GenomeNet

Database: RefSeq
Entry: NC_016473
LinkDB: NC_016473
Original site: NC_016473 
LOCUS       NC_016473            5454242 bp    DNA     linear   CON 28-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 2, complete
            sequence.
ACCESSION   NC_016473
VERSION     NC_016473.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 5454242)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5454242)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 5454242)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 5454242)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003003.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5454242
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="2"
     gene            complement(<8917..>12832)
                     /locus_tag="MYCTH_46877"
                     /db_xref="GeneID:11512501"
     mRNA            complement(join(<8917..9029,12688..>12832))
                     /locus_tag="MYCTH_46877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660974.1"
                     /db_xref="GeneID:11512501"
     CDS             complement(join(8917..9029,12688..>12832))
                     /locus_tag="MYCTH_46877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661022.1"
                     /db_xref="GeneID:11512501"
                     /db_xref="JGIDB:Spoth2_46877"
                     /translation="KIELPSKYGGTKEDLVGFLTNLRSYFRLNNDKFPDDKAKVLYVA
                     IRLEAIRGRNGRFRLRHQKTIRITRQTRKATSYSLLFKEAR"
     gene            <20471..>22732
                     /locus_tag="MYCTH_95605"
                     /db_xref="GeneID:11511730"
     mRNA            join(<20471..20653,21494..>22732)
                     /locus_tag="MYCTH_95605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660975.1"
                     /db_xref="GeneID:11511730"
     CDS             join(20471..20653,21494..22732)
                     /locus_tag="MYCTH_95605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661023.1"
                     /db_xref="GeneID:11511730"
                     /db_xref="JGIDB:Spoth2_95605"
                     /translation="MVQNGGDLDLDTDMDTNVTAEQLLAQLGQLQQRIQELDQRDKAA
                     QARIKELENREKYSQKLEIAAIDETTKDVIEVAATSYEDKGSDTDSLGHDGNGEDEQA
                     PYSELVTVDPETGLAEWDMAGEYAPPVSILPALRQWGLTVTQRRDGSWTTDTQGIERP
                     GPNALFLQERIEWYRNEVFRLNTELRERDGRLTRLAQQSEEMKDEMRELRRIVEAIKG
                     EQPVTYDGPDSYAEYLDDQQLSNDVRNPEYQFMRANRGKDERTWESYWKKHSYVSTGV
                     PTVHVQWEGFGKEFQYLPGDAMRLHPRHEAHAQVPWFQCVAHECRYHFRDKFENNHWP
                     TRQENGDGGLRPVEWVYDAGNRAAELLWKIEARNSESITIVPRRAWPRHCGTGRDTWD
                     SCWSNDCLYHADEKKLRIRELQTKLWHARRKAERTQWWEAASTQWLTEMSTIDEAAIS
                     RTTEEVSTDLGNGSGPFEGPGNH"
     gene            complement(<26182..>27018)
                     /locus_tag="MYCTH_2058544"
                     /db_xref="GeneID:11511731"
     mRNA            complement(join(<26182..26271,26384..26739,26811..>27018))
                     /locus_tag="MYCTH_2058544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660976.1"
                     /db_xref="GeneID:11511731"
     CDS             complement(join(26182..26271,26384..26739,26811..27018))
                     /locus_tag="MYCTH_2058544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661024.1"
                     /db_xref="GeneID:11511731"
                     /db_xref="JGIDB:Spoth2_2058544"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            <29461..>30135
                     /locus_tag="MYCTH_2108373"
                     /db_xref="GeneID:11511732"
     mRNA            join(<29461..29805,29875..29878,29987..>30135)
                     /locus_tag="MYCTH_2108373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660977.1"
                     /db_xref="GeneID:11511732"
     CDS             join(29461..29805,29875..29878,29987..30135)
                     /locus_tag="MYCTH_2108373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661025.1"
                     /db_xref="GeneID:11511732"
                     /db_xref="JGIDB:Spoth2_2108373"
                     /translation="MTVFHRTVARPLVLKCAALFLQRFDPSLQPGSLPGTEQAHLLRG
                     LYRFQLYCNLFGKSPKPGGYYVVGRLSAADILALFFVSFSPWEVEEIDCIYTMIWNKY
                     NVVLDVVRYNLAKKSDRQLLRQGIVLNGLTLFSEVLEIYDHKVLVNTMEQYLVKSGAL
                     ERVLS"
     gene            complement(31404..32580)
                     /locus_tag="MYCTH_2299964"
                     /db_xref="GeneID:11511733"
     mRNA            complement(31404..32580)
                     /locus_tag="MYCTH_2299964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660978.1"
                     /db_xref="GeneID:11511733"
     CDS             complement(31631..32467)
                     /locus_tag="MYCTH_2299964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661026.1"
                     /db_xref="GeneID:11511733"
                     /db_xref="JGIDB:Spoth2_2299964"
                     /translation="MRTLPIFTIGALAPLVTSASDCTREFLQDSADSLVAAQTAGDPS
                     LLQPVSDALDYNENYATATFESGILSKPLEIDFSRHYLDTTQCATFTELISATGSKPY
                     VIGVQMYFTDNSVSKIDTLITTTGDWLFNATGTLYWASQEDWGTIPEEERDSREVIQA
                     AADAYCDIFSDKSVQVPWGYPCARLEGGAYTGNGGPDDRCDVGIPSGVNLTNRRYVID
                     ETIGAVSVFLSFNAIPDSHAFRVEKGKLRFVHTMTVMTASRNGRSTTRRRLRGVMAPS
                     AQ"
     gene            complement(33541..35692)
                     /locus_tag="MYCTH_2299965"
                     /db_xref="GeneID:11511734"
     mRNA            complement(join(33541..34010,34071..35168,35238..35692))
                     /locus_tag="MYCTH_2299965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660979.1"
                     /db_xref="GeneID:11511734"
     CDS             complement(join(33930..34010,34071..35168,35238..35405))
                     /locus_tag="MYCTH_2299965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661027.1"
                     /db_xref="GeneID:11511734"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="JGIDB:Spoth2_2299965"
                     /translation="MASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESS
                     AVPPCFSHEGINYLYIRHNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKVLEEES
                     IRDNFVIIYELLDEMMDFGYPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRS
                     EGIRYRKNEVFLDVIESLNLLVSANGNVLRSEILGAIKMKCYLSGMPELRLGLNDKVM
                     FETTGRTTRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKPL
                     IWVECVVESHSGSRIEYMLKARAQFKRRSTANNVEIIVPVPDDADSPRFRTNVGSVHY
                     APEKSAIVWKIKQFGGGKEFLMRAELGLPSVRGDDEHGGGMTGGFGGSMGGIGGPGKG
                     AKRPIQVKFEIPYFTTSGIQVRYLKITEPKLQYPSLPWVRYITQSGDIAVRLPDAV"
     gene            37872..40107
                     /locus_tag="MYCTH_2299968"
                     /db_xref="GeneID:11511735"
     mRNA            join(37872..38629,38702..40107)
                     /locus_tag="MYCTH_2299968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660980.1"
                     /db_xref="GeneID:11511735"
     CDS             join(38065..38629,38702..39966)
                     /locus_tag="MYCTH_2299968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661028.1"
                     /db_xref="GeneID:11511735"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="JGIDB:Spoth2_2299968"
                     /translation="MEHNHMPTDERPPQISPTQPGAGAALPAPSMQQSTDADNAAADA
                     LGSDRNPFSPDHRPAVNSTPSLQLPPLSVSFPSDSTTELAPIQSSRDSTSLPSTQTLP
                     PLSSVTGAQSHAPLPKPPEPSRPAPFTGPTNPWPSLNPFTTYYKPSYLESAESPPSMT
                     SEPGPSRSVSLDDPDVRIAAEALGQMKTECASSPRNRGSTPNTRASSRDYKTASPPPR
                     NHTGRRAEPLLSLITTTYPLLGSTIENAASAYNTGKNYSPHLKTGAEYVENLVKPAVE
                     TVGRKTGVEGGMRWLFSMRGRKQRPSTDIETDERGNGKRRRSDRNSKGEETPHTSPHD
                     IHTDSVDRRMSISTVDTLPAYDDQRSPAYSEVVENPPPSGPGAAVTGQQWGQRFVVTT
                     SGLGIAMKKESIKSLKYCLKVVRDTNSYLSDILVKLKSVIEEYDLASQTDVDDHSMTD
                     GDPPAPHTAEQRSKLIQRMSELREDLFRVIQRTVQTVSKYAGGALPENARNLVHSQLM
                     SLPGRYQIHYVRETEGRRNRENSSPDAWTRDSAHLALLFAKEALQMMTQVGEVLNRTL
                     VSAEEWCDTLYGKKGQPIPSLGTDQSSPAAPVPTIDQDVQMSG"
     gene            complement(40669..41894)
                     /locus_tag="MYCTH_2299969"
                     /db_xref="GeneID:11511736"
     mRNA            complement(join(40669..41504,41567..41894))
                     /locus_tag="MYCTH_2299969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660981.1"
                     /db_xref="GeneID:11511736"
     CDS             complement(join(40800..41504,41567..41794))
                     /locus_tag="MYCTH_2299969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661029.1"
                     /db_xref="GeneID:11511736"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_2299969"
                     /translation="MGQRNLLLCFDAFGTLFHPKGPVMEQYVAVAQQCGLGGFSAQDV
                     EASFKAAFSRQSKLHPNYGRASGMGALKWWTNVITQTFQPLIGKGTELPNDLAPKLWH
                     RFSSGEGYSLSPGVASLLRSLRQRQQERRPKSSRLIVGVITNSDDRVPSILSSLGLHV
                     SPLRFGAPLNSARGGPSEHYDVDLHCMSYDVGVTKPDRRIFDAAEEMAVQLVMAQEAA
                     EHGRDVERAQPALPWLKLYVGDEYEKDVVGARGAGWNPIFVGAKEEVSGQDSVLDLDQ
                     LRNKRLDEVFHRDGPPLTIHADSTQEVLEWLIEY"
     gene            complement(<42382..>43971)
                     /locus_tag="MYCTH_2058820"
                     /db_xref="GeneID:11511737"
     mRNA            complement(<42382..>43971)
                     /locus_tag="MYCTH_2058820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660982.1"
                     /db_xref="GeneID:11511737"
     CDS             complement(42382..43971)
                     /locus_tag="MYCTH_2058820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661030.1"
                     /db_xref="GeneID:11511737"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="JGIDB:Spoth2_2058820"
                     /translation="MTRPPGLIHEFLRQLESRQSLHSESNPDLPRYDVQNPTDRGLLV
                     TSSRPQRFFLGTGASIFTNYLIPAITSAQHEVILVTCFWAPSRTLTALCEALSKLAAH
                     RRRLVQEARATGSTPIPPLHVRICLSSRSLLQKLLHPQSRSGYTYPPASWHKKLGLPE
                     PALLEAGGIRLEAKSLFFLPFSVMHPKFVIIDRQRAFVPSCNVSWESWLEGCVEITGD
                     AVRALFAFYSRTWEDPADTEPARDAWSDRVPGDSEAAGTSWDGAEAGLVMVRSTARLC
                     VDLESHDTVATLVLPSSYHRNPRFRPFPWQRSPPPPDTPLNIASMQLFERAQRSIYIQ
                     TPNLTCESVIIALLDALARGVEVNIVTNRNMMLLEQLVTAGTTTSWCIRSLIRRFCRP
                     KAALGGKQKAQSGGGDASRDLEAGLPNTGTRVGRLLIWYFHAKNPSSPGVLEGQPAVA
                     TRPQGEEPVHSHLKLALVDAEYALLGSGNLDRASWFTSQELGILFQSRELCSKIKAAV
                     DGVLEGRLDLIFDSDHGTGSN"
     gene            <45458..>45823
                     /locus_tag="MYCTH_2124737"
                     /db_xref="GeneID:11511738"
     mRNA            <45458..>45823
                     /locus_tag="MYCTH_2124737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660983.1"
                     /db_xref="GeneID:11511738"
     CDS             45458..45823
                     /locus_tag="MYCTH_2124737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661031.1"
                     /db_xref="GeneID:11511738"
                     /db_xref="JGIDB:Spoth2_2124737"
                     /translation="MREHSRLFFFSSSSFFFFRVADLSSVGTSSQHPVDTTTKRLENA
                     TTSRNLARIFRRRSADAAWAIPPLSRPFPRRQSRALPFMVIQERGFRDSRLFSPSQPA
                     DRNPVPPPRTVRKTWFARD"
     gene            46305..48489
                     /locus_tag="MYCTH_66729"
                     /db_xref="GeneID:11511739"
     mRNA            join(46305..46470,46567..47075,47160..47744,47918..48489)
                     /locus_tag="MYCTH_66729"
                     /product="glycoside hydrolase family 6 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003660984.1"
                     /db_xref="GeneID:11511739"
     CDS             join(46379..46470,46567..47075,47160..47744,47918..48180)
                     /locus_tag="MYCTH_66729"
                     /EC_number="3.2.1.91"
                     /note="CAZy_ID 267767"
                     /codon_start=1
                     /product="glycoside hydrolase family 6 protein"
                     /protein_id="XP_003661032.1"
                     /db_xref="GeneID:11511739"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001524"
                     /db_xref="JGIDB:Spoth2_66729"
                     /translation="MAKKLFITAALAAAVLAAPVIEERQNCGAVWTQCGGNGWQGPTC
                     CASGSTCVAQNEWYSQCLPNSQVTSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSSTTP
                     PPVSSPVTSIPGGATSTASYSGNPFSGVRLFANDYYRSEVHNLAIPSMTGTLAAKASA
                     VAEVPSFQWLDRNVTIDTLMVQTLSQVRALNKAGANPPYAAQLVVYDLPDRDCAAAAS
                     NGEFSIANGGAANYRSYIDAIRKHIIEYSDIRIILVIEPDSMANMVTNMNVAKCSNAA
                     STYHELTVYALKQLNLPNVAMYLDAGHAGWLGWPANIQPAAELFAGIYNDAGKPAAVR
                     GLATNVANYNAWSIASAPSYTSPNPNYDEKHYIEAFSPLLNSAGFPARFIVDTGRNGK
                     QPTGQQQWGDWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYH
                     CGLSDALQPAPEAGQWFQAYFEQLLTNANPPF"
     gene            complement(<48576..>49358)
                     /locus_tag="MYCTH_2058711"
                     /db_xref="GeneID:11511740"
     mRNA            complement(<48576..>49358)
                     /locus_tag="MYCTH_2058711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660985.1"
                     /db_xref="GeneID:11511740"
     CDS             complement(48576..49358)
                     /locus_tag="MYCTH_2058711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661033.1"
                     /db_xref="GeneID:11511740"
                     /db_xref="JGIDB:Spoth2_2058711"
                     /translation="MPDPFRVLVFSRTTAYRHDSIPAGIRALHRLASASAAGRHPFTV
                     DDSEDPAVFSPGSLSAYRVIVLLQCSGEFLDGAQLGALRGFVQAGGGIVAVHCASFAM
                     QSSEWYGHLIGAVFDNHPEPQVGLVKLLDPKHPVMSLRACDQDGGADRPAQEPQEPQE
                     PKQAQLERVWKDEWYNFKAHPRATSDGLHVLLGVDEKSYEGGAHGEDHPIAWCQTFDG
                     GRCFYTALGHFDEAYEDDWFVGQLHGGILWTAGLAEDPSGGN"
     gene            51358..53607
                     /locus_tag="MYCTH_2299975"
                     /db_xref="GeneID:11511741"
     mRNA            join(51358..51833,51909..52187,52245..52304,52361..52615,
                     52697..53607)
                     /locus_tag="MYCTH_2299975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660986.1"
                     /db_xref="GeneID:11511741"
     CDS             join(51483..51833,51909..52187,52245..52304,52361..52615,
                     52697..53284)
                     /locus_tag="MYCTH_2299975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661034.1"
                     /db_xref="GeneID:11511741"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2299975"
                     /translation="MSAETPSKLAETGGPVLQTENDSNVGGLNKKLKNEPEPSSGSEL
                     EEVESGTVDKKALLRKLDWRLLPAVGILYLLSFLDRSNVGNARIEGLADDLHMTGNQY
                     LTGLTLYFIGYVLFEIPCNIILKRTTPRFWLPTLTIAWGVVATLMGIVQNLTGFFIAR
                     FFLGVTESGLFPGVVYYFSMWYQRRERQFRISLFFGFAALAGSFGGILAYGIGKMAGV
                     VWENGWRWIFILEGIATVVVAITAYWFIHNYPETAGFLSDKERSFILQRLAADSDATR
                     DERFTWGNVNKALLDPKCWLYGFSFHAMSLPLYTFSLFLPTIIKDLGYEAASAQLLTI
                     PPYALAFITTLAVATVSERTGQRALPLIGSSLFAIIGYIILLTNSDPTNRPGVSYLGT
                     FFAAGGIYPATALALSWPAINVSGQTKRAVANAMQISIGNLGAVLGTQLYRANDGPRY
                     FVGHSFALGYLVGEIVVSSALYFLLKRENERRAAISPEVKEVGELEDWSGDDDPRWRF
                     QH"
     gene            54290..56590
                     /locus_tag="MYCTH_2299976"
                     /db_xref="GeneID:11511742"
     mRNA            join(54290..54828,54900..55047,55115..56590)
                     /locus_tag="MYCTH_2299976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660987.1"
                     /db_xref="GeneID:11511742"
     CDS             join(54586..54828,54900..55047,55115..56268)
                     /locus_tag="MYCTH_2299976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661035.1"
                     /db_xref="GeneID:11511742"
                     /db_xref="InterPro:IPR007913"
                     /db_xref="JGIDB:Spoth2_2299976"
                     /translation="MAEEGGHGAVVAPNAHAPSAPGGGHHGPAENLVINTQGATTNGN
                     ATKNPPREEIASLTSPRLITPNPFSRKNTSLEIDDYFTGPRDIQKHSKWPIFLQMHGS
                     ILPKLILPLLAVAMWSTWITCIHVLVTPISIGSVLLTVLGFVVGLGLSFRSSTAYERY
                     AEGRKYWAQLILASQNLGRTFWLHTAERSDVPEDQKEEYKRRDVLERLTAMNLIVAFS
                     VALKHRLRFEPYTCYEDISSLVSHLRTFAQAATQEDHDNAQRTLRRHGFFKSVGEYLG
                     VSFAESNPRKAVKKAGRPLGNLPLEILSYLASYVDELALSGRLPVPMQQTNAYNNIAA
                     LNDVLVGTERVLNTPLPIAYSIAIAQITWVYILVLPFQLLATVGDQTWITIPATVVAA
                     YIILGILFIGREIENPFGQDVNDLPLEAYCAQIASEMDIMASLPKPKSSEWMESIDNR
                     VLWPLSSSGWPVWMSRDEDKIREAIIHKVEATFISQKGEEAVLKGQSSSEKSGHEHSK
                     RSMSDV"
     gene            complement(<56733..>57745)
                     /locus_tag="MYCTH_2124742"
                     /db_xref="GeneID:11511743"
     mRNA            complement(join(<56733..56796,56890..56973,57042..57531,
                     57619..>57745))
                     /locus_tag="MYCTH_2124742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660988.1"
                     /db_xref="GeneID:11511743"
     CDS             complement(join(56733..56796,56890..56973,57042..57531,
                     57619..57745))
                     /locus_tag="MYCTH_2124742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661036.1"
                     /db_xref="GeneID:11511743"
                     /db_xref="JGIDB:Spoth2_2124742"
                     /translation="MQVPGGSADDGLRTTLQQSGKMVQNEYDRHFANLGPRFAQGDLV
                     AQTQIQSQISFFSKAASSNSSRKPSLPAGCPTSTVSTISPSLQVTEASEHFRVLLTIS
                     TPVGIGADTATTKRPCQEDLVHSLAPGGLNDLRLKLITRGLNRTHRATATPVPYIAAN
                     IPKKRNMLLEGHWTALLPPSTRRRFARHVVRHLAGEREKVVVGLGGDGESEAIMVRTF
                     LLTRRFIFKCPRERPGIAEYEGDSDIRELNQTLPFW"
     gene            complement(<57789..>58052)
                     /locus_tag="MYCTH_2124743"
                     /db_xref="GeneID:11511744"
     mRNA            complement(join(<57789..57931,58010..>58052))
                     /locus_tag="MYCTH_2124743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660989.1"
                     /db_xref="GeneID:11511744"
     CDS             complement(join(57789..57931,58010..58052))
                     /locus_tag="MYCTH_2124743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661037.1"
                     /db_xref="GeneID:11511744"
                     /db_xref="JGIDB:Spoth2_2124743"
                     /translation="MDCAEMINEKELRVRFVLATLVSTVINLYDRLIEQRRQEKLDRG
                     QNKRIKELEERLSEAEE"
     gene            <58908..60712
                     /locus_tag="MYCTH_80081"
                     /db_xref="GeneID:11511745"
     mRNA            join(<58908..59244,59327..60296,60361..60712)
                     /locus_tag="MYCTH_80081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660990.1"
                     /db_xref="GeneID:11511745"
     CDS             join(58908..59244,59327..60296,60361..60367)
                     /locus_tag="MYCTH_80081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661038.1"
                     /db_xref="GeneID:11511745"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="JGIDB:Spoth2_80081"
                     /translation="MLSGILIFNQKGENLIFRAFRNDCRPRLADVFRIQVISNAQVRS
                     PILTLGSTTFSHVKHENIYLVAITKSNANAALVFEFLYRLIQLGRGYFGKFDEEAVKN
                     NFVLVYELLDEIIDFGYPQNTETDTLKMYITTEGVKSERAIEDSAKITMQATGALSWR
                     KADVKYRKNEAFVDVIEDVNLLMSATGAVLRADVTGQIIMRAYLSGTPECKFGLNDRL
                     LLDNDGLLSLPSGNKMGSKATKAAAGSVTLEDCQFHQCVKLGKFDSDRIISFIPPDGE
                     FELMRYRATENVNLPFKVHAIVNEVGKTKVEYSIGVRANFGSKLFATNVVVRIPTPLN
                     TARITERCTQGKAKYEPSENNIVWKIGRFPGQSEFVLSAEAELTSMTNQKAWSRPPLS
                     MNFSLLMFTSSGLLVRYLKVFEKSNYSSVKWVRYMTRAGSYEIRF"
     gene            complement(62935..64440)
                     /locus_tag="MYCTH_2299979"
                     /db_xref="GeneID:11511746"
     mRNA            complement(62935..64440)
                     /locus_tag="MYCTH_2299979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660991.1"
                     /db_xref="GeneID:11511746"
     CDS             complement(63120..64244)
                     /locus_tag="MYCTH_2299979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661039.1"
                     /db_xref="GeneID:11511746"
                     /db_xref="JGIDB:Spoth2_2299979"
                     /translation="MGNPLRQCQKWLQRNIWGSKGMQPESVAIKPRDPPSNDMSTKTQ
                     SHPTTEPPPYSQESRLTALPEYDVLFRPVRATRASTQAAVCVAGVTGGPAAARAVATV
                     ISIVSHSVANVSKDERPATVSAITTAVIKFATRVVQVGPGVPSVTIYDQALASVPVAS
                     MPALAEGLPKALSNIDHALSSVVPWLRDSVAATIAEAVAKVTDDVAAASLDGGTWRAD
                     MYSRLANSTADGVPDRGVASTRSGPQKLPEQLPDPDSSKSSSADTRSKYGSCEAVRRV
                     ARMQAVIYAIRAHAATAGHIQAERALAAVAAGSGLPDVANAVPGATKCTCNKSPLSCE
                     ASLQVVRARAALSAVKSYTEMTKNTEAAQALSAAERQTRI"
     gene            65192..66871
                     /locus_tag="MYCTH_2299980"
                     /db_xref="GeneID:11511702"
     mRNA            65192..66871
                     /locus_tag="MYCTH_2299980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660992.1"
                     /db_xref="GeneID:11511702"
     CDS             65513..66679
                     /locus_tag="MYCTH_2299980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661040.1"
                     /db_xref="GeneID:11511702"
                     /db_xref="JGIDB:Spoth2_2299980"
                     /translation="MDSPTRRRRPAVHRFSLRYLLVVPVLLAVLTGCVLFVHGDTNIY
                     MLYSQCHARSRLPWLSRLPVLGGPACFLVSFFGEAVASARAAGLMAAVLSFVAGLLTV
                     STVEAARICNAPSRLIACPTAPWLVFDLVGGAFVWQLVIIPAFFRRTRDIIAARKQQG
                     GGGGPQPLSGPTDPTFGEAMRHLASPAEAVAIPVAVALGFVLPALLMLLLARPAAVLV
                     WLFFPVWVSLVRRLARRAALMLMARQGWRRRGSHGSSGSSLHLESSRPALLAVYALPV
                     ACSVLSHALFIWTLTQPDDRKEMTRSALKFITINIFFVGLTVLYWILVEAGWRVALVM
                     VVASIVLGPGAGVCLGWVYREKTVDLDRTVTVVAVGSRRQSGDADPSEETPLLR"
     gene            complement(<67212..73047)
                     /locus_tag="MYCTH_2132970"
                     /db_xref="GeneID:11511703"
     mRNA            complement(join(<67212..67673,67762..67867,67919..69571,
                     70426..70544,70597..70905,71064..72035,72095..73047))
                     /locus_tag="MYCTH_2132970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660993.1"
                     /db_xref="GeneID:11511703"
     CDS             complement(join(67212..67673,67762..67867,67919..69571,
                     70426..70544,70597..70905,71064..72035,72095..72868))
                     /locus_tag="MYCTH_2132970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661041.1"
                     /db_xref="GeneID:11511703"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004102"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR008893"
                     /db_xref="InterPro:IPR012317"
                     /db_xref="JGIDB:Spoth2_2132970"
                     /translation="MPPKRGKKAAAKPALDGCILALSGTFPGATHAAIKAKAESLGAT
                     VAISVTDNVTHLVTTDNDYNKPSSKVAKAQSLGTHIISLDWLLACETNNTREPEKDYT
                     IGKPTAGSSAQPDASKLASSQKGGATATDGTRTRKRASSPVADDASDNDAAPKPKRTR
                     GRKAAAVQADGENDVKMQDANNATNTEPKEEALDKTKGVERAVGEGQVAKSKDIQIPL
                     DEGSPFFQYKVYIDDSGVIYDASLNQTNASNNNNKFYRLQLLVQPQQAKYVTWQRWGR
                     VGERGQTQWTSTTSLQEAVRLYEKKFKDKSGLAWKDRGMNPKPGKYAFVERNYEDDSD
                     DDGETDKAGAKDDKKTSVREPPKSTLHPAVQSLMQLIFNPQYFRDTMSSLNYDANKLP
                     LGKLSKATITRGYQALKELSALIDDPSLAANYGTSYRPAVEQLSNTFYSLIPHDFGRN
                     RPPVISDQAMVKKEIELLESLSDMKDAALIMKLDKVADDDIHPLDKQYQGLKMEEMTP
                     LDPTSAEYAQLQNYLFETRGYTHGHNYTIENIFRIERQGERERFENSSFGKMNQNRRL
                     LWHGSRCTNFGGILSQGLRIAPPEAPVSGYMFGKGIYLADMASKSANYCCSYISGGTA
                     LLLLCEAELGDPMQELIGASYNAGEDAKKKGMVSTWGQGRTGPSKWKDASCVHPSLVG
                     VKMPDTSVPPGPTDVKGAGLFYNEYICYDVAQVCLRYLFRVRITVQPPAAGNRLSMST
                     SPRPHKRTNTCVTCRARKVRCDGRRTICTNCERLGFNCSYDENVGVEVVPGEGGGTAI
                     SVPRRRVRQACQNCHARKARCSGTMPSCDRCRAQRLECVYRPGKRSLPPPVPSTSISA
                     AAPSPGSRSGSGSGSGSGTGSGMDLDSHTAQGAPNDYGTSSGTASPATAVDPSEPDEA
                     LALKAFDNFFRHVYHVAMFSFLHRPSLMELYHAGSLDRALVLSIVGVASLLTDLGPGM
                     AEYGNRCIEEAVSLCLASLEKPTLSRLQALVLAIKHRILSKRFSSAFMLHAIASRFAT
                     ALRLYQENPELCFLAREARRRLMWSIYMIDASISMGQADVAIWFDAERQIQLQLPCNE
                     RHFDFDLPDPTEPLRPPGPDPVTGAIPPLPDVLGLMALHIRLYWIRSRILQCTSKAAA
                     SPTADALAMLPSQLADFAAELEMFEARLPVSFRENEANFRLRSYSSRLNIFITTHLLW
                     RQCHLDLYRLFLPGLKEALAPAALQQLDPHFVMHKRRSCYEHARRMADMMSQLLSLSS
                     TSTSPPVADLDLPGGDLGLGFTQERVRELATVCLRAARQSTPGPASASIQADIERLIA
                     SGLSLPEGLPAPPGRPRSLDAGAGEPYLAPQLSTPRTSHAGAQLGVPTSAPTPANQNM
                     MASVQMPPPASVSPMAGLNLPLAEGAIQGTAPVAPSQASGVTSGSNAFEELPEGLYFG
                     PEFFGIESWSALPHGWADIGHFSGSGIP"
     gene            75240..76848
                     /locus_tag="MYCTH_2299985"
                     /db_xref="GeneID:11511704"
     mRNA            join(75240..75674,75761..76848)
                     /locus_tag="MYCTH_2299985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660994.1"
                     /db_xref="GeneID:11511704"
     CDS             75887..76081
                     /locus_tag="MYCTH_2299985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661042.1"
                     /db_xref="GeneID:11511704"
                     /db_xref="JGIDB:Spoth2_2299985"
                     /translation="MCGTKISYACMTTLISQSITCSCDRVVACGKSTLFCGTCSHPRC
                     KELRGEVQQPVPQQLSSSLR"
     gene            complement(<77230..>78840)
                     /locus_tag="MYCTH_2057317"
                     /db_xref="GeneID:11511705"
     mRNA            complement(<77230..>78840)
                     /locus_tag="MYCTH_2057317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660995.1"
                     /db_xref="GeneID:11511705"
     CDS             complement(77230..78840)
                     /locus_tag="MYCTH_2057317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661043.1"
                     /db_xref="GeneID:11511705"
                     /db_xref="InterPro:IPR004601"
                     /db_xref="JGIDB:Spoth2_2057317"
                     /translation="MLRRSNPPPKAELKLEQLADLDVETPLRQGERGEDSSAEDIIAG
                     EKILDPEAERIDSPGEAPDVPERGAARAPPVNSGYLPLPWRGRLGYACLNTYLRSAKT
                     PVFCSRTCRMASIIDHRYPLSDPSRPEHSVKNRPDKSKEPSLERGLKSVQDLGLANAR
                     DIVRMLRWNGKHGIKFMRLSSEMFPFASHREHGYKLAPFASEVLAEAGRVAAELGHRL
                     TTHPGQFTQLGSPRKEVVDAAVRDLEYHDEMLSLLRLPEQQDRDAVMVLHMGGVFGDK
                     AATLDRFRANYAKLSPSVRARLVLENDDVGWSVHDLLPVCEELNIPLVLDYHHHNIVF
                     DSTQCREGTLDICRPELQARIAATWTRKRIKQKMHYSEPCPGAVTPRDRRKHSARVMT
                     LPPCPPDMDLMIEAKDKEQAVFELMRTFKLPGFERINDMIPNEREDEPRPAPKVPKRK
                     QKPAASLKRKRAPDEDPVELNNVGSGTDDREQPVDTGREVSDEDYAMGGPDGRVYWPP
                     GREDWLKPAKRGARTPRLADIERIKKRR"
     gene            <81132..>82871
                     /locus_tag="MYCTH_2124750"
                     /db_xref="GeneID:11511706"
     mRNA            join(<81132..81180,81284..81685,81852..82108,82183..82255,
                     82333..>82871)
                     /locus_tag="MYCTH_2124750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660996.1"
                     /db_xref="GeneID:11511706"
     CDS             join(81132..81180,81284..81685,81852..82108,82183..82255,
                     82333..82871)
                     /locus_tag="MYCTH_2124750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661044.1"
                     /db_xref="GeneID:11511706"
                     /db_xref="JGIDB:Spoth2_2124750"
                     /translation="MRLVQIAASAAALLSTGANAAIPELPLPQSCSGVSSSRFQYTVA
                     SGWSAFKIAGGLKQVRTIVWDTEGNMLVAQSGRGISVHTFGADGCINSTSMLIQANQL
                     NHGLALSPDGKTLYASGETAVYSWSYDPVARALSNQKTLISGISTGIHFTRTIAAVPN
                     SDLILVQVGSNQNLDMAAASPSTGRAIIKIFDTTKAPASGFNYNTNGEVFGYGLRNTI
                     GFVPDPSGVFWGVENSGDDFARTENGQQRDIHQDNPAEELNNLGNPLDPERRNIWYGY
                     PTCFTVWDPSPFSGLKTGDQFVLSPNNTFNDASCAQNNAVPPRLSFQAHSAPIWNTFN
                     ADASKMYVAFHGSWDRSPPTGFKVVEIPFQKLDDGSYEPVAPADSQTGYKDIFGAPNP
                     ASCTANGLTMSNCFRLTAAAWDPSGRGLFVGSDNSAEGEIFILTPSS"
     gene            85151..87210
                     /locus_tag="MYCTH_2299988"
                     /db_xref="GeneID:11511707"
     mRNA            join(85151..85375,85487..87210)
                     /locus_tag="MYCTH_2299988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660997.1"
                     /db_xref="GeneID:11511707"
     CDS             join(85298..85375,85487..86968)
                     /locus_tag="MYCTH_2299988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661045.1"
                     /db_xref="GeneID:11511707"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="JGIDB:Spoth2_2299988"
                     /translation="MVLQDLGRRINAAVSDLTRAPNLDEKAFDSMLKQICSALLEADV
                     NVRLVGQLRKSIRSTVNFKELPPAVNKKRLIQKAVFDELVRLVDPHAEPFRPKKGKSN
                     VIMFVGLQGAGKTTTCTKLARYYQSRGFRACLVCADTFRAGAFDQLKQNATKAKIPYY
                     GSLTETDPAVVARDGVEKFKKERFEVIIVDTSGRHRQESALFQEMVDIQAAIKPDETI
                     MVLDASIGQQAEAQAKAFKEAADFGAIIITKTDGHAAGGGAISAVAATHTPIVFIGTG
                     EHMLDLERFVPRNFISKLLGMGDMAGLVEHVQSLKLDQKETIKHISEGIFTIRDLRDQ
                     LQNIMKMGPLSKMAGMIPGMSNMMQGMDDEEGSLKLKRMIYICDSMTDKELDSDGKIF
                     IEQPTRMTRVARGSGTTVREVEDLLTQQRMMAGMAKKMGGNMKNMQRAQSAMAGGNKA
                     QQLAAMQKRLQSMGAGAGAGGMPDMASLMKMFGGGGGAGMPGLGGMDINAMMKQMGGM
                     MGGQGGRGGRR"
     gene            87756..88220
                     /locus_tag="MYCTH_2299991"
                     /db_xref="GeneID:11511708"
     mRNA            87756..88220
                     /locus_tag="MYCTH_2299991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660998.1"
                     /db_xref="GeneID:11511708"
     CDS             87944..88213
                     /locus_tag="MYCTH_2299991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661046.1"
                     /db_xref="GeneID:11511708"
                     /db_xref="JGIDB:Spoth2_2299991"
                     /translation="MLVEGQHVERREDEAKVLEHYRNPVALVDNKVSVTERGSIVDIL
                     ACGDSSGRGTVMSKTAALLIYVSVAVMLSTASNMYHAASATPHRQ"
     gene            89098..89196
                     /locus_tag="MYCTH_t54"
                     /db_xref="GeneID:11511709"
     tRNA            89098..89196
                     /locus_tag="MYCTH_t54"
                     /product="tRNA-Ser"
                     /note="Anticodon: GCT"
                     /anticodon=(pos:89131..89133,aa:Ser,seq:gct)
                     /db_xref="GeneID:11511709"
     gene            90413..94137
                     /locus_tag="MYCTH_2299996"
                     /db_xref="GeneID:11512503"
     mRNA            join(90413..91154,91226..94137)
                     /locus_tag="MYCTH_2299996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003660999.1"
                     /db_xref="GeneID:11512503"
     CDS             join(90874..91154,91226..93776)
                     /locus_tag="MYCTH_2299996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661047.1"
                     /db_xref="GeneID:11512503"
                     /db_xref="JGIDB:Spoth2_2299996"
                     /translation="MRYLCNLSVYITVEAATLIGLTFVAATSYLYHSVMARKKKTGAA
                     KPPQSTGSTPAAPTAAAASKGADAKGFAQAKPAAGAAPVMKQADSRPENSPYGSPSCT
                     IPFASPLTVPLEILKKSPKLHAAYELRLPELPAIPEGVGHVLVHYLHTGTYESLKPKP
                     TDAMSKQICELKTSIQTYAAARTYDLPELMRLAEAKIEKYGKGLPLPALLEVARDAYP
                     NLTEGDAWFLNYLRSRIRPHLKDPKSLMGSNLLDQISGILSPNRVLLRTVLELFCERI
                     VVRPEATTPPAASTIASPVTSPGTSRPVSPHPPASSMSLLEMRSRSVVREEYTPARKP
                     QKATPWPSPDNMSEASWARSMSPDPVLPETVPPKFEANPVADAKPPVTPFLELGPVIR
                     DAVPSPGPSIKSKAEEGEPEPQPAPESEVKGAIEPKAKATEPKVEDAEQEVKSVEPEV
                     KAAEPEVKAAEPEVKAAEPEVKAAEPEIKAAEPEIKAAEPEVKPAEPEVEATEPEAKP
                     VPEPEVSIAIEPEPKAELEVELPAEPKAEPSIVPPVDALPKRAVEVPTEGPVETEATT
                     AVEPEAKKVEDISEPAASIAQRERKDSGKGIDLEPLPKELDSSPEHVSELEPDSKRQP
                     HIRPQVLREADSGFWEGPDVEPGKEPAPSIVELEESVAEPAPKVAHELEAIAGPKDGP
                     GVEIRDFANADATVESESDKRAETETDATKEAVLDSQPTQVNSEAVANILPKELESQP
                     EPEPLPTRSTEAAPEQSADAATLVSEIGSAREVPETAERKEVKAQPETEKVEPVPRGP
                     EQESLLTIRQVQKETVELQEVAKSEPEPEPQTDSSEPVHLPDVAESAGSVETKAAQPG
                     VESEPEPSGKPEVQDANSDSAVHAPSGDAGAVEPAVTLGAKPATEQEGAKTEADGAGS
                     QPCSAQVRQRSWKRRFLSLRYPVLFGRGM"
     gene            95423..97366
                     /locus_tag="MYCTH_2299997"
                     /db_xref="GeneID:11511710"
     mRNA            join(95423..95806,95895..97366)
                     /locus_tag="MYCTH_2299997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661000.1"
                     /db_xref="GeneID:11511710"
     CDS             join(95589..95806,95895..96993)
                     /locus_tag="MYCTH_2299997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661048.1"
                     /db_xref="GeneID:11511710"
                     /db_xref="JGIDB:Spoth2_2299997"
                     /translation="MDESGRKGTGTQSVQSEAALFSVVKPSQSTADSLPSPAMDSLTG
                     RPSSMKTGPVGRKTSFRVREWAKRSNSSRTAPSTGTSASESLKSHIKHLGGGRLEQVE
                     VRGTANNTTLLAPFPKRGLRSRTSSIDSRVTQWVDFYPSSSESSNSQSKPQADDDDGK
                     RPDDEQPGQQQRQQERQQERRRERQWERAGSNSDLRPAPLRIPSSERRGGASADTPPS
                     KPLERKDSKWKPLPILPAQRASRGREQSGLGPAPPTPTKRAETRGPQEPEPAEQPPTE
                     QGKGGRKGGPSRSDEPQPLPTFRFDSAPPTPDSSAGGAARVLVGEQDWGRQVEGARAR
                     PAGELRGPKGPLQGRAPEGRDEKGTGGSGAVGMDSPPKQVVRHTREERVWLHVNYRGE
                     APFLQAWGLDIANPGDRLEGLTILRELMQAEGAGGGPERREHGNAA"
     gene            97835..99195
                     /locus_tag="MYCTH_2299998"
                     /db_xref="GeneID:11511711"
     mRNA            97835..99195
                     /locus_tag="MYCTH_2299998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661001.1"
                     /db_xref="GeneID:11511711"
     CDS             98057..99073
                     /locus_tag="MYCTH_2299998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661049.1"
                     /db_xref="GeneID:11511711"
                     /db_xref="JGIDB:Spoth2_2299998"
                     /translation="MTPLSDDVPRISRGAEANADKRAHGDGDVGPPRAHESQDPWLQQ
                     ARNAGYTTHIRSASRTTWDGRAPLPRSRSPSPPHAPAQSRLSNPPRPSSAISLPNHHA
                     AEHGRPTVLADRWSYDRERMPPPPPAPRDSRPGTPGTPASDPDASDTGFSRPASTLIE
                     SQTPSRQQSGFFNFMNGSAEPNDSPPLPSDFDQRGQHLSPHLRQSCHILTDEEMEMLA
                     RPPPPHPPMTAPSRPSSPGRDRGACGSAAPGHSSESTSAVAPPEPPQPREGVGRHLNR
                     NSVNSHGSDHSRDVRPSCLGMCDIAPVRPVLGKFGAWFMGVVTPVSFGLLTGCLASTI
                     SGCR"
     gene            complement(100012..102294)
                     /locus_tag="MYCTH_2089588"
                     /db_xref="GeneID:11511712"
     mRNA            complement(join(100012..101358,101572..102294))
                     /locus_tag="MYCTH_2089588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661002.1"
                     /db_xref="GeneID:11511712"
     CDS             complement(join(100109..101358,101572..101656))
                     /locus_tag="MYCTH_2089588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661050.1"
                     /db_xref="GeneID:11511712"
                     /db_xref="JGIDB:Spoth2_2089588"
                     /translation="MATVSRQPFAPVGEARLKSLASVKNRQNAIASSPIKRKASEVED
                     ADNSENIAPVQFPKRSKGADFWGDLSKSFSKPPAFTLTKAASSPVTKDALSSPISRPS
                     PASRPRTVLQPKSPSSRLKTRSAAQSPLTAPAGRSPTRASKRMGILSRRRSQRPDPPA
                     FSQKAAVPFSLDAALRGTIPSYSGSLRQSKLKRRAAASSSSNAAQDFFIPTPDLASSW
                     CFDIHEDTPEQEMTNLLQHGTCTLDISSDEESESRAKRERAEGRDKENIPPPEDVSQT
                     SSARGGPVPEPVEIDEDVLLLKGRGPLAEMNVTDYYAEGCDSSSVFIVPGDEEDPEAV
                     VEGESAVEEQGQDLPALPADGEDQQRWFAEEEDTSERSPRLQPPPAPQVSLDDVERVD
                     VDDIMGGNDRSLEASPSRLGPIEGAGESFELWESHSAKDEGSAPISPAPLVE"
     gene            complement(105262..107270)
                     /locus_tag="MYCTH_2300003"
                     /db_xref="GeneID:11511713"
     mRNA            complement(join(105262..105597,106146..107270))
                     /locus_tag="MYCTH_2300003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661003.1"
                     /db_xref="GeneID:11511713"
     CDS             complement(106239..107231)
                     /locus_tag="MYCTH_2300003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661051.1"
                     /db_xref="GeneID:11511713"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="JGIDB:Spoth2_2300003"
                     /translation="MAHSESSSGSESPAPVVNGDKSRRSKSKNNNNNNGKKRSREGDP
                     KDAASDADANGAHPLGERRSSVSKPARDFRDKPEPPPKKKKRKTPAPAAPAPAVKETP
                     TAEEAAEQSTRSPSPVIDFDGLSRPSVGTRKRVDEDDEQKQARLERMKGAVRTLLECV
                     GEDPDREGLLATPDRYAKAMLYFTKGYQENVRDIVNGAIFQEGHNEMVIVKDIEVFSM
                     CEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAEMFARRLQVQERLTKEVANAVMEVLK
                     PQGVAVVMESSHLCMVMRGVHKTTSTTITSCVLGCFERKEKTRNEFLSLIGVNR"
     gene            108153..109571
                     /locus_tag="MYCTH_2300006"
                     /db_xref="GeneID:11511714"
     mRNA            join(108153..109052,109144..109571)
                     /locus_tag="MYCTH_2300006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661004.1"
                     /db_xref="GeneID:11511714"
     CDS             join(108414..109052,109144..109560)
                     /locus_tag="MYCTH_2300006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661052.1"
                     /db_xref="GeneID:11511714"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="JGIDB:Spoth2_2300006"
                     /translation="MASPSPHSPPSSHPQQPSINNMSTNKKRTADGAAAPALKRRKPS
                     TISTASGPTSAHPLRQTSFPPDLDDSSSAFFGARSPSADADAMSLVSGSQVSTAAPLK
                     KKRGRKSKAEKAREQTPSVAGGRAPTAVSGVSEGGVRGSKSVAGGAGGGDEGEGEDEG
                     PTEVAATADVRTKEQKEEEHRLRGMLISALSEDQFYRFENWRAANLSKASVRRLVNAT
                     ISQSVAENVVIGMRAVAKVFIGDIIESARRVQGEWIEKLGEKQTDFPTPPATAAPTPT
                     ADGGDADDAQKRETKDSEVDDRRGPLRPEHLREAVRRYRKGFEGGGVGMQWIFHQQQQ
                     GGVERFPTRTGGRRIFR"
     gene            complement(110308..111218)
                     /locus_tag="MYCTH_2300008"
                     /db_xref="GeneID:11511715"
     mRNA            complement(110308..111218)
                     /locus_tag="MYCTH_2300008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661005.1"
                     /db_xref="GeneID:11511715"
     CDS             complement(110415..111038)
                     /locus_tag="MYCTH_2300008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661053.1"
                     /db_xref="GeneID:11511715"
                     /db_xref="JGIDB:Spoth2_2300008"
                     /translation="MTLSPAAVTNSPEYQTALPARVIGRPKMVSIGKADEATATTKTK
                     RQSPIRRLAAKLGAKAVRREVAIYKPRECVVPEDREAEGESQSTTAEGGTGTRRSRRL
                     LDKQQKEQPRSASQQSAVSKSSSSDGASPPRASRLRKENKSSSTSPGSGSRADWDPLG
                     AQGQNKTGAAPSLSLMMADWEIAPGRIRVRDDREGIVESEWSPYHCC"
     gene            complement(113792..115431)
                     /locus_tag="MYCTH_2300010"
                     /db_xref="GeneID:11511716"
     mRNA            complement(join(113792..113836,113894..114944,
                     115030..115431))
                     /locus_tag="MYCTH_2300010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661006.1"
                     /db_xref="GeneID:11511716"
     CDS             complement(join(114070..114944,115030..115285))
                     /locus_tag="MYCTH_2300010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661054.1"
                     /db_xref="GeneID:11511716"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="JGIDB:Spoth2_2300010"
                     /translation="MHLARLQRPLQRAAASSALPFSAVLRPTTTTTALEERFGHLRIS
                     SLNSANAAVEGRRYATVKSQGAYKLKSKKTIPKKMGAKKTGDQYVVTGNIIYKQRGTI
                     WHPGENTIMGRDHTIHAAVCGYVKYYRDPQRHPTRQYIGVAFNREDKLPYPPTSPRRR
                     KLGLVAVPRKVERPAEETTSPSGIPLSVTRHETVAQDEKEAPKPATEEQPVANLPEPV
                     SLTDGNAVVANLIREKLQSRQIAQAKAEAKKLEQLKELEARKGTRVFHLQSDYSYRES
                     NWEIGRLVGDAGVVPGTDQPESRKAKFRLRRRKRVVHFKGIKKRKMAKAARRREYRKM
                     VREKRAARMAQRAEAAAAVKASLGKAASAAANAAADKGEVKA"
     gene            115480..116312
                     /locus_tag="MYCTH_2300011"
                     /db_xref="GeneID:11511717"
     mRNA            join(115480..115916,115975..116312)
                     /locus_tag="MYCTH_2300011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661007.1"
                     /db_xref="GeneID:11511717"
     CDS             join(115724..115916,115975..116132)
                     /locus_tag="MYCTH_2300011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661055.1"
                     /db_xref="GeneID:11511717"
                     /db_xref="JGIDB:Spoth2_2300011"
                     /translation="MRLVSFIVLALASLVSAQFGFFDQMFSGGGQQHRQPQNVPSDSS
                     HYRTQYARSHCDKYLCPDTLACVHFPHHCPCQWPSHEDKFELAEGQRICISKGGFKAG
                     EAARKVELARKGLL"
     gene            complement(116281..117646)
                     /locus_tag="MYCTH_2300012"
                     /db_xref="GeneID:11511718"
     mRNA            complement(join(116281..117310,117420..117646))
                     /locus_tag="MYCTH_2300012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661008.1"
                     /db_xref="GeneID:11511718"
     CDS             complement(join(116493..117310,117420..117486))
                     /locus_tag="MYCTH_2300012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661056.1"
                     /db_xref="GeneID:11511718"
                     /db_xref="JGIDB:Spoth2_2300012"
                     /translation="MASVANTTQTRTPSGSQPTRPKGILKNSCRRSPPVSPTDGHSLP
                     HTPEASFPLSPKEAKELTIANTQYNAGHRRSSSTTASRPGGSRRQSSLPPNDGQEEQG
                     QRLKWDEANLYLTEQERTSTMKINEPKTPYAKHYDPSEDPSDEDDDDDDMDKVDGAPH
                     PTGQQRRSQTQRRRHGAPSDDEIPRLSLGEPEEEVPEPSSPPRPRAVHVDSKGSGHDT
                     DGEEYLVGLSAEEREKHRRFEEMRKKHYEMKNVAALLGHPEELEELDDDDDDGDGDAA
                     GEGRPPVPPLPSRVNGTS"
     gene            complement(118888..>121166)
                     /locus_tag="MYCTH_2076976"
                     /db_xref="GeneID:11511719"
     mRNA            complement(join(118888..119274,119329..119609,
                     119687..119827,119894..120334,120396..120569,
                     120733..120824,120893..>121166))
                     /locus_tag="MYCTH_2076976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661009.1"
                     /db_xref="GeneID:11511719"
     CDS             complement(join(118959..119274,119329..119609,
                     119687..119827,119894..120334,120396..120569,
                     120733..120824,120893..121166))
                     /locus_tag="MYCTH_2076976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661057.1"
                     /db_xref="GeneID:11511719"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2076976"
                     /translation="MALDDAPRGVVPSDKLEVGGDDEKEQYTQDKVQRLEAKNRVIQG
                     AKTATEKEQKMTLMQGIRLYPKAIAWSVLISTCIVMEGYDLCIVNNFYAFQQFNKKYG
                     KQLPDGTWEVPAPWQAGLSNGANVGELFGLLINGYVSERFGYRWTVIVCLMLINAWTA
                     LFFTAQNVQTLLAAEILCGIPWGVFQTLTITYASEVCPVALRGYLSTYVNFCWGLGQL
                     IGIGVIMSMLDRTDEWAYRIPYALQWMWPLPLAIGIFFAPESPWWLVRKGKLDKAKAA
                     LLRLTSLNRETDFNADETIDMMVHTAALEEKTTSGATYLDCFKGHDLRRTEIVGMCWA
                     IQNLCGNSFSNYSTYFLTQAGLDSHSAYGFALGQYGFNMVGVLGAWFLMSRGIGRRSL
                     YLYGLCVLCAMLLILGFLGLVPEAHRREGSIATGSIMLCWALTYQLSVGTVCYSLVSE
                     ISTRRLQIKTVALGRVFYIIVGIFCSVVTPYMLNPGAWNWRNFAGFFWGGICFLCIIY
                     VYFRVPEPRGRSFAELDMLFQMGVSARKFPSTRVNVFEEDIDGDLMNEYQKQTSAKGP
                     VSAHIP"
     gene            122244..124991
                     /locus_tag="MYCTH_2300024"
                     /db_xref="GeneID:11511720"
     mRNA            join(122244..122473,122551..122579,122707..122796,
                     122897..122947,123045..123337,123400..123421,
                     123504..123767,123845..124303,124370..124470,
                     124530..124629,124681..124991)
                     /locus_tag="MYCTH_2300024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661010.1"
                     /db_xref="GeneID:11511720"
     CDS             join(122406..122473,122551..122579,122707..122796,
                     122897..122947,123045..123337,123400..123421,
                     123504..123767,123845..124303,124370..124470,
                     124530..124629,124681..124862)
                     /locus_tag="MYCTH_2300024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661058.1"
                     /db_xref="GeneID:11511720"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2300024"
                     /translation="MSPHGTATSGSGSSTQALAKFGCARCRQHHLRCDRVTPTCGRCL
                     SADEPCRPPGLKIRESNKYQFKFGKRQRWVKTPRRLVFIDESHAATNDASSPDSEPDE
                     SETVWDSSPVASGSSSQKSPPVSAGMTQYRPASPPERLRRMMISSVVNPPAPNWPLTD
                     PEEARLFRHFVEKLAIWLDLCDPHHTFEIMVPQMAKDFPVLLNAIFALSARHLGQTLS
                     DGSLRKKYNRLADTHNEACINIMKGLLMSKDYQSVWTEHLFAATIILQVMEEMNAGLR
                     DEDDDNGVHGHQEAIGRGHLPGMYRFVRERSFEPGTLGAASFWVGLRQEIYSAVTKRQ
                     PVCLNLVHPGLVNRSLDQTDDYTWANLAVMHCADVVNFCFDTDKHRRQSWDELERWNR
                     RWFEEQPPSYDPVFKGSRGSAVFPEIWYHRSCQVIGVQHHRLARLFLLDHRVKSGALV
                     RAEERNEVEESIRATVREICGIGRGNSFTPPGLFTSCMAIAAFGHYFNKVEEQDAMIS
                     ILEETQKDHARPTESVRLDMLQAWGRNTGLSGRPAKAPNTKRIA"
     gene            125941..127693
                     /locus_tag="MYCTH_111314"
                     /db_xref="GeneID:11511721"
     mRNA            join(125941..127377,127452..127693)
                     /locus_tag="MYCTH_111314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661011.1"
                     /db_xref="GeneID:11511721"
     CDS             join(126493..127377,127452..127508)
                     /locus_tag="MYCTH_111314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661059.1"
                     /db_xref="GeneID:11511721"
                     /db_xref="InterPro:IPR007828"
                     /db_xref="JGIDB:Spoth2_111314"
                     /translation="MAAVDIRPAQRDGPALEAITDAVAMVNILRGMATSETTAFDAES
                     RFDSDKDKSAFRKYDEACDRVKGFYAEQHAKQTVAHNLAARQRFYSPTRKRPEMTVWE
