232708..2234360)
                     /locus_tag="MYCTH_2295177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658857.1"
                     /db_xref="GeneID:11505764"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2295177"
                     /translation="MHSKADPALNTVRGFNGTPVVSGDEDSDYCPTPQPGEKGRAKKV
                     RKPHAIDDVVSANCSPGLRPQVSQGGLSGISRLRMEFDALNIAGNSTANSTAASSRTT
                     SLTCSESLRSPFAKDATATSSGRDSGYKSRTESIASSGDETASHSSRTSTRYEINLEN
                     DFASEANGRAAEGAVPPRRKMTADDFEQLRCLGKGAYGTVLLVKQRTTGRLFAQKQFK
                     KASLVVHKKLIEQTKTERQILESVNRHPFVVKLYYAFQDQEKLYLILEYGQGGELFTH
                     LSTERMFSEETAAFYMAEMVLALTHLHNDLGVIYRDLKPENCLLDAEGHLLLTDFGLS
                     KVAVDDADACNSMLGTVEYMAPEVIQGKKYGRAVDWWSLGALGFDLMTGHPPFRGPNN
                     AKIQDNIVRQKLALPFFLSPDAKDLLTRLLRKDPSKRLGSNMPKDLDTIKKHRFFRKI
                     DWKRLAARELEPPIQPVITDPELAENFSPEFTEMSLSPVVGRFADANGGKDGDLWGDV
                     GCDGGDRHGGAEDEPGKDDLFGGFSFVAPHSLLESHGFRVPA"
     gene            2235676..2237804
                     /locus_tag="MYCTH_2295178"
                     /db_xref="GeneID:11505801"
     mRNA            join(2235676..2235795,2235877..2235907,2235970..2237804)
                     /locus_tag="MYCTH_2295178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658810.1"
                     /db_xref="GeneID:11505801"
     CDS             join(2235748..2235795,2235877..2235907,2235970..2237489)
                     /locus_tag="MYCTH_2295178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658858.1"
                     /db_xref="GeneID:11505801"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR014906"
                     /db_xref="JGIDB:Spoth2_2295178"
                     /translation="MMHPSRKAYVEDAEPENQGGVDLDAIPIDRDYNIPSASAGIAPE
                     KASALLSQFERRRLAATIAVPTDDARVRAKLRELGHPITLFGEGPADRRDRLRELLTE
                     QVQAQQASAQEKADVEMQDAEKEEEEEEAEEQEEEFYSRGTDELLQARRDIAQFSIPR
                     AKRRIEFQKREATIPLRTHAKFRKGIKDRLQSFELQGSQTAGDRHVSMTRISPNGKMV
                     ATGNWGGQVKLLDIPTLEHKRTLRGHTNKISGISWMPGATLPERNVSEETVNLASGGA
                     EGQIHLWSLSQDTPLATLSGHSQRVCRVEFHPSGKYLASASEDTSWRLWDVATSTELL
                     LQEGHSRGVYAVSFNTDGSLLASAGLDSIGRVWDLRSGRTVMILDGGTDGHIKPIYGL
                     DWGSDGHRVLSASADGWIKCWDVRKVQQQGGIGAHTSAVADVRWFKGLDDPVEGTPPG
                     QDEKGAQLPKKSGTFFVSAGFDHKVNVFSADDWALVQPLTGHTGPVASVDVSRDGRWI
                     VSGGHDRTVKLWGRNDSAGMFGDD"
     gene            2238061..2240154
                     /locus_tag="MYCTH_2295180"
                     /db_xref="GeneID:11513213"
     mRNA            join(2238061..2238739,2238853..2240154)
                     /locus_tag="MYCTH_2295180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658811.1"
                     /db_xref="GeneID:11513213"
     CDS             join(2238266..2238739,2238853..2239902)
                     /locus_tag="MYCTH_2295180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658859.1"
                     /db_xref="GeneID:11513213"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Spoth2_2295180"
                     /translation="MSSIDRYRPLREGYQPPSLPPKPVPPAIDRLSKSPSRRRDIPPA
                     VPSPPTHSSRTSPPRPQSRRSAPSPARSSPPRTSQSRPNQWFFTADEVASSPSIIDGL
                     PLAEERLRRAKGVNFIYQAGILLELPQLTLWVAGVFFHRFYMRYSMVEERGGIHHYNI
                     AATALFLANKTEENCRKTKDLIIAVAKVAQKNTKLVIDEQSKEYWKWRDSILAYEELM
                     LEALTFDLLVDNPYVRLHEYMGQLNLLRNMRLRDSVWAFCNDACLTVLPLLLNARDIA
                     IAAIFFATAVTREKIDDVNGEPWWKYLRGSETHTVNAVNLMIEFYKENPLRKQDSKVP
                     GSPKFDLESTRRRGELSLSQMDLDSSQYNTPTPPAGTDRGGTQSPRPGGARPNGRTGG
                     ESGDGKEVAIKKEDLSDSSAARIGAAGAEPASQAGDRGDSDAALKAAANDLSTHRRAS
                     ASSLNGSAPISEGGLVSPRIRRRSEDPGGWEEREAKRPKLEEDDDDDDVDEGEIKGS"
     gene            complement(2240185..2241678)
                     /locus_tag="MYCTH_2295183"
                     /db_xref="GeneID:11508641"
     mRNA            complement(join(2240185..2241106,2241163..2241487,
                     2241552..2241678))
                     /locus_tag="MYCTH_2295183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658812.1"
                     /db_xref="GeneID:11508641"
     CDS             complement(join(2240407..2241106,2241163..2241487,
                     2241552..2241600))