                     AIEKLNALIDNSDPDTELSQIHHLLQSAEAIRRDGKPRWMQLVGLIHDLGKLMLFFDG
                     CAEGQWEVVGDTFPVGCQFDERCIYPETFKANPDSSHEVYGTRYGIYQPGCGINNLMM
                     CWGHDEYLYLVIKDQSTLPPEALAMVRFHSFYPWHREGAYMDFMAEGDEALLHAVRAF
                     NPYDLYSKSDEVPKVEELKPYYLELIDEFFPQKVIKW"
     gene            complement(<127954..129237)
                     /locus_tag="MYCTH_2089610"
                     /db_xref="GeneID:11511722"
     mRNA            complement(join(<127954..128618,128772..129237))
                     /locus_tag="MYCTH_2089610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661012.1"
                     /db_xref="GeneID:11511722"
     CDS             complement(join(127954..128618,128772..129039))
                     /locus_tag="MYCTH_2089610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661060.1"
                     /db_xref="GeneID:11511722"
                     /db_xref="JGIDB:Spoth2_2089610"
                     /translation="MTSSRLRVGFVPEHFSTPIHFAKKHYGLDAELIPFPSGTGHMIT
                     ALRAGEIDVGIGLTEGWVAGLGKAQEAGDKDGGYRLIGTYVETPLCWAISTGAERPEI
                     RTVDSLQGGKIGVSRIGSGSYVMGYVLAEERGWLVPTAGVGSDKEQAAPYSDIVVLNT
                     FENLRKAVNSGEADFFMWEHFTSKQYYDKGEIRKIGEIYTPWSSWKIVASTRLIQGDG
                     NPDAAVENLLEKLDQGIKHFNENKEEAVKYISTELDYSEEDAREWLKTVRFPERTRGV
                     DAKVVIQTVETLCTAGVLKINSSVDASSMIAKQR"
     gene            131336..132105
                     /locus_tag="MYCTH_2300032"
                     /db_xref="GeneID:11511723"
     mRNA            131336..132105
                     /locus_tag="MYCTH_2300032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661013.1"
                     /db_xref="GeneID:11511723"
     CDS             131349..131828
                     /locus_tag="MYCTH_2300032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661061.1"
                     /db_xref="GeneID:11511723"
                     /db_xref="JGIDB:Spoth2_2300032"
                     /translation="MRYHLSLAVLSLLGATSVATADRRPCGFKIAPCPTGEICQKVDP
                     GCDRGENCQGYCVPAATPTTLVTKTTASPPEPTYQFCGGFANIQCENENHVCIDAPDD
                     NCDPRNGGADCGGICVEPVFCGGIAGLQCPDGKRCIDDPRDRCDPKNGGADCGGICV"
     gene            <134534..>135853
                     /locus_tag="MYCTH_2108406"
                     /db_xref="GeneID:11511724"
     mRNA            join(<134534..134572,134637..134751,134784..134906,
                     135188..135649,135801..>135853)
                     /locus_tag="MYCTH_2108406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661014.1"
                     /db_xref="GeneID:11511724"
     CDS             join(134534..134572,134637..134751,134784..134906,
                     135188..135649,135801..135853)
                     /locus_tag="MYCTH_2108406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661062.1"
                     /db_xref="GeneID:11511724"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2108406"
                     /translation="MELLLRPAVLAPALKGRLEVTHVPPYCLIQGKPVSLLGAQDWVI
                     DQPDSVLNRLHAPDPSVVHDPVHDKLITTNLTNQIGNLVPDVAEETAWDAPLAMQKLD
                     SVMRESARLNSFVTVGLSRVVVAKDGVVTPAGVKIPRGAAVSVPSYPVSRDNDIYPGA
                     DEFRPFRFAEQRADDSVEYVKQVAKAFATTSTDYPAFGHSRNACPGRFFAANDLKLIL
                     AHLVLNYDIRPRNSWLGLNRVPPLQATIPTRYYTYKAEFMSRILI"
     gene            137539..140265
                     /locus_tag="MYCTH_2300033"
                     /db_xref="GeneID:11511725"
     mRNA            join(137539..138005,138110..138140,138197..138326,
                     138405..138553,138611..138729,138800..138803,
                     138888..138982,139048..139080,139137..139162,
                     139220..139240,139295..139348,139402..139511,
                     139563..139624,139681..139742,139800..139893,
                     139957..140265)
                     /locus_tag="MYCTH_2300033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661015.1"
                     /db_xref="GeneID:11511725"
     CDS             join(137991..138005,138110..138140,138197..138326,
                     138405..138553,138611..138729,138800..138803,
                     138888..138982,139048..139080,139137..139162,
                     139220..139240,139295..139348,139402..139511,
                     139563..139624,139681..139742,139800..139893,
                     139957..140040)
                     /locus_tag="MYCTH_2300033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661063.1"
                     /db_xref="GeneID:11511725"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="JGIDB:Spoth2_2300033"
                     /translation="MGILEDLNLPTGVIYGDDVLKLFTYAREKGFAIPAVNVTSSSTV
                     VAALEAARDARAPIILQTSQGGAAYFAGKGVKNSAEKQEASVVGAIAAAHYIRSIAPL
                     YEIPVVLHTDHCAKKLLPWLDGMLEEDEKFFKQNGIPLFSSHMIDLSEEPVDENISTC
                     VSYLKRMAPMKQWLEMEIGITGGEEDGVDNSGVDNAALYTQPEDIWKIEQAFRPVSKY
                     FSIAAGFGNVHGVYAPGNVRLHPELLGKHQAYVSEKLGGTDKKPVFFVFHGGSGSSKE
                     EYLEAISNGVVKVNVDTDMQWAYLTGIRDYITKNIDYLKTQVGNPEGPNKPNKKKYDP
                     RVWIREGEKTMSARVAVCLQDFKTAGTL"
     gene            complement(140389..141778)
                     /locus_tag="MYCTH_2300045"
                     /db_xref="GeneID:11511726"
     mRNA            complement(140389..141778)
                     /locus_tag="MYCTH_2300045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661016.1"
                     /db_xref="GeneID:11511726"
     CDS             complement(140537..141454)
                     /locus_tag="MYCTH_2300045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661064.1"
                     /db_xref="GeneID:11511726"
                     /db_xref="InterPro:IPR008547"
                     /db_xref="JGIDB:Spoth2_2300045"
                     /translation="MIKTDVAKAGGGAESAVLGLTKLSSQVFVREGQPGVLDPGHPST
                     VVIYGWGDAKPRHLAKYVDGYGRLFPHSRIVLIFSPILKALYQTLEARSRTMLPVIEA
                     VYPEALGKPAGEKPAGGRERVLLHVMSNTGGINCAATMNAYSKHTGGAVFPHDMLVCD
                     STPGSTRFLPNVGPWSRAMALGAARWFPWPFVVTQALAALFLGCLHGFGWLIGATSAA
                     EFSTRAVNDARLSDRGAKRLYLYSKEDDIIRWEDIEKHAAEARQKGWSVSAEVFEGTP
                     HVGHMRGHPDQYWGAIAAAWAEAVAGKGR"
     gene            142647..143964
                     /locus_tag="MYCTH_2300046"
                     /db_xref="GeneID:11511727"
     mRNA            142647..143964
                     /locus_tag="MYCTH_2300046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661017.1"
                     /db_xref="GeneID:11511727"
     CDS             142999..143661
                     /locus_tag="MYCTH_2300046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661065.1"
                     /db_xref="GeneID:11511727"
                     /db_xref="JGIDB:Spoth2_2300046"
                     /translation="MTDLRKQRGISLPTAFSLQPPTEAAPPRPDLAALREDRDKHWTR
                     LELPVNDPLSYARCLRNCVYYDPRGGQPASLVIYKWIRLASGENFTAASLGYVADCWP
                     YVVEAQRPTRSEAEERRRRGESLPLAPDVRLWYPTVVLNLEVKKPLPDEGLEWLQLRI
                     HSKQIKDGRFDLEVVVLDEHGDLVALSNHVNLILSSERNTSRRSTGGERGGGAKEPLS
                     RF"
     gene            144556..145991
                     /locus_tag="MYCTH_2300047"
                     /db_xref="GeneID:11511728"
     mRNA            join(144556..144762,144845..145991)
                     /locus_tag="MYCTH_2300047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661018.1"
                     /db_xref="GeneID:11511728"
     CDS             join(144742..144762,144845..145411)
                     /locus_tag="MYCTH_2300047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661066.1"
                     /db_xref="GeneID:11511728"
                     /db_xref="JGIDB:Spoth2_2300047"
                     /translation="MVTTRDLEWCFLGNPKSEKRYATYHNERVFPAVGYDRVFDYFDC
                     KEVNFLSEDTFLQGRRGNGRMRLPAGVWMTVKQGSIRFEPDDRSDGSGSRAPPPSLAS
                     GYSGSIAPSNYCPSPPRDAATFRSPARAASSSDITARSQPNPGDWEVIEEMGRHCGEP
                     LDDRSIAPSESISSVGSRRGASQATRRYTYDYYGH"
     gene            147110..149609
                     /locus_tag="MYCTH_2300049"
                     /db_xref="GeneID:11511729"
     mRNA            join(147110..147547,147642..147859,147943..149175,
                     149255..149609)
                     /locus_tag="MYCTH_2300049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661019.1"
                     /db_xref="GeneID:11511729"
     CDS             join(147367..147547,147642..147859,147943..149175,
                     149255..149317)
                     /locus_tag="MYCTH_2300049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661067.1"
                     /db_xref="GeneID:11511729"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2300049"
                     /translation="MVANLVLLALPLLATYLAATLWHRRFRQWANFPQLKPSLLWGHL
                     QVIHEYTLRAKPKIHIDAVFAQIAKDLGSPPLMYLDLRPVSYPMVVINSHEIAEQVSR
                     VSKLFPWRTPKSPTMWDLVRVIGPESILLRQSEDWKQLRKRFNPGFAPQHLMTLLGCI
                     CDKTMIFVDQLERYARSGREFPLNKLTINLTFDIIGAITMDVDFDAQQSESSGQGEFI
                     KLYDRLLNMYGTEDSRFPWWMYPRREWRRYKLSKQIDRRLEDMIRQKHAEQQQQQQQR
                     KQQQEGGEAGKGKPRDILSLSLQGSSELSRELLAETRDQLKTFLFAGHDTTGILLAWL
                     FYELSRSPHVLKAVRGELDAVFGPDPDPGAVREKLMAPNGEELINKMPYINSVIKEVL
                     RLRPPAGTARMAPPGTGFTVRTPDGQSFCLDGAIIYNCATIIQRDGTVYGDTADDFVP
                     ERWLGDKSIGSADAEQNEAAGRKFPPGAWRPFERGPRNCIGQDLATIEARVIVALVAR
                     RYDFVKVGLGELDLEEAGRPILDEKGQYKTKPELYNTQQVTAKPVDGMMMKVRRLA"
     gene            149986..150545
                     /locus_tag="MYCTH_2300050"
                     /db_xref="GeneID:11511747"
     mRNA            149986..150545
                     /locus_tag="MYCTH_2300050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661020.1"
                     /db_xref="GeneID:11511747"
     CDS             150217..150534
                     /locus_tag="MYCTH_2300050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661068.1"
                     /db_xref="GeneID:11511747"
                     /db_xref="JGIDB:Spoth2_2300050"
                     /translation="MAPDEKAATVLSQVAQFHVDAESQPTSPRLHKTAGPDNSASAVP
                     VTVTVSEVSSPPASPAERPATVETHPEPEPEPEPEARNKTEPCSTFAYFPLLPAELRL
                     KIW"
     gene            150565..151671
                     /locus_tag="MYCTH_2300052"
                     /db_xref="GeneID:11511748"
     mRNA            150565..151671
                     /locus_tag="MYCTH_2300052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661021.1"
                     /db_xref="GeneID:11511748"
     CDS             150669..151352
                     /locus_tag="MYCTH_2300052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661069.1"
                     /db_xref="GeneID:11511748"
                     /db_xref="JGIDB:Spoth2_2300052"
                     /translation="MSFLPRTVVLHAKRSHYADYVKYDAPKWQSQSCNPAALSVNIEA
                     RAAALEHYTVALPLFAPPPRTSALERAGDLLQDSDRVLYLNLEQDTVVLLGDLQYVHI
                     MKLLDDFRRLDRPRTWSPRAAYGKGLRRLAMSVAFWTHDVGAAALEMFARKALADIEE
                     FILFTYAKPLPPSDWRGLCVLKEVDVDGGFYRDFRMGRGRQFRVKDGWMVVGKGPMKL
                     ADIYFQGGW"
     gene            complement(151672..152881)
                     /locus_tag="MYCTH_2300054"
                     /db_xref="GeneID:11511749"
     mRNA            complement(join(151672..151973,152041..152273,
                     152363..152881))
                     /locus_tag="MYCTH_2300054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661022.1"
                     /db_xref="GeneID:11511749"
     CDS             complement(join(151830..151973,152041..152273,
                     152363..152783))
                     /locus_tag="MYCTH_2300054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661070.1"
                     /db_xref="GeneID:11511749"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="JGIDB:Spoth2_2300054"
                     /translation="MVFNTSRSAVTATCGALRRCSAVTESVARQLGQPARQLSTSASR
                     SSDEVLETPAEQRERPRWSYTPERMKGPGFSINVVKDPRRTVWHNNDDPAKLDAMYNR
                     LLGSKGDRMLPDEIKWLAITHKSFDQGRRGFNTRLAYFGRLIVSLETTRHIMVTPAPA
                     QDSPTQDSFGREPFQHSALANVDKLSSKQPMDVVSKEKLAKLAIEVGLPEVVRWKPRM
                     PENLEASGLTAVLNTALFAIIGAISLQHGAGVAQQVVREKILRRLGA"
     gene            153138..155176
                     /locus_tag="MYCTH_2300056"
                     /db_xref="GeneID:11511750"
     mRNA            153138..155176
                     /locus_tag="MYCTH_2300056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661023.1"
                     /db_xref="GeneID:11511750"
     CDS             153220..154983
                     /locus_tag="MYCTH_2300056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661071.1"
                     /db_xref="GeneID:11511750"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="JGIDB:Spoth2_2300056"
                     /translation="MAAAPKRSASSTGAAGAGSLRERLAAVLPQGHKFDIHHISTPPT
                     RAEPLCAAPPGQRPEKTYKESHFLAVSICSRDIAVASSKRPSPDANRGKEQTETRKQA
                     LVFALEVFIFTTAYQTILFVSKADSTGYLHLLDLPEGAPSPIRQVCATFLAYLLDHRR
                     RSHVQSVVNLFARAQAQYLFPGSVRNKGKHVLDDRGLVRWWCKVLNPLMEGLSNGPWT
                     STRGYLLVPGLEHLETRAFIPRTTASSSNWVIGHPLEQISHYSRELDRVPPRCLIPGY
                     PDDPKSRFRDELDEEVSKQKKEIGEWRSVKSLDQFWEMMSFRQECSSGRLTGFIWLVF
                     DPIQPSSPLPNSHKTTPTTADLTTTNNGSSDSSPSHAVSTTPPRQEVEVSSNTPQPSS
                     LRAPAPPTAPDSRSSKAVKRKTKRRLSGPVVPRAPKVKTQVRSSLASRPTRTAYYYWP
                     PEARGDKLVREAEYKRIVELLLHLDFSTLDKAVGSTRRWLNEVGIGDGAEGDIVGKAS
                     IATPPQVRGAAFDTVSGTVTNLTGLVRRKNVSTSVEADAGRSSAPTTGEPTGPAFEPA
                     PKVNVLGSSLVRKRKKGTGDH"
     gene            complement(155177..157013)
                     /locus_tag="MYCTH_2300057"
                     /db_xref="GeneID:11511751"
     mRNA            complement(join(155177..156712,156783..157013))
                     /locus_tag="MYCTH_2300057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661024.1"
                     /db_xref="GeneID:11511751"
     CDS             complement(join(155370..156712,156783..156930))
                     /locus_tag="MYCTH_2300057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661072.1"
                     /db_xref="GeneID:11511751"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Spoth2_2300057"
                     /translation="MQIDNDADARFAATTQSFLTWFQSLPGATFRSDLIAIEDLRSRN
                     AGRGIVARTDIAADTVLFTIPRSSIICTATSALKNEIPGIFDLEGDEDGNSDSGGEDG
                     TSSSQDSWTLLILILIYEYLQGDASQWKPYLDVLPSAFDTPMFWSPTELAELQASALV
                     TKVGREEADRMIRSKILPVIRGHDHVFFPHGRQRLDDDQLFELAHRMGSAIMAYAFDL
                     EKDDDANEEASEQDEWVDDREGRTMLGMVPMADMLNADAEFNAYINHGADSLTATALR
                     TIKAGEEILNYYGPLPNGELLRRYGYVTPKHARYDVVELPWDLIEAGLRERVGDRMSP
                     ADWEQVNKLTRSDDDFEESFVLERSSEDPDSTGQLEGDATFTGLPDELSDQFKTFLKA
                     TKTVGHVDLVSDKDTRKVVFLQVVFDALRARERQYATSLEDDQSLVDAGQLTERQRMG
                     VWVRMGEKQLLREAQTWVQHQMGGLQDRVSDDLRQDDGPAAKRRRT"
     gene            157937..159848
                     /locus_tag="MYCTH_2300059"
                     /db_xref="GeneID:11511752"
     mRNA            157937..159848
                     /locus_tag="MYCTH_2300059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661025.1"
                     /db_xref="GeneID:11511752"
     CDS             158065..159489
                     /locus_tag="MYCTH_2300059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661073.1"
                     /db_xref="GeneID:11511752"
                     /db_xref="JGIDB:Spoth2_2300059"
                     /translation="MSLNCPNCGAHLTFALAEDSRATSAAAAAAAAPRRKLVLAEKAG
                     SHDVNPTDADLQRLKHFMCFPFNTSLLWKPTQPTMRPVVSDKEEEVGILKDCRARQTL
                     DRVARKMHATIRACGEQSADTLLESRRRGRAKQDLPVPMHTVFEAVGAIIYAMEWTSG
                     QPRAEELVPTPAGTGTVHPQAVMGPFEPGYALELPSVYLPQYTLQLRRLFEHMLVIDY
                     GFPARPICGSIFGPMLLPSTWFLHAWSEFEIFSDFLVGIARVWRWRQGLPNDKSWGLI
                     AEATSDWAHYIGLRLPVWDVATMIYYYCLHRKPVDAEDRKEGWTGYTGVLQEMIAEVP
                     TRGTDRLERKLSLDVHLLIPRFVRDRKLREQMLLIAQDLAAKYGCQLAPPKMPKPPMW
                     RRLFGQVPCQLAPPKMPKPPMWRRLFGQVPSQQGPEDREKGHEDLKLLEGLRWESRGE
                     GDLDPSCAGKKSLHWLDVHKSVMN"
     gene            complement(<160212..>160993)
                     /locus_tag="MYCTH_2108417"
                     /db_xref="GeneID:11511753"
     mRNA            complement(join(<160212..160748,160778..>160993))
                     /locus_tag="MYCTH_2108417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661026.1"
                     /db_xref="GeneID:11511753"
     CDS             complement(join(160212..160748,160778..160993))
                     /locus_tag="MYCTH_2108417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661074.1"
                     /db_xref="GeneID:11511753"
                     /db_xref="JGIDB:Spoth2_2108417"
                     /translation="MVGWGYGLPLAAGAYAVVAWVAKLVRLLWRQLPQVPESRRQQLQ
                     NSVVWRKVGNAGGALGGLVGGLCPAPGKWGVESGGVGGRRGGADGEGVEGGCDRGSGS
                     REGLGRPGGDAAGTSAAGSGGIGCGWGGPGGRGGGTGGGGGGIGCGWGGPGGRGGGTG
                     GGGGGIGCGWGGPGGRGGGTGGGGGGIGCGWGGGREAEEAAPAAAAAAEDWAGMQARW
                     AVAAEVAAEVAAEEAEWAAVADAREAGWAAVE"
     gene            complement(<163432..>164791)
                     /locus_tag="MYCTH_2059134"
                     /db_xref="GeneID:11511754"
     mRNA            complement(join(<163432..163568,163633..163957,
                     164036..164103,164167..>164791))
                     /locus_tag="MYCTH_2059134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661027.1"
                     /db_xref="GeneID:11511754"
     CDS             complement(join(163432..163568,163633..163957,
                     164036..164103,164167..164791))
                     /locus_tag="MYCTH_2059134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661075.1"
                     /db_xref="GeneID:11511754"
                     /db_xref="JGIDB:Spoth2_2059134"
                     /translation="MPFTSQRTSSSLLEEHTRKNGKFSDAESSLASISTNQARASRKE
                     HKLTHLLSCLGSSNPLPAPIAADDVVWLMDNVAFWDRGGHWEAEFVAAVFDQQASAKV
                     VDIVGDIASKVGLARGGDEERTMERRISPFVMEILQGRQIKVRFNGPTLLKLGPGGRN
                     GISSDIRRVPEPSTGPVAKSTADVPSGVTGVLEMKTVYAEPEGWAVISDIDDTIKITQ
                     TSDPVRILRSTFVSKPTPVPGMPELYSSINRLLAPSALFFYLSASPYNLYPFLRGFRD
                     TYYPHGQLILRDSNWMTISGLLSSLTLGTEKYKIDRIKKIQRWLPRRKVICIGDSTQS
                     DPEAYGEACRAFPQWIKLVLIRKVTDVAAVGIREKNEPERFERAFDGVPR"
     gene            complement(<231749..>231958)
                     /locus_tag="MYCTH_2059724"
                     /db_xref="GeneID:11511755"
     mRNA            complement(<231749..>231958)
                     /locus_tag="MYCTH_2059724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661028.1"
                     /db_xref="GeneID:11511755"
     CDS             complement(231749..>231958)
                     /locus_tag="MYCTH_2059724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661076.1"
                     /db_xref="GeneID:11511755"
                     /db_xref="JGIDB:Spoth2_2059724"
                     /translation="YLDNILIFSKIIDKHRKYIKAVLDTLYTYKLSVNKEKSKFYIRK
                     TVFLRYKISLGQIRIEPLKVKAIKN"
     gene            <343130..>344347
                     /locus_tag="MYCTH_2057467"
                     /db_xref="GeneID:11511756"
     mRNA            join(<343130..343297,343461..343588,343688..343928,
                     344018..>344347)
                     /locus_tag="MYCTH_2057467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661029.1"
                     /db_xref="GeneID:11511756"
     CDS             join(343130..343297,343461..343588,343688..343928,
                     344018..344347)
                     /locus_tag="MYCTH_2057467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661077.1"
                     /db_xref="GeneID:11511756"
                     /db_xref="JGIDB:Spoth2_2057467"
                     /translation="MAAADVINQAALARHVDTAPHTTVDRPSGQHNVQAVMNYYKDPE
                     DGTPPAPIYVGYDKYTLDGHGFQIVRHESKEKDFLDEEQIKSIYYPETEQLLKNVTGA
                     TRVFIFDHTIRREKQPGVSDAAFRGPVRNVHIDQSYKASVERVRYHLAEEAEQLLQKR
                     FQIINVRDPPTTHSTRALSVWRPIKTILKDPLAIADAHSVPDSDLVGAALIYPHRDGE
                     TYAVKPNPRHRWYFKYTQRPDEVTLIKCYDSATEPGIARRVPHSSFIDPAEEDKPQRE
                     SIEVRTLVFYDN"
     gene            complement(344455..345567)
                     /locus_tag="MYCTH_2300064"
                     /db_xref="GeneID:11511757"
     mRNA            complement(join(344455..344750,344837..345567))
                     /locus_tag="MYCTH_2300064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661030.1"
                     /db_xref="GeneID:11511757"
     CDS             complement(join(344553..344750,344837..345409))
                     /locus_tag="MYCTH_2300064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661078.1"
                     /db_xref="GeneID:11511757"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="JGIDB:Spoth2_2300064"
                     /translation="MATAKDVPYHLIYWPGIPGRGEHIRLVLEEAGAAYSDTAFTEGG
                     IGEVLAFIQGETPDDGINPPVFAPPILKHGELVISQTPNILQYLGGRLGLVPDPEKDR
                     DGLYRVNSLALTALDGLSNEPHDCHHPIASGLYYEDQKPESKRRSEDYVKNRLPRFLT
                     YFERVLRSRSSGEGPWLYGGNLTYADLVLFQCVDGLKFMFPKAMAKLEREGEHAKVFA
                     LHQAVAERPRIAAYLKSPRRQKYSNGIYRYYEELDIEP"
     gene            complement(374239..376651)
                     /locus_tag="MYCTH_2300067"
                     /db_xref="GeneID:11511758"
     mRNA            complement(join(374239..376042,376151..376651))
                     /locus_tag="MYCTH_2300067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661031.1"
                     /db_xref="GeneID:11511758"
     CDS             complement(join(374268..376042,376151..376475))
                     /locus_tag="MYCTH_2300067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661079.1"
                     /db_xref="GeneID:11511758"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Spoth2_2300067"
                     /translation="MMQALEKAKKSIATDYTWQRARQLTVSGARALPGAAAEYVTDKF
                     PIIGWLPRYRPRWLVNDVIAGLTIGLMLIPQGLSYARIATVPVQYGLLSCWFPPMLYA
                     LMGTTKDLSTGPTSLISLLTAETIESLQGGGWSAQEIASAVAMMMGIYGLVIGLLKLG
                     FLLDFISLPVLSGFISAVAITIILNQMDSLLGEPDVRDGTANQIHDVFQQLPRANGYA
                     CAVGFTGILLLAALDRAGRRWGKRNKVVWFLSITRAFITLVIFTGVGYAVNKSRGSPD
                     RFLFDVTQVSSAGGRGIQHPRVPDAGLLSRVAARSVAVFVGSAVEHTAIARSFGVRNG
                     YIVDQSQELTYYGATNVVNSFFHAHGVGGAMSRTAVNSACNVRSPLSGFVAAAVVLVS
                     IYELLGTLYWVPKATLAAIIITACWPLISPPSVFYRYWRASLADFVSSMIAFWVSLFV
                     STSVGIASAVGFNIVYVLLRQVFARVATIPDPPRSELAAALDESRDYPSSVPADTRVF
                     RLTDSLFFPNSYRAKTAIMDTIKTRHAPALGSAENPEAGKRNWSVSREKHVAKLRRRE
                     GIAETAVLPPIRVIVIDFQRANHVDTTACVHLETMLSEIRAYGGSGVSIRFSGMSEYV
                     RRRFERAGWTLVGGGSDDAETCAGRQQEGLVVRTYRNALSAVNGSRQEQAPTQAESEG
                     DEKGGAAVARHVEEVDP"
     gene            379587..381510
                     /locus_tag="MYCTH_2300069"
                     /db_xref="GeneID:11511759"
     mRNA            join(379587..380669,380925..381510)
                     /locus_tag="MYCTH_2300069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661032.1"
                     /db_xref="GeneID:11511759"
     CDS             join(379934..380669,380925..381346)
                     /locus_tag="MYCTH_2300069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661080.1"
                     /db_xref="GeneID:11511759"
                     /db_xref="JGIDB:Spoth2_2300069"
                     /translation="MALLPDWLLRLRRVEPADNPVLAVEKLNSLGRPLQDADKEILVG
                     AVLTMSSSLHLALDMLQEILPQEKSQERLGEVMCPTLGSLLDSLQSTLSSFARSTSRQ
                     APPPEASATPPASTPGTATPRAGGANVAGEHHHHHLSTPRSRHSGHGGRAAVKESEQF
                     GSAGFSRPQTARTETERFPPFEDSRTAGRLDHTGINIRRRPAENLVNALQAEMRVQAA
                     INVAIESLEFAEGQLKMVKEVNRLHGGNFDLLQRHFYQGYNRLLSRALELQWREMGLQ
                     SSRDSLISVASVEQPCPQLARHAATTTNNTGMRARPRQHSISFQSVSSVQSPASTTRG
                     YGETRTPGFQRRSLERRNTIQGIRQEGKYRWCAPPPKAPWLLSHEPVCPGC"
     gene            complement(381900..382954)
                     /locus_tag="MYCTH_2300071"
                     /db_xref="GeneID:11511760"
     mRNA            complement(381900..382954)
                     /locus_tag="MYCTH_2300071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661033.1"
                     /db_xref="GeneID:11511760"
     STS             382184..383747
                     /standard_name="ha2919"
                     /db_xref="UniSTS:515610"
     CDS             complement(382227..382853)
                     /locus_tag="MYCTH_2300071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661081.1"
                     /db_xref="GeneID:11511760"
                     /db_xref="JGIDB:Spoth2_2300071"
                     /translation="MAISFDFQEAEASETRRIAKPRSRLRRFQARAPAPAPAMPPAPA
                     HSQPVPPPVPAAPVVVAAQSPSSVGDKDKGNAPESSADADEPTDPTHTFESVMLPGDL
                     IRRLFESWIEACATFMETSDLCANVSPRWTRSWKQSTLVDLGEKLPADVEEAHMAREN
                     VAILVKRFFQYNLLRRMDGPVKDGKNAVLRHVKELAAKEGIDLGQVDI"
     gene            complement(383157..383948)
                     /locus_tag="MYCTH_2300073"
                     /db_xref="GeneID:11511761"
     mRNA            complement(join(383157..383640,383715..383948))
                     /locus_tag="MYCTH_2300073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661034.1"
                     /db_xref="GeneID:11511761"
     CDS             complement(join(383327..383640,383715..383937))
                     /locus_tag="MYCTH_2300073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661082.1"
                     /db_xref="GeneID:11511761"
                     /db_xref="JGIDB:Spoth2_2300073"
                     /translation="MKAVFLSRKVRQLYAAVCINQDRIRKLSTILKEEQQALDDLIPR
                     IRRHKDKLRHEELEAVRQLRLMERYERLRIERQNSKPTWIEELYKRDRYRDRAPLPDP
                     VPRFRQEIVVQPPLCATSCRVLETERDLAGCQRAVNPVPPSGTGFEVLFGCPLPEVLV
                     PVSAPVPELRQTVPLPAT"
     gene            complement(<384079..>384699)
                     /locus_tag="MYCTH_2058462"
                     /db_xref="GeneID:11511762"
     mRNA            complement(<384079..>384699)
                     /locus_tag="MYCTH_2058462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661035.1"
                     /db_xref="GeneID:11511762"
     CDS             complement(384079..384699)
                     /locus_tag="MYCTH_2058462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661083.1"
                     /db_xref="GeneID:11511762"
                     /db_xref="JGIDB:Spoth2_2058462"
                     /translation="MSSTSALCYLYLFALAALTALVLQLPTRLSELVQVAGDVFFLLS
                     FLAVSCMALIPFWSRPPPALLTVAGYLLFWTVRISVVVIDFGVRSVGLSLEIVDSILR
                     DEELRSRLELAAMKLRRRYAKQQSTLAALNDDITRVCKEHNGHSREFPTVFRHRGPRL
                     LSAAKVPSTGWTEPPLLVKMCKCPISSLTSFTSALPICPLSLACRI"
     gene            complement(385722..389050)
                     /locus_tag="MYCTH_2300079"
                     /db_xref="GeneID:11511763"
     mRNA            complement(join(385722..386812,386959..387715,
                     387800..388527,388604..389050))
                     /locus_tag="MYCTH_2300079"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003661036.1"
                     /db_xref="GeneID:11511763"
     CDS             complement(join(385779..386812,386959..387715,
                     387800..388527,388604..388850))
                     /locus_tag="MYCTH_2300079"
                     /note="CAZy_ID 270125"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003661084.1"
                     /db_xref="GeneID:11511763"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Spoth2_2300079"
                     /translation="MIGTRLAGLGLLVAGVCSASASTSAIELRSAERPLSECPGYQAV
                     NVKTSATGLTADLRLAGSPCNTYGTDLEKLRLEVTYETENRLHVKIRDADELVYQVPE
                     SVFPRPKADGISAKKSALTFKYKANPFSFSVSRTKTGEVLFDTSAAPLVFQSEYLRLR
                     TKLPENPNLYGLGEHSDPFRLNTTNYIRTLWSQDSYSTPEGANLYGNHPVYFEHRKSG
                     THGVFFLNSNGMDIKIDKNPQHLEYNTLGGVFDFYFVAGPSPVDVARQYAEISGLPAP
                     VPYWSFGFHNCRYGYRDVYDVAEMIYNYSAARIPLETSWIDIDYMDRRRVFTNDPERF
                     PMPLLRMLADKLHSNNQHLIVMVDPAVSYSPNPAYQRGIEDNVFLKRSNGSEWLGVVW
                     PGVTVFPDWFSANITRYWNNEFAQFFSKETGLDIDGLWIDMNEPSNFPCFFPCDDPFS
                     AAVGYPPDPPPVRPAAPRPLPGWPCEFQPEGSNCTQQQEEATPSVSLPRHGIEPRTAP
                     IANPPRGDNKWKGLPGRDLLFPKYSIHNKAAYKDSWNGKHGGLSNKTVNTDVIHANGL
                     AEYDVHNLYGTMMSVQSRQAMLSRRPGLRPFIITRSTFAGAGASVGKWLGDNLSTWDH
                     YRAVIRTVMAFTSIYQVPMVGADVCGFGGDTTESLCARWAMLGAFSPFYRSHNELGSI
                     PQEFYRWPTVAEAARKAIDIRYRLLDYIYTAFQQQTVDGTPAVSPMFFLYPNDANTFG
                     LDLQYFYGPGLLVAPVTEEGATSVDVYLPKDIFYDWYTHKAIRGQGKTIRVSNQGLTD
                     IPLFLRGGVIIPARVKSAMTTTELREQNFELLIPVGADGTATGQLYLDDGVSLEQKGT
                     TLITFRYRNGVLTARGTFGYHTKAKITKVTVIGASRKRDEEADTAVVTVNQPLTGNFE
                     IKISGAL"
     gene            complement(389977..393451)
                     /locus_tag="MYCTH_2300082"
                     /db_xref="GeneID:11511764"
     mRNA            complement(join(389977..392466,392536..392927,
                     393004..393451))
                     /locus_tag="MYCTH_2300082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661037.1"
                     /db_xref="GeneID:11511764"
     CDS             complement(join(390309..392466,392536..392927,
                     393004..393129))
                     /locus_tag="MYCTH_2300082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661085.1"
                     /db_xref="GeneID:11511764"
                     /db_xref="JGIDB:Spoth2_2300082"
                     /translation="MEPSSKRRRLAPKVPDPPAVSALPPTPQAQAQPPPQTFSQDQVP
                     SQHYAHAEAAPRLPERDEFEAFARHLQDAAIHIQQQTLRPKHTSVSVLMLQWEEDTSV
                     EPDMLALERVFQERYHYHTDKWAIPTVPNPSVKLGVRIASFLDNARPDHLLIIYYAGH
                     GYVGPDHQLYWACNSRDDAAKLKWDGVRCLFEDAQSEILLLIDSCAVRDAPVAGSHGA
                     KQAIAAYSPDQSALEPGPRSFTAALAETLQKLSFLGRPFSVQKLYDDLCQQRQQDSTQ
                     ALARLSNGSTKPNHTPERSPAFFTLTPARGQGIVLVPLDPKAAQLQSPPHSADADAQG
                     AWKTKPEDHPLHPDEVLDLTLEEQRVLVCTTFVGDASPDMAFFNQWLHSVPSTTSKIA
                     VEGMFLGPPTMLLISMPLNVWNIVQHDKVCCFLGYISSHNMIHLYQRLVNSPPRGLVG
                     IKDEEDSRALKRTPSMHRNETSSHGAPVQKETARRQDTYLNQAVTASIPNIPLHASPG
                     QTPPVGPKDEVEDSAEMQEAAEQLKALSHVRHIGGDSPATLDRQATQVGDSIAVRHIG
                     DPDSPASGVVTGLDGPLYGAEYSTPSAKTKARKPLQKQTPKQEVRCDHCSHAPFKDSS
                     SLRKHVAAAHTRPFPCAFSFAGCTSTFGSKNEWKRHISSQHLCLQFYRCSSCPQSSAD
                     GKGNEFNRKDLFTQHLRRMHAPFAIKKAITKSDSKLQAEWDAHVKEMQTTCLVTRRKP
                     PQRSACPKPDCQSVFEGPGSWDEWTEHVGRHMEKGEAGRMGVDPLLAKWALDEGIIEE
                     LGDGEYRLCAGSGSSVSENQVNNHNHQHHNNDNNDNNINSNHNNHSHNNNDGNDNDND
                     NDKTSSDGVRRAEGDDDPSITVAMPIPVSDNMEVG"
     gene            complement(<395683..>397573)
                     /locus_tag="MYCTH_101172"
                     /db_xref="GeneID:11511765"
     mRNA            complement(join(<395683..395838,395874..396105,
                     396204..396614,396675..396794,396944..397229,
                     397300..>397573))
                     /locus_tag="MYCTH_101172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661038.1"
                     /db_xref="GeneID:11511765"
     CDS             complement(join(395683..395838,395874..396105,
                     396204..396614,396675..396794,396944..397229,
                     397300..397573))
                     /locus_tag="MYCTH_101172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661086.1"
                     /db_xref="GeneID:11511765"
                     /db_xref="JGIDB:Spoth2_101172"
                     /translation="MSITACQDGCTCTSHSAEVHHAIRTLRAYRSAQDGWSSTSWSQG
                     QEISAWILVPAVFTEPDSLSWPISDPVQGLGRTLSAQTMPNQELLMVFTNFLSKFTAS
                     LDGNPEPSNPYIKYYVPYCVNSQLLLRVAIYSAACFLTDTGHVDRTVAMAHKGHVFRL
                     LNEHIRSRMPTTDEVIAEVLQIILNEWLWGNADDLRAHQRGLRDMIKCRGGFRMLGLH
                     GLISKLAISADAAISLSLEVPPYLRGGPELEFSDSSPFPLRVALNTPLIPTLVRFSSC
                     ADALRIHPAVASILDDMRFLLAAVLALPAKPSAKELQKVQATSAWIHERISGLSEDSP
                     ATRRPPEASSAPRADGSMVAEISKQVQSPHGSASLLFRLVLLLPPDHIYQAIRLAALL
                     YSRAIMHRRAFSRVVMSDAYLRLWTTAWRVPLSTWRSLLGVLTWILLPLPHDRYMRGM
                     LNICMFQMGMDNWEIASSAMEAGLRLQRRLAGEPVSPSEAGE"
     gene            397662..398439
                     /locus_tag="MYCTH_2300087"
                     /db_xref="GeneID:11511766"
     mRNA            join(397662..397781,397914..398439)
                     /locus_tag="MYCTH_2300087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661039.1"
                     /db_xref="GeneID:11511766"
     CDS             398021..398179
                     /locus_tag="MYCTH_2300087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661087.1"
                     /db_xref="GeneID:11511766"
                     /db_xref="JGIDB:Spoth2_2300087"
                     /translation="MTDQQGVTLWNRLSIEFLADLNFGVSVINIWVLVGEMAVAAGKD
                     TSKCIPDH"
     gene            complement(400819..403174)
                     /locus_tag="MYCTH_2300091"
                     /db_xref="GeneID:11511767"
     mRNA            complement(join(400819..402203,402287..402851,
                     402958..403174))
                     /locus_tag="MYCTH_2300091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661040.1"
                     /db_xref="GeneID:11511767"
     CDS             complement(join(400952..402203,402287..402851,
                     402958..403024))
                     /locus_tag="MYCTH_2300091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661088.1"
                     /db_xref="GeneID:11511767"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Spoth2_2300091"
                     /translation="MDFNGLKRKDTTKGPPLRILSLDGGGVRGYSMFLILQELMHRTF
                     VEIEGRAPRRSEIPKPCDHFDLIVGTGTGGLIALMLGRLRLDIETCKELYVRLTRMVF
                     ETDKTIAGIPYRSTLFKATKLEEAIKECVREHTVYEKEGNDGSDVGSTYDSLSPVSRS
                     SAAYPRRHASNASVLSFSARSPSAQAARPVFSRNGNPNARLYDERENRTKTAVTAVYK
                     GTPKGGAPAMLRSYDSRREPAPEFDCKIWEAGRATCAIGLAFKPIQIGQSVFHDDGAG
                     TFNPSITALDEAVVNEWPGREVGVFVSVGTGKRPRGSDANSALWYEGFLGEFAEARRK
                     LIAKIEGCEKIHEQMKREHLSKRGVNIENYYRWNVEVGVGEFGMNEWNRLADISTNTR
                     RYLAREEEQKMVQSASAKLAKIHFAKQRWERLSQASPEAAQKVPQISLPLAAELPGDI
                     PPVPARAPTPASPSRQSYDSGHDILPVRGSTPSPRSSCEPPRQSPQPNQLPYPPAPPS
                     GGHPPAAPSHFADGAAEDSDRLVVSAPTPAQYRIATGADKIAIAGPDDYPRRYDDPLM
                     QPAPLRVRPPSVPPPLPPKTPLPEIQAGHGRASAPVLPYPLDEDAPPAVNMARKPYYY
                     SSN"
     gene            404188..406697
                     /locus_tag="MYCTH_2300093"
                     /db_xref="GeneID:11511768"
     mRNA            join(404188..404817,404879..406697)
                     /locus_tag="MYCTH_2300093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661041.1"
                     /db_xref="GeneID:11511768"
     CDS             join(404388..404817,404879..406677)
                     /locus_tag="MYCTH_2300093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661089.1"
                     /db_xref="GeneID:11511768"
                     /db_xref="JGIDB:Spoth2_2300093"
                     /translation="MFSSCFGSGRDRRSAEQEPLLPQYDDDTSLQRQLHQKLHTYQML
                     RALSKGYMPSNEQAIANLRTLLAADVLNPDSSQLSDSGQALAHYAKQWIKQLIELLQH
                     KNANDQIQDFTWYLSQARVSLDMEHVAERASRAKATADTAAVYRSLQTVGSLLLTNSD
                     FRLFLSDLNVVAREVFRDAAFALSEASEEAGKRIGPSAEQQDSVKQQGNGSQSAPSQQ
                     ELVDQTAEVSKVCSGSASTVVDEAENSILRKLDGPEKDTMMHRLKNAVANLRRRRDYS
                     DSVSTLSLLLKRYAMVYSRIARDTVQAAEEDVDRNPETDRALRNFWAFLRSFGEVKEW
                     EELEARFETVVNHGHDDPDFEDLAAKLASALQEMFTDPSFFDDAEQRFQELRTRYKQI
                     SSHSSLRDDMDGLLSQLQATFRSVIRDKDVANLMKTSTTIGKILSPKHHYANTDLVAD
                     SINVFVPLLFQSINYVPIPRLEVSTPQVDLLLENLILEPGTTVNHTSFFPHRLRVETL
                     NDIEIRKARFRTTSAVKTLMRIRVDGLSIRGEEIGYWLRVHSGLLRLADEGIASFELD
                     ERGLDIQLDIEVGRDRLEKILSLRGVKVRIHKLNWKLRRSKFSLLSWLFKPLLKPIIR
                     KTMEVKMATAIGEALHFANRELLYARERLRATRIADPDDLRTFFKAVLARLTAPDDPD
                     LHTRVGVGQPGHGVFEGVYAPGSIVKLWRDEATQAPQRIRENERDGWRNSIFDVQAAM
                     LT"
     gene            407419..408024
                     /locus_tag="MYCTH_2300094"
                     /db_xref="GeneID:11511769"
     mRNA            407419..408024
                     /locus_tag="MYCTH_2300094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661042.1"
                     /db_xref="GeneID:11511769"
     CDS             407556..407852
                     /locus_tag="MYCTH_2300094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661090.1"
                     /db_xref="GeneID:11511769"
                     /db_xref="JGIDB:Spoth2_2300094"
                     /translation="MILADLFSIILRLTELAFAAIVAGLNGDYLSSVHNADSWQLGRQ
                     IYTEVVAGVSIFFAIIWLFPFSGSFVHWPADFAISAAWFAAFGLLVDWLDGNCG"
     gene            409388..410573
                     /locus_tag="MYCTH_2300099"
                     /db_xref="GeneID:11511770"
     mRNA            join(409388..410264,410381..410573)
                     /locus_tag="MYCTH_2300099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661043.1"
                     /db_xref="GeneID:11511770"
     CDS             join(409600..410264,410381..410552)
                     /locus_tag="MYCTH_2300099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661091.1"
                     /db_xref="GeneID:11511770"
                     /db_xref="JGIDB:Spoth2_2300099"
                     /translation="MSGIVHKIKEAVHPDSKSHHNTAPEGSHGPHNSRVANAVDPRVD
                     SDRDGRGAGRTAGHGEYGSAGYGTGRAGYGTGTAEGTHGPHNSRVANAADPRVDSDLD
                     NSRTIGTGRTAGTGATGFGAGTTGGYGSGITGGAGSGATGVTGTHGAPAGTYGPHSSR
                     VANAADPRVDSDRDGRGALGTGPGPAPNTAGPHSSDMANKMDPRVDSDLDGSRTMGGN
                     KTYQSGTMSDARRDPTDAAQVPPSVLRKHLGEPSIEHEDVTHHRERRNSIKTHQETFR
                     GI"
     gene            complement(<410824..412552)
                     /locus_tag="MYCTH_107255"
                     /db_xref="GeneID:11511771"
     mRNA            complement(join(<410824..411080,411142..412109,
                     412200..412552))
                     /locus_tag="MYCTH_107255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661044.1"
                     /db_xref="GeneID:11511771"
     CDS             complement(join(410824..411080,411142..412109,
                     412200..412483))
                     /locus_tag="MYCTH_107255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661092.1"
                     /db_xref="GeneID:11511771"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_107255"
                     /translation="MNLLLFERSSGRLGPDEFARIQATTLLRSFARAPHFRFDGGERD
                     ASVPVGRGNRAVASAADGSGSGGDAAAPRVSLWAHQAGVSALALERFDGRILVSGGSD
                     ATIKLWDLEQCPNPWRYYTYRPVAVVSRAGSDSAAAGHRFGVTHLSFYPFDSAAFLSC
                     SHDQTLKLWSTERASVSGSFFLGSRVYTHAVSPIASHLLVACGTQHPAVRLVDLRSSA
                     AVQSLVPPGQTGGSAGAVLSVSWSPAYEHVLAAGSADGAVRIWDVRKSNGLVALLDQE
                     DVVGLADGGTTSQLRPPRLAAKAHAGAVNGLTWTDDGAYLVSAGHDRRIRVWDAATGA
                     NTLASFGPSIRNSQMGAVTMFVSPLGLTAPGCELLFFPNETEILVMDLHEGSTVARLR
                     GMGPAVASVGTHQGGERAIKNRVTSLAWRGAGGSGGSSGVVMGGSNAAGGLLSGHLDG
                     QIRGWLPELEGADDEGDDDDDGAADISAAKTKKRKALDDAFRSLMGRQVTFS"
     gene            412671..413862
                     /locus_tag="MYCTH_2300101"
                     /db_xref="GeneID:11511772"
     mRNA            join(412671..413107,413166..413862)
                     /locus_tag="MYCTH_2300101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661045.1"
                     /db_xref="GeneID:11511772"
     CDS             join(412930..413107,413166..413764)
                     /locus_tag="MYCTH_2300101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661093.1"
                     /db_xref="GeneID:11511772"
                     /db_xref="JGIDB:Spoth2_2300101"
                     /translation="MEASPDSIFLSSGETTPSSRLSSPAESHSSSSSSSNRRRRSKSS
                     QRHRRRPANVFDAVAGRVTLNGALGDADDATSRSKRRLRAISDRYLSRNPRLAPEEAL
                     FRRKNAPVRYAEYDIYWASDDLPNAGYGSLPDSDLLRSIHSYASKFYETAAARLGPRC
                     VVGTRTVDERSMDESALLAFGILLEEAGREALGKRGDVVFTEASTEAKEATKVVQSTK
                     SPCLVSGGFEAADEPPVSHTSPKPKRRKVANTEISVEEHQ"
     gene            421089..424323
                     /locus_tag="MYCTH_2300105"
                     /db_xref="GeneID:11511773"
     mRNA            join(421089..422581,422718..422828,422919..423530,
                     423632..424323)
                     /locus_tag="MYCTH_2300105"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661046.1"
                     /db_xref="GeneID:11511773"
     CDS             join(421209..422581,422718..422828,422919..423530,
                     423632..424142)
                     /locus_tag="MYCTH_2300105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661094.1"
                     /db_xref="GeneID:11511773"
                     /db_xref="JGIDB:Spoth2_2300105"
                     /translation="MVRNGTSVDVPAEPPLDDDERPESAESAALTAEDAGSSSPGDTA
                     GTQAPINSQEARTITRSMEEEKEVEPGPAVRPGAPSIPLNHTTLAAFLLKWRPISVLV
                     RDILEAENVKYVDEFPIRQEEKRGLLRVWGRGEGLESSLRVDKVDRESLRDVGVVEMV
                     ADDLSDTGAPSPGDCWGGISSSPAPVDGKPSISLPTPDFSEALVWKYVKSFQDNIQNM
                     HPLIIPRELNAMVKLFLDTVQQTMGKQPRGTTIAKFATTPSTQSETGSKRKRSPGPDA
                     AEPSSASPKSSRPVFQRSINNALVLLVLALGKICLHKDKIPDVVPVSEPPAHGSPMAR
                     NGYPASPIQGSSPSQASHSHSSAGLPSPKDGAERPGPSRRASFQGGGASIKGGTSPKR
                     NMDVIPGLDYFAYATDILGGQLAGTSLRHIYAFLLAGLYQGQLGRVLESYAYIKEAGF
                     ALQMKLRPSLDRFRRLNEMGRQGAVSDKSDNQLVFAFWTCLQLESDIIAELPLPQSHI
                     LAYEDIMPYPNIEVAKKLGFDEHVLQSYLAQLYLRKTLNQIHGMLYNPEKPLPLDVTS
                     GAANIIEYIQETMHLSFVPPEFMFEPTDPPASDILSARLRAKYWGAQVITYRPFVRQI
                     LEFNFQKMANDTPLPASDFRSGVVVPVIGPDNDIPPQMIEYAVKGVGALIESTRAFHG
                     LKEKRFIVTNIFGTAHAQWGNLLTLAAAFRDPILSNYIDERLLKELFAKTISFFKIIA
                     PPTSALHIDLRILEGLQRKLWGKSSSTEAVDHPTGSSFSSSASGGPPPVQPMAPAPPM
                     PPVAGPTGVRSSPGDHVGNGMTSMSPPLPSPLPATMPGSATPVPVSPLEPSQGPYPGG
                     MLPPMQHQPSHH"
     gene            complement(<425291..>426455)
                     /locus_tag="MYCTH_2116523"
                     /db_xref="GeneID:11511774"
     mRNA            complement(join(<425291..425481,425611..425781,
                     425969..>426455))
                     /locus_tag="MYCTH_2116523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661047.1"
                     /db_xref="GeneID:11511774"
     CDS             complement(join(425291..425481,425611..425781,
                     425969..426455))
                     /locus_tag="MYCTH_2116523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661095.1"
                     /db_xref="GeneID:11511774"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="JGIDB:Spoth2_2116523"
                     /translation="MASPSASSTGSPVPGTRPDRRRDSNTPDTASTSLPRILWSLQVP
                     LYITHASKSTDPFIVSVPRFSYLALLVPRLTAYYGLPCSSFHHEEIQLRNLAVGLLVD
                     LYQPASLPWRLVVSDGPEWDIADTFTNSAKEADFVRNGNAKQIMSLSKEHSTALWNAV
                     QDNDYAAFNKVNSLLLNAPTPLKNVPIRIYIPSSPREASGAAPASFKVVQTLVPPRLP
                     NRAPQTLGAALKSILPTLFPSSRDPVLANVLLHGGPVPFRAPLEELMREAAYPDGWLC
                     FCVVLL"
     gene            complement(<428796..>433037)
                     /locus_tag="MYCTH_80023"
                     /db_xref="GeneID:11511775"
     mRNA            complement(join(<428796..430358,430434..>433037))
                     /locus_tag="MYCTH_80023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661048.1"
                     /db_xref="GeneID:11511775"
     CDS             complement(join(428796..430358,430434..433037))
                     /locus_tag="MYCTH_80023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661096.1"
                     /db_xref="GeneID:11511775"
                     /db_xref="JGIDB:Spoth2_80023"
                     /translation="MASPLEAAVSRPSSGMASPPPRITSRSRTQSISSDRPSTVAHSL
                     MTPPLAVSPEPAFIAASAASQIVTNDYDSHAEAWYDQHGIEPPGEAATVSPTALQLVN
                     SFLDQLLFNFLSVSRSTALSALRPAVTEVLKPKLAKDAINQADEELREYLGEDGQDGA
                     QPQTADAVSPTGWDLELAWKRTRLRCMVYSSLGDMEEEDEDYYMEQGHLASGPDDKLS
                     ESVSPAVAIFLTSILEFMGEQALIVAGQAAYHRIRAKYEKELKEGARSPTGVADKVVI
                     EDLDMERVALDRTLGRLWRSWKKKIRSPAISSTDRLNRSYSKDSLHSSSGHLRSSGSV
                     AEFAVPATVPEPDAEPGAPPSKEDPADYRDQGANTSQPLEEYLVAASIPLPLGPDDIA
                     EIEVPGLAFYRHEREEDGDAEKERTPTRPKSMISMPLREAPGPLSTASSQHQITRRRS
                     STLPAPARPRFSIPAEPRPDVPAEMQDSPAQASRSTRTLSQNAAEEAEQVQAVETSQA
                     ADSGVAPGGEELKDEIKDDDDDDEVSIEEPRIVRSSRVSILGRTPSTTSSEPGKPASI
                     NTNLPIRTPSIHSARLIEVTSPRSPVVGSRRNSVAVTESARHASPSSANRTVTPPLSE
                     DRQEQSVGSSSVGRPAISHGTRSSGLASSVSISESGEPADRDYTVSPVTPVTPPAPAH
                     AGTSLPTVPEPSTPPKPVIKNVVLPATSSPVSTASTTSGTFFIESMPVLPEGREAAGP
                     SQTGGRRYRSPSTSNPPAVPERSAGRQAVANTSALRQPAAIGQVSVERTRNRSPSQGS
                     SSSRPREPSAGRGRQQTAAESPSSTKLKTVQTSEEQVQSRIDVVRNFEELIQSDQTIQ
                     YTLTPESMRDLESQGQSGRPATAASPVVSIKTRKSEEACRNGSRSPSSSVPRNDAKSP
                     SSAPRSSGSGSHSVTDGHHPSRSFALSPAKHNGVVPRSIPPVPSKPRATNGPQARDAR
                     LERESLAEFAEFIRSTGPADARAASANANANGSSGSGRRRNQGSISNGDVGTTSLASA
                     TSNPNRPRLQPRGAVVDHKDDNSDLIDFIRRGPPSSAGNPRIPRSVAPFRTTMDSDQL
                     SAAVGGRAVDAQLRDAELADSQASTNATDSSVPPSVQSSINSRSALVAKNKPLPSDAG
                     DVDMPMPKRKTRRVRDPYAIDLSDELEDDDEFTPLPPKKAQTQEESLIDFLNNYAPPP
                     EPPVQPFNISQTRNAMQPRKKASTSSLMARFTRRDSAQSSAAGSTVSAASKVPETRSA
                     NGRASAPKAGHIPIQVNIPGSANTHENSNGDSAKAAAMMGGGGPGPVRGRVPMKKFEP
                     REAISVPTRTTSDLAEFLKQSAPPVGTTPMASDFSETAGRDEASGISKVFSRRKKPSV
                     SHPRRMPESE"
     gene            complement(436889..437944)
                     /locus_tag="MYCTH_2300111"
                     /db_xref="GeneID:11511776"
     mRNA            complement(436889..437944)
                     /locus_tag="MYCTH_2300111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661049.1"
                     /db_xref="GeneID:11511776"
     CDS             complement(437112..437828)
                     /locus_tag="MYCTH_2300111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661097.1"
                     /db_xref="GeneID:11511776"
                     /db_xref="JGIDB:Spoth2_2300111"