                     /locus_tag="MYCTH_2295183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658860.1"
                     /db_xref="GeneID:11508641"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="JGIDB:Spoth2_2295183"
                     /translation="MIVAKEFNRNHFARDSDFTISTNGPQPPTIVQFGANSPQELARA
                     STLVAPFSNGVDLNCGCPQSWACAETLGAALMEKRELVRDMVVETREYLRRDGWGVGK
                     EKDINNPKGRSVSVKIRVHKDLRKTMDFITTVLGPDQDRHIDWLTIHPRTRSTPSSIP
                     INLEALEVLTSTFGDRVPILLSGDVFALNALPFTSPLLASAPTFTQSISNTKSHSTTT
                     TTTATISAAAAAAETLTEDSPNPSDRRPSPATYHIPKLAGLMSARALLANPALYAGYE
                     ACPWEAVETFLSNVARAPLPHKLVLHHLSEMCGPGMGPNKASLLTKQERAAMLASGNM
                     LDLIDYLDTVRGLKRRGEQVGLS"
     gene            <2242255..>2244275
                     /locus_tag="MYCTH_2106437"
                     /db_xref="GeneID:11505655"
     mRNA            join(<2242255..2243116,2243168..2243958,2244072..>2244275)
                     /locus_tag="MYCTH_2106437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658813.1"
                     /db_xref="GeneID:11505655"
     CDS             join(2242255..2243116,2243168..2243958,2244072..2244275)
                     /locus_tag="MYCTH_2106437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658861.1"
                     /db_xref="GeneID:11505655"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="JGIDB:Spoth2_2106437"
                     /translation="MTDSRNPVIGLLGGGQLGRMLCEAANPLGIDIAILDEDKSPAKQ
                     AHDTSRHVTGSFKDPARIRELAAQSDFLSVEIEHVETEVLEDIEKNGVEVKQADGSTK
                     THKPPVHPSWRTIRLIQDKYLQKEHFRTSDKAIPIADQVAIESGPAASSSLKAAAAKF
                     GFPFMLKARKGSYDGRGNFKVSSEADFDAAVKALGGLSLYAEKWAPFVKELAVMVIRT
                     EDDNGRLKSCVAYPAVETIHEDSICTKVFMPPRNVSETVCEAARKLATEVVSTLWGRG
                     VFAVEMFLLEDGSLMVNEVAPRPHNSGHYTIEAVPQMSQYKAQLHAVLDLPVPQKLTP
                     RVSSSIMLNILGGATPSAHLKLVELARNTIDDDMDVYLHLYNKASKPGRKIGHITLTS
                     ASPIHELEAKAKPLIELVDQIRIDRINASAETLRPKQDPPATSSSSPAPATEQKKPLV
                     LITMGSDSDLPVLKAGLDILREFGVPYALDITSAHRTPRYMMRVADEAAGRGIKVIIA
                     AAGGAAHLPGMLSSETPLPVIGVPVKATHLDGIDSLLSIVQMPRGVPTATVGINNSTN
                     AALLAIRILGSFMPEYQDKMRKYQGEMEEQVIVKGNKLREVGDIEYLAAKGK"
     gene            complement(2244406..2245489)
                     /locus_tag="MYCTH_2295186"
                     /db_xref="GeneID:11512913"
     mRNA            complement(join(2244406..2244675,2244802..2245098,
                     2245155..2245489))
                     /locus_tag="MYCTH_2295186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658814.1"
                     /db_xref="GeneID:11512913"
     CDS             complement(join(2244546..2244675,2244802..2245098,
                     2245155..2245306))
                     /locus_tag="MYCTH_2295186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658862.1"
                     /db_xref="GeneID:11512913"
                     /db_xref="JGIDB:Spoth2_2295186"
                     /translation="MRHTTLSPLLSSLLLVGRLATAAPVVNADGDCVPYTICVDGVNA
                     CGIRWGECYNVCDASAKPVAPPCPGTEEPPSPTTRVTTKVTTLEPKPTTTKASTTKGH
                     TVTKTVKPPVTPTPTKFTTSTTRPSSTCSTDVTVCWDGINECGMMYGGCFPDCKPWPT
                     FTPPPCPTTTTKQTPTVITSVTMLPILTVPHP"
     gene            <2246951..>2247798
                     /locus_tag="MYCTH_2114542"
                     /db_xref="GeneID:11508474"
     mRNA            join(<2246951..2247054,2247211..2247653,2247719..>2247798)
                     /locus_tag="MYCTH_2114542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658815.1"
                     /db_xref="GeneID:11508474"
     CDS             join(2246951..2247054,2247211..2247653,2247719..2247798)
                     /locus_tag="MYCTH_2114542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658863.1"
                     /db_xref="GeneID:11508474"
                     /db_xref="JGIDB:Spoth2_2114542"
                     /translation="MRLQALTLSLLAAAGLASPIRSAASEELYTLRLSSADKSLDGRY
                     LTTIPDSGNANTTALVVYTSSSKPGDAFIKFHPVVNPSTKLAELRTPSSSSNVALAVV
                     GTNGLFDFASVADPDDTADDLPEGTKVDWTSFRLHQEGDIGTVEYEGDDDAVAEGNWF
                     AFPIRVSEATKEGEAWGVKWKDGSAWTTTDYLPVKVVYEPAYVIAKDE"
     gene            complement(2247897..2249357)
                     /locus_tag="MYCTH_2295190"