                     /translation="MCGQAACVWTLPQTPTGRAAITTRLLSARTVEAIPVSPIPDSTD
                     LPRSVITIDKRTIGVTGKGAPKDNNKGKGKEKGKEKGKEKGKEKGKEKGKEKGKEKGK
                     EKGKEKGKEKGKEKGKEKGKGEGEEGKGKDGGKGGKGGHGKKGGHEKEKAKDEFKHNH
                     GKAKDESKHNHGKAKDEFKHNHGKAKDESKHNHDKAKGEKGKQPRLVGDGMPQDAIKQ
                     DGVPHLIRKGMGADQQLLVT"
     gene            complement(438296..439491)
                     /locus_tag="MYCTH_2300113"
                     /db_xref="GeneID:11511777"
     mRNA            complement(join(438296..438696,438761..439119,
                     439233..439491))
                     /locus_tag="MYCTH_2300113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661050.1"
                     /db_xref="GeneID:11511777"
     CDS             complement(join(438649..438696,438761..439119,
                     439233..439371))
                     /locus_tag="MYCTH_2300113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661098.1"
                     /db_xref="GeneID:11511777"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="JGIDB:Spoth2_2300113"
                     /translation="MMADKTGRRRRSSSILQVYHEPPEPIEQLSDQSALPNLNANWVN
                     AKGAWTIHLVLIICLKIFYDIIPGVSQETSWTLTNITYMFGSYIMFHYVRGVPFEFNG
                     GAYDNLNMWEQIDDGAQYTPAKKFLLSVPIVLFLLSTHYTHYDLAYFTINFLAVLAVI
                     IPKLPFSHRMRVGLFSGVPEE"
     gene            440526..443247
                     /locus_tag="MYCTH_2300115"
                     /db_xref="GeneID:11511778"
     mRNA            440526..443247
                     /locus_tag="MYCTH_2300115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661051.1"
                     /db_xref="GeneID:11511778"
     CDS             440841..442958
                     /locus_tag="MYCTH_2300115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661099.1"
                     /db_xref="GeneID:11511778"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2300115"
                     /translation="MQAPSQMPKPEATLDESSRQHTPGQKRAIPESGGHNDEGSPGSR
                     KEQADDAGLPSPKRLKAAVSSTEADETASSLSSGPPPSQADNAALHAPPRAHAGWNRG
                     ITSGLRTSFAAKDKLRRPLSRQASGSPVQPLTGSIDVDSLAMPSATSHLSGAIRRDDW
                     QALFTKWCVRLMALNQSQKGLKDDPALLREAWGLWLETKVSLPRAHRTTAMEVAKETC
                     LDAEKLQAMFSEALETDLQNPWDAPPTITGQAESVETEKQSNGQPASAESAPAGCQET
                     NDWVLPPPPSCADFDVRHKDQRGWEERFVAWCKSLIQLNGQKIKVDTIRERNRVAELY
                     LRWVGTIDGLSKAKAAAARRTAIHYAQDNSALLTALFAGTSPGGELQTTGSVSPPRND
                     PRPSPTGAVSDGEDETSGDGGTDLLEEKVAAYREKYFPGLGPNETICHMCASRDHDAT
                     ECPETACRFCGDAGHRSFGCPTRLRCTKCKQLGHQKKDCSEKLALPPDEVECIFCQSR
                     DHVDASCHEIWRSFKFNPATVRRVRSLPVFCYCCGSEGHYGPACGLNPQRGEEGPWET
                     WSQANCDRYQDPASSDVATVFEAPSTSSGPRSERPDFGKSIVPQRHIFFEDTDDDDEA
                     EEFIRPPVQKIMRFGHISFPGSKDGGNRSGRGPSNQHNDKNGRLGYTQPPLPPGPPPP
                     LPPQGHQANGRSGGRRRGGGRRY"
     gene            444281..447419
                     /locus_tag="MYCTH_2300116"
                     /db_xref="GeneID:11511779"
     mRNA            444281..447419
                     /locus_tag="MYCTH_2300116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661052.1"
                     /db_xref="GeneID:11511779"
     CDS             444741..447122
                     /locus_tag="MYCTH_2300116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661100.1"
                     /db_xref="GeneID:11511779"
                     /db_xref="JGIDB:Spoth2_2300116"
                     /translation="MATIPQAFYCLWQIEAIRERLFELLPKEDICAVRLANSACCNLV
                     TKRLFLRTHLTFSANSLTKASRIDALSRIGHHIEHLTFYFPHSNATFLPPLIHPQTGQ
                     EICFLYNPHTSAESGLTRPTYGSSELGEILTQQYPPLFHAATHVPSFINAMKHMTNMR
                     HLTIKTPGQNPSERYRRDIVDYALISLRISLERAPLTKLSKLTLSGVHPSAFNYLRHA
                     PGFGALPSASVRWRQIRKLYISVESWDFYGPSPGLDHLMIIDDYIRAFAPQLDKLSFT
                     WLGRRGPCPIALSGDPLFAPPRNSKKLFNEVTSPMSPLPPRPFRRPLVMPRLRYMSVR
                     NTTMSVDQLRGLVASHKHTVREFDFENVALIKGGTWEEALAPLTEGESSDAWSPRSLG
                     NRDYRPGTSRSNASGSVVASSVEDEYLPASSAAAAAASRELFEVDLEGMMFGGMNDVD
                     ALEAGVEEWARGVTAAAQGASRPSTAEEWHENARPSSAGRRSGDDSGLASDIEAAKQA
                     SEGFSTKLKKRRVRRRPRQHQKEEEAPKHQEKRAEDRRREHHSDDSRHHSTRSHHKHS
                     RSDDISDRHSSSRDSHRRHRHHRRHRSDEGAETTFMAGVVGTDDEADRPPETPRPKMD
                     ISVPILNLDPLPVLLQPTVYDPSAKFGPLLDTPESSPISDDGLSPTQRSIEADMLAEA
                     EEAAARSSALKRAKQAVITKLSREFSKRRMDGSKPRNKDSAAVIASLSALNLSMNLPA
                     QQYGGLSCASSSSVGHRLRDNMFGRSMANVAIAPDHRSLESQTALVPLIFSRS"
     gene            447986..451910
                     /locus_tag="MYCTH_2300117"
                     /db_xref="GeneID:11511780"
     mRNA            join(447986..450879,450943..451910)
                     /locus_tag="MYCTH_2300117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661053.1"
                     /db_xref="GeneID:11511780"
     CDS             join(448154..450879,450943..451720)
                     /locus_tag="MYCTH_2300117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661101.1"
                     /db_xref="GeneID:11511780"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="JGIDB:Spoth2_2300117"
                     /translation="MRIAIREQLATVVILAVGVALAVVSIPTWIFVNNFTLGVESDGL
                     SLTASLKAARIASEIKLIQTACQSIATRLLLQDAFRRFYASQANNTTDDDTWADAQDD
                     IQSALDKTGFSALLQARLYSRNTTGNPKGLVSLTGNGAIDSGPILLPYKAPNGSDVHL
                     GDPEYGFPPSLFPNITYRDLGRPSNVMPNTNAFTAVVFPGVSLGNGSEKAGVLLGPLV
                     VNSTYALISLTIPIRDTGNNDYVLGYMTLVANTRTLVEVQTSREGLGNTGRVLFVGST
                     NPWNHFSAPVAASNSTWTPPLEEFGEQEVRFLLPPQPPDGQPDRHSLRSFGSGKYGEP
                     FRLREYPAVLDVLRDQNPSPNNATSKLSTTNEQGYSVAVGVARPQTPLVSWAIVVEKD
                     RTEAYQPIRTLRSILLGCVFGTLGLVLLLVFPFAHWSVMPIRRLKIATENSIDSPGYE
                     DDEDDVFGEENPSSGGTTSGRSSEKGMLANIRRKIRKHQRAKLRQAVTVEPGRRRFKI
                     PAKVESGKHFITDELTELTQTFNEMTEELLKQYTSLDEKVAERTRELEISKKAAEAAN
                     ESKTLFIANISHELKTPLNGIMGMCAVCMEDDDLQRIKQSLKTVYKSGDLLLHLLEDL
                     LSFSKNQIGQQVSLEEREFRLGDVRSQVLAIFDKQVRESRSGLTVTFVSDTPAPGPDG
                     RSSTDKRLPALGPPGVGRLKDMCLWGDQHRILQVIINLVSNSLKFTPPGGTVSLRIRC
                     VGEVEQPSDESRTSSFSKTGSSNRAGRTRHRVGSGSTNSASSKGPHLPLSSVNGGTAL
                     AINPADPKATPQIHIRERSPTPPPPNAKTYLFEFEVEDTGPGIPEHMQQKIFEPFVQG
                     DLGLSKKYGGTGLGLSICSQLATLMGGHISLKSTPGVGTTFTMQIPLKYVKERASSTA
                     SSSVKSRPPSVGSMEGDSRSLAPRNSTEVQRQPAAAPVLDQQPRLVGLSQPFFASTTP
                     NRISKEDQMAAIDRAMATKSGQGKLRVLVADDNSTNIEVVSRLLKLEDVYDVTIAKDG
                     QEAYELVKANMEKNQLFDVIFMDVQMPNLDGLQSTRLIRKMGYSAPIVALTAFSEESN
                     VRECMESGMNEFLSKPIRRPALKKVLAKFATIPEEPETSSLTRRTTPDKTPVATPELE
                     VKDPLANGTGISASVPPTEVQ"
     gene            452525..453681
                     /locus_tag="MYCTH_2300119"
                     /db_xref="GeneID:11511781"
     mRNA            join(452525..452559,452697..453253,453378..453423,
                     453490..453681)
                     /locus_tag="MYCTH_2300119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661054.1"
                     /db_xref="GeneID:11511781"
     CDS             join(452753..453253,453378..453423,453490..453530)
                     /locus_tag="MYCTH_2300119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661102.1"
                     /db_xref="GeneID:11511781"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="JGIDB:Spoth2_2300119"
                     /translation="MRLPYVPNPPETTSEEEAAIVERIKARRAPRPLQALDLTLLHSP
                     PVADGWNSFLGAVRTKTTLPADLREIAIARVAVVNRAWYEWMHHAPLAEQGGVSKQGM
                     EVIKREDPLLLEAPGGAVPAGLTEKQWLVACYADEMTRNVQVRDETFARLREAFGDRE
                     VVEITATVACYNCVSRFLVALDVGEKNGLGPDAVH"
     gene            complement(454001..455100)
                     /locus_tag="MYCTH_2300120"
                     /db_xref="GeneID:11511782"
     mRNA            complement(454001..455100)
                     /locus_tag="MYCTH_2300120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661055.1"
                     /db_xref="GeneID:11511782"
     CDS             complement(454152..454874)
                     /locus_tag="MYCTH_2300120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661103.1"
                     /db_xref="GeneID:11511782"
                     /db_xref="JGIDB:Spoth2_2300120"
                     /translation="MTDSSAWQWILVLSLTALLLSLAVLVPIVNRYAKAYLDAPSEVS
                     TFLDVVDSSVAENESYDRDITKVQRLEDKLRLARLLRDIQKSGDALREELNTLLVGEG
                     SPRLRNGARLCWASHRQRLEEKVRRLDLLRMRFLVVHMAIIAGTATEAAAKKDVALLD
                     PEKSAGLPLTPRPGALPKALADGIKSESPLRRLTVQAIGHQENVEGGHRKGWAGVVME
                     LQKSPLLRERHASIELAMSRSP"
     gene            455701..456787
                     /locus_tag="MYCTH_2300121"
                     /db_xref="GeneID:11511783"
     mRNA            455701..456787
                     /locus_tag="MYCTH_2300121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661056.1"
                     /db_xref="GeneID:11511783"
     CDS             455878..456672
                     /locus_tag="MYCTH_2300121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661104.1"
                     /db_xref="GeneID:11511783"
                     /db_xref="JGIDB:Spoth2_2300121"
                     /translation="MAATDAQFPLPKVLTYPASTPPLLVTQGAEGRLYKTTHLLSDRP
                     CALKYRPPKPYRHPILDSRLTKARISSEAKVLERCWREGVPVPAVYAMDPAAGWMMME
                     WIDGIPVRVGINKLLGPRPEEEALPETHEALLADLMKRIGAAIGALHKTGVVHGDLTT
                     SNMMLRPRKSGQAGGSTGNEDEGEALNGDVFIIDFGLATQSMSDEDRAVDLYVLERAF
                     ASTHPRAEKLFAAVLEAYKETFKKASSVLIKLEDVRMRGRKRSMLG"
     gene            complement(456788..458291)
                     /locus_tag="MYCTH_2300124"
                     /db_xref="GeneID:11511784"
     mRNA            complement(join(456788..457851,457934..458291))
                     /locus_tag="MYCTH_2300124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661057.1"
                     /db_xref="GeneID:11511784"
     CDS             complement(join(456903..457851,457934..457959))
                     /locus_tag="MYCTH_2300124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661105.1"
                     /db_xref="GeneID:11511784"
                     /db_xref="JGIDB:Spoth2_2300124"
                     /translation="MTKLILSTGNIVSGGPSIIRKPGAFRLNLELTNSLRSNFLAAQE
                     DYAAEVAHSNGDANGDSNGSANGGVDLNHGTGGRPAASLWTAEKDGVLYVPAIDRGDH
                     GLQEDPAQYDITAKLFFLPGAPVSQRSHHAREALKHVLRELRAPAVDLLIVSFPGMSF
                     EGDCEWEADRKNAAQGNDEDEIASWPAIEELHRAGLAKKLGLAEFGSEKLSRFLPRVQ
                     VRPAVDQINIKDCCNVPPPLTKLAKEQGIELLVHSDCTDILPKGTLRELLGQGLGGAG
                     LLADPETGAGGLQGDLTPQWVIKYTAVVRDRGVIENKGYFAGAELVDE"
     gene            458872..460213
                     /locus_tag="MYCTH_2300125"
                     /db_xref="GeneID:11511785"
     mRNA            join(458872..459029,459087..459120,459183..459300,
                     459362..459636,459738..460213)
                     /locus_tag="MYCTH_2300125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661058.1"
                     /db_xref="GeneID:11511785"
     CDS             join(459019..459029,459087..459120,459183..459300,
                     459362..459636,459738..459767)
                     /locus_tag="MYCTH_2300125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661106.1"
                     /db_xref="GeneID:11511785"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="JGIDB:Spoth2_2300125"
                     /translation="MAINYLILLSRQGKVRLAKWFTTLSPRDKAKIVKDVSQLVLARR
                     TRMCNFLEYKDTKIVYRRYASLFFIAGCSSDDNELITLEIIHRYVEQMDKYYGNVCEL
                     DIIFSFTKAYYILDELLLAGELQESSKKNVLRCISQQDALEDMEVEDEVTKIM"
     gene            460757..462946
                     /locus_tag="MYCTH_2077028"
                     /db_xref="GeneID:11511786"
     mRNA            join(460757..461235,461298..462946)
                     /locus_tag="MYCTH_2077028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661059.1"
                     /db_xref="GeneID:11511786"
     CDS             join(461230..461235,461298..462380)
                     /locus_tag="MYCTH_2077028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661107.1"
                     /db_xref="GeneID:11511786"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="JGIDB:Spoth2_2077028"
                     /translation="MKYLSLPSFDVVTSALNFDTPDCHVTGSCDLYTTKAAGSDKKLY
                     KNIQQSLQSQHAALLKFGASLSPPQRDSMAASLNLSRSSPFGSLEEISNRRTFAYLIA
                     TLNASHPDYDFSHVLRPADFQRERVLRRVMTQIDSTLSSVRPTSTLLDVAIPRSSPAK
                     PTDFNTGVSTAPPWGPQMWAMIDKEMSLKDCTVFSYQPADDPFDEEEGAIWALHYFFF
                     NKALKRVCYLYVRGVPVMSHSPRVTGHSAMARRTRRSLAGLADDDVDDLGANKRARYW
                     LGDKFAERITASDDDMDDGLVWNRDADGDVNCQYDDDDDEEDDEEGEDFAMDVSEEEE
                     EDDTQRRRSGSSIRGVSEDIAARMEIEV"
     gene            complement(463246..466283)
                     /locus_tag="MYCTH_2314411"
                     /db_xref="GeneID:11511787"
     mRNA            complement(join(463246..464121,464334..464594,
                     464664..464870,464948..465032,465135..465208,
                     465358..465667,465967..466283))
                     /locus_tag="MYCTH_2314411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661060.1"
                     /db_xref="GeneID:11511787"
     CDS             complement(join(463745..464121,464334..464594,
                     464664..464870,464948..465032,465135..465208,
                     465358..465667,465967..466002))
                     /locus_tag="MYCTH_2314411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661108.1"
                     /db_xref="GeneID:11511787"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Spoth2_2314411"
                     /translation="MGQTLSEPVVEKTSAHGGDERLFYGLSAMQGWRISMEDAHTAVL
                     NLLEDNPKAAKEHPSKLSFFGVFDGHGGSNVALFAGDNIHRIVAKQDTFKAGNYEQAL
                     KDGFLATDRAILNDPKYEEEVSGCTACVGLITDDKIYIANAGDSRSVLGVKGRAKPLS
                     FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSAELAPEQQIVTAYP
                     DVVVHEISDDDEFLVIACDGIWDCQSSQAVIEFVRRGIAAKQDLDKICENMMDNCLAS
                     NSETGGVGCDNMTMIIIGFLKGRTKEEWYEEIARRVANGDGPCAPPEYAEFRGPGVHH
                     NFDESDSGYDLEDQKQGKSFGIGGYKGRIIFLGDGTEVLTDSDDTEMFDNSEEDKDLV
                     SQVSKGTLQGGNASEAKADTPADTGSSSSQQQQQQPEQPQAETKAPGNNSADKQKSG"
     gene            <470467..>471726
                     /locus_tag="MYCTH_2124828"
                     /db_xref="GeneID:11511788"
     mRNA            join(<470467..470714,470985..471155,471438..>471726)
                     /locus_tag="MYCTH_2124828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661061.1"
                     /db_xref="GeneID:11511788"
     CDS             join(470467..470714,470985..471155,471438..471726)
                     /locus_tag="MYCTH_2124828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661109.1"
                     /db_xref="GeneID:11511788"
                     /db_xref="JGIDB:Spoth2_2124828"
                     /translation="MDDKERSPSPEFSPLAFGEDLAPLPEYKAAGTTEVDFSGLLGEP
                     LKLHEDLKSGCGGQLWPAGMVLAKHMLRYHRERLQSARILELGAGGGVVGLTVAKGCA
                     RLDHPLYLTDMVEMEPLMRQNISLNGLEDRVKARVLNWGEPLSQEVLEHKPNIILAAD
                     CVYFEPAFPLLLQTLQDLLAVEPSATIFFCFKKRRRADMQFLKAARKTFTVTEIEDED
                     RPVFSRDCLFLYTFTRK"
     gene            472957..474442
                     /locus_tag="MYCTH_2314413"
                     /db_xref="GeneID:11511789"
     mRNA            472957..474442
                     /locus_tag="MYCTH_2314413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661062.1"
                     /db_xref="GeneID:11511789"
     CDS             473228..474016
                     /locus_tag="MYCTH_2314413"
                     /note="CAZy_ID 267832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661110.1"
                     /db_xref="GeneID:11511789"
                     /db_xref="InterPro:IPR005132"
                     /db_xref="JGIDB:Spoth2_2314413"
                     /translation="MKSTVFVASLLASLAAAQPHGHGHAHQHRRKEHSHNKRGVVTTW
                     VTETVYETVTAYVDDTTTELVMPSTKPASTTFLTSTTPAASPGVFIQEPETSSTTSTR
                     VQAPPTSQAPPPPPQSPSPSPEPSPSTTSVAAPPASSSAPPTEAPGGDGSSGSGGQDT
                     RSGEITYYALGMGSCGVDDSGKDNSDNIVAVSSSLMGAQSNGNPMCGKTITVKANGKT
                     AQAVVHDKCPSCAPNDIDVSEKLFLELFGSLDLGRGQVEWYFNE"
     gene            complement(474499..477247)
                     /locus_tag="MYCTH_2300136"
                     /db_xref="GeneID:11511790"
     mRNA            complement(join(474499..476698,476797..477247))
                     /locus_tag="MYCTH_2300136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661063.1"
                     /db_xref="GeneID:11511790"
     CDS             complement(join(474623..476698,476797..477159))
                     /locus_tag="MYCTH_2300136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661111.1"
                     /db_xref="GeneID:11511790"
                     /db_xref="JGIDB:Spoth2_2300136"
                     /translation="MANALRTSSVVPAQLGFLAIYNPSLGTTDETVDDQIVYYASAST
                     LSNAKERRRLLRAAKDGRPTDSISSEERNERLRQIGLAQGMVEFARSFSGGKAVDSID
                     TERARVVLHELEPGWWILASIDLTRLPLSPSKTPATPPTSSPPPAQARGTAPQQTRPP
                     EYEYSAREVKPPALLLRDLLRAHALFLLHHGPSLSALYSALPRPQFGVALARYWDSFL
                     LTWNVLLHGNPARDVLGGIKVAASGELGMGVGEEDRGSGEREVLEGMAGGAVAGLVDL
                     VVGRFGDAGAAEKEGTRTWHAGGAGSGGSEHQRWLGQGTDVGAEDGAVFLGVGALSRR
                     SLRAVTDWMEDVYTWGESAYGVADAPAAAGSRVKRRRRGERSGGVAKASPSGVGSKTQ
                     KKEKGEPGEPETGGDASKADRNDHTKTSAEGGEVAGGMDKMLSYLKFGYGTYWSLGTT
                     SPPSNSDAGDESAADSAAAEDALGRESSRALDDGYFLLGLEEPKADPEQPDRPLQGGP
                     ATPRTVTVELEPEVSRQRDPNNARSPDPDAPHTSQPRTAQLRPVIYIHRPFIYILLFQ
                     PTGTVLPSWEELSRSLHSQLTTLHKPLLSSTAYRPEKPLPASLQSEIYDLVFDPKTLT
                     IHSTIPSIPDPVFVADSTPGGLFGPSPPPPPPPKSSPTTAPWTRVEALSTHNQILNMF
                     AGSRGEAGALERTCKTSRGWWVVWSRVLEQGQTAGADRRSPSPGGSDAGQEGANDGDG
                     SGCGSGPAVGKEIFLVRRASDQGAGAGVRSVGAASYVGGGASAGWAEGASRLAQGIGV
                     DTRRYIEGLLSLNR"
     gene            complement(477717..481013)
                     /locus_tag="MYCTH_2300138"
                     /db_xref="GeneID:11511791"
     mRNA            complement(477717..481013)
                     /locus_tag="MYCTH_2300138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661064.1"
                     /db_xref="GeneID:11511791"
     CDS             complement(477949..480816)
                     /locus_tag="MYCTH_2300138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661112.1"
                     /db_xref="GeneID:11511791"
                     /db_xref="JGIDB:Spoth2_2300138"
                     /translation="MTLGSALPWRACSPQGRIQQRFALAAPRNPPFVGYAALVARAQS
                     TASDKTRPARRLRPPTEPSADTDTASARPPPSLVDRLSRVPVRPHDPYGSVVVKPVTQ
                     YPDKRENREALLKHHRAYTQQLRLEQRRPPGRGGDWRAVLNKLVKWTPPHERQGRIKV
                     VIPKHSVALLLSDHERNLWNIRSRTDCDMTLYRPADEAAPFDPYIVLSGRPTAMTAAV
                     DDILKVSKGVTVVNLDDFLQAGVESSQAGQPPTEGLDDSAFTATRVLPHQMSVPCRPY
                     RLNVRADQIPRPGEWTAQAFQQYVAALIMGNLDASRARELYPDGETHKETVVRLLHAV
                     FNDPAASAAVSLPALKLALRYLTAAGATHVKDAQALFNRAEELGLRVDTDTYNLMAET
                     SVRSKNLPAFESTVSQMVRHGYRPNLGTWLLFLRLVESEEVRRYILQAMDTKSFFLDP
                     TVVNGVSGIMADHDAYRAIQQGQSFDAFIAGLRELYGPEWRLGLRAANRYLDVFGQHS
                     KFGELRQLLEYMFASEHSKPTTISLNTAITRCKHQRKVDLAVDLVRMFDERGHHVADR
                     TTFHLLYELARKTRKPHLLGAVWRYAHRVGMTNHRMQAHGTKVLAGERESTRLTDRIR
                     GLWEEPRRCAITRQEFMENLLLCDYKDSRPELKKQPRATSGQIEEPWKMSPGVVTSRA
                     PSNGDTIPHANVSAVSPENEPRGSSQTPVGTQPSPFQDIHHETENPSRAAAGADMPAE
                     GIKDTPPNARSDDGARGGTGPQQTLLLTAAEKYELYARAMSKTARQFVPSVRLGDFLQ
                     EALDRDRSLHRLAHNDEARNKALQVDLDPVRLPIAKRRGPMFDENGLLRWLAEKRKKE
                     EEEKEEEMTTAVSHNDHESADREIIDVRWTYQENPKVDGSGGATSERANCERAPDSGA
                     LESNHGANDGTTIERVFCSMVESPDHYGGQGILGQPAAGRF"
     gene            complement(481015..483042)
                     /locus_tag="MYCTH_2300139"
                     /db_xref="GeneID:11511792"
     mRNA            complement(join(481015..482598,482664..483042))
                     /locus_tag="MYCTH_2300139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661065.1"
                     /db_xref="GeneID:11511792"
     CDS             complement(join(481517..482598,482664..482922))
                     /locus_tag="MYCTH_2300139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661113.1"
                     /db_xref="GeneID:11511792"
                     /db_xref="JGIDB:Spoth2_2300139"
                     /translation="MPRTRHHRSSRRVPPLKDSDFDHEINLVDKDGEEEAPLGPSSAG
                     PSSQRGAAATGAVMSLAADGEGDAGGETGEQEEQGQPSVVIDEPTPQVGAGDSATLAK
                     TAHVHGKPKTPESEIDVLYENQRGGFLCGIPLFSSKALGNLDPPPWTNFAHKPSPTDI
                     YTAQVPDPSWEWAWPEWRINYDMDVDEDGWTYSFAFSSKFSWHKARWWNSFVRRRAWI
                     RKRVKKNEGYSVQDQYMLNPDYFTVRPSSEMARDRSPSRASTVPGSRASMSTANMESA
                     EPPAIEHSDELLRVLRVSRIDREKIEAVGNYLANAKEDLEGLQAIMHEIISLFLFQAS
                     RRVLLANLTEAYDQSVAEQKAAKESNPELDRKVENLAAAIKHADEEMRRLEYWSDVKG
                     IAEEGESKAAVDHKQGWDSKTWQGVDSSGPSAPSAPERETKTRDGKEAEDGQYP"
     gene            483760..484565
                     /locus_tag="MYCTH_2300142"
                     /db_xref="GeneID:11511793"
     mRNA            join(483760..483980,484061..484176,484257..484565)
                     /locus_tag="MYCTH_2300142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661066.1"
                     /db_xref="GeneID:11511793"
     CDS             join(483869..483980,484061..484176,484257..484424)
                     /locus_tag="MYCTH_2300142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661114.1"
                     /db_xref="GeneID:11511793"
                     /db_xref="JGIDB:Spoth2_2300142"
                     /translation="MSRSKVPLAIGLAAAGGIGYYFYSAGGSPRAAEKQFESDAQHVA
                     AKVKGEVPHRSTDAEQQGRKVGQEIGAKVDSAVETVNRDISKAKSETESHAKAAKADA
                     LKKIDEFDRKVEDSAAKGKSYLSSWFGSK"
     gene            complement(<484706..>487577)
                     /locus_tag="MYCTH_2057284"
                     /db_xref="GeneID:11511794"
     mRNA            complement(join(<484706..485656,485720..487115,
                     487240..>487577))
                     /locus_tag="MYCTH_2057284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661067.1"
                     /db_xref="GeneID:11511794"
     CDS             complement(join(484706..485656,485720..487115,
                     487240..487577))
                     /locus_tag="MYCTH_2057284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661115.1"
                     /db_xref="GeneID:11511794"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Spoth2_2057284"
                     /translation="MASRRDFLSQPAPENYVAGLGRGATGFTTRSDLGPARDGPSEDQ
                     IKAAVAKRSAQLGLTPAKDDDNDDDERYQDPDNEVGLFAGGIYEKDDEEADRIWKEVD
                     DRMARRRQKQREAREKAEREEYERKNPKIQQQFAGLKRALETVTDEEWANLPDPKDLT
                     GRTKRARQERMQRFYAVPDSVLAAARDQGQFGTTVADDGTATEVNKDGTVTDFAKIGA
                     ARDKVLRARLEQQSQTSGIATAGSATSIDPKGYLTSLSNVQIAEQSIGDIEQFRKMLK
                     SAVDSNPKQAASWIAAARLEIAAGKPGAARTLIAKGCQHCPKSEDIWLENIHLNDNRS
                     AKVIAAQAIQANPHSVKLWVEAMKLENDLRSRKKVIRRALDHNPESEALWKEAVNLEE
                     DPADARMLLAKATELIPESLDLWLALARLETPDNARKVLNKAVKKLPTSHELWIAAAR
                     LEEQLGEGSKRPVMKNAVTFLAKRNAMPKREEWIAEAEKCEEEGAVLTCSNIIEETLG
                     WGLDEDDDRKEIWMEDAKASISRDKFATARAIYAYALRVFPNSRSLYLAAVDLERNHG
                     TKDDLWRALEKALNEARRVLARAFKQNPDNEDIWLAAVKLEADNGFTDQARDLLKTAR
                     QNAPTDRVWMRSAAFERQLGNNEAALDLVQDALQLFPAAPKLWMMKGQIYEDLGKLPE
                     AREAYGTGVRAVPSSVPLWLLYSRLEERSGNVVKARSVLDRARQAVPKCPELWTELIR
                     VERRAGNINQAKSLMATALQQMPKSGLLWAERILHLEPRTQRKSLITEAIKRVEDDPI
                     LQVTAARILWAERKLDRAQNWFERALLLDRDMGDTWAWYYKFLSQHGTEEKRAELVAK
                     CVLNDPRHGEHWQAIAKDPKNAGKKTEEILKLVAASLS"
     gene            complement(487711..491648)
                     /locus_tag="MYCTH_2300145"
                     /db_xref="GeneID:11511795"
     mRNA            complement(join(487711..489374,489431..491378,
                     491473..491648))
                     /locus_tag="MYCTH_2300145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661068.1"
                     /db_xref="GeneID:11511795"
     CDS             complement(join(488131..489374,489431..491378,
                     491473..491535))
                     /locus_tag="MYCTH_2300145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661116.1"
                     /db_xref="GeneID:11511795"
                     /db_xref="JGIDB:Spoth2_2300145"
                     /translation="MNSSPTPSAGHWPPRRPSKRSKLRNGSVIIPSTGERLHRAFTLR
                     PSGLFTSRQADASESSTTEPFLARGSLSDRLQAAANSARKGGARLLRWLDSPAGHGVI
                     KCTLAYTLGSLATFLSPLSNFLGRPDGKHVVATLTVYFHPARSIGSMIEAVLIAIVAV
                     AYAELVSILSMCTSVLFGGIMGMVALAHGLVLVVFIGGGFGFMGWVKQKMNNPLVNVG
                     STLASLAITVVVTKETAVFTSVFSNQKIVQLLKMLIMGITITTVVNILIWRVSAVSAL
                     RQSMNKASISLGDMLSMVTRGFLSGSEDDMLSPEFAAASSAYSSVYPQMTKNLREAKF
                     ERYFLGHERLYQLDRAVVRSMETLAQSIGGLRSAANSQFALLKEPLFTPLSRVMSPTE
                     FASSPTASPGLYRTMSGPTRVGRDKFLTLSSIDEASEDGHEEGRTAVGERRRSDATAT
                     SLPPFQHSSEIFELFIQLLGPSMRSLAYTLSEVLRDPPFGEAPDYNITINANFRHSLT
                     DALSLFNEARAHALQELYKTLELDRTRSKSIQADFEEVAAACGHFTFSLQTFGEEMQK
                     YLDVLEDLKFANEHRKRSWNWLKWWRNSRQSAHNALALPYDNAERVALIKPIKKTAIP
                     RGIAEPLVRRRDTYNWEAAPETKKTGLVARLSQKILAVARSLARDDVRFGLKVGVGAV
                     LWASLAFMPQTRDLYRHWRGEWGLLSFMIVCSMTVGASNTTGWARFVGTVIGTAAAGL
                     NWQVSGHSAVALVPLGSLVAFWSFYVIIARGNAPLGRITLLAYNVSTLYAYSLTQKVE
                     DDDDDEGGADPIIKEILLHRFVAVTVGILWGLIVCRVIWPISARRKFKEGFSMLYLQM
                     GLIWKRGPLAILLRSDCSRSYLRTGEQAALQKYAARLDDLRASAAREFELRGPFPSEQ
                     SRRLMACTHRLLDAFYAMSLVTQRKGHLSEGERALLLYTADERAMLCDRIFHVFQVLA
                     SSLMLEYPLTDAIPSVTRPRDRLLGKIFQFRKEHQHDAAGEGVDGTSNGNDSSVAGSR
                     GLGQLRHVNVQERDYALLYAYALVTGQVAEELKAVAKEIEDLFGVLDNETLLLQ"
     gene            complement(493200..495856)
                     /locus_tag="MYCTH_2133010"
                     /db_xref="GeneID:11511796"
     mRNA            complement(join(493200..494112,494166..494349,
                     494406..494937,494996..495153,495214..495856))
                     /locus_tag="MYCTH_2133010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661069.1"
                     /db_xref="GeneID:11511796"
     CDS             complement(join(494021..494112,494166..494349,
                     494406..494937,494996..495153,495214..495498))
                     /locus_tag="MYCTH_2133010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661117.1"
                     /db_xref="GeneID:11511796"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2133010"
                     /translation="MADAFAPRSMKRKNVKGLALKAPAPKPPPTAESAARMGAGNGRG
                     DDNTAQLEIGIEFNLDLKPEDLEIIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAK
                     KEMRKRIVRELQIMHGCHSDYIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPV
                     RVDVLGKIAEATLGGLTYLYSKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSV
                     ADTFVGTSTYMAPERIQGERYTVKSDVWSFGLTIMELAIGKFPFAASEQLSDAESAPA
                     GILDLLQQIVHEPAPRLPKSDAFPQILEDMIQKCLYKEPERRPTPQELYDHDLFVQAA
                     KRTPVDLREWACSLMDRDNRKSHLAPQPSPATQELLRSSDSPTYATQQTPTASYRVDP
                     RQAADHANLAAQVDRLYIREWDHE"
     gene            496791..501735
                     /locus_tag="MYCTH_2300154"
                     /db_xref="GeneID:11511797"
     mRNA            join(496791..497232,497293..497478,497530..501148,
                     501211..501735)
                     /locus_tag="MYCTH_2300154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661070.1"
                     /db_xref="GeneID:11511797"
     CDS             join(497059..497232,497293..497478,497530..501148,
                     501211..501482)
                     /locus_tag="MYCTH_2300154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661118.1"
                     /db_xref="GeneID:11511797"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="JGIDB:Spoth2_2300154"
                     /translation="MSTSMRDLIDGEAELNEEEEDESFDEETGETHARERENILDDSS
                     EEEEDDEDEEEARRIREGFIVDEDEEEEEADDSERERRKKKKRRRIEREEEEQLDEED
                     LDLIGEANPEWERKTQTQTKFKRLKRGHRDEDRGNERPDLAEIFSDDEEDMADERGYG
                     RPSHRAHVDEFDDFIEDDYPEDDEERIQRQEDLEVARPRDKGLAVDTTGLDKDALDDM
                     EAIFGNGDDYAWALELEEEEEDREREEQTIELKDVFEPSQLKEKLLTDEDNQIRVVDE
                     PERFQLDRKPFKEQQTSAEYFKEEARWITNLMWPKKQLPADLHGPFNKAIGKVLEFFI
                     IDGVEVPYVFQHRRDYLIHAKKIRNPDARDNPDAPEYTVDAEKLLTQDDLWRILELDI
                     KFRSLVEKRNALERSVESLKEVGVQDNMLEEMIRQAATLEELQDLQDYLNFQYSAQLK
                     DIAAMGNGVSKEVKRPGAKTALFERIRRSQAYKFVLALGITPDRLAQNALREGKKESS
                     EDDPRPPTELADQLVDDDFPTGDQVINAARQMYAEELFVSPRMRKHFRIQYYSMGIVS
                     CRRTEKGLRKIDEAHPYYEIKYLINHTIRDLAVRPEIFLKMMKAEDEGLVEVHLTLEN
                     EREFRRQLYNEFASDNFSDLADAWNSERQKVLDIAFSKLEKVIAKGVKDSLRTACQDE
                     LLKTCREEYFKRLDQAPLKPKGMVLGTTPRVLTMSNGMGDPNRDPISWTWVEEDGRVL
                     EHGKFANLARDESQRELFAELVRRRNPDVIGISGFSADSHRLVKDVEGIISEKGLMGP
                     EYDDPETNEYRSDLLEVVIVNDEVARLYKDSPRAATEHPTLSPLTRYCIALARYMQNP
                     MKEYAALGKDVTSLLIHPYQQYLPQDKLYKHLETAMVDIVNLCGVDINEAMGDPYTAN
                     LLPYVAGLGPRKAQLLIKGINANGGVVTSRDELVGDPERHKIPVLGPRVWNNCASFLY
                     IEHDSTNPDSDPLDNTRIHPEDYDLARKVAADALGLDEEDVKAETDENGPGAIVRKLF
                     KEEEQEKVNELILEEYAEQLEREYQQRKRATLEAIRAELMGPFEELRKNFAILSTDQI
                     FTMFTGETRDSLCEGMIVPVNVRVVKDDFAIVKLDCGIEGRVEAHEVSYRHSIKDMLQ
                     VGQTAQAKIIDINRKDFVCKLSMREEELRRPYRRHYDYGRGQWDYKQEEEDREELREK
                     DKVTGRTQRVIKHPLFKPFNSTQAEEYLGGLPPGEVVIRPSSKGNDHLAITWKVADGV
                     YQHIDVLELQKENEFSVGKVLRVGSKYTYTDLDELIVDHVKAMAKKVDELMQHEKFQK
                     GSRADLEKWLTTYIDANPNRSTYAFCLDTKHPGYFFLCFKASRNSKVVAWMVRVVPHA
                     YELMKSQYPDMRALCNGFKLRYQSEMLKMQQAGGARGH"
     gene            502815..505964
                     /locus_tag="MYCTH_2300156"
                     /db_xref="GeneID:11511798"
     mRNA            502815..505964
                     /locus_tag="MYCTH_2300156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661071.1"
                     /db_xref="GeneID:11511798"
     CDS             503325..505682
                     /locus_tag="MYCTH_2300156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661119.1"
                     /db_xref="GeneID:11511798"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Spoth2_2300156"
                     /translation="MSTLSAGKSDGGGSSPYHVGVLLKRRRKKGQGYARRFFSLDYTT
                     CTLSYYHHRNSSALRGAIPLSLAAIAADERRREITIDSGAEIWHLRASNAKEFTEWAR
                     SLERASKIARGLENSANETVAPGPQGDAASQPAPTARNAQQEEEDRDWQHVESLVSRI
                     VGTRDALRRLVKDLAAEKRPPSNHGAYLPPNTSTVPEDSDGYSAGQLDKRSFWKRKAS
                     APSSPMTPQSFQAATGASLAVPTTPAAGAPVPNGPKSYGALQEGQERDTYENCAALLK
                     DLDSVVVEFSTLLSASKRRRMPLQEAAEPPRRSIESSTSTVEEFFDAEAGDLDKSQNQ
                     VMLINHQSEEETTASDAEEVSIHESSSASSMDEDEAPPTGDGVGSLFPTKPKALSPLP
                     ITEMVARRKTIPPAKVAPPSLIAFVRKNVGKDLSTISMPVSANEPISLLQRIAEQLEY
                     AQLLDEAARQSQAHQRLLRVAAFAISQFSNGRAKERAIRKPFNPLLGETFELVRTESE
                     VPGGFRLLVEKVSHRPVRLAMQADAAQWSLAQSPAPTQKFWGKSAELTTDGRVRVTLR
                     LPDGSEEYYSWNVATVFLRNVVMGEKYVEPVGTMYVCNDSTGAKAAVEFRSKGVFGGR
                     GEEVHVELLGPDGEQTGVSMSGTWTGSLKAAGQEVWKVGSLVENAANTYGLTTFAASL
                     NEITSIEKGKLPPTDCRLRPDQRLAEQGQLDEAEEWKVKLEEAQRQRRRAMEERGEEY
                     RPRWFVKAETTQDGEEVWRLKGGKDGYWEERAKGSWTGVLDLFAA"
     gene            506367..511025
                     /locus_tag="MYCTH_2300157"
                     /db_xref="GeneID:11511799"
     mRNA            506367..511025
                     /locus_tag="MYCTH_2300157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661072.1"
                     /db_xref="GeneID:11511799"
     CDS             506800..510930
                     /locus_tag="MYCTH_2300157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661120.1"
                     /db_xref="GeneID:11511799"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="JGIDB:Spoth2_2300157"
                     /translation="MTNASTTPPKQRGIRIAIDRGGTFTDCVGNYNGQDVIIKLLSED
                     PANYSDAPLEGIRRIMSHFLGEEIPRGSPLDTSRIDSIRMGTTVATNALLERKGEKIA
                     LVVTKGFGDCLVIGNQSRPKIFDLAIRKPEVLYSTVVEVDERVTLEDYAEDPERTVTK
                     VDVRVGTPEAASADLVMGLSGEAVRVLRRPDRAAVREQLQAVFDSGIRSVAVCLMHAY
                     TFPDHEALVGEVAREIGFRHISLSHELMPMIKLVPRATSVCADAYLTPAIKRYISGFQ
                     QGFEGGLGTKSVEHGKGGKGARCEFMQSDGGLVDVDRFTGLRAILSGPAGGVVGYAIT
                     SYDENTRIPVIGFDMGGTSTDVSRYGEGRYDHTFETTTAGVTIQSPQLDINTVAAGGG
                     SMLFFKNGLFVVGPESAGAHPGPACYRKGGPATVTDANLFLGRLLPEFFPKIFGKNED
                     EGLDPEASRKVLQELADQIYRETGRKMGVDEVAYGFLTVANEAMTRPIRSITEAKGHD
                     TSKHRLATFGGAGGQHAVAIAESLGIKQILIHRYSSVLSAYGMALADVVDERQEPESA
                     VWSDKGDVVDQLKRKMEGLKEKSRQALREQGFEDSEIAFEEYLNMRYRGTESALMIVK
                     PTGEREWDFGTAFVEHHRYEFGFTLDDRDIIVDDVRVRGIGKSFRYNEKSVDEQLKTV
                     TRKDVPADKKHSEADVYFEGGRVKTPIYELGVLSVGEVVKGPAMLADGTQTIVVTPNT
                     TALVLETHVVIDIPESEKDRHSKASEEREVDPIMLSIFGHRFMAIAEQMGRALQKTSV
                     STNVKERLDFSCAIFDENGGLVANAPHLPVHLGSMSTCVRRQADIWKGKLKKGDVIIS
                     NHPSYGGTHLPDVTLIMPAFNEAGDKILFYAASRAHHADIGGITAGSMPPHSRELHQE
                     GAAIKSEKLVSEGRFNEERVIELFYKEPAKHPGCSGTRCLADNINDLRAQVSANQKGI
                     SLIEALIAEYGEDTVQFYMLAIQNNAELQVRNLLRTVHERFRGKDLWAEDFMDDGSPI
                     RLRITIDPDKGEAVFDFAGTGPEVYANINAPEAISYSAIIYALRCMISEDIPLNQGCL
                     KPITVKIPPKSLLSPSDNAAVVGGNVLTSQRVTDVIFRAFEACAASQGDCNNLTFGFG
                     GNVTGQAEVRGFGYYETIAGGSGAGPTWEGTDGVHVHMTNTRITDAEIFERRYPVLLR
                     EFSIRRGSGGKGQHRGGDGVVRDIEFRIPLQVSILSERRVYRPYGMAGGEPGQCGLNL
                     WVRKVKKSSWESSLRKLQREGQGLGNGNGVVQGDKGGQEEEEEEEGDEYEERFINLGA
                     KNSALMAAGDRIIVCTPGGGGWGKVGEAKALEEKADPTQSWKKGSHAAREETALQA"
     gene            complement(511843..514469)
                     /locus_tag="MYCTH_2300159"
                     /db_xref="GeneID:11511800"
     mRNA            complement(join(511843..512164,512233..513710,
                     513872..514469))
                     /locus_tag="MYCTH_2300159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661073.1"
                     /db_xref="GeneID:11511800"
     CDS             complement(join(511896..512164,512233..513710,
                     513872..514305))
                     /locus_tag="MYCTH_2300159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661121.1"
                     /db_xref="GeneID:11511800"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2300159"
                     /translation="MAPAHDDEELSISLSPSQIRRRRRPGEGQDQSTDNSHHRHHQTT
                     TPRSSIDAAVMASGSAPTTAQNAPLRDKTRTEQRIGAYNIVKTLGEGSFGKVKLAVHR
                     GTGQQVALKIISRKNLISRDMQGRVEREIEYLQLLRHPHIIKLYTVIKTPTEIIMVLE
                     YAGGELFDYIVAHGKMQESEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNV
                     KIADFGLSNIMTDGNFLKTSCGSPNYAAPEVIGGKLYAGPEVDVWSCGVILYVLLVGR
                     LPFDHEHIPTLFAKIARGSYMVPTWMSPGAANLIKKMLVVNPVQRATIEDIRQDPWFL
                     KDLPAYLQPPVEEFLNTGVDPNKAIKVSDIAPHAPPQEQEKLHNEVTEKISKTMGYGK
                     RDVEEALEADEPSAIKDAYMIVRENKIMESTQLAGLATDDATPSPHPDPTMSSTRSVA
                     STSTGTSSARPPYVSKVGILPSSLPVYHKAFMDRERARAEGIDIPEAPIAVPDPSSHT
                     RSPAEQEETLRRLKPHSRSLVPLDDPSRPRGLTPVNPPKKNKPIRWQFGIRSRNAPWE
                     ALLCIYKALHKLGAAWIVDEDYDLSRQDDENGDCSGSRHSRKQSSSSGVDPRELYKLP
                     ADPWHIKIRWETNNLQKHSAASGLGETSANPQVTREGEDFDIVAMRMEIQIYEMEPGV
                     FLVDFKVDGYETPEGKLFEDKEVASPFPFLDMAARLIMQLADAD"
     gene            complement(516333..517941)
                     /locus_tag="MYCTH_2300162"
                     /db_xref="GeneID:11511801"
     mRNA            complement(join(516333..517518,517587..517941))
                     /locus_tag="MYCTH_2300162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661074.1"
                     /db_xref="GeneID:11511801"
     CDS             complement(join(516559..517518,517587..517772))
                     /locus_tag="MYCTH_2300162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661122.1"
                     /db_xref="GeneID:11511801"
                     /db_xref="InterPro:IPR002794"
                     /db_xref="JGIDB:Spoth2_2300162"
                     /translation="MKPAIAIPATLLLVYRAYSKKSLTPGGLLAATLTAIAHAIHPWN
                     LPFALLVVFFLAGTRATHVKENVKANLTLKSGGTSGGEGPRTHVQVFANSLSASIFSL
                     LHAYQLRSRQRALLNSPSDDAGSLCFAWGGDLLVIGIIANYACVAADTLSSELGILAK
                     GEPRLITSPTLRKVPRGTNGGVTLTGLAAGLLGSVIIVTAAMLFLPFCTDETAGRLGG
                     GAPWSTEQRRTLILGLTLWGLLGSIVDSILGGLFQSSVKDVRSGKIVEGEGGVRVLVS
                     AGAGPRGSEREHDATTDGASAVEDTDPTSGSAAGTTPRPDRYNARNKHRRPSFGNEKP
                     SRIVENGWDLLDNNDVNFLMAFGMSVGAMAVASWYWQVPLRSVFPGA"
     gene            <528057..>530429
                     /locus_tag="MYCTH_2059558"
                     /db_xref="GeneID:11511802"
     mRNA            join(<528057..529067,529164..529249,529322..>530429)
                     /locus_tag="MYCTH_2059558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661075.1"
                     /db_xref="GeneID:11511802"
     CDS             join(528057..529067,529164..529249,529322..530429)
                     /locus_tag="MYCTH_2059558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661123.1"
                     /db_xref="GeneID:11511802"
                     /db_xref="JGIDB:Spoth2_2059558"
                     /translation="MGNDLAAADGSYPDYLPWSDFQDELDRYPSTVQLTRQDTSLCAI
                     PNFANIPSPSELVVASSRTSINTPETSVMSLEYAAVPGTRDFATAVHSDSAVPEFEAV
                     VLAEAEWNLARCNPPPPPGHCPKTAVVHLRILEQKSKQEDTWSALEEYLEKVEGDASD
                     LAPVVPISSCTRDKLLAITQSFLHKALEIHRRGHNSCRKSGYCSPGDCNFIVLPPPKI
                     LEYFLRSYLRSLTVYYPLVTAGCVDPNEMLQDNQASTLLVLLMIAQGAAAMPLQEARY
                     LSAGLTETCRISLFDIVEKDMGLSADPTTLRCALLFLVLGAWSGDKWLMDIAMGQRGM
                     YMSTAKNPKFDDNAINSEVQWRAWVERETRHRLVYNYVMLDQELSLFHDTAPLFAITE
                     LQCPLPAPEVLWMSADSAQWLGAMQSLNVCTVNGTQPIFSTAPAAQSLHGLFQEFLQD
                     HPLMGQAGLSPQHLRLLLHPLQAMVCHLRQMVSCFSDVFSTPHPAGCPVTKESILHRL
                     DEVQALLQKWYDITMNYSKTNPGCPATHCNLIMYHLVSLNTVADFSEIERLARREEFG
                     GLQWELPIRHGKCIFHRQKAIIHCGQVIRLLRLMPKECRPAWWPAAMYRAMLTLWADS
                     ISRVDPNARGDEHGNIGSQESVLVMIDQLTLEHPALINYLWSGNGMPLLTQPRGTQVG
                     LDDPGRLLTCAINDIETCYSSRIGEGIKRKLISLGKNWNLEVSVLSPSGAGC"
     gene            537312..537786
                     /locus_tag="MYCTH_2300166"
                     /db_xref="GeneID:11511803"
     mRNA            537312..537786
                     /locus_tag="MYCTH_2300166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661076.1"
                     /db_xref="GeneID:11511803"
     CDS             537386..537553
                     /locus_tag="MYCTH_2300166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661124.1"
                     /db_xref="GeneID:11511803"
                     /db_xref="JGIDB:Spoth2_2300166"
                     /translation="MADPQFILSPFLLFFFLLFTFCWFQRGPVTAVLQTHGKQKNTRV
                     SMNRFSDSPLP"
     gene            539059..540970
                     /locus_tag="MYCTH_2300167"
                     /db_xref="GeneID:11511804"
     mRNA            join(539059..539171,539231..540376,540509..540970)
                     /locus_tag="MYCTH_2300167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661077.1"
                     /db_xref="GeneID:11511804"
     CDS             join(539065..539171,539231..540376,540509..540626)
                     /locus_tag="MYCTH_2300167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661125.1"
                     /db_xref="GeneID:11511804"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="JGIDB:Spoth2_2300167"
                     /translation="MGQYPDGLRGPLVVQDPNDPYKGDYDEEHILTVSDWYHNDSITS
                     VRNMLTPSNTLFQPPIPDNLTVNEGQGLHINFTKGKRYRIRMISFAAFGAAMVHFDSH
                     TMNVIMNDGAYIKKQDAYQLRLAPAQRYDVLLSPNDSDEGNYPFLVSLDINRDWTNSS
                     ERFVWPHNYTGYLVMDESKPLDRLDVVDKWQPVDDAQFQPYDGAAAYSTYQKLMKLDF
                     AFCFDQNGYPRSCFNNLTYISQRVPTLYSAATTGDSNTNPVIYGQVNPFIVDYDDTVQ
                     IVVNNIDTASHPFHLHGHHFQVLYRAASGAGNWTGRDENYAANPPMRDTITVMPRSYV
                     VLRFRATNPGVWLFHCHIEWHVEMGLTATVIEAPDRLRNMAFPDDHIDACKKTGTPYQ
                     GNAAGNIGNATDTTGFITVPPTTYYGSTYPPPNTTSQRKRHTPTQPMLRKRVVPFAKL
                     GWLWHH"
     gene            543576..550726
                     /locus_tag="MYCTH_2300170"
                     /db_xref="GeneID:11511805"
     mRNA            join(543576..543816,543889..544180,544270..550726)
                     /locus_tag="MYCTH_2300170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661078.1"
                     /db_xref="GeneID:11511805"
     CDS             join(543605..543816,543889..544180,544270..550470)
                     /locus_tag="MYCTH_2300170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661126.1"
                     /db_xref="GeneID:11511805"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_2300170"
                     /translation="MDQGHLAKAFLLQAFHHLKKLIDKMPPAERAMLPEFRTLQQLNE
                     RYHSATLKHAGIDAALLAMAQIVHYINHSEKHCEDITQPHQTFLIGLCSGLWASSAIS
                     VSPSLPDLVHVGVQFVLFAFKTGTYVHSVSQQLSPAFDRSECWTYVFSGLEQDDVVAR
                     LDAFNRVCNIPPACRAYVSAVSEYNIAISGPPSTLDTLVKNEILPAEPVSIPVHGPYH
                     APHLHAEVDVKALLDLDKPETRDALYMTSPRSPIMNCGAGTWFTETDTLSLVAAVATT
                     ILKETLDFTKVLKGCVEAAREFKFEDRRCLILPLGPTQNAGTLKKLLEEEAKLKVKTR
                     MPPPYSPESTASTVGNQGSIGRPKLAIVGMAGRFPDAPSHEALWRLLEQGLDVHREVP
                     PDRFDVKTHFDPTGQKDNTSHTPYGCWIPEPGLFDPRFFSMSPREAAQTDPMQRMALT
                     TAYEALEMSGYVPNRTPSTRLDRIGTFYGQTSDDWREINAAQTIDTYFITGGVRAFGP
                     GRINYHFGFSGPSLNIDTACSSSAAAMQVACTALWAGDCDTAVVGGLSCMTNPDIFSG
                     LSRGQFLSKNGPCSTFDNKADGYCRADGCASVVVKRLDDALADNDRILGVILGTATNH
                     SADAISITHPHGPTQAILSTTVLDEAGVDPHDVDYVEMHGTGTQAGDGTEMRSVTDVF
                     APADRPRPHDRPLFLGSVKANVGHGEAASGVTALIKVLLMLEKNLIPRHVGIKPNSII
                     NQTFPKDLSERGVNIAFHTTPFKRRDGKPRRVFVNNFSAAGGNTGILVEDPPKPPPAK
                     PDPRSHHIVTLTGKARASLLMNAERLLRWMEQHPETPVSHISYSTTARKMQHYWRISV
                     TGSEIGDIQKAIQNALGEGNFSPVKAEQPKVVLMFTGQGTFYAALGKEFYRNHSVFRR
                     SIDGFVKLARMQNFPSFLGLIDGSEPDVSRLSAVELQLGLVCFQMALARLWMSWGINP
                     AAVVGHSLGEYAALEIAGVLSASDVIYLVGSRAQLLEKACEPGTHGMLAVTGAHDAIM
                     EAMGRRALGLNVACINGPRETVLSGPVAKTLEVASFLSPRGFRSTPLKVAYAFHSPQV
                     EVIMDDFEKLAQGVTYNVPKVPVISTARGKVIVADEFDARYLREHSRNTVDMLGGLVD
                     AQRNGTIDAETVWLEIGAHPVLTTMVRATFGTTTVAVPTLRRDEPCYKTVTESISTLH
                     SQGVDLDFNEYHREFSDSVRLLDLPSYAFDERNYWIQYTGDWCLIKHRTAAASESESK
                     PRWPTISTTSVQKVVKVEVDGDVATVEIESDLHQEQLRNAVSGHRVNGAPLCPSSLYG
                     DMAMTVCDYAYKLLRPESRDIGCNVSNMEVPKTLILDETAKSHILRLTVTANAKLGFA
                     DLTWHTGDGKRKINHAHCKVYYGNRDDWQSEFDRAAYLVKSRIDFLQEAEKRGKASKV
                     GRGLAYKLFSALVDYAPRYRGMEEVTLDSATCEATARIRFQTTEQDGTFYFSPYHIDS
                     VCHISGFIINGTDAVDSREQVFISHGWGSMRFTEIPDANKEYRSYIRMQKMKDSKMMA
                     GDAYVFDGDKIIGMTGDIKFQCIPRHVLNTVLPPRGAQAVRTPAAAAAAAAAARPPTT
                     TAAPSKQTSKEPSKSPTKPPNKSAATKTKKKEKTVTPSNIRTVDQNLKSVVTAVMDIL
                     VRELGCSPDELADNVSFNDLGVDSLMGLTVTGKFREELSLDDIDSDVFLEHTTIGAFK
                     QYLARFESRPGRQESVPSRGSEVSPDDESPELDSDSDVTTPPDDSETHSSKAGEPAEA
                     PSADEGAKLRDTLRRAIAEEAKVEVEEVLAVRDLPSLGVDSIMGLAIVGRVLEEIGVA
                     LEKDLFLTNTTLKEIERALGIEDLPKKSSKAKQEPKQQQHEQAPPRKEARQEPKQESK
                     KETKEEPKQEPKKENKKGPEEESKQAEKSRRQTEESSKTGPPVKQHPRIGLEEPAPPK
                     PPRPTEIMDDYPQRTARSVLLSGTSKCSKQLFMIPDGSGSATSYTEIAKVGGDWRVWG
                     LFSPFMKTPEEYVCGVYGMAAKFITEMKRRQPSGPYSVAGWSAGGVIAYEMVYQLTTS
                     GEEVENLILIDAPAPVTIEPLPQGLHAWFASIGLLGEDSGKDGGEKKVPEWLLPHFAA
                     SITALSNYYADPIPKDRSPKTMAIWCEDGVCHLPTDPRPEPYPKGHALFLLDNRTDFG
                     PNRWDEYLDVNKLKLRHMPGNHFTMIHGELVCLSQDHHLRMLRC"
     gene            complement(<553598..>554815)
                     /locus_tag="MYCTH_93342"
                     /db_xref="GeneID:11511806"
     mRNA            complement(<553598..>554815)
                     /locus_tag="MYCTH_93342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661079.1"
                     /db_xref="GeneID:11511806"
     CDS             complement(553598..554815)
                     /locus_tag="MYCTH_93342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661127.1"
                     /db_xref="GeneID:11511806"
                     /db_xref="JGIDB:Spoth2_93342"
                     /translation="MASNITFTGVLNFNYAPKVVEVDGIPSHHPVKESCQPCYGMKVK
                     CSGHNDRARPCHQCMTRPSVECFFTRSKRPVRRGANNAAVPAAFPPAAPSAVPAAAFP
                     AVAAPALVSFSQGPVAIPAAPPAIPGFPAPPTAMSGPLGVATHGANPADLAWGTLGPF
                     PGATNLVQAAAAAPAASISLAPGPPRPPGPVPPSQSRLRRFGCEIHRDLYDEPLELSR
                     LVNAPQHAAVPYSADSLLGQNSASLRSCWLVVDCPRCVARPEVVAATYEVALEMYTIY
                     ERVARIAANPEPEPEPEPDPTFPAAAAVVSGPFALPSPPPSPLLPLPLRLSRDAEEFD
                     CLAERVAVLLAPYDQDGAVELWNRAKNLRVIAGWETDESGEETGGIEEEIQDWVGEEE
                     GNLPWSGEVDMGL"
     gene            complement(556537..559484)
                     /locus_tag="MYCTH_2300172"
                     /db_xref="GeneID:11511807"
     mRNA            complement(join(556537..558594,558650..559484))
                     /locus_tag="MYCTH_2300172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661080.1"
                     /db_xref="GeneID:11511807"
     CDS             complement(join(556875..558594,558650..559419))
                     /locus_tag="MYCTH_2300172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661128.1"
                     /db_xref="GeneID:11511807"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="JGIDB:Spoth2_2300172"
                     /translation="MIPIQSPRKSPRNNQQQSPGKGDKRAKPPPPSFFGPKVAAPSSA
                     IPSSSPAFATPAHPLRPFQPPAPAKAAVLPIILPPATLRPLAFRTFTKKHSLTLTSSA