                     /db_xref="GeneID:11505657"
     mRNA            complement(join(2247897..2248583,2248644..2248795,
                     2248896..2249357))
                     /locus_tag="MYCTH_2295190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658816.1"
                     /db_xref="GeneID:11505657"
     CDS             complement(join(2248263..2248583,2248644..2248795,
                     2248896..2249265))
                     /locus_tag="MYCTH_2295190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658864.1"
                     /db_xref="GeneID:11505657"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="JGIDB:Spoth2_2295190"
                     /translation="MAALRSTTSMLLGAASRPALRATAAVPAAVRGMAQVSDATASGD
                     KPRLKTFQIYRWNPDTPTEKPRMQSYTLDLNKTGPMVLDALIRIKNELDPTLTFRRSC
                     REGICGSCAMNINGTNTLACLCRIPREDSSDMKIYPLPHTYVVKDLVPDLTQFYKQYK
                     SIKPYLQRDTPSPDGKEYRQSREDRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPA
                     ILLQSYRWLADSRDERKAERKEALNNSMSLYRCHTILNCTRTCPKGLNPGLAIAQIKK
                     EMAF"
     gene            complement(2249596..2250903)
                     /locus_tag="MYCTH_2295193"
                     /db_xref="GeneID:11508193"
     mRNA            complement(join(2249596..2249849,2249932..2250903))
                     /locus_tag="MYCTH_2295193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658817.1"
                     /db_xref="GeneID:11508193"
     CDS             complement(join(2249787..2249849,2249932..2250765))
                     /locus_tag="MYCTH_2295193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658865.1"
                     /db_xref="GeneID:11508193"
                     /db_xref="JGIDB:Spoth2_2295193"
                     /translation="MTFQTPGAPAAKRRRIEEANATLRKPFRSPLISRRDGNPPGSES
                     QQNSPSVNRGSFSTKINAQAPTTPAPARGYRSSSAATPLSSVQNRAPSAAGPKAPASP
                     TSRQSCNPGRGTTELRPGTAAGENPAEQGDLLHQLHLAQADLGNLLRSTQSRLDLARQ
                     ARHIEQASATKSGPGEPVDAELRAMTARWKSTSRQAAEELFGLIRERVEGMGGVKAWG
                     ATRRWQHGSSWATMEGESTGGRKGDTVGEEGNGVFEGEEVVAVEEEKKTRDEEEEEDA
                     ESSLNIEPDVLGYDPVEEKWRD"
     gene            complement(2251088..2254240)
                     /locus_tag="MYCTH_2295196"
                     /db_xref="GeneID:11508515"
     mRNA            complement(join(2251088..2251700,2251767..2253707,
                     2253762..2253908,2253971..2254240))
                     /locus_tag="MYCTH_2295196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658818.1"
                     /db_xref="GeneID:11508515"
     CDS             complement(join(2251276..2251700,2251767..2253707,
                     2253762..2253908,2253971..2253995))
                     /locus_tag="MYCTH_2295196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658866.1"
                     /db_xref="GeneID:11508515"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="JGIDB:Spoth2_2295196"
                     /translation="MKGLLWLSLLLQAIAFTFADAQADQHVLGGDAAEKTDGDSFRAE
                     IAEQSRGQTAREPGSDLVDAALAELHKLYQPLHHRARKQHGIFGTLLHLALKAVPTFR
                     LSAPTSESSSRHVLSGKLQQATNLLEESARKNNSDALYILAEMNFYGNFSHPKDFPAA
                     FDYYHKLALLNGNSSALYMMGLMYSTGIGGAVERDQARALLYYTFAANKGHTRAEMTV
                     AHRHHAGIGTPKNCELAVKYYKRVADKAIAWYRSGPPGGRAWIAESHRIADDNGGAYG
                     EGASVASAGGNALKAHPNSDAYASIEDIIEYLDLMSQKGDFKASFNLGRIYYEGQRGL
                     NKNVALARKYFLDVAQKYWRKNRPVDNPKTGLDRTAGKAAGFIGRMYLRGEGVEQDFN
                     RAKFWFERGDSLKDAQSQYGLGLLYLNGYGVKADPSRAIDYLKTAANQDYAAAQVQLG
                     YLYLDHGSNEDVATANHYFELAARWANIEAYYHLAEANNIGLTHDRSCNGAVAYYKNV
                     AERAEPLVSSWAEANLAYESGDIELALLEYLGAAEQGYEKAQNNVAHILDPDKSRLPL
                     ARLLSRHPTSPLLQDPTLALIQWTRSSRQGNIDALVKMGDYYLYGIGAEPDVDKAVQC
                     YTSASEYHQSAQALYNLGWMHEHGVGLDQDYHLAKRYYDAALATNEEAYLPVALSLLK
                     LRAKSAWNTLTHGRINSIQDEPTPRKEWSLSDWINNFLQDDDARYYDDLYDEQYEDEM
                     PGGDPLDIDDGVMESVAILGLAAALVFLIMYRQQRQQAIRRQEEEARRQQQQQQQQQQ
                     QQQQPQQQHQGGAGVGNQQQPPQQERGFFPRPGDPDFGQWAAGVVGH"
     gene            2254281..2256192
                     /locus_tag="MYCTH_2295198"
                     /db_xref="GeneID:11505738"
     mRNA            join(2254281..2254482,2254598..2254971,2255033..2255132,