                     LQELATFIGRHCGSGWREEGLAEKVLEEVARTWKNRNGGVIVDGTSPELKDILKTLEG
                     NMSGGKIMSGPRGLSRQNSLMLEPTEDPNHSKTRLGLRPTTTLTRDDSQTSFGMSSVE
                     IDEEPDEEELQDVRRWMKVINAFEQPRYTYNVAKKQFEKIASKPSLLPPASHKTEAFR
                     NRYNAIHQRLLRNEAFQTSAVTSARLTALRRSGSTMQSHKITPVANLLGRHGTNHMLL
                     GMLVILPTGNLAISDLTGTIGLDLSHAVAIPEDSAWFTPGMIVLIDGVYEEDEETTGK
                     GLSGSSGVGGTIGGRFQGFFIGQPPCEKRRATLGVSGLDGGVDHTIGGGFGWIDFLGV
                     GSARAVGPRMRKVEQRLVRQPALADPDSPGRGRVVIVGELNLDQPRSLQALKKILSLY
                     ATDPEGSTPMAFVLSGNFTTHAVMARGGSGGSIEYKEYFDALASTLADFPTLLTTATF
                     IFVPGDNDGWVSAFSGGAAVPLPRKPVPDLFTSRIKRVFAAANAEAGLLSTTEGKGGE
                     AIWTTNPSRISLFGPNHEIVLFRDDVSARLRRSSVRLKSKTAITATAVGDPQPSQTED
                     VTMSGANPTPSSPLAPNLEAMDLDDNTQARQPRSPREEGKEAALPYDVLAARRLVKTL
                     LDQGYLAPFRQAIRPVHWDYASALYLYPLPTALVLVDTTAPPFCVTYEGCHVMNPGSV
                     LVSGRRGVARWVEYTPVGGAGRGGRLRECTF"
     gene            559664..560776
                     /locus_tag="MYCTH_2300173"
                     /db_xref="GeneID:11511808"
     mRNA            join(559664..559845,559897..560276,560333..560434,
                     560529..560776)
                     /locus_tag="MYCTH_2300173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661081.1"
                     /db_xref="GeneID:11511808"
     CDS             join(559762..559845,559897..560276,560333..560434,
                     560529..560598)
                     /locus_tag="MYCTH_2300173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661129.1"
                     /db_xref="GeneID:11511808"
                     /db_xref="JGIDB:Spoth2_2300173"
                     /translation="MFTRRLFHARELRNFSRTVSTLASNPSIKVFPNPQQPNSYLLSY
                     LDTTPPNPSLAIGTTTAVPPTPNSFQSNPRFISILNDVLAKHAADDPGLKSQARAFAS
                     PGGFTFIQARNQRGTGTGAGGASAEGGAGGAGVGGWVHLSDSRNPPDFGRIAWPEDIF
                     GSVEVNGKGEIIGNYQASGTYRIVTNQGILGLSPFLQEKLIARLREEESKS"
     gene            complement(560799..561773)
                     /locus_tag="MYCTH_2300175"
                     /db_xref="GeneID:11511809"
     mRNA            complement(join(560799..561233,561288..561395,
                     561464..561773))
                     /locus_tag="MYCTH_2300175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661082.1"
                     /db_xref="GeneID:11511809"
     CDS             complement(join(561039..561233,561288..561395,
                     561464..561601))
                     /locus_tag="MYCTH_2300175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661130.1"
                     /db_xref="GeneID:11511809"
                     /db_xref="InterPro:IPR003173"
                     /db_xref="JGIDB:Spoth2_2300175"
                     /translation="MPYNKKRQAGSESDAEQQVTKKPKGEKNAQKDLKQGTDAEGNPY
                     WEIGNNRRIGSSKFKGSTLVNIREYYTAPDGELRPGKKGISLTLEQYKALLRVIPELN
                     EQLRSQGHDVGSIPAAEAGASVVKRAKPQKPNIDATSDEEEDDE"
     gene            562178..565616
                     /locus_tag="MYCTH_2300176"
                     /db_xref="GeneID:11511810"
     mRNA            562178..565616
                     /locus_tag="MYCTH_2300176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661083.1"
                     /db_xref="GeneID:11511810"
     CDS             562286..565465
                     /locus_tag="MYCTH_2300176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661131.1"
                     /db_xref="GeneID:11511810"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="JGIDB:Spoth2_2300176"
                     /translation="MKQEDASTPGAIPAKMEEQGGPTASPVKTEACPPQKSTGASSEE
                     SLSTKVFSFLATATPETLGGVAVGLAATTYLVLGRLGLVLIGAFGGIVSFIQWEQRNA
                     EVVRAVRGERGIDVVARLLTARKGSEDAAVEEPSSSDAESALVRSFDDLQPETREALN
                     ELVDAVIDNYVKWWYSPIVPSDRSFPLACRKTLTTFLSSVSNRLSRKRPADAFLDFLT
                     NSSSILVVFMSELSNAFSELPVDSKLNAADAVYNYLASHPESNLATLLDKKQQAHKFR
                     LAAEDMLGFLDRSTYECDPVRIFLREILAGVILETTLQSCSKSEWINAWIVYLLESGE
                     PDLSQAIDVGMQTGPGSTDVVFADLDGNVGNIGLTRGNRSSLELERARRKESMAHKKK
                     LSKAEEEMELAMEEMKRLNQMIAREGAQSGAQSNAQAQQDAKSERNRSPAEASERLND
                     ALERHANAQDIRKDSTETQNLPQRPDTSSGDSKRASSDGSSSRNEAIHTPATPQSGVT
                     PSSKHDSPPSATEGSRFTSFDQIVPPARDEPEAEAKEAPKPPLTLHNATITVLDEPGD
                     GRIRNKPSWDYLVQIEPATTLYPGWMIVRKYSDFETLHEVLRRIATISGATLFSERHS
                     ALPSWKGHTRTSLRSELERYLRDACAHQTLAESEGLKKFLERDNGHIPSAPKTGFQAF
                     EKLGKNVLDVLTSAPLEGSKAVVGGVTGVLGNIGLGQRKPAPSAPSPPPSALQDVTAA
                     SRLSISTLPRVDSSASLSGMRRTRDSLDSQRSSVIALQPGKVPSMDRRPSNNSQGDAE
                     PDSRRFSQASARNSREFSRPSSRAPSRAPPMRSPSSFSFDEFRLPPPPDLISDDYESP
                     VSPSNARPHDSHHARSLTMPALDTQRRLNGPPLQGKQHSKLTEQETRVAVELLFAVIN
                     ELYTLSSAWNIRRTLLAAAKSFLLRPGNPSLLSIQSLIQTTVLDANTSDAGIAAHLKK
                     LRENTLPTEQERAAWPAEMTSEEKENLRVKARKMLIESGVPAALTGVMGQAATSEALG
                     RLFDCLQIEEVARGLMFGVILQAVRTVTH"
     gene            565618..566046
                     /locus_tag="MYCTH_2300177"
                     /db_xref="GeneID:11511811"
     mRNA            565618..566046
                     /locus_tag="MYCTH_2300177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661084.1"
                     /db_xref="GeneID:11511811"
     CDS             565797..565952
                     /locus_tag="MYCTH_2300177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661132.1"
                     /db_xref="GeneID:11511811"
                     /db_xref="JGIDB:Spoth2_2300177"
                     /translation="MDRTCGLGYARFDFPPGCKQILRTKDLPKYFGRHFQLEDVIHKD
                     RATVSQP"
     gene            566930..569391
                     /locus_tag="MYCTH_2300179"
                     /db_xref="GeneID:11511812"
     mRNA            join(566930..567447,567513..567588,567667..567770,
                     567853..568140,568249..568354,568433..568732,
                     568874..569391)
                     /locus_tag="MYCTH_2300179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661085.1"
                     /db_xref="GeneID:11511812"
     CDS             join(567029..567447,567513..567588,567667..567770,
                     567853..568140,568249..568354,568433..568732,
                     568874..569218)
                     /locus_tag="MYCTH_2300179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661133.1"
                     /db_xref="GeneID:11511812"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2300179"
                     /translation="MGQDAKMRGDETGSADDKVETINVEDARLQRMQPPEFIRNLTPE
                     ERARLEKVLKRKIDLRLLPAIIIMYIMNYIDRWVIRLISPSKKLIKKWGVRTNAEVGN
                     LLSNNIAAARLAGKVGLEEDLNLTSTEFQTSVSILFVGYLLMQIPSNLFLNKFGKPAI
                     YLPACMTIWGLISALTAVCTNAAGLMANRFFLGIVEAAYFPGCLYYLSCWYTRKELGF
                     RTAVLYSGALISGAFSGFIAAGVSWGMDGARGIGAWRWLFIIEGAATIAVAIACMFVL
                     PNFPRTTKWLTEEERTLAAWRLQEDIGEDDWVNSEEQTFWQGAKMAFLDPKTYILTVL
                     LFCIVASGTVTNFFPTVVNTLQEGALGNKENKNISLLLTAPPYVLGVIVTYLNATHAD
                     KTGERYWHITIPMWVAVIAYIIAATTTSIAPRYLSMMLMVPSVYSGFVVGLAWISNTM
                     PRPPAKRAAALAFVNAVSNCSSIYASYLYPKSADPHYTVAMIVNCCTAFIAICTATVM
                     RVVLVRLNKKLDAGIWVEGAINAVPGEGAVNGFRFKV"
     gene            complement(570014..573387)
                     /locus_tag="MYCTH_2300181"
                     /db_xref="GeneID:11511813"
     mRNA            complement(join(570014..572831,572927..573387))
                     /locus_tag="MYCTH_2300181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661086.1"
                     /db_xref="GeneID:11511813"
     CDS             complement(join(570159..572831,572927..573109))
                     /locus_tag="MYCTH_2300181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661134.1"
                     /db_xref="GeneID:11511813"
                     /db_xref="JGIDB:Spoth2_2300181"
                     /translation="MIESENLRTASLYINNQLLSRGLLRDGNGIDFAHPGDTDAEVAE
                     TMSRVMAVINDLILRRDRDAEHRESLSTTLRTLRAESLRQANDIQRLQEKYAEAQRKV
                     GLSEAAEAALRTNLKASEATVHRLKEEAARTKSLVAQTRASCANEVRKRDRQIESLKK
                     AVTEAARARGAGKGTGVTSITVVGDTGSEAEHGSRPCGADGQNCDLRTETNAFLAELA
                     RSLSEENEGLLQLIRRTTEQLKEMSGWDVVNGNPPENGDGHALALASNPADLSIEVDA
                     VLEHLRTILTNPSFVPIEEVVVREDEIHRLRDGWEKMETRWKEAVHLMDGWRKRMQAS
                     GRPVNVEELKMGLRLSPVKVKNVEETSHGYALRLGDGSENEEEEDDPQPHCDEGPLDL
                     VPHRGADDDGSDASSMFDHDVDVDDLDVEEPNVEILQQSIMLPSAPMPSPPELSPLRD
                     SFTAANRGERPHNRKPPKGFPTIAEENARSIDAEEPPLPPPHLERLQQSPHRKPILSL
                     RTVPPEEAAKVELPPSAAVSTPDTSVETMPLNKAADERTSKKSAAAAPAAKAQKRVPP
                     TTRNREPSKKVDPVKIAEAAKKVEPSKRETTRREVIRKEEGEKAKNTSKPPAKPRPSR
                     PPITRGRSESRPDEHSSHSARRPRAASATSAASVRSTGTNRSTANRSANKSPNKSANA
                     EPAKRPPSPSAPAAGPSPAPSPSRSPKRVNSRLPLPRPGCNNALPAPQQSPLNMEAIT
                     AKLAASEREADAARVRAKLKAARLGKGVNLPPSGATTAAGSTEFADTDFNPADAATAA
                     ISTRSESDSATTGTASTSASTSDGAPPSCTSTATTATAAGDEDADELGFSPPVKAPQP
                     GRSQAQKQHERRRQPQPQQQQQQQQQQQEQQQDREREQQQRQHQQQKQVVDTDPKKSP
                     VRKRERRTSRVASRRRSTLNPWELDALIQGGNVTVGR"
     gene            complement(573847..575498)
                     /locus_tag="MYCTH_2300182"
                     /db_xref="GeneID:11511814"
     mRNA            complement(join(573847..574024,574285..575498))
                     /locus_tag="MYCTH_2300182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661087.1"
                     /db_xref="GeneID:11511814"
     CDS             complement(574465..575454)
                     /locus_tag="MYCTH_2300182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661135.1"
                     /db_xref="GeneID:11511814"
                     /db_xref="JGIDB:Spoth2_2300182"
                     /translation="MPSGPATIGDFSVLPVAIPPIPSFPHNVVHYLYVRRHTPKIPTP
                     TDDRSLFLTNVPADSTEAHLRALFASLVGAGRFESASFESKRKDAHSQTQSLIDAAQP
                     AHAARLLQAHGKKRKREDEEAERAREEAAARLPSTWTRPLRRSGNTAVVLLADEKSVE
                     QVLRAIAKTHKTKKYPTWGADDGAGGGDVLAGKVPPLGSVWLKAHNRLSYPDKAALQA
                     SVDAFSTLFAQREQEAAEIAKRLRNEPDEDGFVTVTRGGRAAPASRTEAEEAKRRMLE
                     KQEKKKQELTNFYRFQLRERKKEEQAELLKRFEEDRKKLEAMRGKKAKFVPES"
     gene            complement(576101..578344)
                     /locus_tag="MYCTH_2300183"
                     /db_xref="GeneID:11511815"
     mRNA            complement(join(576101..576767,576875..577773,
                     577946..578344))
                     /locus_tag="MYCTH_2300183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661088.1"
                     /db_xref="GeneID:11511815"
     CDS             complement(join(576162..576767,576875..577773,
                     577946..578183))
                     /locus_tag="MYCTH_2300183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661136.1"
                     /db_xref="GeneID:11511815"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Spoth2_2300183"
                     /translation="MPHKVDAEHLQEVDLYAPFTSDTILEVRTGKMKPLPGLAVQSGI
                     DKTPREGPVRVTELGLEGDEHDPTFHGGVDKAIHGYCSSHYATWRAEYPSAADAFRPG
                     GFGENLVTRHLNERNLCIGDTVSISPPDPGPDAEPPVLLQVSLPRQPCFKLNHRFRLK
                     NFAPATWRTSRTGWYFRVLRPGAVRAGDVIRLVARPHPEWTIDRVQEYLHRNTGDPAM
                     NEALAAIEELGAEARDAFRARVVRHRARERRKAREQAGEGGENGNGDKERQRWREYRV
                     VERTRQTERIVSFVLQAVEPLREDGEEEVQLRHGAHARIRLGNGLVRAYSIVDGDRNR
                     FQLGVALDEKSRGGSRYLHEIVQVGHTVQVGAITNSVQVATAASNHIFVAGGVGITAF
                     LALFEHYKRIHYSATLHYAVRSVEDVPFRERLAKLGDDVVIYDKAAGQRLSIRRIIEG
                     MPWNSKLYFCGPKRLMDEAARETKAHGIAEKEVHFEAFEADVSGDPFEVVVANKGGKT
                     IRVGEEETLLECLQREFGEVDSSCCVGNCGTCRVDLKEGRVDHRGTALMEEEKATSML
                     ACVSRGIGRITIEI"
     gene            581163..>583228
                     /locus_tag="MYCTH_2089701"
                     /db_xref="GeneID:11511816"
     mRNA            join(581163..581330,581432..>583228)
                     /locus_tag="MYCTH_2089701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661089.1"
                     /db_xref="GeneID:11511816"
     CDS             join(581187..581330,581432..583228)
                     /locus_tag="MYCTH_2089701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661137.1"
                     /db_xref="GeneID:11511816"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2089701"
                     /translation="MSLMQLPYELVALVIRGLDLDDIRNLSCTCKGFRFLIQESEMAK
                     RLLETRAPHSAEARDARASKKYASGLRRLLKRREALASVSPYLVAVVGFAQEWIYENG
                     VLCYCRGRELRLLDLHRSADAEIVVDLRTLVRRALPDASAPHKHELKLLYYSHGIVSC
                     LYSLIRGGRAGRRDFLIAFDASEGQVITAVELQSTSKLFVRNNDLFLYYGTTTGPDQD
                     GDEYWAIRGFDITASAWIAGQLNVPEAIGTDIGSTVCFEIIDGYFYGLSNLRSLAVEE
                     VDWVSYYSCFRFPLKVDGFASLHALDRAPELWRRDHTEGPLDDRWTFLRLLKDEGTGR
                     LMIIESRKEWLEGSITPRRTYYTSLIGFDVMAGPIPDTHAAKRRHGGGPRRWPRDPHL
                     VHPGDDNSAFNITLARCPLRSYYPACQTFIDLVDDSSSSDPREQKVRIRGGTRRPWTP
                     GELTQSGRQETAERGEGLEALLRQIDRIYRSDTGLFWPPDQEEDPSVEDPALADLYAV
                     LNPPGYVGNLHGSWDERSTVYATGGGGSGGLSALVFVSWDPAIYLAGVPAFPGNLAIR
                     RPGSWAPSCATKESPPAKYKSVGTARRHSTLLPDATSRPTASPCSATPLRDGISGGTQ
                     VSWRRIQPAMYREISRGYHFAL"
     gene            complement(584961..586945)
                     /locus_tag="MYCTH_2300185"
                     /db_xref="GeneID:11511817"
     mRNA            complement(join(584961..585100,585299..586595,
                     586683..586945))
                     /locus_tag="MYCTH_2300185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661090.1"
                     /db_xref="GeneID:11511817"
     CDS             complement(join(585075..585100,585299..586595,
                     586683..586718))
                     /locus_tag="MYCTH_2300185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661138.1"
                     /db_xref="GeneID:11511817"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="JGIDB:Spoth2_2300185"
                     /translation="MSLRGFQKGLARAPQQIKVKLNIGEHTKDPVYIDAERRFQDLET
                     ETKRLHDESRKYFEAINGMLAHQIEFSKAMTEIYKPISGRMSDPDSLVVHGNPEGIRA
                     CEEYEAVVKDLQETLAPELEMIESRVIQPANELLDVVKVIRKTVTKREHKKLDYDRHR
                     ATLKKLQEKKDKTAKDEKAIWKVENELEQSTQDFNYYNDLLKEELPRLFALEREFIQP
                     LFQSFYYMQLNIFYTLHERMQRMDIGYFDLTLDVEDAFHKKRGDVQERAEALTIVRFR
                     TTGQKRPPKYAKPPRPGALEGPKTAGLLTAGGSPSASPSTPELEPATTTTASPAPTAS
                     YRRPSWQAAVAASYSSPDSNPPPPYSPGPGLAAAAAAAAKSKPPPPPPPKPRALSAAP
                     KVETVTALYDYAAQAEGDLSFRAGDVIEVVSRTRNENEWWTGRIGGKEGQFPGNYVRL
                     NA"
     gene            587738..589980
                     /locus_tag="MYCTH_2300189"
                     /db_xref="GeneID:11511818"
     mRNA            join(587738..588100,588170..588993,589221..589980)
                     /locus_tag="MYCTH_2300189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661091.1"
                     /db_xref="GeneID:11511818"
     CDS             join(587818..588100,588170..588993,589221..589643)
                     /locus_tag="MYCTH_2300189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661139.1"
                     /db_xref="GeneID:11511818"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="JGIDB:Spoth2_2300189"
                     /translation="MANIAPSVLRQASRLASRSSVSTASRRGIRVLSRAAPAPARGDC
                     RRCYVTQSKSDNAQVQTDTAIRLDRAELEKAGATLETTQNGSTTLVSPMADVLKQAVK
                     MDEGQRPIYLDMQATTPVDPRVLDAMLPYYTGIFGNPHSRTHAYGWESERAVEQARSH
                     VAKLIGADPKEIIFTSGATESNNMSIKGVARFFGRSGKKKHIVTSQTEHKCVLDSCRN
                     LQDEGYEVTYLPVNSNGLIDLDKLRAAIRPDTALVSIMAVNNEIGVIQPLAEIGKICR
                     EHKVFFHTDAAQAVGKIPLDVNAMNVDLMSISSHKIYGPKGVGACYVRRRPRVRLEPL
                     ISGGGQERGLRSGTLAPALVVGFGEACRIAAEEMEYDHKRIKALSDRLLKGLLSMEHT
                     NQNGDPNHFYPGCVNVSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRALGNS
                     DENAHSSIRFGIGRFTTEAEIDYVLKAVKERVGFLRELSPLWELVQEGVDLNTIEWTQ
                     H"
     gene            <590091..>590683
                     /locus_tag="MYCTH_2124857"
                     /db_xref="GeneID:11511819"
     mRNA            join(<590091..590153,590570..>590683)
                     /locus_tag="MYCTH_2124857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661092.1"
                     /db_xref="GeneID:11511819"
     CDS             join(590091..590153,590570..590683)
                     /locus_tag="MYCTH_2124857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661140.1"
                     /db_xref="GeneID:11511819"
                     /db_xref="JGIDB:Spoth2_2124857"
                     /translation="MDRSSFYSYMCELWVSYLSSRQTANGRYHVRQTNLNEATQVQPL
                     TFRRWLDNVWAFTF"
     gene            complement(<591961..>593724)
                     /locus_tag="MYCTH_93330"
                     /db_xref="GeneID:11511820"
     mRNA            complement(join(<591961..592849,593054..>593724))
                     /locus_tag="MYCTH_93330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661093.1"
                     /db_xref="GeneID:11511820"
     CDS             complement(join(591961..592849,593054..593724))
                     /locus_tag="MYCTH_93330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661141.1"
                     /db_xref="GeneID:11511820"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="JGIDB:Spoth2_93330"
                     /translation="MATIITTLLCDAHIATDHRSADSSFRRGLSPIAREACEIVSRIR
                     RQGTRSPAAAAPADSSRLRQILKRMPKGALLRAHCHALVDVDYLVTAALDRPGMCISC
                     PVGSLAGQHARREADFGIHFRDKADPDRSSIWAADYKAGTFVTLSKAANEYPEGGRPG
                     FLEWLKGRCRTSMQDCHLGRGGMGSTVGRGIIGGMIYYEPMWRTFLQRVMTNMVEDDV
                     YWLEMGLTFPLAFYSEGSEAPDRNYDRMFQAIDEEVAKFQSTSLGRQFWGLRVVWSTL
                     RSQESRAIVNDADNCISTKLLWPQLVAGYDLAGLENLGRPLADSLPELFWFRKRCAQE
                     DVQIPFCLTAGASPGDDGDVATERNLFDALLLGTRRIGNALALPQHPRLIEAVRDRRV
                     LVEICPSLPAGASRHYPLWVLLAHGVPCALCDDDSGILFGQGRDGASRMTNIFWRALL
                     AGDMADLATLGSLAENSVRWAAFEDQDAETWYVRPKPPPPSPPLPSSAVSPLCSAVAC
                     SASRQAKNPVA"
     gene            complement(<595421..>597323)
                     /locus_tag="MYCTH_2116566"
                     /db_xref="GeneID:11511821"
     mRNA            complement(join(<595421..596630,596792..596910,
                     597000..>597323))
                     /locus_tag="MYCTH_2116566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661094.1"
                     /db_xref="GeneID:11511821"
     CDS             complement(join(595421..596630,596792..596910,
                     597000..597323))
                     /locus_tag="MYCTH_2116566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661142.1"
                     /db_xref="GeneID:11511821"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2116566"
                     /translation="MTIRKISSTEADKTGTLSVAPAGLPSRNPSKSYWLREPSRTLLG
                     HRGTPDLPETADVVVVGSGITGAFAARFLKEGPDRKGRASDGGRGDLSVVMLEAREAC
                     SGATGRNGGHCQPLVYGSVPAVAAFELEVCDFLERFVREESVDCDWVSLTGVHAFLSE
                     NMFELAAADAENLKKSHPELAAQLEVVRASGGTETLASLRVPSAQGAIIQKKAASLWP
                     YKLVATVLERLVAKFPAPSFNLQTNTPVTSLSRAESGPGWALTTPRGRITARQVLLAT
                     NGYTSHLLPAFSDLIVPVRGQIGALLPPRPDPSAGKPPAKLAHSYVFAADPEPGSAST
                     APRDDYLVQRPLPTGGELIYGGGRRLARGLGVGEWRDDEVEPEVARYLRRELCPPLDL
                     SPTAGTAEEEEEEEEDDDEGKKSRGLELEASLEWTGVMGYSRDRHAWVGPVPESLGGG
                     GPEGGLWICAGYTGHGMPAAALSAREVVRQMLASGDGNSAAREEEEEDGKVRLPREFV
                     LDEERVERARRLPQLTQGWEATNFATLFGAGSSVPPTGAKGE"
     gene            complement(597566..599757)
                     /locus_tag="MYCTH_2300192"
                     /db_xref="GeneID:11511822"
     mRNA            complement(join(597566..598207,598261..598327,
                     598386..599232,599507..599757))
                     /locus_tag="MYCTH_2300192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661095.1"
                     /db_xref="GeneID:11511822"
     CDS             complement(join(598108..598207,598261..598327,
                     598386..599232,599507..599518))
                     /locus_tag="MYCTH_2300192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661143.1"
                     /db_xref="GeneID:11511822"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="JGIDB:Spoth2_2300192"
                     /translation="MSTEEPTLQRRASSRKSVAFTEEKLVVDADGSVTMVATPNDETK
                     ETALSHTPRTPPLTAALGAFTDASSAPADGAAEGAAPAADSNPDGLDLSLMKKKKKKV
                     KKDDDEAADGAAAAGGEEAIDLSMKKKKKKKVPKEEDEFAKKLEALNLDGGEGAEAPA
                     EEGVQEGDMEKGTGIWAHDETRTIAYDPLLSRFFALLAQKNPDHALTGTRSYKIPPPQ
                     CLREGNKKTIFANLPEICKRMKRAEEHVTAYLFAELGTSGSVDGSRRLVIKGRFQQKQ
                     IENVLRTYIIEYVTCKTCRSPNTELSKGENRLYFITCNSCGSRRSVQAIKTGFSAQVG
                     KRKKMKA"
     gene            <600167..>600583
                     /locus_tag="MYCTH_2058204"
                     /db_xref="GeneID:11511823"
     mRNA            join(<600167..600416,600480..>600583)
                     /locus_tag="MYCTH_2058204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661096.1"
                     /db_xref="GeneID:11511823"
     CDS             join(600167..600416,600480..600583)
                     /locus_tag="MYCTH_2058204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661144.1"
                     /db_xref="GeneID:11511823"
                     /db_xref="JGIDB:Spoth2_2058204"
                     /translation="MRTPSASSSFVIPEVPPSSSSDRDDDIDSLPSISSSILDSDSET
                     DSSDAQREWEASLEQLQLLLTMIILPFAGKFLGRKFAYWSWARYMEWMHNVEIRWTSK
                     SAFNAAGAAEAASSL"
     gene            complement(600822..601922)
                     /locus_tag="MYCTH_2314426"
                     /db_xref="GeneID:11511824"
     mRNA            complement(600822..601922)
                     /locus_tag="MYCTH_2314426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661097.1"
                     /db_xref="GeneID:11511824"
     CDS             complement(601162..601671)
                     /locus_tag="MYCTH_2314426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661145.1"
                     /db_xref="GeneID:11511824"
                     /db_xref="JGIDB:Spoth2_2314426"
                     /translation="MQKIQLILRAVQLLFIIILTGLIGNVIASNEDAASSATAAINFS
                     MFVIALSWVAALLGLAAGLFERIVLPVLVILAADGFATLFTFIDAIVLAAKLGAVNCS
                     RTQGHAASWIAYGSHNDEKRCREIQASTAFMWFLFATFAAALVLSFLSFRRGGGSMRS
                     GPTMSQVRV"
     gene            complement(602874..605954)
                     /locus_tag="MYCTH_2300199"
                     /db_xref="GeneID:11511825"
     mRNA            complement(join(602874..604759,604813..604941,
                     605002..605118,605208..605954))
                     /locus_tag="MYCTH_2300199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661098.1"
                     /db_xref="GeneID:11511825"
     CDS             complement(join(603300..604759,604813..604941,
                     605002..605118,605208..605691))
                     /locus_tag="MYCTH_2300199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661146.1"
                     /db_xref="GeneID:11511825"
                     /db_xref="JGIDB:Spoth2_2300199"
                     /translation="MASFDLEKRAIASAEGNYVSQTFKENTPRRRGFHWLALLLGTLS
                     IFSIAVAASRRCSAATSLFSSYGASRTSRSHSAPGSQPGYNRLPGRKAWEATTATTSS
                     ATPHPTVLKTFEVAQPVLMPDGPAESDGSTRNATDYSPELCTVLLMRHDFAWSYDAPF
                     MGEYTPPDCEFNRVVLNFSVVSEGRQFDRLAIMYFGDTEVWRTSTAEPTAPPGISWTY
                     LKDMTQYLYFWKSPQKIIFDLGNLIDDKYTGIFNTTLTAIFYNRDIKTDQAPPSDLII
                     PISAHRGANNSISRFILPTENATNTITLPRNIRRAVFSVSANGQASEEFWWSNVLQTD
                     VDTFSATAGELPGLSPFREVQVLIDGRLAGVQWPFPVIFTGGVVPSLHRPIVGIHAFD
                     LREHEIDISPFLGLLCDGKEHTFTIRVAGLNNTSHTAATLTNTVNESWYVTGKLFLWL
                     DSDPSSITRGEIPIIMQPAPAISTTRSVTSSLINGTTEANETLTYTTSVRRSLRITSN
                     TASWTQSLTYTNKGHVSAFGYTQFNNLLISGSDTLRIASPSVRYHATYRYPILCNSTY
                     SVSPQGNLSISAYLSHGKSVSVSGASVFPTGLEAFQRYAGKGSTSRVETTKVGTAEFR
                     QTGDGRSSTGWGEAKQWFWFGLEEAVVEDGGSGTGANPGTGGDVESPEDRRGKELELY
                     YREVEAVNGTVVGDLRRLDGKAVSSGSGGDGEGQQKVLVNAAAMQYA"
     gene            complement(606146..607697)
                     /locus_tag="MYCTH_2300201"
                     /db_xref="GeneID:11511826"
     mRNA            complement(join(606146..606596,606656..606844,
                     606899..607697))
                     /locus_tag="MYCTH_2300201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661099.1"
                     /db_xref="GeneID:11511826"
     CDS             complement(join(606451..606596,606656..606844,
                     606899..607190))
                     /locus_tag="MYCTH_2300201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661147.1"
                     /db_xref="GeneID:11511826"
                     /db_xref="JGIDB:Spoth2_2300201"
                     /translation="MSQLRTARPASARPRLALTRAPLPKPRRPFHSTRPRRADSSQKR
                     GEAVPEEPLSLSARLKKLSREYGWSAVGVYLALSVLDFPFCFLLVRTVGTEKIAHVED
                     IVIRSVQKVIPERVQNWWREYRQAARELKRQRTGGVDEVEVIGHGVAEAEQRTRQEGA
                     SLATQLALAYAIHKSFIFVRVPLTAAITPKVVKVLRSWGWQIGKKAKR"
     gene            608831..610855
                     /locus_tag="MYCTH_2300213"
                     /db_xref="GeneID:11511827"
     mRNA            join(608831..608965,609053..609787,609879..610228,
                     610336..610509,610584..610855)
                     /locus_tag="MYCTH_2300213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661100.1"
                     /db_xref="GeneID:11511827"
     CDS             join(609079..609787,609879..610228,610336..610509,
                     610584..610628)
                     /locus_tag="MYCTH_2300213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661148.1"
                     /db_xref="GeneID:11511827"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="JGIDB:Spoth2_2300213"
                     /translation="MSAPPTQTHFSYPPPPGNGQGSVNYPPPPQAGPAPTPPSGTSSP
                     SDPPPPTPQQQQQQQHYPPPPQQQQQQQQYSPPPPQQQQQYPPPPQQQQQQQYAPSPQ
                     ASPSPMQHGALPQHLRTPSTVSQGSPNQPQFAPPPSYPVQDDKGTYPPEKTQHLQQPQ
                     PQLQPQLQPQFQPQLQPQVPIIDPTGTPAAGHFVGASTIVDDVGTFNGGSYRISHRDC
                     NSILTIQLAIGCPIEARPGAMIAMSPSIVLKGSVKFSVKKLVAGGDMGSSTYTGPGEL
                     LLGPPMLGDITSLRLTGQESWSVSHDGFLACTQNVVKDYKRQGLGKAMFSGEGLWVYK
                     ISGTGLLWLTSFGAIIRKDLVEGEKYIVDNGHLVAWNTKYVLERVASGGIISGLASGE
                     GLVCKFTGPGTVFIQTRNAKSFTAYMGGQQVNA"
     gene            611927..614310
                     /locus_tag="MYCTH_2300215"
                     /db_xref="GeneID:11511828"
     mRNA            611927..614310
                     /locus_tag="MYCTH_2300215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661101.1"
                     /db_xref="GeneID:11511828"
     CDS             612158..614197
                     /locus_tag="MYCTH_2300215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661149.1"
                     /db_xref="GeneID:11511828"
                     /db_xref="JGIDB:Spoth2_2300215"
                     /translation="MAGYTKHVSSIKGAPRLRPCGLKTKTTQGIASNDWRKRATAASS
                     TEASTKIHKQAYDPSDDVCIRLDLETDESFSGPQFRFPKEKKVAWENTVSAPVWQLLS
                     SSSSTSGDDAKEVINVQLKQAKPILASVNGETIALPNRFSFDVVAANQGNMSPGPAVG
                     ELRRLNGFTAFRRISSQDPDDLFVELQKVVNGSRDVGNPATSVSSASSHLRESAEEPS
                     VQGKQRHLGLGGSESSASEIQPSNASTVRSDEEELRFQRMLDRLQNNRRHPSPKPEAG
                     VAAAPSRRIFDPAIMALKVKNEAEVLDRSIHLGQSEEAANTFFAQQLDQMRKLERQGS
                     NDSGYGSTDRSDDTDGRSGAGLRIEQRLNPAAAKFKSAAQSDAAPWMPPKKMSRPPLT
                     NIFPDAMLSHSITPHAAAKGNTPSRSSQPTLASTATAISHEHRLVNKSGNVEAPLSRS
                     QPISRPFEFATPVQGAIPNGLPVGAYPGQIISHAGVAATMSAATMASPQVLTTTNLPA
                     TNAFNTFPPTAGLQLPVCTQSAISGVNVYPPHAVSFIPVTPVPVAIGSNGKPARPYFP
                     VTTKPRDHDPVKQQLYEAYLEWRKANEPGYHMKCKMRQANRVMRQYQQQQDPTLTKDP
                     ANWKAIAERAKAAVGAAAAAAAEEKKRREELVRQEMKAKVKDLSRDSHGMVRVGA"
     gene            complement(615113..618310)
                     /locus_tag="MYCTH_2300216"
                     /db_xref="GeneID:11511829"
     mRNA            complement(join(615113..616347,616410..616971,
                     617033..617154,617218..617433,617578..617871,
                     617944..618310))
                     /locus_tag="MYCTH_2300216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661102.1"
                     /db_xref="GeneID:11511829"
     CDS             complement(join(615469..616347,616410..616971,
                     617033..617154,617218..617433,617578..617871,
                     617944..618099))
                     /locus_tag="MYCTH_2300216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661150.1"
                     /db_xref="GeneID:11511829"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2300216"
                     /translation="MAASGALVPGGQPDLTLDANQKRDTEIKAALAQGQELAKNGKYS
                     KALRVVVDAVNLCPCDPAGNGKQRHGKDKSCNISQCMAALKSNDPDALYQVAKGPCSC
                     GYSWPSCSIPTHAVALDALADCLFKAEQHTAALSTALATIRLDPTSAVGYCRGAKILR
                     HLLKNASITQSKPAEARVVAHILSGDDRLPSILDLRRLLDRFIQVGLDITSRYRHKLK
                     DSYNVVLQRMAYHMKCEVARRDPVKELPSEVLSMIFSLLDTTTLIRCLGVNKQWNQRI
                     THDSRLWADLRLSRPGSPGRHFPAFLQKHQRDIKSLVIHDVSRFQLTTTKIHQILQGL
                     PRLERLYLDSGKRYPNRSEIHLQLPRAPTPSSARLTQLSLVSFNLVKPVMQLLSFSWD
                     TLTVLNLVNAGPFVSRQSAGTSNPFDAIRLAKLKKLRITQGDPTVPSGQLSWEDNIEM
                     EPIVMATPNLEQFHLDGFLAYWRRGEPRIEKDGQWLSLRKLVLGSLRTPDDTTIDDWN
                     THFLPPLPSTMESIEMLNVSPEIAHNVMFTLKLSDPVTNDWAPPHEEYEARHFPNLEV
                     FRCISGVLHHALLQRVLEPSARAGKLKVLELAATSAPGFYPRTHPAGSQLGSDFVPAR
                     DLRSLASENLHTLGLHDFNFFDDTSNPHASIYAFCGDPFIDWLDCFPNLHTVAVYPGR
                     WEGVAYFIAKLILHPKVKVIHQDYLRGVHWYEAQQLAKEHGVALHHTPNHLPVGWPMI
                     ED"
     gene            complement(621605..622088)
                     /locus_tag="MYCTH_2300219"
                     /db_xref="GeneID:11511830"
     mRNA            complement(621605..622088)
                     /locus_tag="MYCTH_2300219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661103.1"
                     /db_xref="GeneID:11511830"
     CDS             complement(621747..621965)
                     /locus_tag="MYCTH_2300219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661151.1"
                     /db_xref="GeneID:11511830"
                     /db_xref="JGIDB:Spoth2_2300219"
                     /translation="MLLVQPFFVLFFFLFLFWLFHVSRADTLRLDPTGYNVCKRAVEI
                     RLSSGAWFVWQVSANRSWMFTSFARALP"
     gene            complement(622684..623775)
                     /locus_tag="MYCTH_2300220"
                     /db_xref="GeneID:11511831"
     mRNA            complement(622684..623775)
                     /locus_tag="MYCTH_2300220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661104.1"
                     /db_xref="GeneID:11511831"
     CDS             complement(622871..623119)
                     /locus_tag="MYCTH_2300220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661152.1"
                     /db_xref="GeneID:11511831"
                     /db_xref="JGIDB:Spoth2_2300220"
                     /translation="MCYQLVELYSACRCLYYQHAVDRCAAYGRPGHGIQMRTILVGYA
                     CSEHTSHASGYDCSYSPQYSDSGYHSGRSSKSSRGHYR"
     gene            complement(629084..633838)
                     /locus_tag="MYCTH_2300221"
                     /db_xref="GeneID:11511832"
     mRNA            complement(join(629084..630533,630597..633838))
                     /locus_tag="MYCTH_2300221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661105.1"
                     /db_xref="GeneID:11511832"
     CDS             complement(join(629217..630533,630597..633605))
                     /locus_tag="MYCTH_2300221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661153.1"
                     /db_xref="GeneID:11511832"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2300221"
                     /translation="MLSASSSNNHSLFSFGSRNGLSADVTDSAASFDFLPSVSFDDLQ
                     SSLESAAEFKLTQFPSPTGQGTILGSGSAADHSMVERPDITRNARGIHASVQQPAATR
                     SRTGSILRKPSTSSRHASLTAAAPSNPGAQNAPSAPAATRSRRQSHYPPVSNASIARP
                     PRKSTGDAGLGLDFEPRKRRPSVASLSDRNGLEPPTRSSVDGGSRPTGDLLRAQAGSR
                     SSKARSVQPPPRASQATLTPDTSARSLDQPRMPTALPRSPRAAVKGASLACSKRVSVM
                     PGAPQLPHVTGLGARTISPTDTRRLKRLSMHHSQSQTPAPVLPNPPPLAANVRSSSRS
                     PSMLPRKISTPSSSRTTPDPNRKSYSSGLSVNSNGSFNNTTAVRTSTASVGHRNSQLL
                     NSRLPAPKALASHVIAGRDDEEYVPPVPAIPKAYESPKDPLAEAPSLEKRKSNLSHDA
                     SSVHSSNSTPSISGALNDGPSAKLQRRPSNRKSIHTSKLDLESKPVAAHPKKSLQPLR
                     LPPLTLGPLSTPTATKIAALQDKGSSERDLSPPPTRQIVKTPTTPMTASKGSFFSRTR
                     LEERHDIQHLRSSSSVHRLRRGTPPPPPEPASSSDSFAAVKNGDQRSGPSPFLSSSVP
                     KDGHMEVPFLKRSKTGGDLAAPLDAAADIPTPTHQSKPSGPRAQKPVTTRQPKSPPPF
                     SSPEEPQTSSSMSSLRRKLSLSWKRQNKNGSTNQPQGEKAESKPAKHDSMPPPRIPAS
                     ATANNIPSAKPASPAPSNKSNGTGTYLESRRRKSSASSLNAIIAQEQRGRSDAAAKKE
                     STLGTVSERNAAPQNPPVVQKGLKPRHSTAGLRHHDVWTAELDSYDLIAEEEMKKLGM
                     RRKDTELAARTLDALRKRATPKERVSPQEAIRIAVLNIYERGEIVDYKDVYFCGTQNA
                     AKVVGDPQSDSPNFGYDDERGDYAIVPGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTG
                     VLVAVKIIRNKKRFHQQALVEVNILQKLREWDPQNKHCMVNFTHSFYFRGHLCISTEL
                     LDMNLYEFIKSNAFRGFSLKLIRRFTKQMLSSLNLLKQHKVIHCDLKPENILLRHPLH
                     TEIKVIDFGSSCFEHEKVYTYIQSRFYRSPEVILGMTYGMPIDMWSLGCILAELYTGV
                     PIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSS
                     KTLQQVLKCDDEAFLDFIARCLRWDPDRRMKPEEAIRHEFITGQKTSVPVPRSAVRDS
                     SPSKRVNSIGIPRPLPEPPAAAKTATSGPLRSRDNAAAAAAASTAGGTLGANYGPGKP
                     STVPPSSGGGGGQTTTRRVSGMNASAGGVKRTSAGAAATAGSGGNNNNNTNNSGGVNG
                     GANAASYSGVTSSVSNSSLPRASIRSVSGGLAGLGVGGGGAGGVGPRQDLAAAGATAA
                     MSRHA"
     gene            636222..638494
                     /locus_tag="MYCTH_2300225"
                     /db_xref="GeneID:11511833"
     mRNA            join(636222..636626,636700..638494)
                     /locus_tag="MYCTH_2300225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661106.1"
                     /db_xref="GeneID:11511833"
     CDS             join(636439..636626,636700..638164)
                     /locus_tag="MYCTH_2300225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661154.1"
                     /db_xref="GeneID:11511833"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="JGIDB:Spoth2_2300225"
                     /translation="MDEYATGFLNVIEEDAAPEVEEQDDEGRREAAETPEPDSAKKRR
                     SLRDGIFRAANLQDRLLEKLVSQVIPADDGHGQVPDLGGGGVPAFAERPGFSLPLMTT
                     NFRRFNARIGVVFKFQARVLRLLSWRRPTQTLSFLAVYTFVCLDPYLLFALPLAVALF
                     GILVPSFIARHPAPAQDADRLRNMSYHPRGPPLAPARTVKPTKELSRDFFRNLGDLQN
                     VMEDFSVAHDKIIALVVPKTNFSDEALSSALFVLLFAAFLLMLIAAHLLPLRFIALVG
                     GWAGVLSGHPAVARWLQQAKLEYLEPTTGPPSAPRDSQQQQQQQQQQQQQQKQQQQQQ
                     ADTPQEKKRGSALPFPAFSLQELIRRDIQLDSDPETREVEIFELQRQSPTTLEWEPWL
                     FSPSPYDPLSAARLAGERPRGARFFEDVLPPPGWEWSEKKWALDLWSREWVEERIITS
                     VEVETEGERWVYDMWSGERDAGNGGGGGGGVGGSSSSSSSSGEGEGSKEGGGGGQGKA
                     PAAGPSANVSWEEGEEGMGRRGQWRRRRWVRMVKRKKVAGSG"
     gene            complement(638495..640729)
                     /locus_tag="MYCTH_2300227"
                     /db_xref="GeneID:11511834"
     mRNA            complement(join(638495..640368,640581..640729))
                     /locus_tag="MYCTH_2300227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661107.1"
                     /db_xref="GeneID:11511834"
     CDS             complement(638825..640354)
                     /locus_tag="MYCTH_2300227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661155.1"
                     /db_xref="GeneID:11511834"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="JGIDB:Spoth2_2300227"
                     /translation="MPSPAPAPDTRPHRDTFGKVVCNPEDSEWRPLPSPAHMVHFRSS
                     SQKDRPAMATQPEQPASSSSSSAIPGAGLHPNSSSNKNNNNNNSSSSSSSNNNNNNNN
                     NNNNSNSNNHGYHSNNPAAPLWQSPAAIPPRTSSTNSTAAAALRNLPDHDWLPGYAAA
                     TAAAAASHKRQRSRKASVVGTTSFPSAAAMSAASQPPPDPNRFATEDFSNRRTWSEEK
                     DKVLMGPFDYLNGHPGKDFRSALVKAFDAWLEVPPESLDVITRVISMLHTASLLVDDV
                     EDNSQLRRGFPVAHFIFGIPQTINSANYIYFCALQELQKLRNPKAVSIFAEELLNLHR
                     GQGMDLFWRDTLTCPTEDDYLEMVGNKTGGLFRLGVKLMQAESRSLIDCIPLVNIIGL
                     IYQIADDYHNLVTSQYTANKGMCEDLTEGKFSFPIIHSIRSNPGDMQLLNILRQKTES
                     EEVKRYAVKYMESTGSFDYTRKVVDVLIERARKMTDEVDDGRGKAEGIHKILDRMVIK
                     D"
     gene            complement(641747..644053)
                     /locus_tag="MYCTH_2089733"
                     /db_xref="GeneID:11511835"
     mRNA            complement(join(641747..643060,643186..644053))
                     /locus_tag="MYCTH_2089733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661108.1"
                     /db_xref="GeneID:11511835"
     CDS             complement(join(641830..643060,643186..643376))
                     /locus_tag="MYCTH_2089733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661156.1"
                     /db_xref="GeneID:11511835"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Spoth2_2089733"
                     /translation="MVSNAPVTGVDPEVPSEKKKGDVQNKFNSDDSSTRIEPVPATYP
                     PDKEEKEGSVEINYHTLTWWQAGVVLIAETVSLGILSLPAVVATLGLGPGIVVMVFMG
                     LMATCSGLVMGEFRKQHPWVQSFGDAGEVIGRSIGMGKFFQELFGWAQTIFQIFVMGS
                     HLLTWTICLNTLTNSAACTIVWGVVGLAIFWLLNTPRTLRAAGYYSFASFASIFTAVM
                     VTMIDVGIEKPIGTTSIEASRTIGFTSAFLAVTNIGVAFSGHSCFFSVMSELKQPNDW
                     PKALMLLQVCDMVLYIVVSVVIYVYVGPDVPSPALSAAGSPVVRKVIWGIAIPTIVIA
                     GVIYGHVAAKYIFVRVFAGTKHVVKRTTLGVIGWLGITAATWIIAWVIAQSIPVFSNL
                     LGLVCALFASWFSYGIPGCLWLWMHYGNWFSSPKKIAQFSLNALLLLVGLVLCALGLW
                     SSGEAIAQDSGSDPWTCKSNAAS"
     gene            647087..648715
                     /locus_tag="MYCTH_2300230"
                     /db_xref="GeneID:11511836"
     mRNA            join(647087..647206,647399..647943,648077..648715)
                     /locus_tag="MYCTH_2300230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661109.1"
                     /db_xref="GeneID:11511836"
     CDS             join(647536..647943,648077..648577)
                     /locus_tag="MYCTH_2300230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661157.1"
                     /db_xref="GeneID:11511836"
                     /db_xref="InterPro:IPR012535"
                     /db_xref="JGIDB:Spoth2_2300230"
                     /translation="MESLLSVAFDNLSSFDGSKIKKGLKQVEGLLAQICLSGPSSPRK
                     PSAARGRDQEQASRKGLSDLSGDPAFCEFFKLQEGFEWNIAQRLLTTLDWLVVRGGDG
                     QYDLLIVNALDLIQGVLLLHPPSKVLFARSVHMNLLLDLLEPINCPAIQSAAIITLVV
                     ALLDMPQNMRVFEQLDGLLTITSLFKSRETGREVKFRLTEFLYFYLTPEAPSIPRAEA
                     RMSAGAPGLLQPSPSKLAKVFGGNRNGEARADRPGQGRGKGGQESDATLSVEEKKRLV
                     DRYLPGVVDELLKDLDTYKPFGGVLS"
     gene            complement(649123..650998)
                     /locus_tag="MYCTH_2077114"
                     /db_xref="GeneID:11511837"
     mRNA            complement(join(649123..650424,650524..650575,
                     650676..650998))
                     /locus_tag="MYCTH_2077114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661110.1"
                     /db_xref="GeneID:11511837"
     CDS             complement(join(649302..650424,650524..650575,
                     650676..650868))
                     /locus_tag="MYCTH_2077114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661158.1"
                     /db_xref="GeneID:11511837"
                     /db_xref="JGIDB:Spoth2_2077114"
                     /translation="MAALIRSLPAFGWLLAAVAGAATTEHERFAAVETGAVLAPRLYH
                     MGPASPLEKREDGCREGWHPCNDIGPPGENACCPNDQYCIVNPSDTTTAGCCSIGARC
                     RGSPCDPTAYQCNKTTTITAQGTPSVSLIPACCGRVCTGTSEFQCPTSLGGGCCKYGS
                     RCGRDKQCIFTLTEPSPTPTPSTSIDPALIPPPPGCETGQTSCPASLGGGCCPATQSC
                     TLITGKAHCADNPPEPTGSGVSVVDGADGGLSPGATAGVAVGVVVGAGAILGLAASWW
                     CARRRRKGGGMSEATGSAPASRPTGVVGRIVGGSGGAGSAGREISDVTSDVASRSGRF
                     GGGGGGGGLVQDYFGPAPAVGPYSETHTSSPVTTPGLDRGGVPLQPHEPGDIAVPVEI
                     DSRLKGAEGPPAGLAITPRANAPHESEDVQEHYELYGSEVGQISPTLPSPYGEGVPSP
                     HERPS"
     gene            complement(<651796..>653370)
                     /locus_tag="MYCTH_101107"
                     /db_xref="GeneID:11511838"
     mRNA            complement(join(<651796..653023,653090..653192,
                     653280..>653370))
                     /locus_tag="MYCTH_101107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661111.1"
                     /db_xref="GeneID:11511838"
     CDS             complement(join(651796..653023,653090..653192,
                     653280..653370))
                     /locus_tag="MYCTH_101107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661159.1"
                     /db_xref="GeneID:11511838"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_101107"
                     /translation="MSTTNSTKWTITAIVALAAAAAPMGSSIFLPALPSMSVDLDASE
                     TVTNLTISFYMLAMSIFPLWWSSFSETLGRRTVYIVSFSLFLIFSICSALSVNIAMLL
                     VMRILGGGASASVQAVGAGTIADIWQPANRGRAMGIFYLGPLVGPLCAPIIGGALTQG
                     FGWRATMWFLSIYGGVMLLMLLFCLPETLAKPPGGAAAPAPAPTTAGAVSPALQRVPT
                     TTQSIKLRTRHTAVLLKRLLLDPLSVMLYLRHPPVFLTVYLASIAFFSLFILNISIQS
                     TFSRPPYSFPPIPLGACYLAPSTGYILASTLGGRWIDYIMAREARRAQRYDADGKLVY
                     LPEDRARENMWLAAALYPGAMLWYGWTAEKGVHFMVPCVANFFFGFGSMLVFGVTTTM
                     LTEFMPRRSSSGVAVNNFVRNIFSCVGSVIAQPLIDAMGNGWLCTMVALFALLTGNAA
                     VWALRRFGPQWREEMDRRLRQGK"
     gene            <653519..>654057
                     /locus_tag="MYCTH_2108494"
                     /db_xref="GeneID:11511839"
     mRNA            join(<653519..653745,653847..>654057)
                     /locus_tag="MYCTH_2108494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661112.1"
                     /db_xref="GeneID:11511839"
     CDS             join(653519..653745,653847..654057)
                     /locus_tag="MYCTH_2108494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661160.1"
                     /db_xref="GeneID:11511839"
                     /db_xref="JGIDB:Spoth2_2108494"
                     /translation="MLLLLLLLLLVSWLFGNLIGVIFAALQNHRVLFVPGVVLVSRHG
                     SDPGILRVWARRSRSGSGRGRGRGRGWLTVRRAVDAQVPGQNRKNQEEKRQNPPPTRE
                     CSCRTVSLERERDIEAGNKQAGASAPLIGRHFGLILRPYPYLG"
     gene            655001..656587
                     /locus_tag="MYCTH_2300236"
                     /db_xref="GeneID:11511840"
     mRNA            655001..656587
                     /locus_tag="MYCTH_2300236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661113.1"
                     /db_xref="GeneID:11511840"
     CDS             655200..656540
                     /locus_tag="MYCTH_2300236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661161.1"
                     /db_xref="GeneID:11511840"
                     /db_xref="JGIDB:Spoth2_2300236"
                     /translation="MSLTNASPADAAAAAKSASHVLATLSADARNEALTAIHAGLAAA
                     RDDILAANARDLESAKKAAADGKLSQSLVSRLDLGRKGKWEDMLQGILDVRDLDDPVG
                     KVTLRTRLDDGLDLERVTCPIGVLLIIFEARPEVIANIAALAIKSGNAAILKGGKEST
                     ESFVAIARVISAALDRTRVPNDAIQLVTTRDVIPQLLALDNQIDLVIPRGSNDLVRYI
                     KNNTRIPVLGHADGLCAIYLEPSADPAMAAEVIVDSKTNYPAACNALETLLVHEAALA
                     THLPTVAAALAAKGVDLRCDAPSKAALAGVPDLTIADATEQDYSTEFLSLTLAVKTVP
                     SLADAVAHINTHGSHHTDCILTSSAENAEQFMAAVDSSGVYWNASTRFADGTRYGFGT
                     EVGISTNKIHSRGPVGLEGLMIYKYKIRGHGQVAASYGAGEGKKQFLHQRLPLE"
     gene            complement(<657033..>659894)
                     /locus_tag="MYCTH_101105"
                     /db_xref="GeneID:11511841"
     mRNA            complement(join(<657033..657137,657525..>659894))
                     /locus_tag="MYCTH_101105"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661114.1"
                     /db_xref="GeneID:11511841"
     CDS             complement(join(657033..657137,657525..659894))
                     /locus_tag="MYCTH_101105"
                     /note="Contains conserved domain Smc[COG1196], Chromosome
                     segregation ATPases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661162.1"
                     /db_xref="GeneID:11511841"
                     /db_xref="JGIDB:Spoth2_101105"
                     /translation="MATPLTPTPSAALNSSTPAGAGAGHGTFDTARKPVDNAENRNSS
                     DDGDSTPFLPHGRDSVTSPTQRGPSPPKPRPGSRILSGSELSPLKILQQHQQSQVQAQ
                     TQNQPSPQSAGEEAPSSAKSMPPPPLPQSPRKPAPIKRFPVRVSQASSTASESPRRSS
                     EDRRSSGERQFTGERQASSLPEAVRENEGLKHVIDIFEDEVNAMNDEPDDIDHDGDHT
                     MSMEHDAADGRSHAAEEEHSAADDTMMSTFSAFSTVPNLTMLGQMRSDSPTKLSTVGG
                     STPRVGGRPEGSIAARTPRSNGSYDAGNTTTNLMDFTEQMRYGAYGAQPTPSRRGGHL
                     PARTPDDAATPQRNNLVNLLDFDIPPAPTPRSIPTITPRELESLKSGFLSEISSLKAS
                     LSGKEAEVLSLKTAVGDAEKRVGECMEQLREVQGMLEALQAEKDSWERRGREMEAVLR
                     KVKEEIVVSQREREELEFKLDEAEKRREAAEMMAQDAESKMAGMRAGKLSAEAAAAAG
                     ENRPPVPSNKEVEIAVERVARELHALYKSKHETKVAALKKSYENRWEKQVRKLQAQVD
                     QLTQENDELRHSNHSRSHGGIDPARLAEIEEERRADKARDAAQIKELEAEVEKLEAVL
                     KTVQADNADLRVLLERERVEKGELVMLAEEMMNMQQSFIGNVPEEDEEQQQQQQQQQQ
                     PQPQQPTPAPAPVQSAKTPNRRQSSSLSSRTPGTTAGNGSSTNNFRMSVNGAPNGFRA
                     SGLRAPGASGFGKPSGIAGPESRIGRVAHHERTKSAAVMGVSGHHGSASGERTERDWL
                     LVEPVDAFGGSKASHHVNTPSLLFGF"
     gene            complement(<661404..>663395)
                     /locus_tag="MYCTH_93313"
                     /db_xref="GeneID:11511842"
     mRNA            complement(join(<661404..662661,662756..662888,
                     662957..>663395))
                     /locus_tag="MYCTH_93313"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661115.1"
                     /db_xref="GeneID:11511842"
     CDS             complement(join(661404..662661,662756..662888,
                     662957..663395))
                     /locus_tag="MYCTH_93313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661163.1"
                     /db_xref="GeneID:11511842"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="JGIDB:Spoth2_93313"
                     /translation="MNSAAPEMYYSQHMSAGPAPPPQTVTSPYTHQHPQQHSQPTLLQ
                     PGPGQYAPPPQYGGQYAYANGLSPPTGPPVSNALSAPQPVLPLPGVSQPGVPNSPYGG
                     STFDTTGQIAPPGVKPRVTATLWEDEGSLCFQVEARGICVARREDNSMINGTKLLNVA
                     GMTRGRRDGILKSEKVRHVVKIGPMHLKGVWIPFERALDFANKEKITELLYPLFVHNI
                     SNLLCHPTNQSRGQVMAAAQRKPIPGLPSLPHHQLALPGPQPPLSSHPPSMVRPSLDR
                     SHSFPTAPTSAPTVMNGMGNSDNFQWNQQGMGNGQGPNQVSIDTSLTNNSRSLPSTPA
                     ATPSGSSLQSMQNYPPASQPYDNSRPMYQPGPPSSSYPPPSNDRPPIYTNTHNNYVKS
                     EMGPPANRSNGSNAEQGDTKPPNGIMQASQGEAGASAEEEADHENDGEYTHDSGAYDA
                     NRSTYPYNPPPVSSLSNDHSHISPELAGSPHQAGSGRATPRTAAAPQPYYGPQGYSTP
                     PRVGQTSSNLYNVVSNERGSANGTSTNDVYGNQGDMSGSMPNGYPVLSGVPTLKRGRD
                     EDDDRGDMKRQKGLVNGTGSMPSPTFNNQMTQPTAAISAQRRR"
     gene            complement(<672582..>673079)
                     /locus_tag="MYCTH_2124880"
                     /db_xref="GeneID:11511843"
     mRNA            complement(join(<672582..672664,672782..>673079))
                     /locus_tag="MYCTH_2124880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661116.1"
                     /db_xref="GeneID:11511843"
     CDS             complement(join(672582..672664,672782..673079))
                     /locus_tag="MYCTH_2124880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661164.1"
                     /db_xref="GeneID:11511843"
                     /db_xref="JGIDB:Spoth2_2124880"
                     /translation="MVCIPPGPAPPDRGGLVPASGLPPTTPPNLRPMSMSLFAPPRFP
                     PPSFGPSSAPAFPFLNTNHHLPNLAGEENTAELIIVSSNVMPSYQLRSVFGGGLEELF
                     VDRLVSSLATFYGLLRDAGVGYTI"
     gene            <674985..>676008
                     /locus_tag="MYCTH_2022424"
                     /db_xref="GeneID:11511844"
     mRNA            join(<674985..675754,675906..>676008)
                     /locus_tag="MYCTH_2022424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661117.1"
                     /db_xref="GeneID:11511844"
     CDS             join(<674985..675754,675906..>676008)
                     /locus_tag="MYCTH_2022424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661165.1"
                     /db_xref="GeneID:11511844"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="JGIDB:Spoth2_2022424"
                     /translation="PPPTPKLPLPAEARYSRTFDPWNSASTGHQRAETRGPHGWRESR
                     NKKMNSQFRAGNSGGERMADTVGVGSEEFDERLGMFVPKEVRARALNSVADMLRNPGS
                     MRAASKPPVTRPSATSFVSQPAPVPEGGLGNAQSDEDGGGLTADEKLTVDRKAEDEAR
                     EEEKAKRARERKIFDGLVIYVNGSTYPLVSDHKLKHMLSEHGARMSLHLGRRQVTHVI
                     LGKPSGPNGGAGGGLAGGKLEKEIKRVGGCGIKFVGVEWVLESIKAGRRLPEARFANL
                     KIASRRQQSVLGAFS"
     gene            complement(678451..681345)
                     /locus_tag="MYCTH_2300248"
                     /db_xref="GeneID:11511845"
     mRNA            complement(join(678451..679049,679155..679369,
                     679442..679959,680019..680277,680339..680582,
                     680657..681345))
                     /locus_tag="MYCTH_2300248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661118.1"
                     /db_xref="GeneID:11511845"
     CDS             complement(join(678586..679049,679155..679369,
                     679442..679959,680019..680277,680339..680582,
                     680657..681032))
                     /locus_tag="MYCTH_2300248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661166.1"
                     /db_xref="GeneID:11511845"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2300248"
                     /translation="MDHPQDQVQRHSLTDPEGFWAHQAEQLHWHKKPSAVLARTTKTL
                     KSGNKHAHWEWFPDGEISTCYNCLDRHVLAGHGDAPAILYDSPVTNTKQRITYAQLLD
                     EVEVFAGVLREEGVKKGDVVLVYMPMIPAALIGILAINRLGAVHAVVFGGFAANALAQ
                     RIEASRPVAILTASCGINGNKPPIPYRDFIDEAVRISSWKPPKTIIWQREQLLWRPTR
                     KLQGERKWQHLVKSARARNQRAECVPVRSSDPIYIIYTSGTTGLPKGVVRETGGHAVG
                     LHLTISYVFGIHGPGDVMGCFSDIGWVVSHSYTLYGPLLTGAASVIYEGKPVGTPDAS
                     AFWRLVDEYKINTMFTAPTALRAIRKDDPDNAHFTRVGERGGLRSLKALFVAGERSEP
                     AIITMYQSLLNKYAAEGAQVIDNWWSSESGSPISGIALAPHAGRNRKTGMKEKQRPLE
                     IKPGSAGKAMPGFDVRVVDDQGVEVERGKMGNIVLALPLAPTAFRTLWKDEERFYKGY
                     LKRFDGKWLDTGDAGLVDENGYIHIMGRSDDIINVAAHRLSSGALEQAISSHPLVTEA
                     CVVGIPDALKGHLPFAFVTTSATSPLRPEEEEKLYGEIQSLVRSQVGAIATLGGMVVG
                     RGMIPKTRSGKTLRRVLRELIENAVLHGDVDRPVNVPSTVEDAGVVGVAREGIREYFK
                     RRGGLKAKL"
     gene            complement(681869..684092)
                     /locus_tag="MYCTH_2300252"
                     /db_xref="GeneID:11511846"
     mRNA            complement(join(681869..682864,682978..683060,
                     683230..683403,684067..684092))
                     /locus_tag="MYCTH_2300252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661119.1"
                     /db_xref="GeneID:11511846"
     CDS             complement(join(682636..682864,682978..683060,
                     683230..683394))
                     /locus_tag="MYCTH_2300252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661167.1"
                     /db_xref="GeneID:11511846"
                     /db_xref="JGIDB:Spoth2_2300252"
                     /translation="MKLTAAVLALASGAMATVAGNGTVSYTTEVVTAVTTFCPGPTEI
                     AYGSVTYTVTEATTLTITDCPCTIKKPVTTISSVVCHNCPSYTNGTATTGSATSVQTP
                     AGTITLPANPPANTPPANPPASTGSGSPPITAGAGRTTVLSGGALAGLLGLAAFVL"
     gene            685511..687155
                     /locus_tag="MYCTH_2300258"
                     /db_xref="GeneID:11511847"
     mRNA            685511..687155
                     /locus_tag="MYCTH_2300258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661120.1"
                     /db_xref="GeneID:11511847"
     CDS             686002..686913
                     /locus_tag="MYCTH_2300258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661168.1"
                     /db_xref="GeneID:11511847"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2300258"
                     /translation="MDLLQREGRYPLPPHAPKTLGVEFSGTIESLGPGADASSSSSSS
                     SSSSSSSSRFKPGDAVFGLAYGGAYAEYIAVSTKMLLRKPDYLTFEQAAGIPETWITA
                     IQALHFVPQAQPGQSVLWHAGASGVSIAGIQLSRLAGASEIYATAGSAEKCAFVEKEL
                     GAALAVNYKEANWVEEILKRTGGRGVDLVVDFVGGDYFEKNLDVIARDGRICMLGLMG
                     GAIAEKVNIGKLLYKRARVEGSTLRSRDEQYQGRLRDKLEEYLPKFESGELKVLIDTV
                     LPWEEIVKAHELLEANKTMGKIICTIP"
     gene            complement(<687170..>688250)
                     /locus_tag="MYCTH_2059010"
                     /db_xref="GeneID:11511848"
     mRNA            complement(join(<687170..687982,688056..>688250))
                     /locus_tag="MYCTH_2059010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661121.1"
                     /db_xref="GeneID:11511848"
     CDS             complement(join(687170..687982,688056..688250))
                     /locus_tag="MYCTH_2059010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661169.1"
                     /db_xref="GeneID:11511848"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="JGIDB:Spoth2_2059010"
                     /translation="MTNSELATRGPESDAQETDTPSPSDSPALADAPAHPAMTEHCTS
                     DRPLPAGQTSTGELTKLNDVDVYISKPADYPHTPSRLLLLLTGGTGLHSVNNQIQADR
                     FASEGYVVVMPDLFAGDPAPNSSLTAADLAGVSTTAAQSSSSSSSSLLDVFKVKALET
                     AKSFLIDMWLARHTEEKVMPILEKVLEGARDEFADAVSHGGGVYAVGYCFGARYVLLL
                     AAERPARRQGQRRGDDEEANRPATVPPQIKAGALAHATLVSKQDFVGLKAPLSVVCVE
                     DDPVFPDEVRIAGEQYMTENGVEHEVQVYPGVPHGECKPAKQPPPPGARGAECGRRNR
                     C"
     gene            <689148..>690629
                     /locus_tag="MYCTH_2116588"
                     /db_xref="GeneID:11511849"
     mRNA            <689148..>690629
                     /locus_tag="MYCTH_2116588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661122.1"
                     /db_xref="GeneID:11511849"
     CDS             689148..690629
                     /locus_tag="MYCTH_2116588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661170.1"
                     /db_xref="GeneID:11511849"
                     /db_xref="JGIDB:Spoth2_2116588"
                     /translation="MPGVLTRNTRVPRGHSDSSTPATGTTKCNKLSKAQAAGKQSQTS
                     APFTPRSSNIEIVLPSRKRKVQDAAECKSKKIRFEPETSIAPATPVSRKRKGARFAEP
                     DAAAAPSTPNCAAPTPSSRRKRRFESDETSQAEELLERLNLQSSPVSKRSKTTVHRRA
                     PQNDFDLPNELLDLLDLHEAFLKTLNMQYAHNGTTSPIDLRTLYTSVTRAWGKRHVML
                     DDIQRCVGVLSWTPTRTMGAQPTAPFYLTDYGRDKICIEFHPSAERGPLREPKLKMDF
                     EANLRTLWLSRSNNIPPTIFIGTLPKAPLHPKNASMMNPLLAASAKTQTTLDAFKQSI
                     AEKKQQDEAAKKQAAAAAAAANGPSGGSLLDRIRLKETLASQSPQNEPTAADLQRRRA
                     LQRAADVAAVIGMLCKATVATGSGQARVSFSMAALMVRLKDSVRTPVSQEDGMLCVRL
                     LAAEVAPHWLKIVKIGGRENVVCTMGMQPTKAEVEDRVKALLG"
     gene            complement(<690822..692114)
                     /locus_tag="MYCTH_2314437"
                     /db_xref="GeneID:11511850"
     mRNA            complement(join(<690822..691563,691688..692114))
                     /locus_tag="MYCTH_2314437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661123.1"
                     /db_xref="GeneID:11511850"
     CDS             complement(join(<691243..691563,691688..691849))
                     /locus_tag="MYCTH_2314437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661171.1"
                     /db_xref="GeneID:11511850"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR013729"
                     /db_xref="JGIDB:Spoth2_2314437"
                     /translation="MSAWDTDVVKIGRNVRSGGGAPRETVVRSQSALNAAKRAGAPIV
                     TEKKYSTGNAAARPAVEGQRLTMVDRADDVVKPKTVGTVVGKAIQKARNEYQHPNGNK
                     GLTQKELATKCNTTPTIVASFERGDAAPDQKVLAAMERVLNVKLRGSDIGKPKFEKKE
                     K"
     gene            692520..694737
                     /locus_tag="MYCTH_2300262"
                     /db_xref="GeneID:11511851"
     mRNA            join(692520..693253,693307..694737)
                     /locus_tag="MYCTH_2300262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661124.1"
                     /db_xref="GeneID:11511851"
     CDS             join(692714..693253,693307..694653)
                     /locus_tag="MYCTH_2300262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661172.1"
                     /db_xref="GeneID:11511851"
                     /db_xref="InterPro:IPR010775"
                     /db_xref="JGIDB:Spoth2_2300262"
                     /translation="MVSPGAAALAALFTTVCSVLLPATASGQLVLLLAPKHSDLFVGF
                     PGHGLLWKALQAALGTSILVLLFLWSLRATGGTFEPSCCTGSEKVSLYPCRTTHSRLL
                     PKQHSFSYSYLLVGIPVSFEGNAGGMVSVRAKARPGLLSWFPIGFFGGWFTVDAGDYL
                     ERGKSELSLREKLDRYLLNQGVCPKTYPYAYLITAARFLGYHFNPVSFWYLYDARKHL
                     AAMILEVNNTFDERRMYFLTEESFSESQSDGFSTCSCGGQQSKRPSQRVSCERTFRQA
                     WPKDFHVSPFNSRKGSYTLTASDPLASVGVQGMAAPISITITLLSSKGDPKMVATLSS
                     AGDPLEPSTMTSRQKACFLASWWHVGFLTYPRILKQAAALFFRHRLRVWFRPEPLKGT
                     LSRRATATERQLEAVFRRYLQHLVEQAQVALEVKYIAAAGILLDKDVRVFTSPAAREK
                     RAEKRGTGSIAVTEELELAVLTPAFYTRFVRYQRNGLNSFLRELNEARTIWLSRPELL
                     RGLFASQKKESKPCSTNTAPSCSAGLLPPGFWELVCFRVIPYLRSGNVLGLSELDEYV
                     MQHDSERERERYGRCVLQVMLADRITLRSVAGLKVLEFVVLVYLTWWLLGFVLGWCVK
                     VSLD"
     gene            695591..696816
                     /locus_tag="MYCTH_2300265"
                     /db_xref="GeneID:11511852"
     mRNA            join(695591..696114,696243..696451,696530..696816)
                     /locus_tag="MYCTH_2300265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661125.1"
                     /db_xref="GeneID:11511852"
     CDS             join(695994..696114,696243..696451,696530..696607)
                     /locus_tag="MYCTH_2300265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661173.1"
                     /db_xref="GeneID:11511852"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Spoth2_2300265"
                     /translation="MPLTGHCLCKAVTYTADVDAPLLTGYDHCDDCQRQSGSTYSLVV
                     VVPKDKLEVKGPLKKWEGKGSSGKSVWRWFCQECGSPIAHDPDAAPEIIALKGGTLDS
                     EIKKTLKPTQEIWAVGKLPFCQEKLENVAEYMP"
     gene            699709..701424
                     /locus_tag="MYCTH_79897"
                     /db_xref="GeneID:11511853"
     mRNA            join(699709..700587,700696..701424)
                     /locus_tag="MYCTH_79897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661126.1"
                     /db_xref="GeneID:11511853"
     CDS             join(700175..700587,700696..701086)
                     /locus_tag="MYCTH_79897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661174.1"
                     /db_xref="GeneID:11511853"
                     /db_xref="InterPro:IPR013175"
                     /db_xref="JGIDB:Spoth2_79897"
                     /translation="MAPSSKNAAAAAKDRRKSSNTAGPAVTGAAASPSSSHLVTLKVP
                     PQRLRAIVDPDFVEEDTPAKQSPAAAATSGTENASDSTPNSPPAGTPASQSAVMGPPS
                     EGPKKKGVKRSAAAATNGNGEAKVRGKPGPKKKQRLEDGTIEGGRGSLAAHKLGPKAN
                     QGAINAGLRALDRSGKPCRKWSRGGFTIKTFTGVVWEIPRWTAPPKARPEESADSSTP
                     ASDSSNKENKEDNSQVKSEASNNGGDVEMQDTPSFAADNSPAPVPVAAV"
     gene            702654..706227
                     /locus_tag="MYCTH_2300271"
                     /db_xref="GeneID:11511854"
     mRNA            join(702654..703714,703794..704020,704213..704352,
                     704784..704876,704930..705644,705884..706227)
                     /locus_tag="MYCTH_2300271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661127.1"
                     /db_xref="GeneID:11511854"
     CDS             join(702771..703714,703794..704020,704213..704352,
                     704784..704876,704930..705644,705884..706083)
                     /locus_tag="MYCTH_2300271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661175.1"
                     /db_xref="GeneID:11511854"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="JGIDB:Spoth2_2300271"
                     /translation="MTNPYQQQQAGSDFDPLASSRLPPLNARRPSYASVVSGNPSGLT
                     RPTRSGGFSHLLNPSPDSEQQRQASGLYSSGMAYALNAPPVEVPGRDEAVSGGEELGE
                     DVWPARLGVSFPYFSRAFDLYMCSKDSVFPDDPVSREDIRFPSAPSIPNISSTGFLSP
                     SYLRGTIYLQKLEEKHRKRISAERDSAVSSKGGPAASSSSLSGRLTANGSSSHSSATS
                     SKISGSLHRGMAFDAAEKPIYLAEDDDAVSPLPSRWNKDDKEAALEVLGDGYEVRHTG
                     RASSEHEASAIRADHYISPSCGVYYFEITVLNGRQDKIKTPQIAIGFASKDTSTSRAP
                     GWEPDSWGYHGDDGHSFASQNVGKAYADTFGVGDTVGCLINFRLNHALFTKNGRELPI
                     AFKDVPFKDVKGKLYPIVGLKKKEDHIMANFGQRPFMFDIDGYMKRQQSMIEDEIRLA
                     DTSKLVPGLSETDLIQQLVLQFLQHDGYVETARAFAEELQAEKTALQLDPQAPVKGIS
                     IRDDEDAHNRQRIRRAVLEGDIDRAMKYTDACYPTVLRDNEQVYFRLRCRKFIEMIRK
                     EAEHNLLLEERRSGHINPKALASGDTDEEMLEASAGDFGGTSANTNGNGEDMDMAMGD
                     ADGSDDNDLAAGLSKLSQEALVYGMELRAEFAADQDPEVARQLDEISSLFAYPNPLKV
                     KEVAHLLDGSGRVAVAEALNSAILTSLGKSSRAALETVYAQTSVLLEELRKDGGDGAF
                     VTIDNVIRQIPPTTLRPARSGSGGRGVETMGL"
     gene            complement(707153..>708403)
                     /locus_tag="MYCTH_2142789"
                     /db_xref="GeneID:11511855"
     mRNA            complement(join(707153..708068,708176..>708403))
                     /locus_tag="MYCTH_2142789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661128.1"
                     /db_xref="GeneID:11511855"
     CDS             complement(join(707295..708068,708176..708403))
                     /locus_tag="MYCTH_2142789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661176.1"
                     /db_xref="GeneID:11511855"
                     /db_xref="JGIDB:Spoth2_2142789"
                     /translation="MASIPSAAPSWRKMQIPRPLQRLFDYFPLRIYEPNELPERSQQL
                     TSGDLPTLYVFSTDSDARLGLPSFNPGCLKWQTLLRLANLDFRILPSTNHSSPTGSLP
                     FLLPPRTSPTASPAPIPASGLLSFARKNPWRPGKAADLDLGHLDADLPPRAQAYLALI
                     THSLRNAWLCALYLDPTHDALLRRLYVDPASSSRAVRAALLHQLRRAAAEQVATASSG
                     GGKIVSLAPVDSADGIDEEAVYRSARDALDALASLLRESETAWFFGTERPGSFDAALF
                     SYTHLMVEYMSEEEDTESAKGRVSLGRMVKEAGNGELAEHRERMLGVAWPEWDGYRR"
     gene            <709241..>709997
                     /locus_tag="MYCTH_2124896"
                     /db_xref="GeneID:11511856"
     mRNA            join(<709241..709407,709589..>709997)
                     /locus_tag="MYCTH_2124896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661129.1"
                     /db_xref="GeneID:11511856"
     CDS             join(709241..709407,709589..709997)
                     /locus_tag="MYCTH_2124896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661177.1"
                     /db_xref="GeneID:11511856"
                     /db_xref="JGIDB:Spoth2_2124896"
                     /translation="MAIDCYATLPSDAKTHTIPGVAQPCGEGEKRFSLTDPPGQQQAI
                     LDGVTFSGGNSGSRVSRRRTKEPEDPGLSYSVPPADATALQHLSSSKTNRSCGSLAPS
                     WAPTSTDTTHLPGPHEPLASCNPTTETCFNARQLGCSGARHGHGNGGQQWKVSLRRSQ
                     SLSVPSENLLADTLRRRPGYDRCPLQVQVLI"
     gene            710985..712603
                     /locus_tag="MYCTH_2300272"
                     /db_xref="GeneID:11511857"
     mRNA            join(710985..711506,712134..712603)
                     /locus_tag="MYCTH_2300272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661130.1"
                     /db_xref="GeneID:11511857"
     CDS             712230..712469
                     /locus_tag="MYCTH_2300272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661178.1"
                     /db_xref="GeneID:11511857"
                     /db_xref="JGIDB:Spoth2_2300272"
                     /translation="MDAQPTFNGTQPSAMSSSSSTQPSPTQPSPTGNVVPPAPRPIKA
                     PSTEAFLKDFTLVAEAAKRAQMAVLMRDFESVGLN"
     gene            complement(712837..714630)
                     /locus_tag="MYCTH_2300274"
                     /db_xref="GeneID:11511858"
     mRNA            complement(join(712837..713788,714070..714319,
                     714448..714630))
                     /locus_tag="MYCTH_2300274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661131.1"
                     /db_xref="GeneID:11511858"
     CDS             complement(join(713205..713788,714070..714319,
                     714448..714477))
                     /locus_tag="MYCTH_2300274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661179.1"
                     /db_xref="GeneID:11511858"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2300274"
                     /translation="MDIQSLYSVKDKVVLVTGGAKGIGRMISEAFVVNGAKVYIASRD
                     AAACKAACAELNALPNVRPGSAIALPADLSSLAECQRLAAELSAREKKLHVLVNNSGA
                     TWGEAYDSYPDSAWTKLLTLNLQRVFTLTQLLTPLLEAAGQASKTAGTEGRGEDEGEG
                     EGEGVVTDPGRIIHIGSIDGLRVPQLPTFAYSATKAGLHHLSRHLAVALGPRGVTSNT
                     LACGPFPSKMMAATLRDFGDAIRAANPLGRIGTPADAAGACLFLASRAGAFVNGATIA
                     LDGGVSLVSKI"
     gene            complement(724043..>727606)
                     /locus_tag="MYCTH_79885"
                     /db_xref="GeneID:11511859"
     mRNA            complement(join(724043..724726,724893..727409,
                     727535..>727606))
                     /locus_tag="MYCTH_79885"
                     /product="glycosyltransferase family 2 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003661132.1"
                     /db_xref="GeneID:11511859"
     CDS             complement(join(724589..724726,724893..727409,
                     727535..727606))
                     /locus_tag="MYCTH_79885"
                     /note="CAZy_ID 267837"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003661180.1"
                     /db_xref="GeneID:11511859"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="JGIDB:Spoth2_79885"
                     /translation="MAYHSQGDGYEGHPMQDLPAHHGQHEDDSHAALLNQNQAYDQDR
                     LGAHTPPVRPVSAYSLTESYAPGAQLTRPGIGATSTPPPHGGTEYGGASGYYPPQFSA
                     DPAYRMSSVDSDESWVRRQQPNVAPTGGLKRYATRKVKLVQGSVLSIDYPVPSAIRNA
                     VQPRYRDEEGNNEEFLKMRYTAATCDPNDFTLKNGYDLRPRMYNRHTELLIAITYYNE
                     DKVLLARTLHSVMQNIRDIVNLKKSSFWNRGGPAWQKIVVCLVFDGIEKADKNVLDVL
                     ATIGVYQDGVVKKDVDGKETVAHIFEYTTQLSVTPNQQLIRPVDDGPNTLPPVQFIFC
                     LKQRNSKKINSHRWLFNAFGRILNPEVCILLDAGTKPSPKSLLALWEGFYNDKDLGGA
                     CGEIHAMLGKGGKKLLNPLVAVQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRFRA
                     IMGRPLEQYFHGDHTLSKILGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGQKWHLS
                     YIKAAKGETDVPEGAPEFISQRRRWLNGSFAASLYSLMHFGRMYKSGHNIVRMFFFHI
                     QLIYNILNVIFTWFSLSSYWLTTSVIMDLVGTPVPASETSSEHHAWPFGDSATPFINA
                     VLKYIYLAFVILQFILALGNRPKGSKWTYITSYIVFAIIQGYIIVLSAYLVAQAFKTP
                     LSEQIQVDSAENALKSLFGGTGAAGVILVALITIYGLYFLASFMYLDPWHMFHSYPHY
                     MLLMSTYINILMVYAFNNWHDVSWGTKGADKNDALPSAQVSKGEKDEVVVEEIDKPQE
                     DIDQMFEQTVRRALAPFKEEEKPEPKDLEDSYKSFRTMLVVSWLFSNCLLAVVITSDN
                     FNSFGIGHSATKRTAWFFKFLLFATAALSIVRFIGFLWFLGRTGIMCCFARR"
     gene            complement(742445..743271)
                     /locus_tag="MYCTH_2300282"
                     /db_xref="GeneID:11511860"
     mRNA            complement(742445..743271)
                     /locus_tag="MYCTH_2300282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661133.1"
                     /db_xref="GeneID:11511860"
     CDS             complement(742555..743094)
                     /locus_tag="MYCTH_2300282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661181.1"
                     /db_xref="GeneID:11511860"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2300282"
                     /translation="MLEVLDTAGQEEYTALRDQWIRDGEGFVLVYSISSRSSFTRIKR
                     FHHQIQRVKESTASSPSYPGSPISAATPSAPVPIMLVGNKSDRIAEREVSTQEGHALA
                     RELGCEFVEASAKNYINVDKAFYDVVRILRRQRQAAAQPVSPTGSSKHESSRRTDSGI
                     QSEKGRHRRERRRGGCVIL"
     gene            complement(<747146..>753492)
                     /locus_tag="MYCTH_2124903"
                     /db_xref="GeneID:11511861"
     mRNA            complement(join(<747146..747235,747351..747656,
                     750009..750101,752697..752864,753481..>753492))
                     /locus_tag="MYCTH_2124903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661134.1"
                     /db_xref="GeneID:11511861"
     CDS             complement(join(747146..747235,747351..747656,
                     750009..750101,752697..752864,753481..753492))
                     /locus_tag="MYCTH_2124903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661182.1"
                     /db_xref="GeneID:11511861"
                     /db_xref="JGIDB:Spoth2_2124903"
                     /translation="MGDDELSRHPRNRRTKTRANDRRTLPGSHSHVSLFSLQPSAKEG
                     EAAQDWLRSLHARDEHVPSNGDSYRTLAVLSAKRTDSPETTVIWGENPPPRLPHPLFI
                     PPQARHGSHTRKVKNEGRREGGTEGRFRLCPVPPVETATARYTHSFKASGPGLNGRTT
                     VPTLPPPPQEGSRQRTPQRPSHHREPRFDMAERSRLNGNGRPIPAGLSIVCPSLEAAC
                     LENI"
     gene            754185..758714
                     /locus_tag="MYCTH_2300285"
                     /db_xref="GeneID:11511862"
     mRNA            join(754185..757540,757611..758714)
                     /locus_tag="MYCTH_2300285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661135.1"
                     /db_xref="GeneID:11511862"
     CDS             join(754426..757540,757611..758590)
                     /locus_tag="MYCTH_2300285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661183.1"
                     /db_xref="GeneID:11511862"
                     /db_xref="JGIDB:Spoth2_2300285"
                     /translation="MNVWETEDESAGPTLSRAVSRSSRKSKRSITPPGKKGKSRSPPP
                     VPGDKSERGSKRSSRDVTNDENISILDPRRFTPTLHASLVSEILSLRRDQEEKLKIIE
                     SLESSLHAAREESEFLQASLLATGKESRSLKRQLSLLEGGTSSALGELAKERDEAIES
                     AAEARKRLEAVQKKLRSQEEDSERVHGQWAKEKEEWEDEKRKYERRIHVAETRLKAVL
                     EEVAAFQAAQAQGQNGQNGQNGQNGPANGAESDGEDGSVKDNNDAASVRSMSLTNSVR
                     FSVANSILKATGNSLADELGFDGGYDDDSDYGGRDSVLSKGGHMRNFSRDSLAVKTHQ
                     RHWSTDSLVRPGSVARGKLAFNRAALERLEDGMVKEDDESLPPAPPKVSYVDTGIQFS
                     PPPSPKIVPVKPPAPDPASFVQRHERVCDVDSPPRADQEIEANQRRKRVSATQPLAIR
                     MPGIHSLMVNGSSQTVEEPLSPPRTPKSPLQEAAPSPRPKTPPPPPPRPVMVSASTQT
                     EEAPPPPPPPLDPSLLALPMPVPSISIIPPTSRPTTPREPLLPQLTKDFGCQVSLQTT
                     ISVTSTSMQTEEIRVDKRLDKLPPHLHPSAITSRPSSPAGGAAENATEDTRQFTPVPG
                     TLPPRNPRRLTSKRSLNDMPSSPPIAPSILEEETSDLYPGNNDNGPLSSQRAPMRRPP
                     RISSLFAGFDGNSSDEADEFMDAELSDSEYRTALSAPNPRSGSSLGGKRNSIGTVTSS
                     ENTFSLKASNRLFGRGSEDGEAFDYGSYPTHDMRDSSFGRRVSRRGGRPSAFGTKSSV
                     MRRAVMIQNGIASHQRARSPSITDPREPPFPIPTRASSRKPPISISAPSDGRASPSKG
                     SDAWSRRGSGRSHYRASSIRKVRSAAVMPRSHRNRRRGSRSPPPVSLSTEAPESPGLP
                     PLPGNDITAPRTRDGYMAPRDRSHRSQPSTTTANTADTGAASHGGSNQTPTVVDAIAQ
                     TMVGEWMFKYVRRRKSFGVADAKGGDDSSNDRHKRWVWLAPYERSILWSSKQPTSGSA
                     LLGKSGRKLAIQSVLDVKDDNPPPKGVASIFNRSILILTPQRALKFTATSAERHYIWL
                     TSLSFLAHSNQAIPETLMVPQPKPLAEQYELPKPKRRAIRDSIRLTKAKAGVKSDPVT
                     AESQPDSAPPAIPTFRPRPVPEVYSHPAHARDLSRDTAEPPPIPRFSDRTNHAPVVHG
                     RKRSNTGGHTGPPISFRGFSGTAGSGGYHTASNSTAGNSVMTAGSSDIYSNTGASAIT
                     GSSAMTWATPSVRTSEASSRPSGPGTNNFFDAIGTVRMEAFISPLTWSDTPPYELDDY
                     RLMARRRSKELRRRTSRSSRQSRTTRATDDLDEWYLRDDPFRGF"
     gene            759401..760810
                     /locus_tag="MYCTH_2300287"
                     /db_xref="GeneID:11511863"
     mRNA            759401..760810
                     /locus_tag="MYCTH_2300287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661136.1"
                     /db_xref="GeneID:11511863"
     CDS             759493..760647
                     /locus_tag="MYCTH_2300287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661184.1"
                     /db_xref="GeneID:11511863"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Spoth2_2300287"
                     /translation="MEETLEQIQERHRKEQRDLQSRITNKKKNATKKTRKFVNEECDR
                     LERELKERQDEELRKFRGEADGPEDLLDGSNDDDEQSQEHQTQPPRPPIATADDLSNK
                     LESTTLTSLQETPQSQSPPSQQQQQQKQQQQQPRQKRNRQKERLARRAAEQEAAAAAA
                     AAEAASMPDRRELERRAMQKEFAAHALREHEIAPDGHCLFSAVADQLQANDIPLTAGR
                     TTTTTTTAAAAAAAEVVQADKNTNGGPDPDQEPKQPPSSLPPYRVVRRAAADWIAAHR
                     DAYEGFLEEGIEQYVARIRDTAEWGGQLELSALANAYGVEIRVVQGQGRVEVVKPAEE
                     EEEEREEEEESGAGAGAAQKAGKGKTLWLAYYRHGYGLGEHYNSLRRVET"
     gene            761499..762978
                     /locus_tag="MYCTH_2300289"
                     /db_xref="GeneID:11511864"
     mRNA            join(761499..761887,761949..762048,762137..762978)
                     /locus_tag="MYCTH_2300289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661137.1"
                     /db_xref="GeneID:11511864"
     CDS             join(761867..761887,761949..762048,762137..762579)
                     /locus_tag="MYCTH_2300289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661185.1"
                     /db_xref="GeneID:11511864"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2300289"
                     /translation="MLKIWSMKKEQQKAENASDGASGGGPKKKKVTAAQLRVQKDLSE
                     LSLGSTMSTEFPDPDNILFFILYIEPDEGMYKGGRFSFTFNITPSFPHEPPKVLCREK
                     IYHPNIDLEGKVCLNILREDWKPVLNLNAVIVGLQFLFLEPNASDPLNKEAAEDLRNN
                     REGFKRNVRQAMAGGTVRGETYQKVLV"
     gene            763646..766109
                     /locus_tag="MYCTH_2133056"
                     /db_xref="GeneID:11511865"
     mRNA            join(763646..763941,764045..764076,764200..764478,
                     764573..765240,765333..766109)
                     /locus_tag="MYCTH_2133056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661138.1"
                     /db_xref="GeneID:11511865"
     CDS             join(763737..763941,764045..764076,764200..764478,
                     764573..765240,765333..765360)
                     /locus_tag="MYCTH_2133056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661186.1"
                     /db_xref="GeneID:11511865"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="JGIDB:Spoth2_2133056"
                     /translation="MASRSFSKALRPLARQLASPAVQQRTFVAAAAAVRASAVASRVA
                     AAPARQQVRGVKTIDFAGSKEEVYERADWPQEKLLEYFKNDTLALIGYGSQGHGQGLN
                     LRDNGLNVIIGVRKNGKSWQEAIQDGWVPGKNLFEVDEAISRGTIIMNLLSDAAQSET
                     WPAIKPQITKGKTLYFSHGFSPVFKDLTKVEVPNDVDVILVAPKGSGRTVRSLFREGR
                     GINSSFAVYQDVTGKAKEKAIALGVAIGSGYLYETTFEKEVYSDLYGERGCLMGGIHG
                     MFLAQYEVLRERGHSPSEAFNETVEEATQSLYPLIGANGMDWMFEACSTTARRGAIDW
                     TPRFKDALKPVFNQLYDSVKSGEETKRSLEYNSQPDYRERYEAEMEEIRNLEIWRAGK
                     AVRALRPENQK"
     gene            complement(<766340..767370)
                     /locus_tag="MYCTH_2133058"
                     /db_xref="GeneID:11511866"
     mRNA            complement(join(<766340..766551,766736..767370))
                     /locus_tag="MYCTH_2133058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661139.1"
                     /db_xref="GeneID:11511866"
     CDS             complement(join(<766340..766551,766736..767075))
                     /locus_tag="MYCTH_2133058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661187.1"
                     /db_xref="GeneID:11511866"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Spoth2_2133058"
                     /translation="MADPSTAPPLTRASVEAAHKLIEPYIHKTPVLTNSTLDRLASTP
                     RTEAELAGTVWAGRTPAKPVLRFWFKCENFQRVGAFKARGAFHAIERLKQEPGWAEAG
                     GREKGVVTHSSGNHAQALSLAARESGITAHIVMPSTSAAPKIAATRGYGASVTFSGPT
                     APEREAAAAAVIARTGARLVPPYD"
     gene            768248..770701
                     /locus_tag="MYCTH_2300294"
                     /db_xref="GeneID:11511867"
     mRNA            join(768248..769282,769488..770701)
                     /locus_tag="MYCTH_2300294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661140.1"
                     /db_xref="GeneID:11511867"
     CDS             join(768831..769282,769488..770619)
                     /locus_tag="MYCTH_2300294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661188.1"
                     /db_xref="GeneID:11511867"
                     /db_xref="JGIDB:Spoth2_2300294"
                     /translation="MGSLGHTVPPFPVLEDTRPDDRSLPAFMVSTTRGFLPRMDPIET
                     LPPDFDALESILQRMPVKTLSGEPGLLAHGKLGETVDRELPDLTDAIDKYKDDLPLMN
                     ALYRDYSFLASAYLLEPCHERFVRGEGYGLARDVLPANIARPIAKCAALCNFKPFMEY
                     AGSYALFNYRLVDPSKGLASDNLRLIRAFEHGLDPSSSEAGFVLVHIEMVKHSGPLVA
                     GAVACIDACSSPSSSSSSSHRRSRAELNEGLRTVLAALRRINATMETMWSRSRPADYT
                     SFRTFIFGIASQSMFPRGVLYEGVELSDDDGDYYYKDGGEEEQQQQQQQQQQDGRREG
                     GRRVAFRGESGANDSMIPLVDNLLSIPMPDTPLTEILRDFRSYRPGEHRRFLEWVARA
                     AEEGGLKAWALGLDGGEEAEGEVEDEKRETRALWIQVLNQVRDFRWRHWCFAREYIIK
                     RTSHPTATGGSPIVTWLPNQLAAVMDEMVRLYERVGGAGLGAEVEDIMELVGRQRETL
                     RKEVRKFCEERGVKEFVPA"
     gene            complement(770762..772564)
                     /locus_tag="MYCTH_2300296"
                     /db_xref="GeneID:11511868"
     mRNA            complement(join(770762..771629,771756..772564))
                     /locus_tag="MYCTH_2300296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661141.1"
                     /db_xref="GeneID:11511868"
     CDS             complement(join(770905..771629,771756..772296))
                     /locus_tag="MYCTH_2300296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661189.1"
                     /db_xref="GeneID:11511868"
                     /db_xref="JGIDB:Spoth2_2300296"
                     /translation="MPADRGAKFHHEYCAFGDHTTFAPASSRPHAPTAAAIAARSLHD
                     ADDARRLWANASAELSLRPPFALLSEPEIPEKDESIAPAWSLFRRAASALALLEKRQW
                     ACPSGTSSCSSIGFPNSCCGQDETCVEVPDTGLGPVGCCPSGATCSGGISDCADGSTA
                     CGSSIGGGCCIPGFVCMGVGCVRYSSSSSPPPAATPTTLTTTSTRIVSDPTRSTILVT
                     VTTTVTPSGPPVTSTVIETTTASSTRSGGGAGAPFRPTSSPQPSGSNTRTTGTGAYCP
                     TGFYPCLARAGGGCCQTGRDCAVTTCPPPPQQSEITTIVNGNGVTVVVPADGAATTAT
                     ATTTADGCAAGWFLCGRDAGPDAGCCPSGYECGTASCFREGAGATGASVAKELPRQSG
                     SAGEARATAGWGLVVGIGMLWGVGWGLWV"
     gene            complement(772806..775155)
                     /locus_tag="MYCTH_2300298"
                     /db_xref="GeneID:11511869"
     mRNA            complement(772806..775155)
                     /locus_tag="MYCTH_2300298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661142.1"
                     /db_xref="GeneID:11511869"
     CDS             complement(773071..774837)
                     /locus_tag="MYCTH_2300298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661190.1"
                     /db_xref="GeneID:11511869"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="JGIDB:Spoth2_2300298"
                     /translation="MSLSSLAHRAARPSLLGNPVLRLSYTALTTTRHASLSAINKGLV
                     RSEQARPQGPRPEKLSELAAGTKRMTYAERQEARKRLAEERPSFKIRKGKKDITEYPD
                     QAKPKSRQARFYDPESPFGKKSLVYQMKTGKLRDELRALEEKETESGGSSDSPFETSV
                     PRPDLRSPPRRRSARERQSVRDDDTGDVADFVAELTRSAGPNRDAPRGDVSRRREAPA
                     GAEDGDSLGRGGSSSSSRRDRGAGRREDAPRHKKEEDRDPPTITYTTAASQFLYGRSV
                     VEAALRCSRRQLYKLYIYGGANRRTRGDDSLIRTLAERRGVPVTVLGDERGLRLLNRM
                     SSSRPHNGFVLEASPLPQPPVTALGPLPDDYAGNPRYGVELGHQSAEEVAVNGRPASL
                     PAPTASHRPLVLVVDRVVDPGNLGAILRTASFLGAAAVGITRRGSAGLTPVALKASAG
                     AAESLPLFSVGSLPEFLSLSRANGWEVYAAVAGAPARKQRRHVDLRDVEEADPLRRDP
                     CVLLVGNEGEGLDRMVVKKADYEVNIPNMSAPDSGVDSLNVSVAVGLLCSAFLKGAAK
                     EMEGLGIGLGQGEEKGAKEDLW"
     gene            776855..781999
                     /locus_tag="MYCTH_2300299"
                     /db_xref="GeneID:11511870"
     mRNA            join(776855..780496,780550..780742,780865..781999)
                     /locus_tag="MYCTH_2300299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661143.1"
                     /db_xref="GeneID:11511870"
     CDS             join(776894..780496,780550..780742,780865..781784)
                     /locus_tag="MYCTH_2300299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661191.1"
                     /db_xref="GeneID:11511870"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Spoth2_2300299"
                     /translation="MQFGTKKRKRDADYTSSDEADDSSVDDDELENLRGTRRRRGLID
                     DYLEIGNGRRSTRASTRASSHLVSSEGEHGAETGRGRRLRPRASLALNQGFQYDDRDE
                     LQDSDGETNDPTFAFVQSDIVKTRRRRLRKGTATVRRSAPVSSLGGDSDIEFEPRRRS
                     SRANRNTRAMADNFLEDDDTFYVEEDRTSATPKVVGMREVFQAASYDFKEAHQTVCDS
                     CGFDERKGPLIGCQGCSNSYHKACLGVRSVRDHRVTKVAEDSFVLQCRFCVGIYKQKD
                     PRAPRHDVCQACYGKNPSCVPFSEKKTPKQEEALRIENGGVDPITPVDPKLVNNPENV
                     FFRCGRCRRAWHYEHLPHPNKSRDPVFDDPLNLRKHRLQEYQISWMCKACQDTEEEKV
                     DKLVAWRPREPRLYKKDQPITDYNEEHLEYLVKWENKSYNHCIWMPGAWVHGVVSAIM
                     RQAFVKRTFGNDSDEAVDGERQHVDSLLRWTEKEAIHDSWITPDIILDVHYAPRTREA
                     EKKYRAKSVKDKFEDDLSRIHHVIKIYVKFEGLGYDDAVWDTPPAPDTGPIYDAFCEA
                     YREFLNGRHFQSEPWKNMVARIDEFRQRDFCADIEVKQQPKGLQRGKLMQYQLDGLNW
                     MLYNFREERSVILADEMGLGKTVQVVALLSSFIQDNPRVWPFLIVVPNATCANWRREI
                     KKWAPDLRVVAYYGGRVSQRLALDYELFPNGPREMKAHVVIMSYESAKDNETRSRFGN
                     TKWAGLVVDEAQALKNDENTLYRALQALRIPFKLLLTGTPLQNNKRELFNLLQFIDPS
                     FRAEELDQQFAQITSENLPELHSLIRPYFLRRTKAEVLTFLPPMAQIILPVSMTVLQE
                     RLCKSIMQRNPELIRSVFVQGKLKANERAGLSNILMQLRKCLCHPFIYSQAIEDRGAP
                     PEVARRNLIEASSKLMLLEIMLPKLKERGHRVLLFSQFLDQLTILEDFLAGLGLRHER
                     LDGRQSSMEKQKKIDAFNAPDSDIFAMLLSTRAGGVGINLATADTVIILDPDWNPHQD
                     IQALSRAHRIGQRKKVLCFQLMTVGSAEEKILQIGRKKLALDHLLIETMDNEEDAPND
                     VESVLKHGAAALFGEGKKKETITYDSAAVDKLLDRSMIEETKTGDDKSAESAFAFARI
                     WANDEGTLAEELQEETEQTINMSVWDQILQQRAEEARREAERNMEKLGRGGRRRGAAN
                     YTGPRFEFDEAQEAAAAAESDRGSVDGDFVGSDKSEPESTDEDTVRSGESSRTNMRNP
                     GRQDSESLDARAAIKKIRDSRYSREYSREPRNPKVKGPEATTTAVLRPPPAEDTDENN
                     KALAQKPPGKRGRPRKHPEPAGQHQATTAPARAGAAGPGAGTGTASAGTLAGHPATGR
                     RNPSQNKLIRKTLPGEGIAWTVDDVKVDPGRRSSVPPPRPIIQSTTPIPVPKIPSYTP
                     IATSVASPLFSNPAAAPAAVPVHSIPPPPPPPPAPAPAGPSSIAPVEAQMQFQACFVC
                     RYTHPTTWECPEMRSEVHLRLLLDQLKSVSGPVAGEEGAGAGTVATAALVAQQRRAFV
                     LEKLRQIKAEQVAAASSGH"
     gene            <784022..>787052
                     /locus_tag="MYCTH_2108524"
                     /db_xref="GeneID:11511871"
     mRNA            join(<784022..785401,785518..785556,785742..786630,
                     786754..>787052)
                     /locus_tag="MYCTH_2108524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661144.1"
                     /db_xref="GeneID:11511871"
     CDS             join(784022..785401,785518..785556,785742..786630,
                     786754..787052)
                     /locus_tag="MYCTH_2108524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661192.1"
                     /db_xref="GeneID:11511871"
                     /db_xref="JGIDB:Spoth2_2108524"
                     /translation="MNQTKDLQTKHDPVSGSMSSSEISRSSCYTIEPIRPLAAVSETS
                     KMCKMSPTISTPPTTTRPPSPPPVEYPPTGAIRGWPPMTPSYSPARPFASESPSRCAV
                     LGAGRSAQRLNDYCAELKTLVLDDNRMSGGSQNIGNGIDVLASDDPLSSHPDLADRGG
                     VGKPEGDDRLGASTKIGTGPVDGGQTHEHGPMGAVFRRLPRFDQASRPLVSGNWRAKS
                     AAEASRPQLMTVNGVQLSPVTTGGQAQQQQQQQQQQQQQQQHPRPLFLGTTTRNPLTA
                     SANLGMATGFGQPNLTSHPPPAPVSLSTPASMGSFARGGGQGQGHGQGHGQGHGQGHH
                     SSASSGTPSSSYSSSSSSSSSPSSYYYYHHHNNNNYQHSSPGPAADGRDAMTTTFSVS
                     LPNDAVGYCFVRPDGRRTRLVPVDMLPYPLQGIPAHEAAGGERLVALPVPVGVGADGR
                     SSNCHPLMAASPPARNSGGDAIQHASLTPLFSSSLIHQTTTPGTATATTTAATSAKRM
                     KVYCDKWVHEGVCAFTQQGCKYKHEMPSDRATQHQLGLFLGYPVWWKRRQAELARAQF
                     PASGPVSVPGPGSGPGSGPGSGPGSGPGSGPGPIRDGERPCSASSSFSSSSSSSSSSS
                     QSSSSSSSSSSSSAAVASSSPSSSSPSPAGGGGLPATRWGSGSGSLPAREKLLLPPSW
                     RTPASPVDQQQHHQHQQKSPHRACPEQVLQGRNGHGLFASRTWHREEEQRHRPPGQFS
                     NNNNNSSNNSSSSNSSSSSSSAFKAACTFAFPSATTTTTNNTNTTTNTTSINNKTTSC
                     SAGAAHTTPTSPYGPIAPPPPPPPQPLPSARPNGNDKDDKDDEENNRAGGPPRQRSPL
                     TGANAQAGGQDR"
     gene            complement(<788215..>789858)
                     /locus_tag="MYCTH_48238"
                     /db_xref="GeneID:11511872"
     mRNA            complement(join(<788215..789290,789390..789591,
                     789703..>789858))
                     /locus_tag="MYCTH_48238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661145.1"
                     /db_xref="GeneID:11511872"
     CDS             complement(join(788215..789290,789390..789591,
                     789703..789858))
                     /locus_tag="MYCTH_48238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661193.1"
                     /db_xref="GeneID:11511872"
                     /db_xref="JGIDB:Spoth2_48238"
                     /translation="MDQLISVLLHFPPAGGIAGDDQYDSAAKSHSQKLDKLAASSDFN
                     DAAAQLLDHVDPAVYSISHAHLLAAVRAAKSLPQPDLLAKVAVFLNTFDARQMRYAGK
                     TLAGILDWLVSGDLFPVTLLRLDPTGSVLTSYHVALVKLAFTTDNVEPALPLLERNIV
                     FYPGAKGLQETRRLGSLDLPPASYMTVETRLTKQLSSSDVLQYDLLRGLCFIQRRAWA
                     QAFDALERVVTYPAKDSHSCSKIMVEAHNKWILVGLLLNGKTPMLPSYTAPGAQKTFA
                     SLGKPYHSIGKAFEESTAERLKTEFEGLGPQFFSEENNLSLMRLVLQHYQRWQVINLR
                     NIYTTVSLEQIRARTQSAETAAPLATEAEVERLVKDMIDEGMLRGAIERPIDGGPAYL
                     VFHEPNEELSEAEFAQRMLRTAQRLKEVEPLVRATNERLGTSRDYVRYLTGQQKKGGK
                     DAQRDYGSSFVNQVEDEDLMTGVVAAY"
     gene            complement(790277..792929)
                     /locus_tag="MYCTH_2300304"
                     /db_xref="GeneID:11511873"
     mRNA            complement(join(790277..790755,790821..792278,
                     792344..792604,792678..792929))
                     /locus_tag="MYCTH_2300304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661146.1"
                     /db_xref="GeneID:11511873"
     CDS             complement(join(790665..790755,790821..792278,
                     792344..792604,792678..792712))
                     /locus_tag="MYCTH_2300304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661194.1"
                     /db_xref="GeneID:11511873"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="JGIDB:Spoth2_2300304"
                     /translation="MAEAEITQGAIEAIFCDRERAAVQFPVPVLQCLHIKFLENKNPG
                     VPGPERYRIVLSDIRNYVQCMLATQANRVVHDGLLQKGSIVRVKQYQAQSVKGKSILI
                     ILDLDVMTHLGTPDKIGDPKLMEAAPSEQQQNTTIGGAGFYGGAKSEPAAVHETKPQV
                     QRQVASRTGGGGGSGGHAASTIYPIEAISPYANKWTIKVRVTSKSDIRTWHKTHSEGK
                     LFSVNLLDESGEIRATAFNQEVDQFYDLLQEGSVYYISTPCKVQLAKKQFSNLANDYE
                     LMLESGTVIERADDQSSVPQVRFNFCTIQELQGVEKDATVDVIGVLKEVNELEQITSK
                     TTQKPYDKRELTLVDDTGYSVRVTIWGKTAREFDASPESVIACKGTRVSDFGGRSLSL
                     LSSGTMAIDPDIPEAHKLKGWYEAQGRNNTFATHSNLSSVGAATGRKDDAKWIAQIKN
                     ENLGVDKTDYFTVKGTIVHMRQENFAYPACPSESCNKKVTDMGDGTWRCEKCNITHDR
                     PQYRYIMSVCISDHTGNVWISCFDEQARLIMGKTADEMMELREQDQAAFEAAFDAANC
                     RKMSFRCRAKMETFAEQPRVRISVWNAAPLDYKSEAHRLAELIKEMSV"
     gene            793459..794956
                     /locus_tag="MYCTH_2300308"
                     /db_xref="GeneID:11511874"
     mRNA            join(793459..794222,794329..794389,794468..794956)
                     /locus_tag="MYCTH_2300308"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661147.1"
                     /db_xref="GeneID:11511874"
     CDS             join(793541..794222,794329..794389,794468..794804)
                     /locus_tag="MYCTH_2300308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661195.1"
                     /db_xref="GeneID:11511874"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="JGIDB:Spoth2_2300308"
                     /translation="MPPPIIDSHIHLYPSSEVSSLAWCTPDHPLAGQRSVSEFLAAAT
                     TGSSSPADPSGGGSGGSGGGGGGGSLAGFVVVEVDRKNDGSRDWAGPLQEVAWMRRLV
                     TGQPRPGEGHSAEDARLCLGLVPWAPVASGPAELGQYLEEAEKEAGPETWRRVKGFRY
                     LLQDKENGVGLEEGFIEGLKLLGRKGFVFEVGIDQHRRGRVQLEQAVEMIDRAHEGVE
                     EEDKVVFVLNHLCKPDLTIINQNDPSYVAWRTAMFTLSKCHKTYMKLSGCFSELPDKL
                     KERSAEDIFAAIMPWLAVVVAAFGPSRIMFGSDWPVCTVGVGEDAWKKWHKVVDMVCD
                     LAGLSERDQEMLWSGTAKQAYKLEI"
     gene            799975..800609
                     /locus_tag="MYCTH_2300311"
                     /db_xref="GeneID:11511875"
     mRNA            join(799975..800106,800180..800609)
                     /locus_tag="MYCTH_2300311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661148.1"
                     /db_xref="GeneID:11511875"
     CDS             800291..800536
                     /locus_tag="MYCTH_2300311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661196.1"
                     /db_xref="GeneID:11511875"
                     /db_xref="JGIDB:Spoth2_2300311"
                     /translation="MPSQVATTPLSAPIPIPPPRRNLGLITTQELFASLNATLASKSD
                     ELVTPVRHIQEHDYSVPAPPPPSPVSFRDHWPATMRH"
     gene            complement(802384..803377)
                     /locus_tag="MYCTH_2300312"
                     /db_xref="GeneID:11511876"
     mRNA            complement(join(802384..802800,803014..803377))
                     /locus_tag="MYCTH_2300312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661149.1"
                     /db_xref="GeneID:11511876"
     CDS             complement(join(802643..802800,803014..803107))
                     /locus_tag="MYCTH_2300312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661197.1"
                     /db_xref="GeneID:11511876"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Spoth2_2300312"
                     /translation="MSKQITKAEVAQHKDEKSMYIIIDDGVYDVAGFLDDHPGGAKIL
                     KRMAGKDATKQFWKYHGKSVLEKYGPKLKVGTLKEEAKL"
     gene            complement(803559..805523)
                     /locus_tag="MYCTH_2300313"
                     /db_xref="GeneID:11511877"
     mRNA            complement(803559..805523)
                     /locus_tag="MYCTH_2300313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661150.1"
                     /db_xref="GeneID:11511877"
     CDS             complement(803958..805325)
                     /locus_tag="MYCTH_2300313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661198.1"
                     /db_xref="GeneID:11511877"
                     /db_xref="JGIDB:Spoth2_2300313"
                     /translation="MMASLKRIIAGALCLILLSIGPVRCDKADAETIKTDDPDITMLT
                     GTRSDATESSTDVPTGIYHTPSSRETDATTSLPTGRGHLTESDTEATSSETVTYITGS
                     HASSSTTTSDKKTSSTTSTSTAPPQPTNTRPCNNYPELCDRKYGNVTQVGCHNSPFVR
                     SGSAAANQQFPVVDQLNDGVRFLQAQIQWPVNGTVPHFCHTSCDLLDAGPITDWLRQV
                     KDWVASHPYDVVTILLGNGNYSTPDKYAPYIEESGITKYAFTPGLGLMTVDDWPTLGQ
                     LILSGQRVIMFLDYMANQTAYPWLLDEFAYMWETPFDPVDDAFPCIVQRPPGLPQPDA
                     KRRLYLMNHNLNAEVSLLGQSLLVPAVSRLNVTNAAQGPGSLGMAANNCRTDWGRAPN
                     VLNVDYYNYGNYPGSVFEVAARMNNVSWTRRPCCGPDSSAAARMEVARAVAWMGLAWA
                     VWMTV"
     gene            806534..>808060
                     /locus_tag="MYCTH_2089819"
                     /db_xref="GeneID:11511878"
     mRNA            join(806534..807234,807353..>808060)
                     /locus_tag="MYCTH_2089819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661151.1"
                     /db_xref="GeneID:11511878"
     CDS             join(807034..807234,807353..808060)
                     /locus_tag="MYCTH_2089819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661199.1"
                     /db_xref="GeneID:11511878"
                     /db_xref="JGIDB:Spoth2_2089819"
                     /translation="MGLPAVLRSRLNTSSEKTDPSTPSTPISKEHVLESNDAGFKRAT
                     RMRRNFALSASFSYVLAWIFLVLVLVGNTYPRPVLSQTYFFKLDLTDIIPTSVPNASL
                     INSIAQSIGLHDFYQVGLWNFCEGYVGVGITYCSPPRTLYWFNPVEVLTNELLSGATI
                     ALPTQVVTILSVLRITSQIMFGFFLTAALLAFLMIFVSPLAVASRWWSLPLAVASFVE
                     MLLLIAASVVGTAISVAFKYAAEAQSELNIHAEVGPRMFIFMWLATGFSIWAFAAHSG
                     MGCCCTSRRDLRTGRRVIRNGRGVRF"
     gene            complement(808308..810689)
                     /locus_tag="MYCTH_2314451"
                     /db_xref="GeneID:11511879"
     mRNA            complement(808308..810689)