                     2255189..2255255,2255383..2255726,2255842..2256192)
                     /locus_tag="MYCTH_2295198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658819.1"
                     /db_xref="GeneID:11505738"
     CDS             join(2254668..2254971,2255033..2255132,2255189..2255255,
                     2255383..2255726,2255842..2256034)
                     /locus_tag="MYCTH_2295198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658867.1"
                     /db_xref="GeneID:11505738"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2295198"
                     /translation="MYQLVNAEGYKYPGQETYVLDILPIAAGFATTASDQTLSLFDPL
                     RLSQGPVKKIKTDHGNLTAAEVYSAADSVVCTTGQNGTISVWDLRLDPSSARAMQLGG
                     NLPGLLSLACSNETNSVAAGTELANHQASILIWDLRSASAPRMQYNEGHSDDVTELAY
                     NPSSPTHLLSGSTDGLLNVTDTLVADEDDAVRATFNHGSVHRAGFLPGATEVYAASHD
                     EKFALYDTADETPLKGAATLDLGDIRALLGCQYLADVVPKQAGMGAVVGVGAQDQEMF
                     QLIHLAKGPGGWGLDRDTIVGLPGAHGSEIVRSFCFFDEQQIVFTAGEDGCVKAWRPG
                     S"
     gene            complement(2256100..2257731)
                     /locus_tag="MYCTH_105847"
                     /db_xref="GeneID:11511558"
     mRNA            complement(join(2256100..2256233,2256354..2257358,
                     2257422..2257497,2257564..2257731))
                     /locus_tag="MYCTH_105847"
                     /product="acetyl-CoA C-acetyltransferase"
                     /transcript_id="XM_003658820.1"
                     /db_xref="GeneID:11511558"
     CDS             complement(join(2256194..2256233,2256354..2257358,
                     2257422..2257497,2257564..2257678))
                     /locus_tag="MYCTH_105847"
                     /EC_number="2.3.1.9"
                     /note="orthologue of Erg10 in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="acetyl-CoA C-acetyltransferase"
                     /protein_id="XP_003658868.1"
                     /db_xref="GeneID:11511558"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="JGIDB:Spoth2_105847"
                     /translation="MAGLPPVYIVSAARTPVGSFLGSLSSLSATQLGSHAIKSAVERV
                     PQIKPEDVEEVFFGNVLSANLGQAPARQCALGAGLSEAVVCTTVNKVCASGMKAIILG
                     AQTIITGNASIVVAGGTESMSNTPHYLTNLRTGNKYGDTPLVDGVQKDGLRDAYGKQE
                     LMGMQGELCSQELGLTREQQDEYAINTYKRAQAATAAGLFTEIAPIEVSGGRGKPPVK
                     VDRDEEVKNLNEEKLKTVRPAFIPNGGTVTAANAAPINDGAAAVVLVSEAKLKELGIK
                     PIAKIIGWADAARDPSHFTIAPALAIPKAIKHAGLTEKDVDYYEINEAFSVVALANIK
                     LLNLDPEKVNVFGGSVAIGHPLGASGARIVTTLTSVLREKKGRIGVAGICNGGGGASA
                     LVIENLQSAVLQELAKPNL"
     gene            2258059..2261976
                     /locus_tag="MYCTH_2295204"
                     /db_xref="GeneID:11508146"
     mRNA            join(2258059..2258296,2258354..2259505,2259558..2260549,
                     2260668..2260755,2261024..2261976)
                     /locus_tag="MYCTH_2295204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658821.1"
                     /db_xref="GeneID:11508146"
     CDS             join(2258134..2258296,2258354..2259505,2259558..2260549,
                     2260668..2260755,2261024..2261589)
                     /locus_tag="MYCTH_2295204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658869.1"
                     /db_xref="GeneID:11508146"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="JGIDB:Spoth2_2295204"
                     /translation="MDDDLYDEFGNFIGEEAEASEEESEHGVDVGNYAYDEYPEAAAE
                     APAAEQMDIDDEGPSNAVVLHEDKQYYPTAAQVYGEGVETLVQEEDAQPLTQPIVAPV
                     EHKKFSIEEADLPPVYFDRNFMTDLMNFPEQIRNIALAGHLHHGKTAFMDMLVLETHA
                     ITDRLDKRTGKKRDEQLRYTDVHVIERDRGLSIKAAPMSLVLQNTKGKSHLFNIIDTP
                     GHVDFVDEVAASLRLVDGVCLVVDVVEGVQANTEQIIKHAVLEDIPLTLIVNKMDRLI
                     LELKIPPNDAYYKLKHVIEEVNKVIEDTIPGRGVEKRVSPEKGNVLFSCTSMGWCFTL
                     ASFAKMYSDSFGGINIDEFARRLWGDVYFNPRKRNFTRKPIEKEAKRSFVNFVMEPIY
                     KLYSHTISESPEDLKKTLGKLGIELKPSQYKSDPKVLMKLVCEQFFGPSTGFVDMVCQ
                     HIPSPVEAAEKKLSQYYTGPLDTKVAESMKKCDQNGPLVIHVTKLFNTSDAKSFYSFG
                     RVMSGIVRPGTEVRVLGEGYSIDDEEDMVLGKVSDVFIAETRYNIPTDGVPAGNWVLL
                     GGVDNSIVKTATIVDKKFEDEEDAYIFKPLSHFTESVLKVAVEPINPSELPKMLDGIR
                     KINKSYPLIATKVEESGEHVILGTGELYMDCVLHDLRRLYADMEVRVSDPVVRFCETV
                     QDMSATKCYAITPNKKNTITMAAEPLDDGIAKDIESGAVRIRDPVRKTAKFFEEKYGW
                     DMLAARSIWAFGPDEMGPNILQDDTLPTEVDKKRLNTVKESIRQGFSWATREGPLCEE
                     PIRNTKFRLIDIELAQEAIFRGGGQIIPTARRACYSSFLMASPRLMEPVYSVSMTGPQ
                     DSVSTVYNILARRRGHVLSDGPIAGTPLYRVDGLLPVIDSFGFETDLRINTPGRAMVS
                     LVFDRWSIVPGDPLDREQVTRPLQMAAPLATARDFVLKTRRRKGLSEDVTVAKFLEPE
                     FYQKLLEEGTLDGV"
     gene            complement(2264045..2265117)
                     /locus_tag="MYCTH_2295207"
                     /db_xref="GeneID:11508179"
     mRNA            complement(join(2264045..2264516,2264594..2265117))
                     /locus_tag="MYCTH_2295207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658822.1"
                     /db_xref="GeneID:11508179"
     CDS             complement(join(2264140..2264516,2264594..2264804))
                     /locus_tag="MYCTH_2295207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658870.1"
                     /db_xref="GeneID:11508179"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="JGIDB:Spoth2_2295207"
                     /translation="MERDLDNANPTILSVSQLPSRRRKGLSTRNGPDSKCDSIVYPKH
                     AWPYGSYPASDDEEYGEEPMDEQDIYDLISTISDPEHPHTLGQLSVVRLPDIHLNPSP
                     AELPDPDSLVTVLVELTPTINHCSLATVIGLAVRCRLEQTLPPNYRVDVRMKSGTHAQ
                     DDQVTKQLGDKERVAAALENDTLQRMVDKMLETCA"
     gene            2268902..2272250
                     /locus_tag="MYCTH_2295212"
                     /db_xref="GeneID:11509159"
     mRNA            join(2268902..2269184,2269252..2269296,2269362..2270255,
                     2270314..2270595,2270671..2271224,2271319..2271764,
                     2271881..2272250)
                     /locus_tag="MYCTH_2295212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658823.1"
                     /db_xref="GeneID:11509159"
     CDS             join(2269076..2269184,2269252..2269296,2269362..2270255,
                     2270314..2270595,2270671..2271224,2271319..2271764,
                     2271881..2272175)
                     /locus_tag="MYCTH_2295212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658871.1"
                     /db_xref="GeneID:11509159"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2295212"
                     /translation="MSNDPTTRRLLPQTSQMASFSFVPPAYQQQPRETQKNYVFVDEH
                     NRHKRLKVMRACEGCRRRKIKCDAATTNTWPCSACVRLKLHCVRPNGFDSSDSQVYEP
                     PQPQIEVQHTPDGFGQQPPPIQSQQLLAHAPKPGALYQSQSSYQDTSGLYHPVQYGEP
                     QPVPHGLHYSPVHHQSVGAVDQQYAAQTAAFPTPPLQHAPNPGSSEETYQSEYAQQDL
                     ADLLGSLKVNEAGTAPYLNSKMQSARDEEPAVEEDGDEYKTSLPPLTVGPGSKIRIPP
                     ELMPDDDTVLHYLDLYFVNAHPYVPVLDKNHFYHQWHNNRDSISPLLLEAIFAIAGRL
                     ADEPAQGQQWLAMASRHADSFMDVPRLSTLQALMILLKARESAPKKGYYYRSWMSIVQ
                     CVQLGKDLGLDEHYAEHQAGRGCGASQAECALKTRIWQTLFVVELMIGSPQGRTDFKI
                     DEDSVDFNLPRPLPNGDESEYHVSRNFTYLARIVRSVGRMARTYGRLKKTKDWGIDPE
                     FVQLDPSLNAWLAGLPADLTISYPADGSPPWLPSAFVGNLHSYYYLSIILFNRPQLAA
                     LSPSTPGGQWKQHMVVSYNAAKMLCRLQEAVINSFGLNGLQCMQRGINFTIYAILSCI
                     VLHLVAITSPDPDLNSEARDYFTRHMRILERCMSAWPMPDMQKQIDSVREAFSADIRK
                     PFVLKPTFPYGSPHSATHPSPPGRPLDSQMQHSQVSYTSHPLTPVSVGPPDTKGESPS
                     VQSLTTMASVHGSQAPGVGQTLPLSEAPAWNPSRIFDQWNTSFGTPQIAQPSPPSVAA
                     QANSLGGVESSGLQNMHTVHQNQLRAGAQMPLPPYTPAPPQTFVTPAMWQESVASVYE
                     GGLKRAWDYDAHLPMKRH"
     gene            complement(2273088..2274182)
                     /locus_tag="MYCTH_2295218"
                     /db_xref="GeneID:11508535"
     mRNA            complement(join(2273088..2273781,2273882..2273998,
                     2274112..2274182))
                     /locus_tag="MYCTH_2295218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658824.1"
                     /db_xref="GeneID:11508535"
     CDS             complement(join(2273354..2273781,2273882..2273939))
                     /locus_tag="MYCTH_2295218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658872.1"
                     /db_xref="GeneID:11508535"
                     /db_xref="JGIDB:Spoth2_2295218"
                     /translation="MIVAPTYISAGEPLMKTAGVALCGIIPAVYVAWTTSPFVAAMHL
                     HLPPYARWSPAILERFARTAPPGTRLDVTTMSLIGKPRVSSMTLADLRPARRRLGTVN