                     /locus_tag="MYCTH_2314451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661152.1"
                     /db_xref="GeneID:11511879"
     CDS             complement(809568..810404)
                     /locus_tag="MYCTH_2314451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661200.1"
                     /db_xref="GeneID:11511879"
                     /db_xref="JGIDB:Spoth2_2314451"
                     /translation="MSAIQLSFSLRVSSGVKTVHLLGSWDNYTGQLPLSKDKSSSKGT
                     WKGTFRFQQSTLQPGQRYWYYYIIDGYHVSHNPSVDSTVEPTTGRALNILDVPKVKSS
                     SSSKSSSRKSTSSSSCRSSRASISSDIPKGRPLSISQIKAPKPVSPNATRHILDNDFD
                     EEELSSRFASTGIYDDDYYYDDEDVITDFGAPGSPVSSVGSSLSYHSDSSGSSGYSTP
                     ASECSSCTCERYGITRKGERVRLDCGGSRCAYDDSSCSSSEDEAEYIERSSRRNGIVV
                     RA"
     gene            812881..814341
                     /locus_tag="MYCTH_2300317"
                     /db_xref="GeneID:11511880"
     mRNA            join(812881..813271,813343..813602,813750..814341)
                     /locus_tag="MYCTH_2300317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661153.1"
                     /db_xref="GeneID:11511880"
     CDS             join(813385..813602,813750..814176)
                     /locus_tag="MYCTH_2300317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661201.1"
                     /db_xref="GeneID:11511880"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="JGIDB:Spoth2_2300317"
                     /translation="MDAFPDDTLVQAITAHVSAYMQNYDASHSWDHIERVVAMAHHIY
                     AHSDPAFRSTLDLRTIHLAALLHDVGDRKYLKPGEDPTTQVQTLLLSHSCPPDLAARV
                     QTICSAVSYSTERADPERVASLVATHPELAVVQDADRLDAIGAVGIGRMFTYGGARTA
                     RSMAGTMEHLDEKLVRLEGMMKTKVGRAVAKVRTERLIVFRGWWDEETGLAGRQ"
     gene            complement(814678..814768)
                     /locus_tag="MYCTH_t77"
                     /db_xref="GeneID:11511881"
     tRNA            complement(814678..814768)
                     /locus_tag="MYCTH_t77"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:complement(814734..814736),aa:Pro,seq:agg)
                     /db_xref="GeneID:11511881"
     gene            <816937..>820575
                     /locus_tag="MYCTH_107186"
                     /db_xref="GeneID:11512526"
     mRNA            <816937..>820575
                     /locus_tag="MYCTH_107186"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661154.1"
                     /db_xref="GeneID:11512526"
     CDS             816937..820575
                     /locus_tag="MYCTH_107186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661202.1"
                     /db_xref="GeneID:11512526"
                     /db_xref="JGIDB:Spoth2_107186"
                     /translation="MGAPHAKFALEPDPDLDGLGNHAPMFKKHKVLPHPRKDELQRSG
                     PLRYGRKSEASLPRNSALPAASPSGRHHRASRQARGPEPPPTPPAHSRTSSASHPANP
                     STPQYADTPLGSTDSVEPRPLATPNQQTPPTPNLTPDQTPPGPPVGQASRGPLLNVRN
                     SSRVTADSRDDSFTTAREDPYSSDNNNDDGRSTLRPSSPSARTSQSTVRQVGRVTRSV
                     SQPVGLGLGFEPRPTEDSKPRAAQEFAKFDGDWTNGQAGASEADRKREREWDSGLMKN
                     VTVRKRRPARPTETHDPEVVDDRAVTPTNAARALRSVPLEESPIVCPSRRIASDRYPA
                     PRVAGPHSESSSSVDVKRSSVISTKSNVSATVEAMVVETAPQRRKTLRHVKKQSTLRD
                     SGSEMSPASSAPTSVSPAANGQRQPLGAAAPIAGENVRESYASTTTNNAISSRKARRS
                     VWDSGGVPVVVIPERRSSVRSNGKPPSLRSTSSRRTWSLGSAPVSQPSGSKEHVPIFE
                     RPGRRGRAYSESDGSRPGDQRTMDSPPVIPTRSSSLSAPTSRNASRTGSLTAESLRNH
                     GILQAQQAHRALQEASWKLDQRHNNPRPAAGDEQQSGREVHRPLASVETESRQPVVLA
                     ERAPRREKQSELDGSPALALQDSHSTPKENGALGVERDEDPFFGKRLSVQNTPLSVAS
                     AETTTTSHAEVSEAMAVNIYPHQSKSVVLVNHSAKPSESSSLEQQHKSSSLDTPIARA
                     SGERADALSTPPPLQPPVNDVDSPLRNPRAPPKPPAINFIPATPSGLTPTSEKQKQLG
                     NYYEMTAEKPKRGMSLLKRALTGRTPSDYGPSPARPVGILTRTFSLSRNVRRRNERPG
                     LRRRSTVDLVPPDETRLHPHWRPAYVQDEPCDCPSCREREEADYDYDDRDRDRDRNRV
                     RVGEDEEEEEHGRTYRYPPIDNRPARSSPPSFPSRVTPRRRLSERIKRTFAILPLQNG
                     YEDDDEDGDIFGGYDRSFPATAPDAPDRRTIRRTPSGNLRVMKVRRSMESLTGRRGTP
                     PAAAAGPAVVGGDSQRRGRTFERGYTRLWRSLSRRARSAVRRRGSLGGGIGGGYAGPT
                     AAESRDKDKDQRERRHGGGRGSSNDGRGGGGGGATTAGFLPSLGDRINIPRRLSERRR
                     ERRTEELRGKISGPREVRDGVGDVIRRNSWRDRDALYVMEQQRERRLMLLQQRQQQRQ
                     QQQGERRG"
     gene            complement(<822273..>822536)
                     /locus_tag="MYCTH_2048966"
                     /db_xref="GeneID:11511882"
     mRNA            complement(join(<822273..822331,822431..>822536))
                     /locus_tag="MYCTH_2048966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661155.1"
                     /db_xref="GeneID:11511882"
     CDS             complement(join(<822273..822331,822431..>822536))
                     /locus_tag="MYCTH_2048966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661203.1"
                     /db_xref="GeneID:11511882"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="JGIDB:Spoth2_2048966"
                     /translation="FCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGHEKAQS
                     VIDSITSSYAA"
     gene            823070..824165
                     /locus_tag="MYCTH_2089827"
                     /db_xref="GeneID:11511883"
     mRNA            join(823070..823316,823427..823550,823634..824165)
                     /locus_tag="MYCTH_2089827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661156.1"
                     /db_xref="GeneID:11511883"
     CDS             join(823101..823316,823427..823550,823634..823956)
                     /locus_tag="MYCTH_2089827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661204.1"
                     /db_xref="GeneID:11511883"
                     /db_xref="JGIDB:Spoth2_2089827"
                     /translation="MARLRSLLQQVCSILLLLAVGSQALKFDIQAGSGHDKHSRRCIR
                     NFVSKDTLVVVTAIVDGYRGDGMQLNMHITDATGNEYGKPKDIAGEQRTVFTSHADAP
                     FDVCFENILTGSRYVEHPFRHIELDIDIGADAKDWSAIQATEKLKPVETELRRIEEMV
                     AEIVAEMDYLRAREQTLRDTNESTNSRVKWFGLGTTFLLIALWAWQIMYLRAYFRSKH
                     LI"
     gene            824411..825547
                     /locus_tag="MYCTH_2300328"
                     /db_xref="GeneID:11511884"
     mRNA            824411..825547
                     /locus_tag="MYCTH_2300328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661157.1"
                     /db_xref="GeneID:11511884"
     CDS             824649..825434
                     /locus_tag="MYCTH_2300328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661205.1"
                     /db_xref="GeneID:11511884"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="JGIDB:Spoth2_2300328"
                     /translation="MASLRPATRAVTRARPSLASAVRLLHPNRFESSSSSSSSSPSQQ
                     TPAEDLQVGELQGASFRIEPLRRVGEDPATMRARLLCMPPLPSRFPVPRPDAHIGGRR
                     EREREREREEKKHGKLTQFRGTDQSRKRGTLESDLLLSTFASAHLATMTPAQLAEYDR
                     FLDENDWDIYYWATQDANAAQSQQQQQQQQQQQQPPQQPEQSPRPGEWAQTVGTFKPA
                     YRPVPARWRDSEILRMLRAHVESRRGAGKGGMGFMPPLEEYKL"
     gene            complement(826136..828260)
                     /locus_tag="MYCTH_2300329"
                     /db_xref="GeneID:11511885"
     mRNA            complement(join(826136..826604,826689..826860,
                     826960..828260))
                     /locus_tag="MYCTH_2300329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661158.1"
                     /db_xref="GeneID:11511885"
     CDS             complement(join(826172..826604,826689..826860,
                     826960..828046))
                     /locus_tag="MYCTH_2300329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661206.1"
                     /db_xref="GeneID:11511885"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="JGIDB:Spoth2_2300329"
                     /translation="MSNQPERRQSKRLAGTSLPLLPSRPLPSGQEAEPTTRTRGRKRK
                     DAAAAAAAAAAPTAGGGADADVSPSSAAAAVYDEQDGDFLFTRGPKRAKTASVPVDDE
                     LGEDPAPAPVKRSVGKPPKTGPRRRASPPAPAAAPAAQPMPTRSRSAAATAPAPAPEP
                     APAAAPTTRRISKRKPSLDKTPPPAEDPVVRKPKSRRKARDSTAEKRPQQRRTRAGQV
                     NGTHRGAEEEERGEYGDEQPPSPGRNDGSTPSPSAAQPQSQLIALPLSDTPIINRNKE
                     FRKKGGANGGRRSSLGMRGRRASSLIDNGHTALPHREVNPAEFYKYISSEGLSEPRRM
                     KQLLVWCGERALSEKPPHGKPGSSAILGARAIQDQLLKDFGARSEFSDWFSREDAPKP
                     PIPVVLQPNPRNVDYDAKIAELEARIERLKAQKAAWQSIAAPLPVVPPLYPDPDPRKA
                     PLPDPALLSPSEASILSALTNPDTAFSSFKRQLRSRLQNAQAALEFRVDRLADSAHKL
                     DARVATGGREADAVLALSAARLREREERERRAVGAGAVSVMEVLRSLGRILPEGG"
     gene            complement(830176..832218)
                     /locus_tag="MYCTH_2300330"
                     /db_xref="GeneID:11511886"
     mRNA            complement(join(830176..831802,831982..832218))
                     /locus_tag="MYCTH_2300330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661159.1"
                     /db_xref="GeneID:11511886"
     CDS             complement(join(830337..831802,831982..832063))
                     /locus_tag="MYCTH_2300330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661207.1"
                     /db_xref="GeneID:11511886"
                     /db_xref="JGIDB:Spoth2_2300330"
                     /translation="MGPPTGATGRGASQSPKQSSKQSPSQQDTQSDSKRDTAVKADEP
                     TDTEPAKPLAPPPRPNQQHQGSNSPDYFGNAPAGSLSLEPNPFEQSFSGAPPETPGGT
                     KLPSVAALTSPSSLLPGNTPFAWGGGSLRTGPLSPAMLSGPTNDYFSDTHHIRGSFPT
                     PNESSLRTGLTPGGSGSMFPAPSPTTQAMFGLAGGPSATPGTLDFHRTALSAAAAKRE
                     QAQAHQQQAPPAAPTSQPLEMSNGAQAPKTESKAPTGPFDPHDNDAANGLFLLAQGRN
                     SAQPSSSQQYPPVPPAQVQSQPTTSAPAAQPLNTSPQMNGAPSLTGSSVRGTSEVSQG
                     SEESETARPNTRTRGKRNSGGAAPNSRRKAEETTATKAPANKKQRSNGGASISSVDMD
                     HSEEERHEKIGKEENNNNNNSNSNNNNNNNNNNNNNNNNNSGPKAKMTDEEKRKNFLE
                     RNRCARSTLSGRTTTMALTGFTEWLRSSAVSGRSSGLPTFSPRWRCFLLRTRHSPSKL
                     PNSARRW"
     STS             830979..831987
                     /standard_name="D1S3689"
                     /db_xref="UniSTS:474267"
     gene            <832375..>833848
                     /locus_tag="MYCTH_93272"
                     /db_xref="GeneID:11511887"
     mRNA            join(<832375..832585,832778..832956,833027..833153,
                     833268..833420,833526..>833848)
                     /locus_tag="MYCTH_93272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661160.1"
                     /db_xref="GeneID:11511887"
     CDS             join(832375..832585,832778..832956,833027..833153,
                     833268..833420,833526..833848)
                     /locus_tag="MYCTH_93272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661208.1"
                     /db_xref="GeneID:11511887"
                     /db_xref="JGIDB:Spoth2_93272"
                     /translation="MDSPVGLGSVGEPVAANQQGECREGLQDRANPRKHRVQPDGKNK
                     PAAGHSGLIAAICSDLQPKGLDAMTEGSQADSNGNTGGPVMISFISKLFWLHRLLAVL
                     TPVLHEQLGHCTHEQDHGIRRALWGSSTNTGDSPLHLWSLLALTDRAAVPGVTATSTT
                     KSRNTLAYLAPAESYRGDGMLTSRAAHHSFGLICGSAPLPARWPGSLSGSGGERSSQQ
                     VSETLDSIKPPVGPERKVDLKECASSPLYPVVDGLLLGRGGKGNRQGESTRAKAGGVC
                     ACVLVWGARGELSRTVESGRAGRVWNQEANRRVWSASPGMMIASGTLCNLAFPT"
     gene            complement(837160..842524)
                     /locus_tag="MYCTH_2300332"
                     /db_xref="GeneID:11511888"
     mRNA            complement(837160..842524)
                     /locus_tag="MYCTH_2300332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661161.1"
                     /db_xref="GeneID:11511888"
     CDS             complement(837567..842384)
                     /locus_tag="MYCTH_2300332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661209.1"
                     /db_xref="GeneID:11511888"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="JGIDB:Spoth2_2300332"
                     /translation="MTSSVSDGAGCESPAPPAFSPLTDPAPDPDPEPGNREPSVGVPI
                     TSETPAGDDAVPARHDGDPAPSNAPDAGADPATARPNGDSDQQQPPPPAPAQEDPLPP
                     QPATPAPQTRQAAAVPDAMDLDVPVDAPMSYATSPGLDLYSPYTPQQSQLLMALARLS
                     AASQSQMLTLPPSTVRPSQVSLPPNAALDTPDGFAPETPNAANAAPPADAPLESFARI
                     EFADSVFQMTTYAVIIGRDQRALDQARRDERRLEEYQRKVREHEERGLPAPSPPTQDR
                     GKFSKSYVSEEGGMLGPESDGDENPRPVKRRKTSGGAGSAVGDSHPAEPAAGELAGSE
                     DKNPTLNRQYVSHTPGAAAVNLSALRPSPHYVPFIGIHSPGPNIASRTKAISREHLKI
                     QFNQKAGVFEAIPLHKNGFFCEDVHYRDEKVVLKSGDRLQIKDVDFVFIINGVPHGKT
                     GAEENLEEEGGSNSRRYSEGGKEMSFDFESSHDPERRSTSPEEVPAAPAKEDSDSELS
                     EPPAEDVPEPGPEKAPEQEVMETIEKDPETPAPNIKPEMSLELLASLDPPIPKKRGPG
                     RPPKNGIMSKREERLRKKAAMELAKKNMPQPPPGDPPVKRKVGRPRKHPLPENAPDRP
                     EKRKYKPRKSKNGEEGEGSDVEKSVKERRREKPKTPPLELNREDYTEEQLQKPPKNYG
                     MLIDEVLSAAPDGLTLKQIYKRIQMKYPFYYFTVDTKGWESSVRHNLIGNDAFRKNEE
                     THLWSRVPGIDIDAGKKRTKATSPDHHHSTNMHTFGQHYNANSAAQGQQQMFQAETGM
                     QQQGYRAAAAASPQRPGYAPGNGQGSMGQQHAQPQPGAQAVGAAARQGPRQPYSVPGQ
                     VQGTAAPTAAGPGNQATTAQQPQGNAQTMAYSSPYAARPPPAAPAQPGAPPQGAARQG
                     PPPGQSARPYNGLPRTTTAPYAQNPPAGTRPAQPATMNANSAPLKPAVAPELVRHITN
                     FKTTVTEQLKKRTPAAEAIAMSVINRGLGLATESTIPEEEGLEKIVLGVFESSRQNLG
                     VNQSLHPGLVQALNNFKGNMIKTLEPKMGKLNAERLILSAIDRVLGFADRSTMPGPDT
                     EKKQYDEAENVLIVAIQRVVTEHQRTQAAVASASAPQPASRPGPSPAPTAPGSTQTSV
                     KGHASAAPNPAVSGQYSATAPQGQGAKPNTPLPAYPAPGPARPSAPAPSAPANSKPTV
                     TSAPPPTQQVPRPATASASAPQASATPPPTQIQSQAAQSSGSLQGPVPAPGQHPAPGT
                     TAPGSQVARPPQHPAPAGVAAPLPAHVSGPGPSQPQSPAHALAQAQAQAAAQNAQAQR
                     PTHVPGSGAAPAPTAGQGPDQPAPQTAHVSSAVPNTAAFASSPALSQQQTQQAPPVKP
                     QAPAPAPATTPAAHQPGHDAPRLPSVGSTPVNGPAPVPTTTAPPASTAVQAQMETSPA
                     APSPKPTEPVTAAAAVTAQEKVPHAVNPPLQAPAQGSSQPAAAASPHPTTKQGVQPAT
                     SSATSQTLSQSPTPTPGSSPSATTVTSNQGGSQAAPKAQAPTPVPAAQSQTPAPAAST
                     TNEAVATTSSSTSITSPTTTTTTTTTTTTTTTNPPPVTAPPPTPPAAAVPAAR"
     gene            <845390..>845869
                     /locus_tag="MYCTH_2032045"
                     /db_xref="GeneID:11511889"
     mRNA            <845390..>845869
                     /locus_tag="MYCTH_2032045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661162.1"
                     /db_xref="GeneID:11511889"
     CDS             <845390..>845869
                     /locus_tag="MYCTH_2032045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661210.1"
                     /db_xref="GeneID:11511889"
                     /db_xref="JGIDB:Spoth2_2032045"
                     /translation="VPRSHIVLAVFFVWILLVAFVVLPGSFTSDKRKQDGETVEIPLG
                     GADADRKKLSLTPANTAALVIGSVCVLTGAFGSAWLGLRWRRNHVFLLNRLYMPLVLN
                     ALAGMLATITSVYTQQAGEWGPQAVVTIVVEAVVLGLSLIFFFLHNYWLMQRVASDEE
                     "
     gene            complement(846272..848256)
                     /locus_tag="MYCTH_2300334"
                     /db_xref="GeneID:11511890"
     mRNA            complement(join(846272..847514,847721..848256))
                     /locus_tag="MYCTH_2300334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661163.1"
                     /db_xref="GeneID:11511890"
     CDS             complement(join(846297..847514,847721..847963))
                     /locus_tag="MYCTH_2300334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661211.1"
                     /db_xref="GeneID:11511890"
                     /db_xref="JGIDB:Spoth2_2300334"
                     /translation="MQRAFISELVRRNQYNLRTLRQAPLAEISGALGDLGTLLPLMIA
                     LALQGSIDLPSTLIFSGLFNMVTGAVFAIPLPVQPMKAIAASAISTHLSLRTTTAAGA
                     LVSVAVLVLSISGALRLLTARIPVPVVKGIQLGAALRLVTSGASLILPLPWLAPAAPL
                     DSRLAVLAAFLLLFLTQRAPRFPYALILFLFGLLAALSAAEPPAALVSTHHQQDQHQQ
                     DRHQHPGPLRFYLPGFASPAAWTAALSQLPLTTLNSVVAVSALAADLVAASSSTTGTP
                     RTPPPPAGVTALGLSVAAMNLVGCWAGAMPVCHGAGGLAAQVRFGARSGASVVLLGLA
                     KLALGLVAALSGPSSSSSSSSSSSSSSSSSSSAESGVVGVLQRFPRGALGVMVVAAGL
                     ELGKVGAGFDRVWRAGDEDGDGAAAAAVVEERRGKEREERWMVMMVTAAGTLAFKNDA
                     VGFLAGCCCHAAYKIADWTGRRRVWEVAGERRPLLW"
     gene            complement(848257..849502)
                     /locus_tag="MYCTH_2300336"
                     /db_xref="GeneID:11511891"
     mRNA            complement(join(848257..849036,849123..849502))
                     /locus_tag="MYCTH_2300336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661164.1"
                     /db_xref="GeneID:11511891"
     CDS             complement(join(848550..849036,849123..849322))
                     /locus_tag="MYCTH_2300336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661212.1"
                     /db_xref="GeneID:11511891"
                     /db_xref="InterPro:IPR014850"
                     /db_xref="JGIDB:Spoth2_2300336"
                     /translation="MARTGFFHHLGTFLLFAATVLLIVTCISAPVVNDLAILRVDLGG
                     DNSGGEQINFGTFGYCLTRPDADDDCSRSRVGYSPAAFLAAVDGTEFSEHAEDTTRTL
                     TKAMILHPIACGINFIAFLLAVGAGTIGSFFASLVALVAFLATGLACIIDFVLFGIIR
                     SNANDRGETTGAEAWYGPAAWTILVSAVCSLLGAVIVFFTCCSARLHRRRGAATKTDY
                     ASPPRRRRFW"
     gene            complement(850714..851982)
                     /locus_tag="MYCTH_2300339"
                     /db_xref="GeneID:11511892"
     mRNA            complement(join(850714..851448,851571..851982))
                     /locus_tag="MYCTH_2300339"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661165.1"
                     /db_xref="GeneID:11511892"
     CDS             complement(join(850894..851448,851571..851720))
                     /locus_tag="MYCTH_2300339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661213.1"
                     /db_xref="GeneID:11511892"
                     /db_xref="JGIDB:Spoth2_2300339"
                     /translation="MSLSQAGPTAAKLRSILVKVTPAPTTLSERRAVLGVLKKYADVE
                     VFKKLHDPSHFVSIVAQPQMALNLVAKSPLEFEYAARQSASTRTAAAATTPEPKTFLV
                     KIVENPAYKHRTHIRESLTYGRWPEHEQQRKQRDADAQLFAMDSMPRAALGAVCPPGI
                     ASAGLADWESAGQLAEDDGLATWLSGKVDFVQARQMKRARNATAFESLVEAYERRRNE
                     GKTSPAVSAARAADGS"
     gene            <854887..>855396
                     /locus_tag="MYCTH_2124936"
                     /db_xref="GeneID:11511893"
     mRNA            join(<854887..854898,854995..>855396)
                     /locus_tag="MYCTH_2124936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661166.1"
                     /db_xref="GeneID:11511893"
     CDS             join(854887..854898,854995..855396)
                     /locus_tag="MYCTH_2124936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661214.1"
                     /db_xref="GeneID:11511893"
                     /db_xref="JGIDB:Spoth2_2124936"
                     /translation="MATDELENREKYSQKLVNEAYAKIEALEGAKVKRIKIEPPSKYG
                     GTKEDLAGFLTNLRSYFRLNDDKFPDDKAKVLYVATRLEGKALRWFEPTWNDYLTEED
                     KDDRDAFTQAVFRSYDRFEEELRKVFGDKDEKIHA"
     gene            <855643..>856119
                     /locus_tag="MYCTH_2124937"
                     /db_xref="GeneID:11511894"
     mRNA            join(<855643..855690,855745..>856119)
                     /locus_tag="MYCTH_2124937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661167.1"
                     /db_xref="GeneID:11511894"
     CDS             join(855643..855690,855745..856119)
                     /locus_tag="MYCTH_2124937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661215.1"
                     /db_xref="GeneID:11511894"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2124937"
                     /translation="MNGTTVKANDKKKRAYKQDQKKTTKDKSNVTCYNYRKKGHYKRE
                     CRSPKKGWKLTPGKEIAAIDETTKDVIEVAATSYEDKGSDTDSLRHDGNGEDEQAPNS
                     ELVTVDPETGLAEWDMAGEYAPPASILPALGQWGFTVT"
     gene            complement(860631..861489)
                     /locus_tag="MYCTH_66448"
                     /db_xref="GeneID:11511895"
     mRNA            complement(join(860631..861116,861185..861489))
                     /locus_tag="MYCTH_66448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661168.1"
                     /db_xref="GeneID:11511895"
     CDS             complement(join(860958..861116,861185..861391))
                     /locus_tag="MYCTH_66448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661216.1"
                     /db_xref="GeneID:11511895"
                     /db_xref="JGIDB:Spoth2_66448"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTSVAKPTFVEVVFAMALAYRFLPWIAFSRSSVVLRMLNVVPNLSWMNLNAVWKKPS
                     ASCPKSLRGSGVFVSRRSF"
     gene            917446..917882
                     /locus_tag="MYCTH_66442"
                     /db_xref="GeneID:11511896"
     mRNA            join(917446..917653,917701..917882)
                     /locus_tag="MYCTH_66442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661169.1"
                     /db_xref="GeneID:11511896"
     CDS             join(917530..917653,917701..917798)
                     /locus_tag="MYCTH_66442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661217.1"
                     /db_xref="GeneID:11511896"
                     /db_xref="JGIDB:Spoth2_66442"
                     /translation="MPCSFCFSRGLCCRMIESSSRCGEYVHHGRSYDGSRVLVLSLSR
                     IIDESKRLDRLKQDAKEALRADRDSLAKA"
     gene            <931370..>933367
                     /locus_tag="MYCTH_2043746"
                     /db_xref="GeneID:11511897"
     mRNA            <931370..>933367
                     /locus_tag="MYCTH_2043746"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661170.1"
                     /db_xref="GeneID:11511897"
     CDS             <931370..>933367
                     /locus_tag="MYCTH_2043746"
                     /note="Contains conserved domains CHROMO[smart00298],
                     Chromatin organization modifier domain, rve[pfam00665],
                     Integrase core domain and RNase_H[cd06222]."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661218.1"
                     /db_xref="GeneID:11511897"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="JGIDB:Spoth2_2043746"
                     /translation="QWEEQHEQAFTQIRDAITEDPVLVLPDPKKPFEVETDASDYAIG
                     GQLGQRDEQGKLHPVAFFSKKLDGPRLNYPIHDKELLAIVEAFKEWRPYLSGTIEPVQ
                     VYTDHKNLRYFTTTKELNGRQIRWAEFLAEFNFEIRYKKGKENARADILSRRTDHTKG
                     RTGTTPPLFKERTDGTLHHETQTPVEDDPLDSFLECCAIFREERINEAQYQAAPGPVV
                     PDGVEERDGKLWYRDKAYIHDKDQQLRMIRELHESKLGGHKGVTKTVAQVKKHYDFPQ
                     LTARVKEVVRNCDICNRSKTARHKPYGLLQPLPTADKPWSSVAMDFITKLPESKDTAT
                     GVTYDSILTVVDRLTKWAYFFPYKESWTAEQLADVIYRQVASVHAWPQEWITDRDTKF
                     ASKFWQALMQRLGVNSKLSTAYHPQTDGQTERLNQVVEQYLRSYVNYQQDDWVMLLPT
                     AQLAYNTTPTETTKVTPFFANYGYEADLRQGPEVTVPRAAVKAEQMHALHEKLKKELE
                     FVKTRMKNYYDKHRLEGPRLERGDKVYLIARNLRTKRPSTKLDFKKVGPFVIKERIST
                     SNYRLSLPSSMRLRTDVFHISLLEPAPKNAKVATHIEAEDEEEEWDVEEILDSRIING
                     ELQYLVKWLDFGPEDNSWEPVKNLNCPEKLEQFHRQNPDRPK"
     gene            954684..956232
                     /locus_tag="MYCTH_2300343"
                     /db_xref="GeneID:11511898"
     mRNA            join(954684..955086,955174..956232)
                     /locus_tag="MYCTH_2300343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661171.1"
                     /db_xref="GeneID:11511898"
     CDS             join(954883..955086,955174..955923)
                     /locus_tag="MYCTH_2300343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661219.1"
                     /db_xref="GeneID:11511898"
                     /db_xref="JGIDB:Spoth2_2300343"
                     /translation="MASSVFHQARPPSPPVPLPCVPGPKLAPFTRNAYADIEFIKFLG
                     RENDVDSLVWKVKINKAGPFALKLFYFWHWNFLRKNQGGDLTRPLAGPQLYVDYFDPF
                     NCECRAYGRLKEEKREDLAVRALGYLLLTPQQEIDLARRVIGRSTPPPSANAATLDGD
                     NFWGRHEQHRGLPVRAIVKDLVASKAPDPAQAAGPWVDLQALHSLGIFVKDTHGGNYL
                     NGKLADFSRSWTMYHPALDQIGARKLRSLMLDELQQLLDYYYDGADDSTVIPQDLEAF
                     CSGYLDRYRNFPKAYNWLKWEKNADAAKAYVEQGLFERGAH"
     gene            957219..958074
                     /locus_tag="MYCTH_2300345"
                     /db_xref="GeneID:11511899"
     mRNA            join(957219..957793,957871..958074)
                     /locus_tag="MYCTH_2300345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661172.1"
                     /db_xref="GeneID:11511899"
     CDS             join(957505..957793,957871..958043)
                     /locus_tag="MYCTH_2300345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661220.1"
                     /db_xref="GeneID:11511899"
                     /db_xref="JGIDB:Spoth2_2300345"
                     /translation="MLSGLSSLLAIPALLAATAVAAPSGEVPAALAPREAACPTVTRW
                     KEWHYETVWLSTTTVTNGWSSLGSVTSTKTEEMTRTINTRTTVFSPLVTTLPVTTASP
                     TVATETTTLTWYTHTVTVTSPGYAPSSVCQVTTVTYTIPSTTSVTQTMDLS"
     gene            complement(958077..958782)
                     /locus_tag="MYCTH_2300347"
                     /db_xref="GeneID:11511900"
     mRNA            complement(958077..958782)
                     /locus_tag="MYCTH_2300347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661173.1"
                     /db_xref="GeneID:11511900"
     CDS             complement(958257..958640)
                     /locus_tag="MYCTH_2300347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661221.1"
                     /db_xref="GeneID:11511900"
                     /db_xref="JGIDB:Spoth2_2300347"
                     /translation="MLWDKFMWYAGSDGSDRHYDSEKRLCFGLVSANSNPHDRDRPSK
                     WGCGYLHYSHSGASAATQFLRRDGPVIVYISNPNRPPAHLVPGPVSQAVWQAYDSQPF
                     SQTVEVTVATWTSTDVTVTGCVTVV"
     gene            complement(<959280..>961844)
                     /locus_tag="MYCTH_93263"
                     /db_xref="GeneID:11511901"
     mRNA            complement(join(<959280..959518,959603..959668,
                     959958..960205,960252..960367,960536..960714,
                     960749..960789,960844..960952,960991..961044,
                     961091..961170,961284..961414,961686..>961844))
                     /locus_tag="MYCTH_93263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661174.1"
                     /db_xref="GeneID:11511901"
     CDS             complement(join(959280..959518,959603..959668,
                     959958..960205,960252..960367,960536..960714,
                     960749..960789,960844..960952,960991..961044,
                     961091..961170,961284..961414,961686..961844))
                     /locus_tag="MYCTH_93263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661222.1"
                     /db_xref="GeneID:11511901"
                     /db_xref="JGIDB:Spoth2_93263"
                     /translation="MLAGERSDQGGIGAPRALRLGGRDGPLSRDGAVAASSAVWLDQL
                     GSRYMESSLRWRASLLRKKLLPEYLNGQPGWLKEGTRSGAEADNGKSEPSQARVQQSG
                     TAAAGAGQVAQRGRANLVCVRSTQERTLAIQVTLVSEEQNLLWEKHALSVPHGQMNEK
                     DVRISLSIGYTTDTLCIRLVGRPGSQIVRAAYRWSRDPQRQENAKLAGQPQHSRLHGL
                     HALLGGLVWAAAGAIRFGAPRVPWSSTRHLASLWGSMKSELARWQPGPTLRAADEVVG
                     ALQLPRFPAAATQRGFPTPAHIAVEAGCYAMYQPQDPPVSFLPALCPVPTYTRLNMVA
                     MCRSLPCEHRHIIAVICHSKSILRLPAVTEYLGAIHPAPKRTNSDSSACNAYSTHGFI
                     TLSQAGPPASDAECHRDLLSRGWFRVTIPLPPTYLPPHTHPHARAHTNARTHTINTIN
                     TINEEGRLRRKTTLFQELGMDES"
     gene            962696..963107
                     /locus_tag="MYCTH_2300348"
                     /db_xref="GeneID:11511902"
     mRNA            962696..963107
                     /locus_tag="MYCTH_2300348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661175.1"
                     /db_xref="GeneID:11511902"
     CDS             962713..963039
                     /locus_tag="MYCTH_2300348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661223.1"
                     /db_xref="GeneID:11511902"
                     /db_xref="JGIDB:Spoth2_2300348"
                     /translation="MPSPGSDNNTSDMDDFHNELWALAESSSISLRYASAPGGIRKYT
                     AGGISLRYQRATDAAMRATTVVRNRPRMRRRSKTRRGSTGSSAVQSPAMSSAASPQPP
                     NAECPP"
     gene            <964859..>966574
                     /locus_tag="MYCTH_2026137"
                     /db_xref="GeneID:11511903"
     mRNA            join(<964859..965523,965632..>966574)
                     /locus_tag="MYCTH_2026137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661176.1"
                     /db_xref="GeneID:11511903"
     CDS             join(964859..965523,965632..>966574)
                     /locus_tag="MYCTH_2026137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661224.1"
                     /db_xref="GeneID:11511903"
                     /db_xref="JGIDB:Spoth2_2026137"
                     /translation="MAGVQAMPFTASELPHSANKERAGFCWQGVPGAASTDIFDQYVE
                     LGDSDAESASGQSGGFGRLVQLDQLDQLGFSELPSMTPHVSLDQIMAPGGGAQGGPEA
                     QSRPSELKRDHEVAGASPSPRVCQPSQHLHPLYRAQTDMVLLNSVGDTPGGGSISDSE
                     LLNLEGLTMRSPRIQIPHLSTSEPASPPSGAASPRKVSQLGTLCTKIRNMTATLQGMN
                     SETSILPEDVQRFVAGSEPNLVNGYLRGSFNPSGLLNDQFVHPLQLNGGAMHQTPLST
                     APIADGLRLPVSALDGKPLWTTAPGTYLDGGGGDDDANTWWDPSSDAMDTDVPAVSYH
                     AAVNERSSSLNMGVQLHHRQSFEYPAPPGTNDTTNTVTTTIFGSKGMMLHTPQPRGIP
                     SAVLHSDVSAHRPTRADCHHRRPRPRASSLSARHHQQHQYGPGVSPRKGRTVKGSGSA
                     SASRIASTSPSPRPPAFAPGPNGSLLHGRSASMQTLHYSGLAAGLSADGGAAIHKRKS
                     WTGRRTSSSSSSLHHQYHGLAMTAAAAA"
     gene            complement(968798..971518)
                     /locus_tag="MYCTH_2300349"
                     /db_xref="GeneID:11511904"
     mRNA            complement(join(968798..969118,969186..971518))
                     /locus_tag="MYCTH_2300349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661177.1"
                     /db_xref="GeneID:11511904"
     CDS             complement(join(969085..969118,969186..971392))
                     /locus_tag="MYCTH_2300349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661225.1"
                     /db_xref="GeneID:11511904"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="JGIDB:Spoth2_2300349"
                     /translation="MRWSITRPLAALASLAALASPSHAEYILQSNSLNACQENSGFTA
                     SLFKVVFTPKNHTANVDIVAVSSVQGNVVFDVAISAYGYQFIKRTVDPCKVGLAGLCP
                     MTAGKIPLNFNLNVGEDAVKQIPSIAYTFPDLDAKVRVFINRTDGSEAGQSVACVEAD
                     ISNGKTVDLLGVKWATAIVAGLALVSSAIVSGLGHQNAAAHVAANALSLFGYFQAQAM
                     LGLTGVHLPPVVMAWTQDFQWSMGIIRIGFMQDIFTWYQRATGGTPSTIFDSLTTVSV
                     QVEKRAVNLSLGLAKRSLAMMPRSISEPMSAIMKRDLIKRGNIQTSSGSYIVYGIQRV
                     AFRAGIESTNLFMTGLIFFCLLVLFTSAAVAAFKGFLETAVKKKWMPSDRFLEFRNGW
                     LTVLKGILFRLTLIGFPQMTILCLWEFTQKDSAAEVVLAVFFLFGMVITLGWAAYKVI
                     MIARRSILMHNNPAYILFSDPQALNKWGFLYVQFRASAYYFIVPVLGYALVKAMFIAF
                     AQDKGTVQAVGFLILEAGALIAASVLRPWMDKKTNSFNIAICALNFINSIFLMIFTEV
                     FNQPPLVTGVVGVILWITNAVFALILLLMLIVSTIFVFFRENPDGRYQIMADDRTSFM
                     KSQTHLAQTTELDALAATARGDKGGFKGGLDLDDDAESITSDSLRHQTEHLVVPSNGS
                     VTGFSSQPRAPASPSMPLFPADGPRSPPRFNERPASPFGASNYGPAFRAQNNSSPWQR
                     GAGYDH"
     gene            complement(974223..977625)
                     /locus_tag="MYCTH_2300351"
                     /db_xref="GeneID:11511905"
     mRNA            complement(974223..977625)
                     /locus_tag="MYCTH_2300351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661178.1"
                     /db_xref="GeneID:11511905"
     CDS             complement(974309..977101)
                     /locus_tag="MYCTH_2300351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661226.1"
                     /db_xref="GeneID:11511905"
                     /db_xref="JGIDB:Spoth2_2300351"
                     /translation="MDHCPPRPQRLLRSATSSSSAFSRISTVSDFTDFDSLRGHATCP
                     PPQPPPHPRQPLSSLQTSNIVGSRWGGEQGYVYASPTSGWATLTTSPHAVGYSPVAST
                     DAVAQSIEHHGRCYPYNHHEAIPAAEKEEEEEEQEKKRDGAGLGRLARSAAPMNCGEA
                     DNAASARVSSAPVFDLTTTLGPTTKADEAFIKALQEQEAHGKLTGGLGAGIKADMTVT
                     ESALLAATPLSERPLSQTFTRSSRRLSRAETVKRLGQSEANKRGEVIEVVMEDDDDVP
                     PHSKVDISLVAGDDDTEDRGPAPFVPRQTTFPTRKPTTTVFYPQPNWKPFSLRGPYLI
                     SLIVLSLALGACVEILYRSSARDPLVSFKGPSEIPPAQYFAIKFLPMIVAVSYGVLWQ
                     ITNFDVMRLEPFYQMSKEGGALAAESINVDYLGQFNLFRPLRAIHYRHWAVAVSSVAS
                     LLANTLVPTLGAASIILSPDRDTRLLFPNREKNILMHHVWSRLLVVTFVIIASLGAVL
                     LYQLQTRRSGLLADVKGIAGLASMATVSHILMDFKDMDVATHQDIHQKLKNHRYVLRN
                     SSLAPDDSSSDQVDNNANAKTKAAVGGDDDDDDDDETDRYTNHHLSPNPQPLMLRAAG
                     ALPFLCLILLFTALLPVILFTPATTLADRAPWLVTAVAVLIKLSWGALETDVRVMEPY
                     YILSRRHAPPKTLCLDYTAMPFGWVAVQGLLNRHWIVFAVGLGTVAAEVLTVLVTSLA
                     TVEGRVFIALLDEKKTGSGGAGGLGGGEDAGLTTRAAAAAAVVAEAAASSSRKTTAGE
                     IINAGEETVPSFWLSLALALAILIYMAAVVAVVFARRGRVFLPRQPNTIASVLAYIHQ
                     SKMLYGFVGTAKLSNAEMLKRLEDLGKTYGLGWFHGRDGQTHCGIDEEELLSGYKVGY
                     DYSRATKPWEEAMNWL"
     gene            complement(978985..980856)
                     /locus_tag="MYCTH_2300355"
                     /db_xref="GeneID:11511906"
     mRNA            complement(join(978985..979212,979295..979745,
                     979900..980203,980329..980856))
                     /locus_tag="MYCTH_2300355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661179.1"
                     /db_xref="GeneID:11511906"
     CDS             complement(join(979069..979212,979295..979745,
                     979900..980203,980329..980605))
                     /locus_tag="MYCTH_2300355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661227.1"
                     /db_xref="GeneID:11511906"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="JGIDB:Spoth2_2300355"
                     /translation="MARNLFLSSSSRPRQIQRGIAEPFGRREPVSTPSPRPLEQPSFR
                     PHAPRSQNQQRRFYNYYPGGGGGNRERSPPPYDPEHREARLREAKPLFHWRGFRALNT
                     PSTYTVVAVAVSGALIFYFSNLETVPVSGRTRFNVYSPESVKKAGEMEHKRLLWELEQ
                     RGARLLPDWDPRTIRVKRVMARLIPFSGMQDENWEVYVVDDPRTANAFVLPGGKVYVF
                     SGILGLARNDSGLATVLGHEVAHNLADHHGERLSQDIGASIVLWSLVILGGAFGLGPI
                     IMHFFGSRFLDVAFGFPMSRLQESEADYIGLMMMAEACYDPREAVGFWARMERATGQE
                     VPEWMSTHPTNMNRIKKIQEWLPQAMEKRAKSDCSTTASFADLFRQALRTGQAVIVI"
     gene            complement(981347..>983800)
                     /locus_tag="MYCTH_107178"
                     /db_xref="GeneID:11511907"
     mRNA            complement(join(981347..983104,983179..>983800))
                     /locus_tag="MYCTH_107178"
                     /product="glycoside hydrolase family 16 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003661180.1"
                     /db_xref="GeneID:11511907"
     CDS             complement(join(981525..983104,983179..983800))
                     /locus_tag="MYCTH_107178"
                     /note="CAZy_ID 268019"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003661228.1"
                     /db_xref="GeneID:11511907"
                     /db_xref="JGIDB:Spoth2_107178"
                     /translation="MAPSVLRLGAAALACASSTLAVETYQLKESYNPSNFFDKFTFFS
                     SPDPNQGFVKYRSKQDATNLGLIQSTKDEVTIKVDSTGTDKDGRSSVRIESVNTYNSG
                     LFIADFSHFPKPACGAWPAYWMVGPQWPLDGEVDIYEGWNLNTANKVVLHTDGPSVVG
                     SCTVSQEDFTASLRYSNCWDKAPDQPGNTGCAADEPDGTFGGAAGGVYATEWSETGFK
                     IWSWTHDNVPSDVKSGKPDPSTWGMPVFAAGGSTCDVTKTFNNMRIILNINLCGDAAG
                     GLWGETCQAATGVAQCAQYVQQNPKAFEQTYWKIRGIDVYQLETVKPSSTAASSTSTT
                     SSKSSTSNTSAASSTSTSDSTPSSTSTKSTKSTAPTSTTGASTSATETCTSDVTTESA
                     TETVTSTSSSGPATETDTESDCPDDNTPSTTFPPDVTGTSGTATATASVSATETATET
                     ESECSDDISETATVGPTDSSTKVTATAAPTDSFTEVTATASTTEFTTSTIYSTVTSTI
                     TSCAPTVTNCPARTVTSVIVIGTTVCPVTEVKPTETGGGVPGTGVPSASAPGAGSPSA
                     DVPSSNVPGTGVVPTSSVPTVSVPAPGGPIGGDTTLRTSTTVYRTTTVVVPRPTDGSA
                     GGGDNDNNNNNNNNEEEGSGDNNETASSSTLAPSFVSPPASSSAIPDEPEQAQPTDTG
                     AGVPPVEIVTSTSPSATSSGLSPVVTAGAGKVAARSAVLMGVGAVVALVNL"
     gene            complement(985376..986375)
                     /locus_tag="MYCTH_2300359"
                     /db_xref="GeneID:11511908"
     mRNA            complement(join(985376..985944,986046..986375))
                     /locus_tag="MYCTH_2300359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661181.1"
                     /db_xref="GeneID:11511908"
     CDS             complement(join(985607..985944,986046..986280))
                     /locus_tag="MYCTH_2300359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661229.1"
                     /db_xref="GeneID:11511908"
                     /db_xref="JGIDB:Spoth2_2300359"
                     /translation="MRMGLRMMLRHVLAVLALLAAPSWARFTNAFDGINCGSDLVLTW
                     DAVPPQYYPPCITAQVIDRNGDGFSANAYRVNITTGVSGTSYTWEGAPYPLRWILGGL
                     YQLELRPMSWPGGDVPLLAKSPSFTIADAGVAAQPDGSAEEVSEFPNSAAPRAGRRRK
                     ERECSQADGCFFLFLLYSFQTASARRFSER"
     gene            complement(988896..>990314)
                     /locus_tag="MYCTH_2089843"
                     /db_xref="GeneID:11511909"
     mRNA            complement(join(988896..989929,989997..990117,
                     990148..>990314))
                     /locus_tag="MYCTH_2089843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661182.1"
                     /db_xref="GeneID:11511909"
     CDS             complement(join(989594..989929,989997..990117,
                     990148..990314))
                     /locus_tag="MYCTH_2089843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661230.1"
                     /db_xref="GeneID:11511909"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Spoth2_2089843"
                     /translation="MGDLGHYVDFPSPPNSMYYVYGDGDRYLSESQSPNNSAVGSRAQ
                     LGSEQASDNSVYRYPSPGHEEGESAEAPEPQKPAAKRKRENRYKNAPPAVLSRRREQN
                     RASQRAYRERKDQRIRDLEQMLNEAKQRNDVLSRAYAALHAEYMALKSSQLGDTSYPQ
                     QFGGGLLYNSSGTPVTTPLNASGGVDGLEGLDMYAYGDMSTPRGYTL"
     gene            complement(995430..997687)
                     /locus_tag="MYCTH_2300363"
                     /db_xref="GeneID:11511910"
     mRNA            complement(join(995430..996252,996316..996420,
                     996491..997149,997210..997687))
                     /locus_tag="MYCTH_2300363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661183.1"
                     /db_xref="GeneID:11511910"
     CDS             complement(join(995876..996252,996316..996420,
                     996491..997149,997210..997415))
                     /locus_tag="MYCTH_2300363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661231.1"
                     /db_xref="GeneID:11511910"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Spoth2_2300363"
                     /translation="MKSTAPADHEPEHSSKQTGQTKPPSPSLKSMIWHGIKSDASRAW
                     YVIRNTSFREVMRRNPGEAFGAIVAVAGAIAVFIYCVYAYYTYFYSRQFTRYPEPVAQ
                     ALRKALYFSNHDPDPQRALKYYKQALELCDQEGLDHFSDDVMGIKIQVAAWLEKIESY
                     HNAITVLENLLNDCKRWVEVMEKSAAEGTLPKLEPVPAAKEGEAGVPEQPREGWWAKR
                     TRLLAKAVSISVKLANLYSDEHVLEREVAHERLVWAVETALKETQRRAKEGLKDGEGP
                     WMSLEEIGGSLEALAYSYQEKSQYHLAVPLFFQALRLCQDPCHIALLMNNISTSFAEH
                     PLIPPGDAPVHAMMEESKTWATAAEQRASYLAAAQRWAQNAIEHASQPQGDRRTSECD
                     RACAVALSNLGSVLAMLGKNSEARAKYEQSIALSKKFGFDDYAAEAEARLRSLPEA"
     gene            998295..999832
                     /locus_tag="MYCTH_2314458"
                     /db_xref="GeneID:11511911"
     mRNA            join(998295..998344,998424..998588,998742..998776,
                     998876..998933,999034..999832)
                     /locus_tag="MYCTH_2314458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661184.1"
                     /db_xref="GeneID:11511911"
     CDS             join(998498..998588,998742..998776,998876..998933,
                     999034..999215)
                     /locus_tag="MYCTH_2314458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661232.1"
                     /db_xref="GeneID:11511911"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Spoth2_2314458"
                     /translation="MAGKFEPKVPVQLDPPKDDPISPEELAKANGENGGKCYVAIKGI
                     VYDVTGNKAYQPGGAYHVFAGKDASRALGKTSTKPEDVSPEWRDLPEKEQSTLNDWIT
                     FFSKRYNVVGKVQGATNFE"
     gene            complement(<1000848..>1001012)
                     /locus_tag="MYCTH_2023079"
                     /db_xref="GeneID:11511912"
     mRNA            complement(<1000848..>1001012)
                     /locus_tag="MYCTH_2023079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661185.1"
                     /db_xref="GeneID:11511912"
     CDS             complement(<1000848..1001012)
                     /locus_tag="MYCTH_2023079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661233.1"
                     /db_xref="GeneID:11511912"
                     /db_xref="JGIDB:Spoth2_2023079"
                     /translation="MCDYDEFSFTCGHYVIRRKSYCHFARNHPTHGCRSVKKLRNIWE
                     QGRPCDECIQR"
     gene            1016570..1020238
                     /locus_tag="MYCTH_2300377"
                     /db_xref="GeneID:11511913"
     mRNA            join(1016570..1017173,1017245..1017342,1017412..1017861,
                     1017916..1018182,1018244..1019239,1019301..1019919,
                     1019983..1020238)
                     /locus_tag="MYCTH_2300377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661186.1"
                     /db_xref="GeneID:11511913"
     CDS             join(1017132..1017173,1017245..1017342,1017412..1017861,
                     1017916..1018182,1018244..1019239,1019301..1019919,
                     1019983..1020165)
                     /locus_tag="MYCTH_2300377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661234.1"
                     /db_xref="GeneID:11511913"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2300377"
                     /translation="MARRSQFSPQDRFPLLSHGDSSPGSPDSIIMRNLEQSASLNMLS
                     LTHARSQRGFAQHQGMHPLNQFIHGPGPWSPFEAAAGQPVGMSFNQPRPSFTTYRSAP
                     PSEPDTVCLSIGGTPTDSGYGSNARQSVGNPSVQGELEQNFLSRFQAIGQEDASPKDE
                     PHTRETQAQRPSSGAPTSKRMTCPVCNEPVKRRSDLKKHEARHTRPCKCPFWDCPKAE
                     EGFATKNDLDRHTKSVHKLLMGVVTVYRCDVDQCKDKPKDWPRLDNFKQHLRRKHGIE
                     NADLSRFTFQVSGSDAAGLRPSESAPSELPTASSSTLTPETLWVGTDQGHVDPASLFR
                     NSHLDQMGNVNPFSSFSSMKERVPVTLETGSLRLSDQNITENPHPVTKSAPFVLDTQR
                     PTMEGARSGAELISEEANLPSRIGIAPDILIQACAASRPFDQLDAQPRQAQEMANSDA
                     PETPDVSRSDVLTRVDEVESNAPDDMDVDGSALDSGSEDGSHDSDSDEDEPSQNSTDS
                     QSNLLRDAGAQYIKVDEAHIKASLSQVELDAENQRPIDLDDETQASAVVKSLIEKGKL
                     GEMLKRLGYPALDDVETKGQMPTDPSSTAGDSGNIYKCQECQKPFQRRCELKKHLKRH
                     AKPYACTYVNCNKRFGSKNDWKRHENSQHFQAEIWRCAERPTDRPDQGECGKVCHSRE
                     SLRTHLEEEHGIRDFVVLDKRLADWHLGRNYEFRFWCGFCQKTIESTGKERPAHSQRF
                     DHIDDHLNGRHGLPKADIKDWKHVDTESIESPASLPGKSRRSKGKHMVLAGKARKRGY
                     DGGGDDGSSRSKRLKDGRGIVWFWECCLCHHYWRESITPKCMNDGCNHECCENCDREP
                     ATSLENEPEPEPEVPPSIRDREEDGIMM"
     gene            1025527..1028144
                     /locus_tag="MYCTH_2300382"
                     /db_xref="GeneID:11511914"
     mRNA            1025527..1028144
                     /locus_tag="MYCTH_2300382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661187.1"
                     /db_xref="GeneID:11511914"
     CDS             1025668..1027929
                     /locus_tag="MYCTH_2300382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661235.1"
                     /db_xref="GeneID:11511914"
                     /db_xref="JGIDB:Spoth2_2300382"
                     /translation="MGHPYVLGGAAFPCDDMPFQSQPCGGLQDGLQDSSMRYIDPNMQ
                     NPASSAFDGTSWAAPAQQSFKENAATFFVVDPASQVSDHGAVRPAVSVSQAPVPYARY
                     GSPFSSAEPSPPGAGLSPPADTESYYDGGYPRTPSEANLLSPFQPPLPMEPFAHAVQF
                     RSMGPGPDYVKLCDVSPGQQHSEYCESDNDMFDFNFAPQPAYFSGHVIRDVVPASHGA
                     AVPEPELSDTQPGLDETQSQSVVKEEIKVESQYPPLEDDAGPEKQPGPKRRQQHGNDD
                     EDDDGGRGGHGNNGDLQYRPSKRRRTTSRIPEQHAAKTIPAAASLPRATRTRAGNPIP
                     PPPRSGSSLSGGKARLACPDCKQRAFASRADLDSHVKKEHRRPFSCVFDFAGCNSTFG
                     SKNEWKRHVATQHLLLNYWVCTEGVCAKVSQDHPPSPDQHQYAAAAATTTTTTTSSSS
                     STTEGKENPRGAIFNRKDLFTQHLKRMHAPKEVKELLPQAASKRAGTSSARGSASANS
                     NNNNNSNNKMSTAQESAILARWAARVKRLQDAAVRPRCRLPTFMRCPFPGCASAPPFR
                     GNDAWNRRMEHVARHMNSPGNDDDATNNNNNKTRRVGCGSGGDSSSSGVPVPAPDPTL
                     VEWAARPDVAIIVPDGRGGWVLKSPLERKPGGNVVVTAPAGHASGDGGGGGGGGGGGH
                     DAAEGGGEEEEGEKQDEDYDGEDDDEEDEEEEVVVVEVMEVGLGDEEQGDGGGGGEDD
                     EAEMDAEGEDDDD"
     gene            <1031864..>1033663
                     /locus_tag="MYCTH_45263"
                     /db_xref="GeneID:11511915"
     mRNA            <1031864..>1033663
                     /locus_tag="MYCTH_45263"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003661188.1"
                     /db_xref="GeneID:11511915"
     CDS             1031864..1033663
                     /locus_tag="MYCTH_45263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661236.1"
                     /db_xref="GeneID:11511915"
                     /db_xref="JGIDB:Spoth2_45263"
                     /translation="MVENSPCRNTYRESGPSAGRERILDRKIERRQLLASFSSNLARR
                     GPRFEGKASDGSVRSIVSLFEKSATHSDSPASSRPDWACGASNELGGRNGRKGHRVVH
                     NDKDHNGRVSGQPLTSQLQNDRLVPSMSPSSTTGYQVEDYSLTLLRHKSYFNNRSLAR
                     CLDEESEEDTRTKVQLVKSNKDGDDKAIVERKKDDPDEHGRGGKGDRILLASQRNHPF
                     PKQQRDNQMSELLPRKELLRPRPQELANRNLLEVDNFWSHVRAELQVDDEEIYGTRPA
                     RTRRQDYEARPRDGYESWTFKQSSTPDASPPASRQSKPDIVHPFLPAPTRPPPPVPVA
                     ARERSLSAVSRWKPHSATHLSEPFPDLASDYPVIWDEPSPTPFRESASAPESADIASL
                     SFDPYPEPELPLLEAGRDSSVSLTEPSHSRYPSSGSGPWTRPPTWRLPSSLYSSSPPS
                     VPPLPSQSPLPTQPRSHRRHPANHSRNRHHHQPHSSKTSACTSFSVSTTYSINATDSS
                     DCGRNTYSSRQTAQTSTSSTATRSTRVDSGAALSSSWSSLVYGPHPPLRRLTTEEKLS
                     EIDAFLGQDAEPEPEREWLCHDQGQNQTDGGWI"
     gene            complement(1033908..1037450)
                     /locus_tag="MYCTH_2300384"
                     /db_xref="GeneID:11511916"
     mRNA            complement(1033908..1037450)
                     /locus_tag="MYCTH_2300384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661189.1"
                     /db_xref="GeneID:11511916"
     CDS             complement(1034066..1036846)