                     YARDTSRLDATRKWWRFRAVAEFSVQEGAEKRVKTGWVWRDIRDGIAKRAAAQAAAAK
                     Q"
     gene            complement(<2275342..>2282171)
                     /locus_tag="MYCTH_99040"
                     /db_xref="GeneID:11505448"
     mRNA            complement(join(<2275342..2275923,2276055..2277329,
                     2277404..2278690,2278864..2279440,2279498..2279598,
                     2279668..2280376,2281416..2281477,2281550..2281859,
                     2281933..>2282171))
                     /locus_tag="MYCTH_99040"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003658825.1"
                     /db_xref="GeneID:11505448"
     CDS             complement(join(2275342..2275923,2276055..2277329,
                     2277404..2278690,2278864..2279440,2279498..2279598,
                     2279668..2280376,2281416..2281477,2281550..2281859,
                     2281933..2282171))
                     /locus_tag="MYCTH_99040"
                     /note="Contains conserved domain SIN3[COG5602], Histone
                     deacetylase complex, SIN3 component and HDAC_interact
                     [pfam08295] Histone deacetylase (HDAC) interacting,
                     Med3[pfam11593] and PHA03247 large tegument protein UL36."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658873.1"
                     /db_xref="GeneID:11505448"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="JGIDB:Spoth2_99040"
                     /translation="MRSPLLSLVALSATVSAQLVVPLLRSPFALERAQAPLMNPAGPG
                     PALPPEPSPGTPAGNGGGVVLSDVMGRDRSMNLFASFVRDIESASRLLEDSSENTTVL
                     APLNSEVEKLPRKPWEDPKDYGALGPDAYEGGEGRERAQRNLRRFVEAHLVPVSPWRE
                     GDKVKPVGGGREIWWEEKEGRRLIQPDGIEIINVAGDVRNGQVVGFELHDGMNSQPLH
                     AGSGFDRDRDLDEQRHRPHHQDELARRERERERDRDRDRERDEADRHHREPYPPAGSA
                     SAGPHHSTAGSLPIHQPVASRISNSITGPGGLLANHGSSAPSLPISGPSAPAPAPGFG
                     GPLHSEAGRPPQQSGGPTHGGSAQHQMFAPMSHGPSGPSGPGSSIGGPGGPGSMYGGP
                     LQQENGRGMPQDGARAMQQLPFGSGMGHGNSMPPGPGGMPQGQQPILNDALSYLDQVK
                     VQFHEQPDVYNRFLDIMKDFKSQTIDTPGVISRVSELFAGHPNLIQGFNTFLPPGYRI
                     ECGLENNPNSIRVTTPSGSTIHSIGAGRASQHDTAQPGGGASQGYMNTRPGWQAPLPH
                     GTESPEATFSVPAQNGPSGYPGPSHGAPFDGTSPIQQRSAPANQNGAPVNHPPAPRTA
                     HTPTPAAAGSAGTNGGPAQQANLEKRGPVEFNHAISYVNKIKNRFQDKPEIYKQFLEI
                     LQTYQREQKPIQDVYSQVTSLFHTAPDLLEDFKQFLPESAAQTRTTSQRAEDNNMAMA
                     ASAPTPQPGHVTRDGPKMPPVGNFAPPTSASKESKKRRPEKATTAGPSSSEQAQTSSL
                     RATLPAVPPTNKRAKLAHKPNVSESTFIEPTLTPVMPEPLAPTPLAVSTQDDLAFFEK
                     VKKHIGNRTATTEFLKLLNLWTQELITTDVLLYKANQFMGGNPELLNSLKAMLRQDTT
                     DETIENRPEPPTGRVSLSNCRGFGPSYRLLPKRERLKPCSGRDELCQSVLNDEWASHP
                     TWASEDSGFVAHRKNAYEESLHRIEEERHDYDFYIEANQKCIQLLEPIAQQMLSLPPS
                     ERPNFKMPAGLGGQSTSIYKRVLKKIYGPEKGCEVANDMFKYPFTVVPIVMARLKQKD
                     EEWRFTQREWEKVWQSQTEAMHLKSLDHMGIQVKTNDKRNLSAKHLVDLIKTKHEEQR
                     RIRVAKGKTPRYQFAYQFTDEDLILDLLRFMVIFANVGGQHNAQERRRILEFFETFIP
                     IFFDLPEDKVSEKLADIDQDSAEEDDEDAAPMELSNGRSRRNGKKSDLLRGVLDPSRN
                     GSRSRGQKESSAASGSKETTPDVGSANEEETPHTPEDSSVPEVSNGRWLPTVPGPIIV
                     EKSKGGRGSDLVGVDGELKADAPFPRAWYNFYCNQNIYVFFTVFQTLFQRLEEVKQST
                     DSVLEEMRRENAEKPAKILGLVHDGLHYFDNEDPATFWPKTRELIEDFITGEIDENRY
                     QEVLRHYYLRKGWKLYTIQELLKTLCRLALSCNNPDAKGEKTKELVKAYLDSRQQTET
                     SFQNEISARKFAEKCIKDGEMFVIAWYPAKKEATVRWLQKDETTFYMDEMERIQQWQY
                     YISSYVRVEHTEGVVRSRLQKVLLERNLPSDVSLKDSSDNDYATKPLHVNEGLVVRIC
                     LNSSKMVFEKGTSDSFIFVSGGGERGSAEEEEREAEAKAKEAFRSEIRAEKLKEKMVT
                     NNAWMKGLSHEEVQKVNNEYQMWKEKEAEIPSGHREEAADATMEG"
     gene            2285696..2288007
                     /locus_tag="MYCTH_2295230"
                     /db_xref="GeneID:11513051"
     mRNA            join(2285696..2286066,2286200..2286472,2286541..2288007)
                     /locus_tag="MYCTH_2295230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658826.1"
                     /db_xref="GeneID:11513051"
     CDS             join(2285948..2286066,2286200..2286472,2286541..2287849)
                     /locus_tag="MYCTH_2295230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658874.1"