                     /locus_tag="MYCTH_2300384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661237.1"
                     /db_xref="GeneID:11511916"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Spoth2_2300384"
                     /translation="MRAAFQRLDGSATEAPRASKSTRGILKTYEGLLALKTVEEMRSS
                     WLAIAPEKREQDWLYLMKAVVDFRPESAALVLEATVEPSTTPGWAVADVFAFLNRWSS
                     TLPDDGRRHQQARLPGLLLHLLRNSPPNHYQFHQWALGQTLSVCEPDTAAEIYSALRR
                     YNHYIHYNTKLKIAGCLTRGSKYKLAALRVFEEVLKDPHVDVNDRRCAALATELFTLP
                     QSWKDGRESPVEVQLLAEAFERVVGLGLSPNVVTYTAMIRSLCLTNQLGTAWKIYDVM
                     RSHGTTPDPHVFSILLNGAKLAISLDSTVRVVEEATPDTFRIPYFWNDIIHTILLAAA
                     EEATSRPVMHGQPIAIPAFSSMLRVYAKFFRLEPLQGLVQTDLQEILAQDDDPSRQLE
                     LNWKQKLAVLVDQLPVSSPEELVEPGVDTLGIMLLGYIKSFSTPQPVLSFYSHFRKLL
                     KSRDPIAIGLASHSTLPYDVVLKSLTDNPGMLRVGIDIVNDMLRDAAASAAALKARPA
                     ESDPTPPPAPPPTTTSGPGAGPEAVEQQTDKATTSTATTVTTTSAAAAAAATEEEESS
                     LPAFHHPPPSVYTWSILLLAFSKQRNLREVERLIQAMRRHGVEPNRVTWNTLLTGHAK
                     RGNERGVVAVVDRLDAARYHPDRYTVTAVGKLHRPERALTHLEERAAAREGERWAEVE
                     EAAVVPEPGRSLWPPRPLVKKQGSSSSSRGGEKVPLRLGKRIDKFRQRLAKERAELEA
                     KMQQERRQAETALEKAKREARETRSRVQEEEWAARARPPPPLPLAEGGAGEEEQAQEE
                     QASSTAEADGAGVSDAAVDSYLRMYDELVFMRTHNELREIKESIKEDQQPTVRRVQTE
                     KGKYPPRWDSYARRPLGLSVGLERAEAETASDGTGTPTPPPPPDEAPATREEAELEAA
                     GEPRPSEQQARE"
     gene            1037642..1038598
                     /locus_tag="MYCTH_2300385"
                     /db_xref="GeneID:11511917"
     mRNA            1037642..1038598
                     /locus_tag="MYCTH_2300385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661190.1"
                     /db_xref="GeneID:11511917"
     CDS             1037765..1038508
                     /locus_tag="MYCTH_2300385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661238.1"
                     /db_xref="GeneID:11511917"
                     /db_xref="InterPro:IPR013169"
                     /db_xref="JGIDB:Spoth2_2300385"
                     /translation="MSSHASLSAAADDRKARLAKLKSLKRKQPTGADADDADKAAAAP
                     HDDSATDQAVPSSSSSSSSHSSSHAPPTKDVARMHLSGRNYDFETKGPKLGFEAPLTL
                     ALEQPTLEQKAQDLEEESKRQAALDAQNDKGIDLFKLQPKKPNWDLKRELNARMEVLN
                     VRTENAIARLVRERLAEKKAASGAARAAGAAGSRAGGGEQQQQQGDAEAEGMLDGAAI
                     VEGMRQREREEEEENRREREAEAEEFGMA"
     STS             1037935..1038873
                     /standard_name="ha2919"
                     /db_xref="UniSTS:515610"
     gene            complement(<1038689..>1039708)
                     /locus_tag="MYCTH_2116644"
                     /db_xref="GeneID:11511918"
     mRNA            complement(join(<1038689..1039366,1039428..1039591,
                     1039645..>1039708))
                     /locus_tag="MYCTH_2116644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661191.1"
                     /db_xref="GeneID:11511918"
     CDS             complement(join(1038689..1039366,1039428..1039591,
                     1039645..1039708))
                     /locus_tag="MYCTH_2116644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661239.1"
                     /db_xref="GeneID:11511918"
                     /db_xref="JGIDB:Spoth2_2116644"
                     /translation="MYGYRGRTGPSKTPPNVQCQKCSWLTAAERHYSYECKAAPQERP
                     YVARPSRTQQLFNPKLLPKLASETPNALQERQGVADEELAKREAERARKRAREAEEDD
                     ALTDSPSPRRHRSPSCDSVSSISTRSPSPAPKRSRTPERRERRRYSPSPSPQHRRGRQ
                     PSYDSDDGYSRGPSERPEPGYRAPASRGSRSPSPRRRPSPRRERGGRDSRRHGSPGSH
                     ARGRDAHARRAYSPSRSRSPSRRDEERERHGAGRYRDREDRSFQGRRSPSPLPPPRQP
                     SPTRERSLSPFSKRLALTQAMNRGR"
     gene            1041460..1044353
                     /locus_tag="MYCTH_2300388"
                     /db_xref="GeneID:11511919"
     mRNA            join(1041460..1042359,1042421..1042750,1042860..1042948,
                     1043005..1043324,1043386..1044353)
                     /locus_tag="MYCTH_2300388"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661192.1"
                     /db_xref="GeneID:11511919"
     CDS             join(1041464..1042359,1042421..1042750,1042860..1042948,
                     1043005..1043324,1043386..1044105)
                     /locus_tag="MYCTH_2300388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661240.1"
                     /db_xref="GeneID:11511919"
                     /db_xref="JGIDB:Spoth2_2300388"
                     /translation="MWLSTGNPTLAIRTRLTLLWFQVAAASTPKGSKPAATVDKAHGS
                     SPVKDAAPAAAAADASNDAASSPNAQQTTGSEQDDESKVVAGLKNLKLEAKSPPNLVV
                     NGSQTSTAEKSSKVGNGQTPSDDTSQRADSNSELGTKPPSLDGKSITSGTTFALDEKE
                     SLRPDDSASVKAAAEDDDAFSVRGSYMAGSRMGSDVAARIQRIQIGDMPPRALPAHNA
                     LAGNKGQGVGTPPSGVSDKQAVAESKGSLGGGATTPDALAPNAFYSQHPDEKLLEAMQ
                     SPKDRIFLLRLEQQVIEFVQDSKEPYMDLPPSNSFCRMLTHRLADYYHMTHSYEAAQG
                     AVRIFRTPFCRIPPSLSSIAASTSNSSSPAPVVLPRKIMRRGEDGELGPASATPSKPT
                     SEAGSESKEKPAPPKEKLTREEREEAYNRARQRIFGSVEKSENSNQDGEDSNGVSRAS
                     SVSGKDKPNGGKRKPKRRDDSENFESRSQFVAWPQHPGWGPSAPQYFPVNAAPFAGQF
                     QQPYPNTPQPVYAPSQAYAPQMVPNNGFAPQYTGMPTYPTPPLPPAVPQAVPPPPQQG
                     YRGPNPPMGGPYGSPMPSISQPEWPQQGFNQNAYPPRSSPVPPAGIPYAYGQLPANAN
                     PSDPKSQHPIPGSYNRQAFNPKTQSFVPGNGLPLQPPPPPHVSGPYGGSNSRHGSPQF
                     HSPHVNYSGYQQPLPQPGFAPPPGPYGMTRQGSNNSMPPYHAVQQPPHVQPPPPHGSQ
                     HMPPGGPMHMPNKPAGPAPTGPGQSFSHLPNYGNPATLPQKPST"
     gene            complement(1044931..1046477)
                     /locus_tag="MYCTH_2300392"
                     /db_xref="GeneID:11511920"
     mRNA            complement(join(1044931..1045995,1046171..1046477))
                     /locus_tag="MYCTH_2300392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661193.1"
                     /db_xref="GeneID:11511920"
     CDS             complement(join(1045003..1045995,1046171..1046275))
                     /locus_tag="MYCTH_2300392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661241.1"
                     /db_xref="GeneID:11511920"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Spoth2_2300392"
                     /translation="MAVDQEHFVHLARPLPPTSMGFAGSAPLTVNIQPQAVFSVIDHA
                     TRRDIRDTQSTRVIGALVGTRSEDGSEVEVRSTFAIPHTENEDQVEVDVEYQKNMLAL
                     TLKASPRETLLGWYTTSHELNSFSALIQNFFASPETGTFPHPAVHLTISTEPGAPIET
                     KTYISAPVAVSPDRAAESCLFIEVPHKLLFTDAERAALGTASAAAANESRSAPVVSDI
                     DSLAQALTTVSDLLDRVSGYVGEVLDEERDGNQALGQYLMNALSLAPKVSPAQIEADF
                     NNHIQDVLMVSYLANTIRTQIDLAQRLATAPLVGSGGEKEGGDKGKDGEEGGGKQESR
                     GAKGGKRGVRSGGGRSTGQRGEPREPRETGE"
     gene            1047021..1049144
                     /locus_tag="MYCTH_2300393"
                     /db_xref="GeneID:11511921"
     mRNA            join(1047021..1047749,1047803..1049144)
                     /locus_tag="MYCTH_2300393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661194.1"
                     /db_xref="GeneID:11511921"
     CDS             join(1047070..1047749,1047803..1049105)
                     /locus_tag="MYCTH_2300393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661242.1"
                     /db_xref="GeneID:11511921"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="JGIDB:Spoth2_2300393"
                     /translation="MEVDSDEEDEDDVQQPAQPYMSLMRSLVESAPKAKRRKLDHPST
                     EGHDRDSSKPEAAPEPAHGNEEESGEEGDPDMVEEPEEDPTNLAPEDLFDEDDELDST
                     DPFETHFADPKEEEVQPKLKAIKEGKWRMERIPTKSTRIFLSTPDTGDAAAKLLPAPV
                     SGISDLKLKKRLHDAMASKHPKFDQVEQTIAPLLFNYQDVLYCNRTVAGSQGVRRMAA
                     LHALNHVFKTRDRVIKNNSRLSRADPNEDLELRDQGFTRPKVLMILPTRQSCVKMVEM
                     IVSICEPDQQENRKRFEDGYVDKQSKFSDEKPEDFRDLFSGNDDDMFRLGMKFTRKTI
                     KYFAQFYNSDIIFASPLGLRMAIGSEEEKKMDYDFLSSVELVIVDQADALLMQNWEHV
                     EFIFEHLNIQPKDAHGCDFSRVRNWYLDDQAKQFRQTAVFSAFNTPELAELLRAHCHN
                     WAGKARLQQECPGTIQYLPVKARQTFSRFEAATIAADPDARFAYFTKAIVPMLTRHKG
                     RDAAGTLVFIPSYLDFVRVRNYFANNTAVEHVSFGTISEYTDVPEASRARSHFLNGRH
                     KVLLYTERAHHFRRYRIKGVKRVVMYGLPDNPLFYQEVAGGYLQRSEQSLMLEPGQGV
                     VRVMFSKYDVMKLERIVGTSRVGKMIHDQGDTFDFV"
     gene            complement(1049165..1050340)
                     /locus_tag="MYCTH_2300396"
                     /db_xref="GeneID:11511922"
     mRNA            complement(join(1049165..1049812,1049929..1050340))
                     /locus_tag="MYCTH_2300396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661195.1"
                     /db_xref="GeneID:11511922"
     CDS             complement(join(1049492..1049812,1049929..1050144))
                     /locus_tag="MYCTH_2300396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661243.1"
                     /db_xref="GeneID:11511922"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="JGIDB:Spoth2_2300396"
                     /translation="MAGGHMKYRQLSRTSAHRQALLRNLVTSLIKDESIHTTWPKAKE
                     AQRLAEKLITHAKKNDEVSRRKAQGILYTPHELMPKLFGEIRERYLNRPGGYTRVLRT
                     EPKDKYDQAPSAILELVDGPKDMRFAMTAAAVARDRALGKPHTELTEKNIAKVTRYRR
                     GGREAFEEMVNKIASLRL"
     gene            1050582..1052015
                     /locus_tag="MYCTH_2300398"
                     /db_xref="GeneID:11511923"
     mRNA            join(1050582..1050838,1050943..1052015)
                     /locus_tag="MYCTH_2300398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661196.1"
                     /db_xref="GeneID:11511923"
     CDS             join(1050818..1050838,1050943..1051866)
                     /locus_tag="MYCTH_2300398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661244.1"
                     /db_xref="GeneID:11511923"
                     /db_xref="JGIDB:Spoth2_2300398"
                     /translation="MGFVAGFAGGVTLTLSLTYLALLTHTSNRQAQSAVLRSQASAID
                     ALIPPEDDHLGRRRRRNATVPLPDGTYRPRESLEQYRRDAAAGGAGPGVSFIETAKTR
                     WNSEILSAVRWAQNKDWSRVREQAEDKVAALLGLELSREPVTVEEVVAVSPPAVRQHH
                     YHSDQQHQPQLHPQHQQQAEHEEAVRRARDSLHHARDTTVAVAQAMRDEAREIVSEAR
                     EVVAAGVHEAKGAVEKGVEKAHDLVERTKAAVHLAEERAESEAYAKMLPVSDIEKALA
                     ERYDSARREERMKRSVEEVLRERYLPLDKRDNSRLRGL"
     gene            complement(<1051998..>1052853)
                     /locus_tag="MYCTH_2124971"
                     /db_xref="GeneID:11511924"
     mRNA            complement(join(<1051998..1052519,1052602..>1052853))
                     /locus_tag="MYCTH_2124971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661197.1"
                     /db_xref="GeneID:11511924"
     CDS             complement(join(1051998..1052519,1052602..1052853))
                     /locus_tag="MYCTH_2124971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661245.1"
                     /db_xref="GeneID:11511924"
                     /db_xref="JGIDB:Spoth2_2124971"
                     /translation="MSSRVVPIHGLDPEEKVEATLVWDGRSSPDFERDVCLGDLIHDF
                     PTSIPYPRALWAPAHRALAHLPGLLRRAAIFLLPSFIQPLTASAPACSRGRATFAGDP
                     RFLRNVRESPTTEPAADRHDDGAAGAGVGGQRVPVRARLGLAALWGPGGGGGEAMDVH
                     LWTVPVEFRCSMVLFLTLLGTARLRRGWRFVVIGASVAFAYLSQRWELVLFYAGMVLA
                     EMDVARSAHGHLGVRRILAGCRWPRRELCEVAGGEMFDL"
     gene            complement(1053598..1055675)
                     /locus_tag="MYCTH_2300401"
                     /db_xref="GeneID:11511925"
     mRNA            complement(join(1053598..1054950,1055062..1055675))
                     /locus_tag="MYCTH_2300401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661198.1"
                     /db_xref="GeneID:11511925"
     CDS             complement(join(1054042..1054950,1055062..1055301))
                     /locus_tag="MYCTH_2300401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661246.1"
                     /db_xref="GeneID:11511925"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="JGIDB:Spoth2_2300401"
                     /translation="MSFSSLVQDLSLRDSSAPRRRGEASVSTVDDRASHISMAKSYTS
                     TAATSVSISGDIGSQLHAGYSHPLARSWQAERQLTKSMLIYPIFVSDQDDEEVLIPSL
                     PNQYRRGINRLVPFLEPLVHKGLRSVILFGVPLKPGTKDALGTAADDPEGPVIRSIRL
                     LRQRFPHLYIVADVCLCEYTSHGHCGILRDDGSLNNQLSVDRISDVAVAYARAGAHCV
                     APSDMNDGRIRAIKLKLIEEGIVHSVTLMSYAAKFSGCLYGPFRDAAGSTPSFGDRRC
                     YQLPPGGRGLARRAIIRDINEGADIIMVKPAGQYLDIIADAKELGRDLPIAAYQVSGE
                     FAMIHAAAKAGVFDLKSMAFESTESILRAGATIVISYFVPEFLDWLSN"
     gene            <1057604..>1059562
                     /locus_tag="MYCTH_107168"
                     /db_xref="GeneID:11511926"
     mRNA            join(<1057604..1058697,1058941..>1059562)
                     /locus_tag="MYCTH_107168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661199.1"
                     /db_xref="GeneID:11511926"
     CDS             join(1057604..1058697,1058941..1059562)
                     /locus_tag="MYCTH_107168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661247.1"
                     /db_xref="GeneID:11511926"
                     /db_xref="JGIDB:Spoth2_107168"
                     /translation="MAGSTDQQSGRREASDSVDRPGSPGTQSPIPRIVVEPADDRIGD
                     NGPPPATRQSAAPRERPRLSERPFLEVPSPPRPSHRRLGSQQIGSSQPSREPSRSRIP
                     QSLTGTLGLPPLMTGPIHPLRMHPVHLTGSSSMPIADTTGRPLGLRYDGNPYTLQGKA
                     VMEKVDKMLAASRALKPEAERSSKGSRSGAAGAMGFLKKLRSPSQLFSKPKPRVPIKP
                     HQIRHITGSLEPLPLPEQTRHVPSVCLRRNELGNLKREKALRVLGETPNLDPLPSIDL
                     DPAATSPDLSFSSTSISTEDDHPFFSRSGTTTTADIATDTATNTITTANNNTTTTTMA
                     AAVTTETVAETATLSGRAPAGFETRPLRAARSGSSRGVTSGAGAGTAAGAGAGIRTAP
                     ESPTMAARTTTTTITTTTSNSTTSSTNAGAGMHTSTRAFRRRSRSVPSLDALLTTPPL
                     QGRPRPHPQADAEGAGPRSAAGAGAGAGAGAGAGAAAAVAPPPSRWVSPRAGGGDRVA
                     TKRHPTPALGDLAALERALRERFPGLAGEGSRVVVVEENEEEVEEEEEEEGKPGDLQP
                     PAGYF"
     gene            complement(1059881..1061533)
                     /locus_tag="MYCTH_2300403"
                     /db_xref="GeneID:11511927"
     mRNA            complement(join(1059881..1060431,1060540..1061533))
                     /locus_tag="MYCTH_2300403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661200.1"
                     /db_xref="GeneID:11511927"
     CDS             complement(join(1060097..1060431,1060540..1061056))
                     /locus_tag="MYCTH_2300403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661248.1"
                     /db_xref="GeneID:11511927"
                     /db_xref="JGIDB:Spoth2_2300403"
                     /translation="MSSTTPDRDFLLALAHTDVFTPLPATTLAAVLASPPFVSIPDTF
                     NARDLGLVPGSPIPPGRLYRTAVFPTEVSAEGRAALRERLGVGRMVDLRTAGERARRP
                     EPAVDGVEEIWIEPEEGLAPNLDDFGEGEGEKGAVRMYLDVLRLYRGGIRAVLEQVRD
                     GWERGAVLFHCNAGRDRTGVVAAILLSLAGAGAETIALDYLLSRIGIEPAKEQLLAYV
                     TKGRMAANMDARGFRNMANLKLGCWEAFVKAVDAEYGGFEGYVRGPLGLSEEDVAKIK
                     NNLVFPN"
     gene            complement(1062106..1063853)
                     /locus_tag="MYCTH_2142826"
                     /db_xref="GeneID:11511928"
     mRNA            complement(join(1062106..1062862,1062918..1063000,
                     1063060..1063140,1063204..1063233,1063293..1063316,
                     1063450..1063480,1063534..1063590,1063667..1063853))
                     /locus_tag="MYCTH_2142826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661201.1"
                     /db_xref="GeneID:11511928"
     CDS             complement(join(1062661..1062862,1062918..1063000,
                     1063060..1063140,1063204..1063233,1063293..1063316,
                     1063450..1063480,1063534..1063590,1063667..1063710))
                     /locus_tag="MYCTH_2142826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661249.1"
                     /db_xref="GeneID:11511928"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="JGIDB:Spoth2_2142826"
                     /translation="MTRKLKFHEQKLLKKHDFINYKQDNNHRHHDVARRYMIQKPEDY
                     HKYNRLCGSLRQLAHRLSLLPPENEVRRKHETLLLDKLYDMGILSTKSKLSQVEHNVT
                     VSAFARRRLPVVMTRLRMAETVQAATKLIEQGHVRVGVEEIRDPAFLVTRNMEDFVTW
                     TVGSKIKQNILKYRDKLDDFELL"
     gene            1063972..1065241
                     /locus_tag="MYCTH_2300408"
                     /db_xref="GeneID:11511929"
     mRNA            join(1063972..1064249,1064344..1064729,1064828..1065241)
                     /locus_tag="MYCTH_2300408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661202.1"
                     /db_xref="GeneID:11511929"
     CDS             join(1064144..1064249,1064344..1064729,1064828..1065061)
                     /locus_tag="MYCTH_2300408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661250.1"
                     /db_xref="GeneID:11511929"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="JGIDB:Spoth2_2300408"
                     /translation="MSSCRQWLSSAVRQCRIGPAQQQPRSFSTSAPVAAFRSIFGDNE
                     SNAGTTSSSARRQRPSSNSNEALYGLLTESVERGGPLSAEEQRQVMEQQGGLGARAYV
                     KDLRATATTDNYLRQMPRRWRTGDVYAPRDMSPAEMRKWRQGRRPTRDIIDMLGFNPL
                     DNYKNFSLISEFMTTMGRIKHSSETGLRPVNQRKIAKAIRRAIGMGLHPSVHRHPEIL
                     RLSRHGLPTASIPTPSDPSQNRL"
     gene            complement(1065212..1068291)
                     /locus_tag="MYCTH_2300411"
                     /db_xref="GeneID:11511930"
     mRNA            complement(join(1065212..1065564,1065695..1068032,
                     1068104..1068291))
                     /locus_tag="MYCTH_2300411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661203.1"
                     /db_xref="GeneID:11511930"
     CDS             complement(join(1065399..1065564,1065695..1068000))
                     /locus_tag="MYCTH_2300411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661251.1"
                     /db_xref="GeneID:11511930"
                     /db_xref="JGIDB:Spoth2_2300411"
                     /translation="MRSQLTRNVYLRLLASRGLLRPCPSPPGRCLAVSSRATPFPLLA
                     RRQPRRTFFGIFQKPPRMLKEPEIEPGYDVLLHYRSLETENARPPEREELLKGWRQFI
                     QHKRKNHLRSLNSTQAFLAYRLLLHLVETGPEDEEGQGDDLSFADLRAALWVTAMKPP
                     KGTTEHHLDLAKLLYGEIERRIQKMRELGIDEDVIREAVGGKDTGDLELFFTALTQYG
                     GSLEAAQRLAELKDTLAERKLVPRVRVFWTLVLRGLAKEGREEELLAEWKKAEAAKVE
                     YMPPIHEIMTTFYATRDRIEETKYWFEKPVHANWARSPKSYMEVVRFALRNGQQQWLQ
                     PVFEQLINSNPQKEWWDVIFQWAVLVMDKGVEDIKQMIDVMSSAQAGKEGKESPKPDA
                     ATIDALITAAIEKQNPYLAERFVSLGAELKIRPRASTYILQMDYRLDAKDFSGVQAIY
                     DKLLRGEVAVKQDEDLPVLNKYLRALCSVPEPDVGRILDITADLEQRQATLEPETVVA
                     LCMVFLRSDNQYEVIDTLSLHTVSYSLEERAQVRRAFVEYCLDRRVSTARAWDCYSLL
                     RQFFPETEPEERVLLMDGFFARRRPDMACYVFGHMRSQSNPAQRPTADMYVRCLEGLG
                     RCPENGGVEGGEEGAGESLRMVHNMLKMDTTIQMDTRLYNALMIAYAAAGEPDVAIDF
                     WRDITNSAEGPSYASLAIVFWACELLPYGDRTARTIWQKIQRMDLEVPPDVFWAYCGA
                     LAGSGHVEEVIRLIRGMEASVGYGPGLMTLGVAYNALPGESRKEQFEAWARAEYPDIW
                     AQLEKKGRKETLRGTKFNIVRDMRA"
     gene            1068430..1069805
                     /locus_tag="MYCTH_2300414"
                     /db_xref="GeneID:11511931"
     mRNA            join(1068430..1068911,1069103..1069805)
                     /locus_tag="MYCTH_2300414"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661204.1"
                     /db_xref="GeneID:11511931"
     CDS             join(1068530..1068911,1069103..1069617)
                     /locus_tag="MYCTH_2300414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661252.1"
                     /db_xref="GeneID:11511931"
                     /db_xref="JGIDB:Spoth2_2300414"
                     /translation="MAPTPPTVLSLKQSFLTTQTRLLSQPLAPTRAWLSSNSNSNNNN
                     NDDDDDEPPLPEKAIDDALFKLNHRLQQHARRVYPPQATRHVAEQIDQLYWNAAAQAT
                     DGARGGDADSDADGEGEGVRPGADLANPDVIATLPLEWEEDGSTSQQQPLEAKRYAEL
                     VGELRALAERKQQAVARVARLRRIRALLEPFSPSSRSGGDGSGGGDDDDGGDSGGGGG
                     TLDAVQENLITRNGEIEAELSRMRMLLARVGGRVGQLKEQGRQARESSAGSLFSDRGE
                     GVGDVDVEMEEQRKVGLLLERF"
     gene            complement(1070662..1073549)
                     /locus_tag="MYCTH_2300415"
                     /db_xref="GeneID:11511932"
     mRNA            complement(join(1070662..1072729,1072792..1072902,
                     1073007..1073023,1073089..1073549))
                     /locus_tag="MYCTH_2300415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661205.1"
                     /db_xref="GeneID:11511932"
     CDS             complement(join(1070990..1072729,1072792..1072902,
                     1073007..1073023,1073089..1073203))
                     /locus_tag="MYCTH_2300415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661253.1"
                     /db_xref="GeneID:11511932"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="JGIDB:Spoth2_2300415"
                     /translation="MSSALSKRQQARNEKSLQELLHNVPGNNLCADCQARNPGWASWS
                     LGIFLCMRCASIHRKLGTHVSKVKSLSMDSWTSEQVDNMRKVGNVVSNKLYNPDNKKP
                     PVPVDADEADSAMERFIRQKYVSRSLSAGKRRPGDEPEETPPPLPPKTPSRFNMRSAS
                     SIFPLGSKSKKGSGSEPNSPREPEARPPLRNKSSGVFGLSVERDRADGDDTAQKLAKL
                     RDMGFTDDQKNSMVLKGVNGNLEKAIEALVRLGEGSGRTPALLTPARAATTPVTRSLT
                     PGANTEANRTRPVSPASTNPFDALDAPPPPQPLSTQSTGTLQTKNPYLSTNPFGAPLQ
                     APSALDLAFQNMSLAPPSQPLFPNHTGGLAQQQNAQMLYQWPTSGPLTAPLSATTQGY
                     SGMATSGSQTYPQQTQPVMPSHNPFFPTQTQPQQQPLSVNTSPFGGNFGSNPFTRSPT
                     RIQSPTLSQIPEQTQQNFYAQSVQPAQPQTTNPFLNQLTPPAQQFPAQMQMQNPQHMG
                     LAPQMTGYMQQQPQQQPPRPDKASILALYNYPQLAPTQNSLQNQNAGQATPAQTANSP
                     FPPQSFPQQQQQQQQQTPPPAQAQQQPQQATPVSSAAMSKNPFASAATSQPGRLMEST
                     PKHNVSRDSMMAQGLEWSNGRHSPDAFASLSARDTR"
     gene            complement(<1076292..>1077924)
                     /locus_tag="MYCTH_2059212"
                     /db_xref="GeneID:11511933"
     mRNA            complement(join(<1076292..1076390,1076483..1076933,
                     1077097..1077108,1077177..1077444,1077801..>1077924))
                     /locus_tag="MYCTH_2059212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661206.1"
                     /db_xref="GeneID:11511933"
     CDS             complement(join(1076292..1076390,1076483..1076933,
                     1077097..1077108,1077177..1077444,1077801..1077924))
                     /locus_tag="MYCTH_2059212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661254.1"
                     /db_xref="GeneID:11511933"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_2059212"
                     /translation="MAPPPPTSSGISFRSADRPLDNYQFTFESYLDDSSRIEPDVSYH
                     FPNDAPENDRVEEQYAIIEMVLDGRLHLAPFSRANPPRRVLDIATGTGTWAIEMGDQY
                     PEAEIIGTDLSPIQPTFVPPNVRFFIEDSSDDWDYPNLFDFIHTRLTTGCWSDMKTQI
                     IQRAFDHLQPGGWLECQEIPSMVYCDDDTLPDDWGWLRWTREFQVAGRLANRDLNAGP
                     DIKDWMCEVGFVDVHEAVFKIPINGWPREARLKQLGMMWQRNLLEGLSAFSLGMFCRF
                     MGKTVEEIELSLVDVRKSLFDRDVHAYHKLYVVWGRKPEAA"
     gene            <1080910..>1087219
                     /locus_tag="MYCTH_2124981"
                     /db_xref="GeneID:11511934"
     mRNA            join(<1080910..1081109,1087210..>1087219)
                     /locus_tag="MYCTH_2124981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661207.1"
                     /db_xref="GeneID:11511934"
     CDS             join(1080910..1081109,1087210..1087219)
                     /locus_tag="MYCTH_2124981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661255.1"
                     /db_xref="GeneID:11511934"
                     /db_xref="JGIDB:Spoth2_2124981"
                     /translation="MGRFFVASRGRISKNRTRKVIRAVLENRLDILDNEQKKLARWAR
                     ESEDSDDVPPGKQLLHSDYFWHCGE"
     gene            1096449..1098780
                     /locus_tag="MYCTH_2300423"
                     /db_xref="GeneID:11511935"
     mRNA            join(1096449..1097824,1097936..1098057,1098119..1098780)
                     /locus_tag="MYCTH_2300423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661208.1"
                     /db_xref="GeneID:11511935"
     CDS             join(1096654..1097824,1097936..1098057,1098119..1098649)
                     /locus_tag="MYCTH_2300423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661256.1"
                     /db_xref="GeneID:11511935"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="JGIDB:Spoth2_2300423"
                     /translation="MAHPPTTDPANTTDMPISTSTTGTPAAMNNPNPETETTDPETDF
                     LLQSYIRLRHAISTKTHRGGDDDDDDDGQHQHRHHHHRHQQPSDRRPVLPTREALAAA
                     LSSLPTRGSPSYLEGRGAAQTHAHLLAALLPALNAQALSPRYYGFVTGGVLPVAEAAD
                     NLVTALDQNVQVHFPLPPGPGSGAPEKEEEEEEEEEEEGPGWTHSASTAVEDAALRML
                     IDLLHLDGEEDDEGKGARTDPRWPGRTFTTGATASNVLGLACGREAVVNARAARAGGK
                     KTVAGDGLLAACLAGGVREVQVLTSMGHSSLAKAASLVGLGHGSIKDVGVPGEPWRLD
                     LDAVERELEREDEGVLSIVVVSAGEVNTGRFATNVLDMPKLRSLADRYGAWIHVDGAF
                     GLFARALPKTDEFLGLHANVAGLELADSIAADGHKLLNVPYDNGIFLCQHASVLTQVC
                     SNPNAAYLASSPGDPNAILSPLDIGIENSRRFRALPVYAVLLSEGREGIAAMLSRMVL
                     LAREIAAFVRDSDHYEWLPTEEASLESTYIIVLFRAKDPELNEVLVDRINASGRMFVS
                     GTKWEGKKAVRIAVASWRVDVERDAAVVKEVLTAIAVGRKC"
     gene            complement(<1098837..>1099112)
                     /locus_tag="MYCTH_46719"
                     /db_xref="GeneID:11511936"
     mRNA            complement(<1098837..>1099112)
                     /locus_tag="MYCTH_46719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661209.1"
                     /db_xref="GeneID:11511936"
     CDS             complement(1098837..1099112)
                     /locus_tag="MYCTH_46719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661257.1"
                     /db_xref="GeneID:11511936"
                     /db_xref="JGIDB:Spoth2_46719"
                     /translation="MAQGEVKKKAKADPGGKGGKAGGKQQQKKSGVTKPKKAKTTADK
                     IQKKYTAGLVAKTEQMLGERAGHLELIGKGRKKGAEKQFKGGSRKFG"
     gene            complement(1099343..1102019)
                     /locus_tag="MYCTH_2300427"
                     /db_xref="GeneID:11511937"
     mRNA            complement(join(1099343..1100028,1100104..1101411,
                     1101462..1101570,1101634..1102019))
                     /locus_tag="MYCTH_2300427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661210.1"
                     /db_xref="GeneID:11511937"
     CDS             complement(join(1099555..1100028,1100104..1101411,
                     1101462..1101570,1101634..1101830))
                     /locus_tag="MYCTH_2300427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661258.1"
                     /db_xref="GeneID:11511937"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="JGIDB:Spoth2_2300427"
                     /translation="MAALKFVPFSSEIELPFYSALFSSKLDHDKLDDSARPVMGLYEP
                     RSQADSQGARMQILGSALTNRDVPAGMTRAKGYIKNVNTIEEFKNTDKTAMITDAGRQ
                     IWEAIQDGTIYSVPSLLSSFAILSFADLKKYQFTYWFAFPALHSDPAWKQTGPVGHIT
                     PDESTALVDAVGTWRYAVSTEGEHGFFLAKKVRGENGAPRQLPEEDASPDIGYQWQIG
                     SLRDFETGFFNDVPEEDRYVAFVDPSNYPESPSWPLRNLLVLIRQRYRLNKVQILCYR
                     DIQARRHEARSIILPLASDAADVTPATKMPNVTGWERDASGKLRRRLVNLTEYMDPTR
                     LADQAVDLNLKLMKWRLAPNLDLDTIKNTKCLLLGAGTLGSYVSRNLMGWGVRKITFV
                     DYGAVSYSNPVRQPLFQFEDCLSGGRPKALRAAEALKDIYPGVEAEGHVLSVPMLGHP
                     VLDEAKVKADFTKLQELVDAHDAIFLLMDTRESRWLPTVMGKASNKIVMNAALGFDTY
                     VVMRHGALPEDGSEETLGCYFCNDVVVAADSMKDQTLDQQCTVTRPGVAAIASALLVE
                     LLTSTLQHPRKHHAPAPVPSQGSGSNYERDPVDHPLGLVPHQIRGFLSNFQNMVIHGR
                     SYPQCSACSKPILSAYKSEGWEFVKKALDSRDYVAELSGLAEVQRQAEAAAAEVEWSE
                     DEGLPEEGEGVLL"
     gene            1102431..1104176
                     /locus_tag="MYCTH_2300428"
                     /db_xref="GeneID:11511938"
     mRNA            join(1102431..1102709,1102784..1103826,1103893..1104176)
                     /locus_tag="MYCTH_2300428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661211.1"
                     /db_xref="GeneID:11511938"
     CDS             join(1102688..1102709,1102784..1103826,1103893..1103940)
                     /locus_tag="MYCTH_2300428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661259.1"
                     /db_xref="GeneID:11511938"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Spoth2_2300428"
                     /translation="MFIGICGSICAGKHTIARYLVDHHGFTQLHLDLRPNHGTEHTTG
                     GATPADSSSSSLSSSGTSSKHPYHFSSPDDLLDFVTKHWRERWVTTDIPSESVLDQYA
                     RRPFFLLLSVDAPITVRWQRYQARQKQRQALLPNSTAPPDGSPPAAAPTLDSFETFAA
                     LSDAHLYDPVTGVNPLVSRAAVRLLNTSSSLAHLYATLGKLDLLNPDRLRPSWDSYFM
                     ALASLAAQRSNCMKRRVGCVVVRDKRVISTGYNGTPRGLRNCGEGGCGRCNAAQGSGH
                     GLSTCLCIHAEENALLEAGRERLRDGAVLYCDTCPCLTCSIKIVQVGIGEVVYSQGYS
                     MDQEAAAVFREAGVRLRQFVPPANGLIHLEKPDLYT"
     gene            complement(1104965..1106441)
                     /locus_tag="MYCTH_2314467"
                     /db_xref="GeneID:11511939"
     mRNA            complement(join(1104965..1105796,1106173..1106441))
                     /locus_tag="MYCTH_2314467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661212.1"
                     /db_xref="GeneID:11511939"
     CDS             complement(1105580..1105774)
                     /locus_tag="MYCTH_2314467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661260.1"
                     /db_xref="GeneID:11511939"
                     /db_xref="JGIDB:Spoth2_2314467"
                     /translation="MAAINYSLVARDSFSTLAKRSNWAGRNAGVMVVFCVVFVVGVGL
                     IGLWIYKKVLARREKRQSHV"
     gene            complement(1108769..1109859)
                     /locus_tag="MYCTH_79765"
                     /db_xref="GeneID:11511940"
     mRNA            complement(join(1108769..1109397,1109472..1109859))
                     /locus_tag="MYCTH_79765"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003661213.1"
                     /db_xref="GeneID:11511940"
     CDS             complement(join(1109028..1109397,1109472..1109842))
                     /locus_tag="MYCTH_79765"
                     /note="CAZy_ID 267852"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003661261.1"
                     /db_xref="GeneID:11511940"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_79765"
                     /translation="MKLSLFSVLATALTVEGHAIFQKVSVNGADQGSLTGLRAPNNNN
                     PVQNVNSQDMICGQSGSTSNTIIEVKAGDRIGAWYQHVIGGAQFPNDPDNPIAKSHKG
                     PVMAYLAKVDNAATASKTGLKWFKIWEDTFNPSTKTWGVDNLINNNGWVYFNLPQCIA
                     DGNYLLRVEVLALHSAYSQGQAQFYQSCAQINVSGGGSFTPASTVSFPGAYSASDPGI
                     LINIYGATGQPDNNGQPYTAPGPAPISC"
     gene            1111242..1112568
                     /locus_tag="MYCTH_2300433"
                     /db_xref="GeneID:11511941"
     mRNA            join(1111242..1111483,1111600..1111890,1112068..1112568)
                     /locus_tag="MYCTH_2300433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661214.1"
                     /db_xref="GeneID:11511941"
     CDS             join(1111352..1111483,1111600..1111890,1112068..1112424)
                     /locus_tag="MYCTH_2300433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661262.1"
                     /db_xref="GeneID:11511941"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="JGIDB:Spoth2_2300433"
                     /translation="MASKLTPFLTRTVARTASRVARPMALPTRAFSLSARNQSDTLMV
                     HRNTPDNNPDIPFKFTEQNERIIAEILKRYPPQYKKAAVMPLLDLGQRQHGFTSISVM
                     NEVARILEMPPMRVYEVATFYTMYNRTPVGKFHVQACTTTPCQLGGCGSDAIVQAIKE
                     HLGIKQGETTKDGLFTFTEVECLGACVNAPMVQINDDYYEDLTPETIKSLLTALKESV
                     TDVSKAPKPGPQSGRKTCENSAGITSLTSEPWGIEKTRDDL"
     gene            complement(1112570..1114762)
                     /locus_tag="MYCTH_2300435"
                     /db_xref="GeneID:11511942"
     mRNA            complement(1112570..1114762)
                     /locus_tag="MYCTH_2300435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661215.1"
                     /db_xref="GeneID:11511942"
     CDS             complement(1112903..1114657)
                     /locus_tag="MYCTH_2300435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661263.1"
                     /db_xref="GeneID:11511942"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="JGIDB:Spoth2_2300435"
                     /translation="MHSFKLLKRRITEMFHSLEESIPSMPSLGGHGRSSAMKGTWEKL
                     QIPPLPRSSHSADIVGGTLYIFGGEVEPRRPVDNDMHAITLPSSGAQADYYAIEAKPA
                     KPAARPGAEKPVIPIVKEPEPEAADGEEPAKGAGAGAGTGTPDDKELSEVPLTTPSPE
                     AGLGGDGGGSGDSIISPASRPDLPDVPPPRVGHATAVIGHRIFLFGGRGGPDMTPLDE
                     GGRVWVFDTRTHLWSFLDPRPAAANLPDIPRPAPRSYHSAAATPKPDTFSAKPPAHSH
                     SNNNKTEAWRDWALGTSAEAERTLGTPQRPVVGVLAERATDPEDDGYGTFIIHGGCLA
                     PSAPGAPTERASDVWAFDVRSRVWQRLPDAPGAPRGGAALAISRGRLYRFGGFNGASQ
                     EGGQLDFLELGVDVFDDQVSRGEAVLCARGGWKSLLFGKEDVGYDDEEAGTGARWPGS
                     RSVAGLEAVTVGGGREYLVLVFGEREASGVGHAAAGRFWDDVWAFQVPPEDMSLASVA
                     DTALSVVGRKSGEGTWTRVQLGPHDDEDDASADGPGPRGWIATAPMGELEENGIVVFG
                     GLDERNRRLGDGWILRLD"
     gene            complement(1115134..1118046)
                     /locus_tag="MYCTH_2300436"
                     /db_xref="GeneID:11511943"
     mRNA            complement(1115134..1118046)
                     /locus_tag="MYCTH_2300436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661216.1"
                     /db_xref="GeneID:11511943"
     CDS             complement(1115449..1117920)
                     /locus_tag="MYCTH_2300436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661264.1"
                     /db_xref="GeneID:11511943"
                     /db_xref="InterPro:IPR006823"
                     /db_xref="JGIDB:Spoth2_2300436"
                     /translation="MGEQPEQAVPSLPFAEAETGKGDTPRRPEFRNGPPDTRPSQQHQ
                     VEKRENTTTSSGSRQRYRRVFYYCAAILLHLIFIRLVYEAFSPRWTTPLLRASDQDEA
                     TSSFGDRYLVGVGKADITGPVVEVNLMGYADPKQVGTGLRQRLYSRAFIVGSIDRPED
                     RFVYLVLDTQSGDTAIRYGIINGLKKLGPSYAVYSHHNVAVTGTHSHAGPAGWLNYLL
                     PQITSKGFDHQGYRAIVDGALLSIRRAHESLQPGYLSVGTTKVYGANINRSLFAYLAN
                     PERERAKYNTSADDDGSVEKDLTLLKFQRASDGKNIGVLTWFPTHGTSLLGNNTLIAG
                     DNKGVAAYLFERSARGDPAAAEDFVAGFSQANVGDTSPNVLGAWCEDGSGQMCSFENS
                     TCSDGKSQACHGRGPFFRVQDNGASSCFEIGKRQFEPAKALYDKLQRDPTPVRGGTVK
                     SFHTFHNMSGFSFALPNGSEARTCPAALGYSFAAGTSDGPGAFDFTQHNGNENTTSPV
                     WKVVSRLLKDATPAQRACHAPKPILLDVGELHKPYDWTPNVVDVQAFRVGQLVIIVSP
                     GEATTMAGRRWKDAVRDASAKLFADEPRGQSSSSSAASPVVVIGGPANSYTHYITTEE
                     EYAIQRYEGASTLYGPHTLAAYINVTLSLLHYLGDGAPAPPSHEDVGLFPPDNSERSL
                     SFISPVVVDRAPMFKSFGQVTADVERVYRRGDPPVRAVFVGANPRNNLRLEGTFAAVE
                     KLSLLREGSQSVWERVRDDGDWALTFHWRRTSEILGTSEVEIAWEPEDWAEPGVYRLR
                     YYGDAKSLGGDTEAFEGVSSPFTLL"
     gene            complement(1118321..1122057)
                     /locus_tag="MYCTH_2138041"
                     /db_xref="GeneID:11511944"
     mRNA            complement(join(1118321..1118589,1118714..1120570,
                     1120637..1121292,1121581..1122057))
                     /locus_tag="MYCTH_2138041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661217.1"
                     /db_xref="GeneID:11511944"
     CDS             complement(join(1119869..1120570,1120637..1121113))
                     /locus_tag="MYCTH_2138041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661265.1"
                     /db_xref="GeneID:11511944"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="JGIDB:Spoth2_2138041"
                     /translation="MSAAGFTSPFGTNSNPFGSSRPDTGGMQRVAEEDENDNVTSPTT
                     PNFGQSAGNSFRGPFGGDSTSDSQQSSIRGPPSAEGYPAQYNFGRRTSVSAESLKPVG
                     DSYDNWSPPVHAKTPEQLDRLKKAISGNFLFSHLDDEQSAQVLGALVEKPIPTKGIKV
                     ITQGDAGDFFYVVEKGSFDVYVNNSGSLQPGPDGMGQKVGTIEAGGSFGELALMYNAP
                     RAATVISAEPQCTLWALDRVTFRRILMESTFARRRMYEGFLEEVPLLSTLTPYERSKI
                     ADALESQKFPAGHTIIQEGDPGHSFYLLESGEAVAYRSGNDTPVKHYKKGDFFGELAL
                     LNDAPRAASVVSQTEVKVARLGKSAFQRLLGPVEGIMRRTKYVGVKTGLDEVDSLQVS
                     "
     gene            1123517..1124944
                     /locus_tag="MYCTH_2300439"
                     /db_xref="GeneID:11511945"
     mRNA            join(1123517..1123855,1123936..1124944)
                     /locus_tag="MYCTH_2300439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661218.1"
                     /db_xref="GeneID:11511945"
     CDS             join(1123637..1123855,1123936..1124937)
                     /locus_tag="MYCTH_2300439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661266.1"
                     /db_xref="GeneID:11511945"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="JGIDB:Spoth2_2300439"
                     /translation="MAFRRRRGAANDAGDAASENDGHKNRPPNTAFRQQRMRAWQCVL
                     TPKLIVTIFSILAAIYLGFGAWLTYLAYTVRDIRINYTNCQKEATSKFEPMPSKYISA
                     HFSKTDSSYNPYEAEWMKETLVVQGKGFTDPRDYCRIRFNIPEELQPTISFFYNLENF
                     YQNHRRYVNSFNAKQLLGDAVDGRTINDSTCDPITSDWRGTGKIVYPCGLVANSLFND
                     TFSSPVLLTVPGSNAANETYNMTTKGIAWSGMKDLYGVTKYSYDQIVPPPNWERRYKN
                     GYTDENPPPDLREDEAFQNWMMLAATPNFYKLYQRNDNDPMKAGQYHIDIEDNFDTTV
                     YNGRKAFVITTLSTMGSRNIWPGIIFLIVGGICLILDVYFILSFFLWKPRKLGDPSYL
                     SWNQPSTSHGHAAS"
     gene            complement(<1124952..>1125206)
                     /locus_tag="MYCTH_101019"
                     /db_xref="GeneID:11511946"
     mRNA            complement(<1124952..>1125206)
                     /locus_tag="MYCTH_101019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661219.1"
                     /db_xref="GeneID:11511946"
     CDS             complement(1124952..1125206)
                     /locus_tag="MYCTH_101019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661267.1"
                     /db_xref="GeneID:11511946"
                     /db_xref="JGIDB:Spoth2_101019"
                     /translation="MDLYVYNARQWQPTLLSQRRGETCKKDKTQRRQGKRNEKGQRQK
                     RHHLPPFAPYNPASQPTLVDRTSRATPYHSATFHLPVPLP"
     gene            1125967..1129624
                     /locus_tag="MYCTH_2300442"
                     /db_xref="GeneID:11511947"
     mRNA            join(1125967..1126247,1126306..1126390,1126453..1126574,
                     1126643..1128248,1128326..1129624)
                     /locus_tag="MYCTH_2300442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661220.1"
                     /db_xref="GeneID:11511947"
     CDS             join(1126071..1126247,1126306..1126390,1126453..1126574,
                     1126643..1128248,1128326..1129431)
                     /locus_tag="MYCTH_2300442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661268.1"
                     /db_xref="GeneID:11511947"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="JGIDB:Spoth2_2300442"
                     /translation="MADIKIDSKTFQERLSHFITAWKSDKRSGDALFAGASSIVILMG
                     KVDEEPEYHKNNAMHFWLLGYEFPTTLMLFTLDTLYILTTQKKAKYLDQIKGGRFPVE
                     VLVRGKDAAENEKLFTKITDAIKAAGKKVGVLTKDTSKGPFVDEWKKVFTENCKDIEQ
                     VDIAQALSAGAFSVKDETELRAMRTSSKACVALLTPYFLDEMSSILDQDKKIKHSALA
                     DKVFGKIEDTNFWKTVELPNRQKMPADFDPEQLDWILGPMVQSGGKFDLKWQTDSDDQ
                     PLHPGVIIAAMGLRYKSYCSQIARTFMVDPNKSQESNYRFLLAVHNLILKEIRDGVVV
                     KDVYNKAYNLIKSKKPELEKHFLKNVGYGIGLENKDPTLVLNGKNTRTLRDGMTLCIT
                     TGFSDIQNPEPQDKNSKVYSLVLTDTIRVTQKEVVVFTGEAPTDADATSFFFKDEEET
                     QPTPKKEKKDPRVGAVATKNITSTRLRSERNTAPDEDAEKRRRAHQKELAAKKQKEGL
                     IKYADATAGKNGVEVKKFKRFESYKRDNQFPPKVRDMGIVIDQKNATIVLPVMGRPVP
                     FHINTIKNASKSDEGDWSFLRINFLSPGQGVGRKDEQPFEDASAHFVRSLTFRSTDSD
                     RYEDIANQISNLKREAVKKEQEKKDMEDVVEQDKLIEIRNRRPAVLDNVFIRPAMEGK
                     RVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNVRHLFFQPCQNELIVIIHLHLKDPILF
                     GKKKTKDVQFYREATDIQFDETGNRKRKYRYGDEDEFEAEQEERRRRAELDRLFKSFA
                     EKIAEAGRNEGIEVDMPLRDLGFNGVPNRSNVYIQPTTECLIQITEPPFLVITLEDIE
                     IAHLERVQFGLKNFDLVFVFKDFSRPPAHINTIPVESLEDVKEFLDSSDIAYSEGPLN
                     LNWSVIMKTVTANPHQFFLDGGWGFLQNDSDDSDGSEEEEEESMFEISESELAEASES
                     SEEDSDYDSNASDDASEDAEVSEEEEGEDWDELERKAKKRDRESGLDDEDRGSKKQRK
                     R"
     gene            <1131803..>1132839
                     /locus_tag="MYCTH_2108584"
                     /db_xref="GeneID:11511948"
     mRNA            join(<1131803..1131815,1131981..1132023,1132158..1132237,
                     1132280..1132529,1132740..>1132839)
                     /locus_tag="MYCTH_2108584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661221.1"
                     /db_xref="GeneID:11511948"
     CDS             join(1131803..1131815,1131981..1132023,1132158..1132237,
                     1132280..1132529,1132740..1132839)
                     /locus_tag="MYCTH_2108584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661269.1"
                     /db_xref="GeneID:11511948"
                     /db_xref="JGIDB:Spoth2_2108584"
                     /translation="MARTWRREHKRGAVAERVLTGEEQGGPGRFSGSLGAPIVKVTAF
                     AVHHPSSVARSKHRAVLTSVVPGSARPEANLEIGRGETGTSAPVSRGETEWMKMVIAA
                     ADRVAHGANTAPSYSYAGATLTPPGDRQAVGFGLGPLSPGEWTTRDQQVPNQWQGSRE
                     T"
     gene            1140522..1142363
                     /locus_tag="MYCTH_2300447"
                     /db_xref="GeneID:11511949"
     mRNA            join(1140522..1140742,1140842..1141832,1141906..1142363)
                     /locus_tag="MYCTH_2300447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661222.1"
                     /db_xref="GeneID:11511949"
     CDS             join(1140927..1141832,1141906..1142298)
                     /locus_tag="MYCTH_2300447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661270.1"
                     /db_xref="GeneID:11511949"
                     /db_xref="JGIDB:Spoth2_2300447"
                     /translation="MATASLISPNTPYQQHQHHNSFSSGYPYSAPITGMTGMISPVEP
                     RRTSAGSEPGHAHRQSLPSISEVLSDRKSLGYVPQPSSAPGHPTPGLPSFTSAPPPRP
                     LSDIIIPDKSSSPRALHPTVSTYPRTEPLPAFSDPARHGLSSRPMPPPLNTFTSQQPS
                     PPVKFEQLEAEQRHAEAQSLRDGHRPPQPPPPTQQPQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQPPLPGLYPETGRLPSGQLPLSAYPVSPRPSGPPLSSPYDAQRPPAYAEEAEYA
                     HHRPSDYKANFDKHFQVNGYQDALQAIMRSCRTGYNFAEAYAAAAQEQQGSQPLPSRM
                     PTENEVSELLSSLVFALKKLEDVRDMVQQNRIQNERARDSNGRSPETEDVPMYGDGMK
                     PPYTMHEVKKRRGVSFFSLSNLSFLDNHTEGKKKGGGEYT"
     gene            complement(<1148883..>1153006)
                     /locus_tag="MYCTH_2124996"
                     /db_xref="GeneID:11511950"
     mRNA            complement(join(<1148883..1149968,1150042..1150627,
                     1150683..1150808,1150862..1151001,1151061..1151126,
                     1151222..1151286,1152898..>1153006))
                     /locus_tag="MYCTH_2124996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661223.1"
                     /db_xref="GeneID:11511950"
     CDS             complement(join(1148883..1149968,1150042..1150627,
                     1150683..1150808,1150862..1151001,1151061..1151126,
                     1151222..1151286,1152898..1153006))
                     /locus_tag="MYCTH_2124996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661271.1"
                     /db_xref="GeneID:11511950"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="JGIDB:Spoth2_2124996"
                     /translation="MDHINLPIPQGNNITDAIRAGIQRLTYAEGRTFSAAWTALDWPN
                     AKKQANLVRSWGIKQLLEIWNKAKGKEADAMLWGDEVEYLVVSYSEQDPKVLLSLKQA
                     DILEALEHDKGLSEKANGQNGSSPQTSQPPPVFHPEFGRFMLEATPGKPWGIEFKELL
                     EVEPNMKLRRRIAKEHMLPNEYPITLTTFPRLGSPGVFTDPSYPVSGPKLRSQFVPDE
                     IANPHIRFPTLAANIRSRRGRKVQVNVPVFRDEKTPWPWRDPTVNYDLHQWPEDDDVR
                     NGAAPDNFIHMDAMAFGMGSCCLQITFQAKNLTEGRQMYDQLSPLGPILLALTAATPI
                     YKGFLADTDVRWNQISNAVDDRTPEELGEKPLVNDRWRIPKSRYASNSTYISEDARLR
                     PEYLDPDLVIDEDIKQQLLDGGMDDRLATHFAHLFIRDPIVIFSEDLKELDLSKTDHF
                     ENIQSTNWQHMRFKPPPADNSIGWRVEFRSMEVQITDFENAAFAVFIVLITRVILSYN
                     LNFYIPITKVDENMQTAHARDAVLTRRFYFRRNLFPTTRAARSSASGASTPSTAASRP
                     PTPTGPVENEYRLMSINEIINGTAYAKATAAVAATAANRGDDPSSQTDAVDKDEEDEF
                     PGLIPLVESYLDSVNVDVDTRCRLATYLDLIRKRASGELWTAARWIRQFVARHPEYQK
                     DSVVGDKITKDLVAAVIRVGELEARGEAFRDVPEVEGFLRELR"
     gene            complement(1153274..>1157428)
                     /locus_tag="MYCTH_2133103"
                     /db_xref="GeneID:11511951"
     mRNA            complement(join(1153274..1156368,1156426..1156665,
                     1157347..>1157428))
                     /locus_tag="MYCTH_2133103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661224.1"
                     /db_xref="GeneID:11511951"
     CDS             complement(join(1153784..1156368,1156426..1156665,
                     1157347..1157428))
                     /locus_tag="MYCTH_2133103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661272.1"
                     /db_xref="GeneID:11511951"
                     /db_xref="JGIDB:Spoth2_2133103"
                     /translation="MKRRADMSPEPVVTEEGGKREKPAHGRPAAQTADIPAEILNFVP
                     PCARKCFQSFISANFDSDICGNSPSLQCLCRQQGTFGYTLGEGAVSCLVAESSRGACQ
                     GQDGGSDAKETAYYMCIGVSNAVSMTHSTILATLVLPPSGTGPLIVPTANPTTTGTDV
                     ATGTTTSMPTPTVRLPTGDEPSSTTTTSSSSPSSSSSAPSSTTATGLASPTQTAETGS
                     GVRDGHSQLSSSQIAGIVLGSTAVIVFGILLVLLARCIRRRRFSDLESGFFNIRESVS
                     FGKKSRPGSSHGVPHITGPLFQVQPQRNPADPRWQPGMPRAGVGLAISPLAARGGGLA
                     RSSPAQAPALSVSRPPTPPRKPSPVSVPKLVPPPRSVPKAGLSPAPGTMAPTARRSPP
                     KPTLTLAIPKGQERMVRAPVSSRDSVVTEFAEDGEGDTAPGPAIWRPPTSDPLSATTV
                     YYADKGGNWILRNSSTKQPGQGQGSSSRAPGPTKRVIQEVPAAPVEVELPSPEHKTRA
                     ERARDAYGGFSPDAVVSPLRLPRKPGRQRLGSPISFKDQRREPQISSPSVSARLSQTA
                     ETIMSESPQASSQPIDTYFATVRESRDLTGGKTKRRSAQKFGRRVSQESATSIESTAE
                     DEDMIEDERQADLSPVAESPRTPVSPGKPPVKYPAIRKHNDKQQQQQQQQPPPDRVAG
                     SELLPPAHRYNVWHPPGRSSPTGMGSMVKLGPFTPDASQSRSNRPERLRNAPSPGPAA
                     SGNPDRQMTGSPEARRGLLSAAELEARYWQRQRQVANPASYWNEAPQARAQPSRSRQP
                     QQRQHQPPSLPTPPYELPGENSTSSPSSSSLGRYGTPRQQPQPSHQQRRPGLLPTPAA
                     TPQSLEGGVKTEGAFSSSSQDQSQSQSQGQGQASLLLAKRRGAEKAAALVLPNANGKG
                     LAGGDGAPGGRRGKSGWKREETTEEHGPVPPITPGWVPELTPTRKGEDLYLNVR"