                     /db_xref="GeneID:11513051"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2295230"
                     /translation="MAVFAMGWQKPDNVAGSSAPAIMVGLFVATGGLLFGYDTGAING
                     ILAMDTFKEDFTTGYTDKQGKPGLYASEVSLIVAMLSAGTATGALLSAPMGDRWGRRL
                     SLIVAIGVFCVGAIIQVCATNVAMLVVGRTLAGIGVGVVSVLVPLYQSEMAPKWIRGT
                     LVCAYQLSITAGLLAAATVNILTYKLKSAAAYRIPIGLQLTWALVLALGLVILPETPR
                     YLVKRGLKEAAALSLSRLRRLDITHPALIEELAEIEANHEYEMALGPDTYKDIIFGEP
                     HLGRRTLTGCGLQMLQQLTGVNFIMYYGTTFFYGAGIGNAFTVSLIMQVINLVSTFPG
                     LFVVESWGRRKLLIVGSVGMAICQLLIASFATASGNDNKPTQNQILIIFVAIYIFFFA
                     ASWGPVVWVVTSEIYPLKVRAKSMSISTASNWVLNFGIAYGTPYLVDTSDGSPDLGSR
                     VFFVWGAFCILSIAFVWYMVYETSKISLEQIDEMYERVAHAWNSRSFEPSWSFQQMRD
                     FGFSDSGIPPAEPQLELQQSNASTSQSDTGGSSATHATAANPQDAKMVSQLANIDLSY
                     "
     gene            2289624..2293398
                     /locus_tag="MYCTH_2087807"
                     /db_xref="GeneID:11512968"
     mRNA            join(2289624..2290434,2290496..2290977,2291041..2291266,
                     2291313..2291404,2291485..2291514,2291566..2292807,
                     2292926..2293398)
                     /locus_tag="MYCTH_2087807"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003658827.1"
                     /db_xref="GeneID:11512968"
     CDS             join(2289771..2290434,2290496..2290977,2291041..2291266,
                     2291313..2291404,2291485..2291514,2291566..2292807,
                     2292926..2293171)
                     /locus_tag="MYCTH_2087807"
                     /note="CAZy_ID 267991"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003658875.1"
                     /db_xref="GeneID:11512968"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Spoth2_2087807"
                     /translation="MALLASTSLLLAGLYLRTTSSVQISETPSQAAGHPPVFTLPPSA
                     DRGKNILPNIKDPKAIDPQTVCPGYKASNLQDTKDGFTADLDLAGPACNVYGTDVEHL
                     ALSVEFQGDDRVHVEIRPRYITPGNETWFLLPEELVPRPSARQAYTPGPNDLTVSWSN
                     DPSFSFTVKRGAIGDTLFSTEGKRLVYEDQFIEFISTLPEDYNLYGLGEVIHGFRLGN
                     NLTRTLFAADVADTIDANIYGSHPVYLDTRYFTVDESGKLTYVANAKDMAAKYVSYTH
                     GVFLRNAHAQEILLQSSGITWRTTGGSIDLYFYSGPKAEDVIRSYQQSTTGLPAMQRY
                     WTLGFHQCRWGYDSWAVLQEVVDNFAKFEIPVETVWCESHSSAPRMGRNDPVRFGYEE
                     GARFLAQLHANHQHYVPIVDSAIYAPNPENPGDAYPPYDRGVEANAFMMNPDGSIYYG
                     AVWPGYTVFPDWVGAVLNGSGAIDWWIDELSRWSEKVAFDGLWIDMSEVASFCVGSCG
                     TGNLTLNPVHPPFGLPGEAGNLVLQYPEGFELTNSSEAVSASSALSTQEAASPTTASP
                     TSSFYRTTPTPGVRNVDWPPYAINNIHGDLAVHAVSPNATHHGGYLEYDFHNMFGHQI
                     LNATYRALLKIHEGKRPFIIGRSTFAGSGKWAGHWGGDNAALWAYMYFSIPQALSFSL
                     FGVPMFGVDTCGFGGNSNYELCSRWMQLSAFFPFYRNHNILGAIPQEPYVWASVIDAT
                     KTAMRIRYALLPYLYTLMARASLEGSTVMRALAWEFPDEPWLADADRQFMLGRAIMVT
                     PCLEQGASTVRGVFPGVGDGGKKTVWYDWYTGKAVTDEIKPGQNVTIEAPLGHIPVYL
                     RGGSVVPVQGPGMTTTESRRNPWGLIVALDREGFAEGELYLDDGESLEPAAVTWVQFT
                     ATNTSITAVPQGDYVDNNTFGNATVMGLAKGPVRMWLNRRVLDHANWQYDQDRAVLLL
                     YGLNHLFPQGAWTDKWEINWE"
     gene            complement(2293400..2294767)
                     /locus_tag="MYCTH_2295239"
                     /db_xref="GeneID:11513008"
     mRNA            complement(join(2293400..2294314,2294415..2294767))
                     /locus_tag="MYCTH_2295239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658828.1"
                     /db_xref="GeneID:11513008"
     CDS             complement(join(2293584..2294314,2294415..2294676))
                     /locus_tag="MYCTH_2295239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658876.1"
                     /db_xref="GeneID:11513008"
                     /db_xref="JGIDB:Spoth2_2295239"
                     /translation="MLTSRLVLPAAWLMLLGSASAAPAPESAAAGTDATTSVTDAAPP
                     PPPVPTNEDGSDAFVTCSNTDGPFKPFCLPKHNDVYYPGSTHYVTWDTSFFPSQNTTL
                     RIVGIYANLPPAVVPEPAPAPDSDEEASSDPELPPSSETAPHGPHGQVVEAFSSDTIS
                     AAWGFYQWHLDQSLLKSHGLKEANITLRIAALAPDSRSAQWYSGPTITLQNKPKKRKK
                     PVHTPTPADDEVLYIALPLIFGFATFMIVGTFCWNRQLRRIGVGNVMGRANTRGRRLG
                     ASRRDRAKNRDKESSIRLMESGGAAADSDEEGWSHGSSSAAERRVFERVDRKRD"
     gene            complement(2295124..2296888)
                     /locus_tag="MYCTH_2295242"
                     /db_xref="GeneID:11513337"
     mRNA            complement(join(2295124..2296425,2296510..2296662,
                     2296766..2296888))
                     /locus_tag="MYCTH_2295242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658829.1"
                     /db_xref="GeneID:11513337"
     CDS             complement(join(2295485..2296425,2296510..2296662,
                     2296766..2296817))
                     /locus_tag="MYCTH_2295242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658877.1"
                     /db_xref="GeneID:11513337"
                     /db_xref="JGIDB:Spoth2_2295242"
                     /translation="MAPIAKAVTVSLQDLKDGTVSSETLYEAFGPDSLGILVVKDVPP
                     EFASLRHHLLSYSSYLGNLPKSELDKLENEKAKYLTGWSLGKETLKNGQVDTLKGSFY
                     ANCAFYVDPKLSCAVPTEQFNPDNFPEYLSPNIWPGEDTLPGFKETFENLCRLIIDVA
                     VLVARACDRFAQKEIPGYPSGYLERVVSTSTTTKARLLHYFPEDPSKEPAPVSVSDEV
                     ANNNDPDEDDWCATHLDHGCLTGLTSAMFVDESESSPLVAAPEVEPASPGVSHLAPLP
                     ELDSSPDPAAGLYIKSRTGRTVHVKIPRDCIAFQTGEALERITAGKFKAVPHFVRGAR
                     AALCDGRIARNTLAVFTQPNLDEEVDMEQHITFGEFARGIVAKNTVS"
     gene            2297226..2298486
                     /locus_tag="MYCTH_2295243"
                     /db_xref="GeneID:11513265"
     mRNA            join(2297226..2297700,2297795..2298486)
                     /locus_tag="MYCTH_2295243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658830.1"
                     /db_xref="GeneID:11513265"
     CDS             join(2297306..2297700,2297795..2298233)
                     /locus_tag="MYCTH_2295243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658878.1"
                     /db_xref="GeneID:11513265"
                     /db_xref="InterPro:IPR010414"
                     /db_xref="JGIDB:Spoth2_2295243"
                     /translation="MVKPLTFKGDKKPKKRKRTDAGEGAGKTGDGTSERQVKAAKQDD
                     ADAEPSEDDSWVSADAVSDISGPIMIVLPSEPPTALACDATGKVFAMPIENIIDGNPL
                     SAEPHDVRQVWVANRIVGTEHYRFKGHHGKYLSCDRIGLLTATADAISPLETFSILPT
                     ADTPGTFQIQTLRDTFLTVRPSRSAKASAPPEVRGDETEITFNTTLRVRMQARFKPRV
                     KASREEKARERISRRELEEAAGRRLEEHEIKMLKKARREGNYHETLLDIKVKTKHDKF
                     G"
     gene            complement(2299371..2302203)
                     /locus_tag="MYCTH_2295245"
                     /db_xref="GeneID:11508113"
     mRNA            complement(join(2299371..2301304,2301384..2301540,
                     2301606..2302203))
                     /locus_tag="MYCTH_2295245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003658831.1"
                     /db_xref="GeneID:11508113"
     CDS             complement(join(2299598..2301304,2301384..2301540,
                     2301606..2301661))
                     /locus_tag="MYCTH_2295245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003658879.1"
                     /db_xref="GeneID:11508113"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="JGIDB:Spoth2_2295245"
                     /translation="MGRRKIDIKPIKDERNRSVTFLKRKGGLFKKAYELSVLCSVDVA
                     VVIFGNNKKLHQFSSRDMREMLQRWTLHGEPNEYKIPADFNGGADDDDDDDENGSSPQ
                     GEGVDPQMYPPQFQTQPQFPVIRNHTASASPPIPNGVFGPRGHTPQPQMASRPSSRND
                     IHRMGANMVGQPVGPPGSQPGAVNGFSRSYMPQTAMYNAQNPHNMPPNMPHGLPQPHP
                     QYSYPQQQPHPHQMQPYVDEQRRASGPATFPHQPPQGQQPGRHSVSPPQPPAQLPPQP
                     VPHMSPPAQAQAHPIQSPPQQHLPPPPPNQQHEVPHIYVPTQESPATEPAPAPAPAPA
                     HAEPKPKQDLVERARQPLLLNTNVKKQPPRKGGSIFTPIEENKSILQQHLAAFSRPEV
                     KSEAPPSSRSQSIDAGSAPKGSNPSSPPSLPRINTQPQQPQIKRNGSLGTIPETVFTP
                     PSRSNSLRVGGSNPRPQLKVRIPDESDGGSATNGSASPRGTTATDITSQPSRRPTDSH
                     SSGVVLPPPSPSASATLLSAGATGPPNPFARPPPHQTIETPVSSLPSRFLGDGLMPSP
                     NPFYAEWGMKGNEHNTLSPLTWSTPVAGMGPSFLREDLPPLKRKSPEPSGNGGDHETS
                     GEALGADAKRVKVDH"
     gene            complement(2306287..2310240)
                     /locus_tag="MYCTH_2295248"
                     /db_xref="GeneID:11508126"
     mRNA            complement(join(2306287..2306909,2306962..2307018,
                     2307073..2310240))
                     /locus_tag="MYCTH_2295248"