     gene            complement(1158401..1160764)
                     /locus_tag="MYCTH_2300457"
                     /db_xref="GeneID:11511952"
     mRNA            complement(join(1158401..1159261,1159321..1159558,
                     1159615..1160764))
                     /locus_tag="MYCTH_2300457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661225.1"
                     /db_xref="GeneID:11511952"
     CDS             complement(join(1158779..1159261,1159321..1159558,
                     1159615..1160330))
                     /locus_tag="MYCTH_2300457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661273.1"
                     /db_xref="GeneID:11511952"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2300457"
                     /translation="MADLASRISKPSDAPADDGAAPATATAEGNGAEKHVDEGTNNGL
                     VETSYDVEVKLSDLQADKDSPLYSVSSFEELGLPKPINDGLLAMNFKKPSKIQERALP
                     LMLSNPPSNMIAQSQSGTGKTAAFVLTVLTRIDLTKPTQPQALLLAPSRELARQIQGV
                     IQTIGKFCENLIVEAAIPGSISRETGVKGSVVVGTPGTVMDLIRRRQFDVSQLKILVI
                     DEADNMLDQQGMGDQCVRVKGLIPRTVQILLFSATFPDKVMNFARKYAPNANEIKLRH
                     QELTVKGISQMYMDCPDESKKYDILCKLYGLMTIGSSVIFVKTRESATEIQRRMEADG
                     HKVSALHGAYEGQNRDALLDDFRSGRSKVLITTNVLARGIDVSSVSMVINYDIPMKGF
                     GDKEQPDMETYLHRIGRTGRFGRVGVSISFVYDRKSFEALSQIANYYGIDLVQLSPDD
                     WDETERRVQEVIKSSRARPDYAPNPLGN"
     gene            1161164..1164077
                     /locus_tag="MYCTH_2300461"
                     /db_xref="GeneID:11511953"
     mRNA            join(1161164..1161418,1161478..1161689,1161754..1163312,
                     1163384..1164077)
                     /locus_tag="MYCTH_2300461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661226.1"
                     /db_xref="GeneID:11511953"
     CDS             join(1161374..1161418,1161478..1161689,1161754..1163312,
                     1163384..1163787)
                     /locus_tag="MYCTH_2300461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661274.1"
                     /db_xref="GeneID:11511953"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="JGIDB:Spoth2_2300461"
                     /translation="MAEVDVAPTLGSELKDGFKPANAWVANGIAWLDDIQSFYRERST
                     IEKEYSAKLNALAKKYFEKKTRKSASLSVGDTPTMTPGSLESASLTTWTTHLTTLEAR
                     ADEHERYGNDLINKVAEPLKHLAVRFEELRKRHAEYAEKLEKERDASYAELRKTKGKY
                     DAACQEVESKRKKTESSFDKAKAQSSFQQQVLDMNNVKNTYLIAINVTNKQKEKYYHE
                     YLPELMDSLQDLSEFRTFKLNGLWTLAAQLEAGMLQQSSGQIDRLSQEITRNQPHLDS
                     MMYIRHNMGSFQEPPDKVFEPSPVWHDDGSMVVDEAAKVYLRNLLNKSKGQLGELRRE
                     ADKKRREVEALKRMRQRVREGTEDKDEVALVSQIFSMQEDLHQVERKRIAVEVETSTI
                     TATVGDVTLGAKNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCEMK
                     VPAECPGEQSKEERKKLKQERQEAANALLKPTGPPEHVAELPSLSRSDTVTSGRSGYA
                     ASSQRSMTGPLSPAEETPPEVPTATRPTSTSGSTTTRRNRIVAPPPAAYISELPGSTP
                     NGSSQGAEQKAKMLYSFEAAGPGELTVPEGRDLVVLEPDTGSGWVKVRAGYKEGLVPA
                     TYIELTSTTSAPAPAAIAPQHTGQSAYSNSGSSIGTAAGQTGGKKKGPAVAPRRGAKK
                     LKYVEALYDYTAQSDAEHSMVEGERFVLIKEDPGDGWAEVEKGGVTKSVPASYVQVV"
     gene            1165026..1167141
                     /locus_tag="MYCTH_66349"
                     /db_xref="GeneID:11511954"
     mRNA            join(1165026..1165331,1165405..1165976,1166042..1166130,
                     1166206..1166545,1166614..1167141)
                     /locus_tag="MYCTH_66349"
                     /product="glycoside hydrolase family 72 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003661227.1"
                     /db_xref="GeneID:11511954"
     CDS             join(1165202..1165331,1165405..1165976,1166042..1166130,
                     1166206..1166545,1166614..1166847)
                     /locus_tag="MYCTH_66349"
                     /note="CAZy_ID 267853"
                     /codon_start=1
                     /product="glycoside hydrolase family 72 protein"
                     /protein_id="XP_003661275.1"
                     /db_xref="GeneID:11511954"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="JGIDB:Spoth2_66349"
                     /translation="MRSAALVSVLATVLGLGAAKPTTTVPEPPSKRASVPTVTVSGNA
                     FWQGDTRFYVRGIDYQPGGSSAMADPLADTTVCKRDIAEFKKLGVNTIRVYTVDNSAN
                     HDECMKELADAGIYVVIDANNPLYSLNRLDPAPSYNTKYLQSVFATIDEFIKYDNTLA
                     FFSGNEVINDNVKSTLAARYVKAVTRDMRSYIKSRGYRSVPVGYSAADVAQNRMQLAH
                     YMNCGTEDERSDFFAFNDYSWCNTNFEEAGWDQKVKNFTGYGIAIFLSEYGCITNGRD
                     FGEVAALMSDKMTPVYSGGLMYEYSLEANGYGIVKIDSPDATSVEEQKEFSKFAKALK
                     ENPAPKGDGGFTSTTHAVACPTKDANWLVDSTLLPAIPDDAKKFMSEGAGRGPGLKGE
                     GSQNAAEGTSTGDATPGSGKVTGTPSHSGDSDDESNAASVDATPFILTGLVAALTLAG
                     TLLL"
     gene            complement(1167059..1167909)
                     /locus_tag="MYCTH_2300475"
                     /db_xref="GeneID:11511955"
     mRNA            complement(join(1167059..1167516,1167668..1167909))
                     /locus_tag="MYCTH_2300475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661228.1"
                     /db_xref="GeneID:11511955"
     CDS             complement(join(1167158..1167516,1167668..1167812))
                     /locus_tag="MYCTH_2300475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661276.1"
                     /db_xref="GeneID:11511955"
                     /db_xref="JGIDB:Spoth2_2300475"
                     /translation="MTLLTPDIDLAPNTKQNTYVNSNLSNAAALLWHAYKSLPSPSNQ
                     VNWAGFYTLDPASPPSRPQLILGPFQGKVACQTIAFGRGVCGTAAATAQTQLVPDVDA
                     FPGHIACDSDSRSEVVVPITVGEGEAKKVVAIIDVDCAVPAGFDEVDRVWLEKLAKLV
                     ARACDWP"
     gene            complement(<1168007..>1168231)
                     /locus_tag="MYCTH_2058793"
                     /db_xref="GeneID:11511956"
     mRNA            complement(<1168007..>1168231)
                     /locus_tag="MYCTH_2058793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661229.1"
                     /db_xref="GeneID:11511956"
     CDS             complement(1168007..>1168231)
                     /locus_tag="MYCTH_2058793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661277.1"
                     /db_xref="GeneID:11511956"
                     /db_xref="JGIDB:Spoth2_2058793"
                     /translation="QVHADASNFAEGVTKEEAYKQVLDQAEGLFFEQRNWVRRHVYVY
                     ICIQQPPLPPKASMDPWSWWFMGHHTDCWS"
     gene            complement(1168961..1171119)
                     /locus_tag="MYCTH_2300476"
                     /db_xref="GeneID:11511957"
     mRNA            complement(join(1168961..1170539,1170610..1171119))
                     /locus_tag="MYCTH_2300476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661230.1"
                     /db_xref="GeneID:11511957"
     CDS             complement(join(1168997..1170539,1170610..1170611))
                     /locus_tag="MYCTH_2300476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661278.1"
                     /db_xref="GeneID:11511957"
                     /db_xref="JGIDB:Spoth2_2300476"
                     /translation="MYNAVVFVSKTAPDFKAAMVGESFLRGATLSDDISNNKGSGLNR
                     PELLVLQQRTARGELVRLSTPACIDQFSGAFEAEYSAVLLVSKELEDMSLAQGSDINP
                     ISTPVPDRSSIQYCLAQRAPAPTCEVDLNAPLLGSVALVNSIALVAAVAVLFKWPSSF
                     HPLVTLGDAISSFLQDPDPTTQGACLLSKTDIWHGRWPLTTAKCWVSRKHYWLRSVPF
                     PLWIATATVWAVCLGLLAASLAHALSMDPSARLSPPGSASPHALLALPNTAPARAGTG
                     TGGALVAALPQLLLAALYLTANALLTSYHLSHESSLFAAAAAAPTAWPRPLRVSSADP
                     AGAQTSSLYLTLPHSVSAVLVCLFAGLSLVLSQSVFAVVVRRVEARVSSSSSSLSSPA
                     GNAAAAATAPPIVALGLSGVGLVVLLAALVGLAAAVLGMGLRRAPPAGPAKEKTLGNP
                     MVLPGGSCSAVISARCHPLAREKGLWMKPVMWGVVREDGGPLGISHCGFTAGRAGPLE
                     AGRSYA"
     gene            complement(1171891..1172337)
                     /locus_tag="MYCTH_2300477"
                     /db_xref="GeneID:11511958"
     mRNA            complement(1171891..1172337)
                     /locus_tag="MYCTH_2300477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661231.1"
                     /db_xref="GeneID:11511958"
     CDS             complement(1172002..1172208)
                     /locus_tag="MYCTH_2300477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661279.1"
                     /db_xref="GeneID:11511958"
                     /db_xref="JGIDB:Spoth2_2300477"
                     /translation="MEMVAPPRDQDLGTYRYTWSEDGGMNKMTRCVRRSRLRAVLRDR
                     EDEPQCFDILFTNYCCCCYSYNYH"
     gene            1174161..1175705
                     /locus_tag="MYCTH_2300478"
                     /db_xref="GeneID:11511959"
     mRNA            join(1174161..1174757,1174952..1175094,1175170..1175408,
                     1175483..1175705)
                     /locus_tag="MYCTH_2300478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661232.1"
                     /db_xref="GeneID:11511959"
     CDS             join(1174358..1174757,1174952..1175094,1175170..1175408,
                     1175483..1175591)
                     /locus_tag="MYCTH_2300478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661280.1"
                     /db_xref="GeneID:11511959"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="JGIDB:Spoth2_2300478"
                     /translation="MDPYSAEGELINIHNHFHQGQYQEVVDFDVSSLSPENALPARVL
                     QLRARVALGQAEDVLAEVQGEADGVPELAAVGALAEQALGRGEAAVETIEKLAQSAGD
                     NPTVQVLGGTVLQAAGKSEEALALLGRHQGSLDAVALIVQIHLQQNRNDLAVKEVAAA
                     RRWAQDSLLVNLAESWVGLRLGGEKYQQAFYVFEELAQAPATSSVQSLVSQAVAELHL
                     GRVEEAQAALEQALKKEPGYAEAIANLLVLSVIAGKSAEELTSSLQKANPDHPLLVDL
                     AEKSDLFDRAATKYKAKVAA"
     gene            1178088..1182172
                     /locus_tag="MYCTH_2300482"
                     /db_xref="GeneID:11511960"
     mRNA            join(1178088..1178381,1178480..1178524,1178608..1180840,
                     1180898..1181652,1181783..1182172)
                     /locus_tag="MYCTH_2300482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661233.1"
                     /db_xref="GeneID:11511960"
     CDS             join(1178214..1178381,1178480..1178524,1178608..1180840,
                     1180898..1181652,1181783..1182001)
                     /locus_tag="MYCTH_2300482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661281.1"
                     /db_xref="GeneID:11511960"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="JGIDB:Spoth2_2300482"
                     /translation="MVRIIPNRLKSGFSNSPTTNSASNSRSTSPMGTKGDVASTEGRK
                     DNGLVLHVVILRAKDLAAKDRGGTSDPYLVLTLGEAKHITHTESKTLNPEWNEQCELS
                     VSGVQSLLLGVCAWDKDRFGKDYLGEFDLALEEIFSDGKTEQKPKWYPLKSKRPGKKT
                     SVVSGEVLLQFTLLDSTNPNATDEQIMEKLAALVKSVPGTDTSRNPTPSRTPVLAPAE
                     KSNSPSPSPPLEANRPADDQDEEDDDDAYEDETPEDEDQSKPEAVEKRRRRLRIKGLK
                     RKKRENPYEFINGGSDVVGIIFLEICSITDLPPESNLTKTSFDMDPFVVASLGKKTYR
                     TKTIRHNLNPVFNEKMIFQVLGHEQQYSFSFTVIDHDKYSGNDFIASVNFPVKELIEK
                     APKADPETGLYSLKEVPDYAAPTQRSRFMRLGLSRTSSSQSLSKLTRPALSKSSSSAT
                     SCSATATQSQTPGASQSQTEGIPEGAQPALPNTGLLQPGDNSVAAAASTLGETSPPDG
                     DDPDFIQYTLPLKMKNQEKWEAKHNPQLFIRAKYMPYPALRQQFWRAMLKQYDTDESG
                     YISKVELTTMLDTLGSTLRESTIDSFFQRFPHKASDSDDAGDLTMDEAVICLEDQLQA
                     KSRPQGVAERVKNLLPESGKIANLLAPARSGEETPPEPKTNDTSTISVPELNTPGEEG
                     ELFDRDDLNISSSEEHVVEIRECPICHQPRLNKRKDADIITHIATCASQDWRQVNNLM
                     MGGFVTSSQAQRKWYSKVITKISYGGYKLGANSANILVQDRLTGQINEEKMSVYVRLG
                     IRLLYKGLKSNNMEKKRIRKLLKSLSIKQGKKYDDPASKAEIPKFIAFHGLDMSEVLL
                     PLHEFKNFNEFFYRALKPGARPCSAPDNPRIVVSPADCRSVVFNRVETATKVWIKGRE
                     FSIKRLLGDAYPEDVPRYENGGALGIFRLAPQDYHRFHIPVDGVLGRPKTIAGEYYTV
                     NPMAIRSALDVYGENVRVLVPIDSPEFGRVMVICVGAMMVGSTVITRCEGEQVRRAEE
                     LGYFKFGGSTVVLLFESGRMVFDDDLVDNSNTALETLVRVGMSVGHAPGEPMWTPDMR
                     KDENQITDADKAEAKRRIQGQVAEESPDDSASGPEGEDVSAKVPPVASIAG"
     gene            complement(1183722..1184578)
                     /locus_tag="MYCTH_2300487"
                     /db_xref="GeneID:11511961"
     mRNA            complement(1183722..1184578)
                     /locus_tag="MYCTH_2300487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661234.1"
                     /db_xref="GeneID:11511961"
     CDS             complement(1183910..1184212)
                     /locus_tag="MYCTH_2300487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661282.1"
                     /db_xref="GeneID:11511961"
                     /db_xref="JGIDB:Spoth2_2300487"
                     /translation="MSPTYTMSAHLCKQIYSSWRQARQSSPDTSPLPSPPTALSNRHD
                     SNTASYFPRPSSPTANEKYSMDSERNLSSHPPSPSLSPSGSGSSGSGSSWRGWGSR"
     gene            complement(1185974..1188427)
                     /locus_tag="MYCTH_2300488"
                     /db_xref="GeneID:11511962"
     mRNA            complement(join(1185974..1187964,1188023..1188092,
                     1188158..1188427))
                     /locus_tag="MYCTH_2300488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661235.1"
                     /db_xref="GeneID:11511962"
     CDS             complement(join(1186041..1187964,1188023..1188092,
                     1188158..1188338))
                     /locus_tag="MYCTH_2300488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661283.1"
                     /db_xref="GeneID:11511962"
                     /db_xref="JGIDB:Spoth2_2300488"
                     /translation="MLVKAAAVKTQACRVLSRPRTFFSSVVVILMLCLLGLMHHNDRL
                     KQRALFMSREPLGRDHIERRAEELKQKRILFEKEYHALKDQPGYNAIYGNTLETLVDE
                     DVRRPSHEERLGSASNTTRVNFTTAEPVTFNPYPKYNSREWKAHHEAYVPCLGPTGKV
                     TEDIRVFKGRPRNFPKPAFGSYNVLGLDRNLCFERETRLGQYGVLPVLDENGNEINWD
                     EVNWGELQDQCLEKNQARFARNGPKNEYVDTNESSAESKRSSPSDDKSTADQEHVLHT
                     LRRFWRKPASRKAPERRSGQPADGTKQRSKERSKLEPRTALLLRSFSGKTYTDNDKQV
                     IRSLITELNLRTGGEYHVFLFVHIKDADQDIWTDDAYKAALEQHVPAEFRSMAVLWNE
                     RAVDRMYPNLTAKARQVHHGQFLPVQMFMQEFREFDFVWNWEMDSRVVGHNYDVLTRL
                     SEFGKKQPRRGLWERNERFYIPSFHGSYDSQFRSAVERAVGGETIWGAPKVPVVTPLG
                     PKPPVPKAEDDDYKWGVGEEADLIELAPIFDPVNSNWVMRNTVWGYRSLDFPWGRLPR
                     RTTIITQSRLSRRLLDAMHYEDLRGNHVASEMVAQTTALLHGFKAVYAPMPVFFDRAW
                     SGEQLERWFNGGPRGQSGSFGSSFGWGQEGRYMGSTWYFRANPPQRLYNNWMGYEDTA
                     IGGPEWEAEHGRPCLPTMILHPVKEIKPTEKGFATDVRLAYD"
     gene            complement(<1191483..>1193924)
                     /locus_tag="MYCTH_2116681"
                     /db_xref="GeneID:11511963"
     mRNA            complement(join(<1191483..1193596,1193879..>1193924))
                     /locus_tag="MYCTH_2116681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661236.1"
                     /db_xref="GeneID:11511963"
     CDS             complement(join(1191483..1193596,1193879..1193924))
                     /locus_tag="MYCTH_2116681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661284.1"
                     /db_xref="GeneID:11511963"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="JGIDB:Spoth2_2116681"
                     /translation="MAAVGRESRFMPTVKLQGLANLGTDRAYVAPSELTPVSQESGSQ
                     SGVSPQFPNAQPDTGKTDGSSAPGIANNSSTPPQSARPGGYGGLDDDSDYEDAVPQTS
                     ASEQEPNMTDRMDAAKDRLDVDRRPSAPGFGPNHGGPPGNGSERPSTSASSNISSGLG
                     GGMMSNPQNGNGRFIPYSKPPEQALEPPRTPNRSETFPRPNDRFGTPARTPSAPTPSA
                     TLHPDRQQPPLGSPGAPGERDLMANDRPRRPSRGPDTSRPPPPRTNAVRPSTPGVPTI
                     NLAEEFGIGNPYHNSSESTSSTNSSANSSQPERRPSQASQASSRTSPPRSLASSRGGT
                     SPSDGPNVNSLMTDIKHSMDEMRSKPPAPAPLKLPPRGMFPKDRPSPLSARPPRTGER
                     GYDPRIDPAVQNPRLAKGRSPLPAPMPDTSLQTGLKIQPPNDVLSPSTPGLPSPSWTG
                     SPERGRPMGDRRPSQAHPEPQPSPQSRAPPQRRSPPERGPERVPERVPERVPERVPER
                     VPERAPEPTRSRSRSRSRPREPTSTSVRGNCKACNQAITGKSISSADGRLTGRYHKSC
                     FVCTTCLQPFSSSTFYVLDDKPYCELHYHKLNGSLCGSCGRGIEGQYLEDESAVKHHV
                     GCFKCGMCRMALRDGYFEVNGRAYCEQDAWRLAGGGMNGGPPHPPGPGGMGFRPPHMG
                     PPGGPRGPMGGGYNPSRLGPMGQRPRMEKRMTRLGMM"
     gene            1197282..1197924
                     /locus_tag="MYCTH_87669"
                     /db_xref="GeneID:11511964"
     mRNA            1197282..1197924
                     /locus_tag="MYCTH_87669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661237.1"
                     /db_xref="GeneID:11511964"
     CDS             1197723..1197899
                     /locus_tag="MYCTH_87669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661285.1"
                     /db_xref="GeneID:11511964"
                     /db_xref="JGIDB:Spoth2_87669"
                     /translation="MRRGPAPPSGTPALPSPEKTGPRAAAVLRPGRRPISEPRGREAG
                     PPPRIVRRCSFTLR"
     gene            1198374..1200902
                     /locus_tag="MYCTH_66338"
                     /db_xref="GeneID:11511965"
     mRNA            join(1198374..1198533,1198624..1199524,1199591..1200193,
                     1200303..1200902)
                     /locus_tag="MYCTH_66338"
                     /product="Myo-inositol-1-phosphate synthase"
                     /note="Has EST support"
                     /transcript_id="XM_003661238.1"
                     /db_xref="GeneID:11511965"
     CDS             join(1198779..1199524,1199591..1200193,1200303..1200612)
                     /locus_tag="MYCTH_66338"
                     /note="hypothetical myo-inositol-1-phosphate synthase"
                     /codon_start=1
                     /product="Myo-inositol-1-phosphate synthase"
                     /protein_id="XP_003661286.1"
                     /db_xref="GeneID:11511965"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="JGIDB:Spoth2_66338"
                     /translation="MAPHAEIDAATANGGGHHTVTNGAAANGTAANGSAARPKFIVNS
                     PNVVYTDNEIRSTYTYRTTEVTDREDGTRVVTPKETVYDFKLDTKIPKVGVMLVGWGG
                     NNGSTITAGIIANRRGLVWETRNGRQAANYYGSVIMGSTLKLGTDAKTGKEVNIPFHD
                     VLPMIHPNDLVIGGWDISGLNLADAMDRAQVLEPSLKNLVRKEMAQMVPLPSIYYPDF
                     IAANQEDRADNLIPGSKACWEHVEQIRKDIRDFKAANGLDKVIVQWTANTERYADIIP
                     GVNDTADNLLNAIKNGHEEVAPSTVFAVASILENAPFINGSPQNTFVPGCIELAEKHG
                     AFIGGDDFKSGQTKMKSALVDFLINAGIKLTSIASYNHLGNNDGKNLSSHKQFRSKEI
                     SKSNVVDDMVAANTVLYKKDEHPDHIVVIKYVPAVGDSKRALDEYHAEIFLGGHQTIS
                     MSNVCEDSLLASPLIIDLVVVTELMTRLKWRLHSDEAESAKGYKSFHSVLSVLSYMLK
                     APLTPPGTPVVNALAKQRAALANIFRAVVGLEPESDMTLEHKLF"
     gene            complement(<1201481..>1203357)
                     /locus_tag="MYCTH_2058064"
                     /db_xref="GeneID:11511966"
     mRNA            complement(join(<1201481..1201564,1201675..>1203357))
                     /locus_tag="MYCTH_2058064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661239.1"
                     /db_xref="GeneID:11511966"
     CDS             complement(join(1201481..1201564,1201675..1203357))
                     /locus_tag="MYCTH_2058064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661287.1"
                     /db_xref="GeneID:11511966"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2058064"
                     /translation="MVITSRWSVPIPRCSLQQWIFGSACGPLPDHKAFIDPENPDANY
                     LTLADYRLLGKRVALGLQKAGLNKGDRVLIFSGNNLFFPSVFVGVLMAGGIVTGANPA
                     FVRRELAYQLKDSGASFLLVAEHAVKTAFEAAAEAGLPRDRIFVLGSSTVPISRLAWA
                     SSPGPGAGARVDGARHWTELLAGHPAEADAWSWDEPSDPEETTCCLNYSSGTTGVPKG
                     VEISHRSYVANGVGVAFMRRLRPDYEKKQKTDRGLALLPFYHAYGQTFFIANFPHLHI
                     PVYVMPSFDFVKMLSYIQRFRITTLTLVPPIVVLLAKHPATGEYDLSSIESIGCGAAP
                     LTREVSEEAERLFREQRRDGGDGDVFIRQGWGMTELTCTAMSWDPNTPVRASAGVGEV
                     YPNCRAKLVSLADGRTPIERAGERGELWVTGPTLMRRYWRRPDATAETIVVDADGTRW
                     LRTGDIAFVDEYKPGGIFHVVDRVKELIKVKGNQVAPAELEGILLDNPDVADAAVVGV
                     TIDGEEVPRAYVVRSPGSAATEQDVARWMEGKVVRYKQLKGGVAFVDAIPKNPSGKIL
                     RKQLRERAQKEVGDAAKMTSRL"
     gene            1205534..1205615
                     /locus_tag="MYCTH_t55"
                     /db_xref="GeneID:11511967"
     tRNA            1205534..1205615
                     /locus_tag="MYCTH_t55"
                     /product="tRNA-Ser"
                     /note="Anticodon: AGA"
                     /anticodon=(pos:1205568..1205570,aa:Ser,seq:aga)
                     /db_xref="GeneID:11511967"
     gene            <1206308..1208401
                     /locus_tag="MYCTH_2089931"
                     /db_xref="GeneID:11512504"
     mRNA            join(<1206308..1206629,1206723..1206822,1206881..1206893,
                     1206948..1207174,1207262..1208401)
                     /locus_tag="MYCTH_2089931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661240.1"
                     /db_xref="GeneID:11512504"
     CDS             join(1206308..1206629,1206723..1206822,1206881..1206893,
                     1206948..1207174,1207262..1208300)
                     /locus_tag="MYCTH_2089931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661288.1"
                     /db_xref="GeneID:11512504"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2089931"
                     /translation="MISIPWTWPRSETAADYSSAVVPLDEAHQHSHSYRLRPRPESGE
                     RRGDGVPGHGDDHGDDDDGADKDGEEGDTAMLVMTNAAAGYSIEGLRREVRRGRRGEK
                     WTAYEMKSKLINKAIQDIGMGRYNWQLFVLCGFGWFADNLWMQGVSLTLPSLSAEFGV
                     SEKSVRYTTSSLFVGLCLGSFFWGIGSDILGRRIAFNLTLLITSVFGTAAAYASSWAG
                     VCLSLLTLLSVWWPVGQLCSSLFAWFFIANWPVDQGWRHFVRTIGIITFVMFLIRFFL
                     FHMFESPKYLLSRGRQAEAVAVVQGIALKNGKKTWLTEEVLDAVVEDSAPRVHTRLST
                     RNIIRNKLASFSAERIRPLFNTRKLGLTTTLIWFSWATIGLGYPLFNAFLPQYLSHGG
                     NGGGGGGGDNTGDIPASEITGETYRNYAITSVVGVPGSLLAAYSVDMKSPFLGRRGTL
                     AISTLVSAVFLFMFVRLGKSPTSQLVFSCVEAFAQNIMYGVLYAFTPEIFPAPVRGAG
                     TGVASFLNRATGLMAPIIAATVPGDGTTAPVHLSAALILAAFVGICMIPIETRGRQRL
                     "
     gene            complement(1208410..1209937)
                     /locus_tag="MYCTH_2300500"
                     /db_xref="GeneID:11511968"
     mRNA            complement(join(1208410..1209573,1209721..1209937))
                     /locus_tag="MYCTH_2300500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661241.1"
                     /db_xref="GeneID:11511968"
     CDS             complement(join(1208521..1209573,1209721..1209765))
                     /locus_tag="MYCTH_2300500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661289.1"
                     /db_xref="GeneID:11511968"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2300500"
                     /translation="MSALLSLLGWSFLPGLVTGWTQSLYYSITIRAGDPKPQPGTPRW
                     AEHRRRIHIAVVALYLLYTIYEADYELRRQGTFYTDLGVPLHATEREVKSRFRRLAAL
                     HHPDKAGGADDANAYFVHLKTAADTLTDPARRFAYERFGPDAVASWAPRCVTVRDFVI
                     RGAQTLVPYYAVAAVAMYGLGLLGYLDWGRYERWLVLAVLFVFEAHTVTRPDMPGILD
                     KVVNPLLGRLLGRAPYLQFQAIALARNLSVTVYIAFSQIGPLLSADTSSGQVVVSGSR
                     GGNEEKALREGLERLEMTVKRLDADATRLLETELAPFAGDEQIRSSMWAKVKEWLVQN
                     TIRSDPMVRDALGRSFAKRRIDAPAGARGTR"
     gene            1210035..1210116
                     /locus_tag="MYCTH_t56"
                     /db_xref="GeneID:11511969"
     tRNA            1210035..1210116
                     /locus_tag="MYCTH_t56"
                     /product="tRNA-Ser"
                     /note="Anticodon: AGA"
                     /anticodon=(pos:1210069..1210071,aa:Ser,seq:aga)
                     /db_xref="GeneID:11511969"
     gene            1211297..1211997
                     /locus_tag="MYCTH_2300501"
                     /db_xref="GeneID:11512505"
     mRNA            join(1211297..1211401,1211502..1211702,1211765..1211997)
                     /locus_tag="MYCTH_2300501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661242.1"
                     /db_xref="GeneID:11512505"
     CDS             join(1211386..1211401,1211502..1211702,1211765..1211928)
                     /locus_tag="MYCTH_2300501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661290.1"
                     /db_xref="GeneID:11512505"
                     /db_xref="InterPro:IPR003033"
                     /db_xref="JGIDB:Spoth2_2300501"
                     /translation="MSLKNDKFPSSAAFDAINDALQASEADRKDAIKQGNAVFAFNLK
                     NAAGETESWHIDLKNKGVVGKGPGDKPTVTLSLSESDFGALVAGKANAQRLFMSGKLK
                     IKGDVMKATKLDPILKKAQTKAKL"
     gene            1214325..1219175
                     /locus_tag="MYCTH_107142"
                     /db_xref="GeneID:11511970"
     mRNA            join(1214325..1216440,1218001..1218158,1218213..1219175)
                     /locus_tag="MYCTH_107142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661243.1"
                     /db_xref="GeneID:11511970"
     CDS             join(1214732..1216440,1218001..1218158,1218213..1218769)
                     /locus_tag="MYCTH_107142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661291.1"
                     /db_xref="GeneID:11511970"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="JGIDB:Spoth2_107142"
                     /translation="MEQQSKKRSIFGFTGLFRSSAAPADNRDDKMDASTKPVAPASAQ
                     RESNTASAPHSPMKRASETQLASRRIIGRPQGPSSKLSQSISASDIAHRPSSLVVGPP
                     RRMPGDNPNKRPPAVSASGTSHAPSNVIPKSTSFSGVSSTPRNIFRSSALYSRPGQQT
                     FSSRVPANTLTQSFPPTTPGKPPHGSTPDVNGRILANTSSTELFKMRIPSPPRHLTGE
                     VLAKEVPDDPNRSGSIYADEFLAHYCPPDFDDYQRRQFFCILDLRRLKYAADEVFTKK
                     DWKINILNFAKEYEKSRSLIMLRYGLYEFKTVRASEAVKKEWKQKHGIPESDDESGAA
                     PKTNGTSKRKAEEELTPESNTLTASISGANKRPRAPESPAKNKRKADVEPDENQPAKL
                     QKPAPSSATKSVFESIANKDQPASGAAAKPAGKSLFASSMASKPNGSLGSSIFGTTPK
                     PTSTTGNIFGHLSDGSKGSGNDGADEESDSSSEAEEQESEAQDVSQSDEAAASGGTST
                     PQLLETKKPTTNGISSASSDAGESSQGRSIFDRITRDPAGQPVRKLTPGDGNLFAAPS
                     DKERTSFGGGSSSGPVFTFGASSQPSSAPIFSQNPPAAQSIFGNSLAPGGGTSTGTNS
                     PFTFGGASSLATTPAATTPEPSANAEDGQGTNADGDDAPQEQISLTGGGPGEEDESVV
                     HEVRAKAVKLVTGSDSDDDSGSNADKAKKNKSPWKVQGVGPLRLLKNKTTGAVRMLLR
                     AEPRGHVALNKAILPDFNYKAEAKYVKVTTATDDGKGLETWMLQVKTPASAQALAEAL
                     EEHKKANKK"
     gene            complement(<1219307..>1220434)
                     /locus_tag="MYCTH_2125016"
                     /db_xref="GeneID:11511971"
     mRNA            complement(<1219307..>1220434)
                     /locus_tag="MYCTH_2125016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661244.1"
                     /db_xref="GeneID:11511971"
     CDS             complement(1219307..1220434)
                     /locus_tag="MYCTH_2125016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661292.1"
                     /db_xref="GeneID:11511971"
                     /db_xref="JGIDB:Spoth2_2125016"
                     /translation="MASFAPRQNPSPPVVPGAPFAAKFTTMPSASSTTRQRASPRIWA
                     SPPPWLPPGAAPPGDETTTATRGLGNRPPTPNSASSSEPFFDDNRTPGQVAVAVITVV
                     VLALVMAPCIAAYYSGRYGSCRRRRRRRRRRCQTTTATPLVARGIPSRRTAVPTPREV
                     PRAHRGTGSSWEDPEARALVQDQLEAHYRSLRAEGLNELGEPPPPYKADEAPPRHHDH
                     HRDPPTLGPQNGTPATTTAAAAAAAVPPGYRGPLRERDGGRRAESATPPTGGVAASEP
                     EPLDEGSGNIELRTLPSQSPTWPQTSPRRSSPSTPVEGPLPRATSRAPSPSPSPSPSS
                     PSPLALALVQPAPSSPPPTPQAAEQADIVAEPEKGRTKPAA"
     gene            complement(1220922..1221791)
                     /locus_tag="MYCTH_2300508"
                     /db_xref="GeneID:11511972"
     mRNA            complement(join(1220922..1221185,1221244..1221791))
                     /locus_tag="MYCTH_2300508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661245.1"
                     /db_xref="GeneID:11511972"
     CDS             complement(join(1221154..1221185,1221244..1221709))
                     /locus_tag="MYCTH_2300508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661293.1"
                     /db_xref="GeneID:11511972"
                     /db_xref="JGIDB:Spoth2_2300508"
                     /translation="MRVLSYRLVTTASRWARGPSFTAAESKIFEPTVPTSPAPSRPAL
                     NQPPIRASAARTKTWMSWDRLRERDEWEDLDVWEEKIKEVENSQAAIDSQVASIRKGL
                     AEMDPLCPEAIDRVQELRSRIEKLSSGARQPSTRAQTETVTIPKTPGVLASHYINGVR
                     HGAGI"
     gene            <1222965..>1223339
                     /locus_tag="MYCTH_2116689"
                     /db_xref="GeneID:11511973"
     mRNA            join(<1222965..1222983,1223080..1223231,1223289..>1223339)
                     /locus_tag="MYCTH_2116689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661246.1"
                     /db_xref="GeneID:11511973"
     CDS             join(1222965..1222983,1223080..1223231,1223289..1223339)
                     /locus_tag="MYCTH_2116689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661294.1"
                     /db_xref="GeneID:11511973"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="JGIDB:Spoth2_2116689"
                     /translation="MVKAVRGVLVECEPAIKSILVHIDSTHHHEFIIEDLDETHLFVK
                     ETMLQVLKQKLEERLKETYRPEEPLEDSD"
     gene            complement(1223363..1224704)
                     /locus_tag="MYCTH_2300510"
                     /db_xref="GeneID:11511974"
     mRNA            complement(join(1223363..1223654,1223716..1224099,
                     1224218..1224704))
                     /locus_tag="MYCTH_2300510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661247.1"
                     /db_xref="GeneID:11511974"
     CDS             complement(join(1223545..1223654,1223716..1224099,
                     1224218..1224596))
                     /locus_tag="MYCTH_2300510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661295.1"
                     /db_xref="GeneID:11511974"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Spoth2_2300510"
                     /translation="MAQQQQSPLPAYADYQYFLVTSPSPLVAHVEINRPAKLNAFHEA
                     MWHELRAIFGRLSVDPDVRAVVLSGAGDRAFTAGLDVAAASEGGVLASAEGQGLDPAR
                     KAARLRRYIADFQECITALEKCEKPVICVMHGIAIGLAIDISTAADIRVCAKDTRFAV
                     KEVDIGLAADIGTLARLPKVVGSQSWVKDVCMTARDFDAQEALAVGFVSQVHESKAAA
                     LAAAFKTAALLATKSPVAVQGTKELLTHSRDHPVEDNLRYTGVWNAAALQTNDVPAAL
                     MSGLKRKKPTFEKL"
     gene            1227106..1230207
                     /locus_tag="MYCTH_2300515"
                     /db_xref="GeneID:11511975"
     mRNA            join(1227106..1227253,1227308..1230207)
                     /locus_tag="MYCTH_2300515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661248.1"
                     /db_xref="GeneID:11511975"
     CDS             join(1227181..1227253,1227308..1230006)
                     /locus_tag="MYCTH_2300515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661296.1"
                     /db_xref="GeneID:11511975"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="JGIDB:Spoth2_2300515"
                     /translation="MNSETGGSWASTRSMGTLACFQRVVYTRPAPKAAANHQASSLPK
                     QNPKPVAEHSGEQTPPAAGPSSEENKTAPVSNAEPVATAIPTSSFQSTTSTSSLNPAS
                     AASVPGSGFGSTARPSTSADSHVLHETLNVINEHMTDFNLPRGNASVRNVNDSGSEYS
                     SHLDHRISYIQGEETDEEEETTYTRQEVESWNADQVAEYLFTVGVEKHHCEVFRDQEI
                     TGEVLLGMDQTSLFIKALDLGSVGRRLKTWQKIKQLQDEVNGQALGTGRNTRNYGSDA
                     GSDAGKARSRTNTITSSGQRYAHLNENSLSGKAGGRRQSQTPKLEPYEPVSPVSPVAE
                     SPGRTYHDKRPSAASVRDLHHSRRHSSTDFRMPGATMNSPVPPKMSASSSTFSRQEAS
                     HKKKPSFDRNWTLGSATKYPPRPLSSAGHHDEVADQPAALQDSAVEMDRGYFSGTDAD
                     GRRRNVLKKRDSAQSSPKSSYAEEQRVRSGTALSRHSRLGSVESVRDSSSLSPAAQKY
                     YGVSSKRTPSTGTTDSLRHIAGSKESMNPTVTRLDSNASNHSQSSPKSAIKRLSQVNH
                     PDFNVNMMLRSGLGGLRAASDAITGGERAKMSPVESPLKESPMYSPARTGSSTPSGAR
                     SFELDSPDTKSPSTTTTATSRTSRKKTKQETSAYTRGLQKITPQEAMKDADYSGWMKK
                     RSANLMTTWKPRLFVLKGRRLAYYYSEDDEQERGLIDISFHRVLPADNERLTGLHATL
                     TGVSSSPAVPAGSHITTSAAADAERDPAEESDSIFIFKLVPPRAGLSRAVNFTKPTVH
                     YFAVPNVKQGRLWMAALMKATIDRDDTQPITSTYQQKTISLAKARQMRHRPPALMNLE
                     ENADEKNEKKGATGDDDGGLGIYSGLDVDSAVARLEKFGLHQQSDSAGARGFGAGTEK
                     DTSLLPQSA"
     gene            <1231186..>1234876
                     /locus_tag="MYCTH_2059413"
                     /db_xref="GeneID:11511976"
     mRNA            join(<1231186..1231935,1231993..1233837,1233926..>1234876)
                     /locus_tag="MYCTH_2059413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661249.1"
                     /db_xref="GeneID:11511976"
     CDS             join(1231186..1231935,1231993..1233837,1233926..1234876)
                     /locus_tag="MYCTH_2059413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661297.1"
                     /db_xref="GeneID:11511976"
                     /db_xref="JGIDB:Spoth2_2059413"
                     /translation="MSKPFNFHIPSSNSVFGFSPDKSREPLLPSTPDRQKSNKTNLFQ
                     QTTTSNRSTTPAGPPPRGGRADDQQDDDHDLSTASFTPAGAPSASYLGSSILKGISST
                     AKDAPARGLFTSGVSGAGKGSASPKGLFTGGGAGAGKKEEEEEEEEEEPPRGLFTGIG
                     GGFDTAGGFTGTGDVKKKKNLFSGIGLGGAQQRRNTPLGRSIRGPGHARQPSRLSRAV
                     GVDEQDGESPKRTTAHGQGKTFGVPFDDDDDDEEEEGDMWLDMPSTAETGADQPAAGE
                     VSDLLMLATPAATERVRREAEDIFRASSFRAGGAARRSEYRYAALAKDAYQQMGTAPV
                     TEPPQVILGTEDLLSRLYDEGVGEAEDEQKMDDTLATAAAQLAALWREHVDELPRPTE
                     DHAAEIGPGPHATPFEKANYLANLALQIHHTRYEEGGLIRAEPLPQTLFRWLNEYHDM
                     YGSQVDDILRHRPSPACHSLFWQAVFIALLRGKVGDAARLLDQAGWGHVRRGQRGEYA
                     YVGQALENVQRAVDETIAVLESCPGFDGNWEIWSSDWTLFRVRARGLLEHLRRFAEGK
                     DSAFGASAFSASAASAQSRQSMAGLARRAESQVPWEIYENLNIVFDIVLGQQGAILEA
                     AQDWLEATVGLFGWWDERASRTEKPLSTSQSLSRSQALVLASAPANSESYLDRLARAF
                     HTAVESDFHFNSQNAVEIGMACVFEDNIKGVIGLLRGWSLPIAAAVAEIASLGKWLPP
                     HRPSGVYGLEDLDMDDLEVLGMDPGAPDEVDGIKDSTLVQYAQALADYEGLSSVQDRS
                     GTSKDGWELSISVLGRMDSPERSEEMVRDLVEHLVQQLHVDSNATVDRLWFLLNELGM
                     IEFAEDTTETYGDILARDSHRYGEAMWYYALAHRPNKVREVMNLLTSYSLIQSTAFPP
                     ANDLDDYLYKLLNDRKNTLEQCASQDMEAAELLGKMLSGYASLRQFYDIRDNEDALPH
                     ATPLSRRKQAATALISVIASSDDNIRGGLYDQTRDGIVSEDFLLALLGEALVFVSDPD
                     NTNVHHGQLATPVITLDQIDVLLKAIEDLQAVGSRVYNACDEFLQLVLASAPGGLKGS
                     TPADLLKKSAGPGPGGSGNAMLAGSSLVASQLQRSLSGTGGGLGKVAVKRRGWDWRSE
                     VTAKTKGEDIMRRLRLGLAKDLAGLWLAEADEMVW"
     gene            complement(<1235365..>1235881)
                     /locus_tag="MYCTH_45679"
                     /db_xref="GeneID:11511977"
     mRNA            complement(join(<1235365..1235604,1235759..>1235881))
                     /locus_tag="MYCTH_45679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661250.1"
                     /db_xref="GeneID:11511977"
     CDS             complement(join(1235365..1235604,1235759..1235881))
                     /locus_tag="MYCTH_45679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661298.1"
                     /db_xref="GeneID:11511977"
                     /db_xref="JGIDB:Spoth2_45679"
                     /translation="MAPLPPPDPLPEFVYKITPTAPPDPIPEQYPLSDLDRQDGFIPI
                     TADLFFKDFTSFYILKLRLANFDQSSVKWDEVDGTNGCPHLYGNFGVKDVVAAKEFRR
                     AEGQSWKDVFEREKGWLE"
     gene            1236883..1238786
                     /locus_tag="MYCTH_2300520"
                     /db_xref="GeneID:11511978"
     mRNA            join(1236883..1237083,1237217..1237346,1237507..1237642,
                     1237737..1238377,1238504..1238786)
                     /locus_tag="MYCTH_2300520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661251.1"
                     /db_xref="GeneID:11511978"
     CDS             join(1237063..1237083,1237217..1237346,1237507..1237642,
                     1237737..1238377,1238504..1238721)
                     /locus_tag="MYCTH_2300520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661299.1"
                     /db_xref="GeneID:11511978"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2300520"
                     /translation="MASTVGKTITCKAAIAWGPGQELSYEDVEVAPPKAHEVRIKIEY
                     TGVCHTDAYTLSGKDPEGAFPVILGHEGAGIVESVGEGVTNVKPGDHVIALYTPECRE
                     CKFCKSNKTNLCGKIRATQGKGVMPDGTSRFRARGQDILHFMGTSTFSQYTVVADISV
                     VAVQQDAPMDRTCLLGCGITTGYGAARITAGVEKGSNVAVFGAGCVGLSVVQGSVAQG
                     AGRIIVVDVNPAKEEWARKFGATDFVNPTKLPEGKSVVEQLIEMTDGGCDYTFDCTGN
                     VSVMRAALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLP
                     GLVQDYLEGRLKVDEFITHRKTLAQINEAFDVMKQGDCIRAVLTMHE"
     gene            1241770..1242897
                     /locus_tag="MYCTH_2314483"
                     /db_xref="GeneID:11511979"
     mRNA            join(1241770..1242142,1242233..1242897)
                     /locus_tag="MYCTH_2314483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661252.1"
                     /db_xref="GeneID:11511979"
     CDS             join(1242005..1242142,1242233..1242307)
                     /locus_tag="MYCTH_2314483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661300.1"
                     /db_xref="GeneID:11511979"
                     /db_xref="JGIDB:Spoth2_2314483"
                     /translation="MAKVKCSFEDCKLPAQRIVGDCSFCQGSFCKNHRLLEDHKCRNL
                     EDCKREAFEQNANQLNKERTQVIKTA"
     gene            complement(1244164..1245798)
                     /locus_tag="MYCTH_2300528"
                     /db_xref="GeneID:11511980"
     mRNA            complement(1244164..1245798)
                     /locus_tag="MYCTH_2300528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661253.1"
                     /db_xref="GeneID:11511980"
     CDS             complement(1244185..1245717)
                     /locus_tag="MYCTH_2300528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661301.1"
                     /db_xref="GeneID:11511980"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="JGIDB:Spoth2_2300528"
                     /translation="MRAPRAAKEKTSKYFDSASAAAAAVPRRLTRASLARFAYNDGTN
                     GSPPTGIDASTGNNGATEEVTLGSDIEDAITTTVSHTLKRKRKRTDTVTQSASRRVAT
                     RSATRSTMKAEIKTEIKPEMETEMETEIDAEMDTAEVKTAGQPASDAKAEADADAESE
                     TKDRPRGRARKPVRKTTDAATGAVTVEPPSDWEEMYELVRQMRISGPAANAAVDTMGC
                     ERLADPDASPRERRFHTLVALMLSSQTKDTVNAEAMARLRTELPPHEPGARPGLTVEN
                     VLAVDPAVLNRLISKVGFHNNKTRYLKQTAEILRDRFGSDIPPTIDGLTSLPGVGPKM
                     AHLCMSATHGWGRVEGIGVDVHVHRITNLWGWQRPPTRGPEDTRRALESWLPRDRWKE
                     INWLLVGFGQTVCLPVGRRCGDCELGLRGLCKSADRAKVLEGRKRRAAVTVTPTTTTT
                     TTTTTTKVEKKEEVVVDKVEMEVEVEEERKEREGVVVNEAVAEAPPQSPRIKQEEEGR
                     DG"
     gene            complement(1246486..1248611)
                     /locus_tag="MYCTH_2300531"
                     /db_xref="GeneID:11511981"
     mRNA            complement(join(1246486..1248251,1248339..1248611))
                     /locus_tag="MYCTH_2300531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661254.1"
                     /db_xref="GeneID:11511981"
     CDS             complement(join(1246542..1248251,1248339..1248416))
                     /locus_tag="MYCTH_2300531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661302.1"
                     /db_xref="GeneID:11511981"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="JGIDB:Spoth2_2300531"
                     /translation="MAAGSDPSSYSGGSLEADHLCVLVHGLWGNPNHMASVAKALRAQ
                     HPADRVYILLAKSNSGSFTYDGIELGGERVCHEIEEELDMIRARGGSIKKLSIVGYSL
                     GGLVARYAIGLLFARGVLDKLECLNFTAFASPFLGVRTPLRGWHNHMWNVLGARTLCT
                     SGRQLFGIDKFRDTGKPLLAVLADPSSIFMSGLARFKRHTLYTNIVNDRSAVFYTTGI
                     SKTDPFVDLTKVKVRYLKGYEDVILDPADPVSPIIDDDTTTTTTTTTTTTTNTNNNNN
                     NNNNNNNNNNNNNNNNNNNNNNNNNNNNKTTATAIHDDLPVTKAPAPAATAAVAKEAA
                     AVAAAAAALRRWARRAPMALVLAVLVPLGTVAFLLNSAVQTARSARRVRLHERGLGGV
                     PTGAFRGVDLFIREVRGAVEDAYVDAAAAAREEYLLVNQPPPPPPPAPAPDRRDEQPD
                     VEKTDDDDDGHGRDEEQKKEGEERGEEEEEEEGGGGGGGGEDSGKKKCAALETERSLA
                     QDIARGESGGESGSGSGSGSSPFPTLALAAYQFAAIDALDQLGWRKYPVWIHKHNHSH
                     AAMIVRMEKPGFEEGRLVLKHWVTEEFLV"
     gene            complement(1249469..1251503)
                     /locus_tag="MYCTH_2142854"
                     /db_xref="GeneID:11511982"
     mRNA            complement(join(1249469..1250271,1250379..1250699,
                     1251024..1251330,1251402..1251503))
                     /locus_tag="MYCTH_2142854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661255.1"
                     /db_xref="GeneID:11511982"
     CDS             complement(join(1249660..1250271,1250379..1250699,
                     1251024..1251242))
                     /locus_tag="MYCTH_2142854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661303.1"
                     /db_xref="GeneID:11511982"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="JGIDB:Spoth2_2142854"
                     /translation="MSPEETPLLQKDGGPAEFGPWPPRLPQNIGHRGYKAAYPENTMA
                     SFRGAVEAGAHAIETDLHLSRDGVVVLSHDPTLKRCFGVDARIADCDWSYLSTLRTLQ
                     HPREGMPRLADLLEWLATAAASSDLPAAASVWLLLDIKTNDDPERLLPAVARTIASAP
                     PPPGGDMKGWKKRIVIGAWNEHYIRHARLHLPGHPLAYIGFSLLYARRFLSDEYSDVH
                     FNLAQPTLVGPLGAAFRGAVRARGRRLFIWTVNEPRWMAWAVSKGVDGVVTDEVVRLR
                     AVLDRPSSSSSPSSSSSSSSPSSASSASDIEAEANGNAEGLEVGIGVGPGDGMRWPRT
                     IRLYLVAMLWQVGAALLTILLWYPLNTRGRPKKGRGAGQLGGATLPVKA"
     gene            complement(1253808..1257112)
                     /locus_tag="MYCTH_2300537"
                     /db_xref="GeneID:11511983"
     mRNA            complement(join(1253808..1255218,1255279..1256234,
                     1256288..1257112))
                     /locus_tag="MYCTH_2300537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661256.1"
                     /db_xref="GeneID:11511983"
     CDS             complement(join(1253968..1255218,1255279..1256234,
                     1256288..1256771))
                     /locus_tag="MYCTH_2300537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661304.1"
                     /db_xref="GeneID:11511983"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2300537"
                     /translation="MPGILPMKVIKVGTSSQSRIAQACDRCRSKKIRCDGIRPTCSQC
                     ANVGFECRTSDKLSRRAFPRGYTESLEERVRALEAEVRELKDLLDEKDEKIDMLSRMH
                     GNRQSQNEKCQSQPPADAKKDAGTPAKEDTFRVQASPLLLGVENSDSYFMGASSGRGF
                     IESLKRKMQENGKSCSDFNPEAFLHIQGCYPLTAKPPSQTMRIPPRLFSDRCVNVYFQ
                     EWAPLFPVLHKPTFLRVYEEFVADPEKIRNNHKLTQLYLVFGIAALSSEQQDLQQIAA
                     CEQQWQRSLEAILMDNTMMTLQCLLLALIYCAIRADYKRLQHYKGIAVGLSLRLGLHQ
                     SQKRFSFGVLTIETRKKVFWTLYTLDCFSAAILGLPKLLKEEDVHTEFPSDTDDEYVT
                     EKGFQPSLPGEATRLSSALALFRGARILSKVLEKIYPSATSHELSLQQMSVLAGELDD
                     WYEKLPPHLKLTFKQDKPSTDVTGSRSPILALAYYYIRTLIFRPAVTSSLGPKAAPAL
                     IAVSEASKHIIQIIQLLEERNMSFSLCLNKADTLVLCGMVLLYQTLGLKQDSKLLKDN
                     EKLVNDVIKAADKAKAPGCYDLKRIARMLVTIDEPPPQSLPTPPRQSPDACLTAPPAQ
                     RHSVSASNKPHATLGRHNAASISESDLLMQQEKLRRMTMPHPTHPRTEQVHPRPRGSF
                     DSQRPSIPLSQRDHRLSLSQAHAAQAALLGRLSASPHTKHQSIDYLHVDSPTQPDSPV
                     HSRGAGGSHPSINHSQQAQLYSQLQKGSSVSTAEWEALLGSIEGGHLNVYDAIYGGPS
                     LSLAEAANAPVSATPTTTNDPWSPDSWDLTGFNLGDFGSATTAHSVVSLSEDGLSSSD
                     DMGSVGSTAAAGMDFRGGLGMPVTTTDGFVLDSLDGPFPM"
     gene            complement(1259014..>1260994)
                     /locus_tag="MYCTH_107134"
                     /db_xref="GeneID:11511984"
     mRNA            complement(join(1259014..1259339,1259470..1259481,
                     1259543..1260670,1260727..>1260994))
                     /locus_tag="MYCTH_107134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661257.1"
                     /db_xref="GeneID:11511984"
     CDS             complement(join(1259226..1259339,1259470..1259481,
                     1259543..1260670,1260727..>1260994))
                     /locus_tag="MYCTH_107134"
                     /codon_start=2
                     /product="uncharacterized protein"
                     /protein_id="XP_003661305.1"
                     /db_xref="GeneID:11511984"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Spoth2_107134"
                     /translation="MRRQTLPIEGLPAWARLNDVVFHDVKVTRTERKGYGMVSGTDLS
                     VTDDTTDSPTLLAVPHALVLNAEAVSEYAKEDKNFRQLLDAVGHGSTRTDALLFLLVQ
                     TVLASRSSHPAVGVSNPWTEYLKFLPETVPVPTLWTEEERLLLRGTSLETAVDAKISA
                     LDAEFGLVREKSSDIVGWNDLLWGAEGASAVSFMDWIRLDALYRSRCLELPRSGESMV
                     PCIDMINHSATPSAYYDENPRDEVVLRLRPGTTISRGDEITINYGDAKSAAEMLFSYG
                     FIDRETAINSLVLPLAPFPDDPLAKAKLVAFGEPPRIHVSRGRGESTGAGEGTLAPTR
                     WTSPFAYLMCVNEEDGLEFRVLQQTDGEQQLRVFWQDEDVTERTRDFETLVRTHPLAA
                     VLRLRVVTVVEEALRAQLERLRSAPAIPVPVLNGEQEDATAPRLREDCVRAAATLRDI
                     EANILEDAITVLDREWCIIRSLLLTDENVVAYLGLKEAAESGLASEEASNEPEDFS"
     gene            1262180..1263478
                     /locus_tag="MYCTH_2300544"
                     /db_xref="GeneID:11511985"
     mRNA            join(1262180..1262224,1262323..1262573,1262647..1262743,
                     1262822..1262967,1263044..1263478)
                     /locus_tag="MYCTH_2300544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661258.1"
                     /db_xref="GeneID:11511985"
     CDS             join(1262405..1262573,1262647..1262743,1262822..1262967,
                     1263044..1263351)
                     /locus_tag="MYCTH_2300544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661306.1"
                     /db_xref="GeneID:11511985"
                     /db_xref="InterPro:IPR002848"
                     /db_xref="JGIDB:Spoth2_2300544"
                     /translation="MAPPMIDPSLFDQLKSKIEEDTSIRKELDQIVDDLNQHVSFTQG
                     VLSRIHSTPRSKYASLLGQVQDGINKEIETVGKLAAFASQYPYYKYNHKWSRTVQDAI
                     STVILCAWLGGLSTESKPGELGRLLTLEDVGQVFNVPVNLKDRDAFHITIEEYLLGLI
                     AVIDELSRLAVNSVTLGDNAMAVQISGFIKDLHAGFQVLNLKNDILRKRVDSIKYAVK
                     KVEDVVYDLSLRNLIPAQDAQ"
     gene            1263490..1265057
                     /locus_tag="MYCTH_2300547"
                     /db_xref="GeneID:11511986"
     mRNA            join(1263490..1264277,1264414..1265057)
                     /locus_tag="MYCTH_2300547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661259.1"
                     /db_xref="GeneID:11511986"
     CDS             join(1263759..1264277,1264414..1264806)
                     /locus_tag="MYCTH_2300547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661307.1"
                     /db_xref="GeneID:11511986"
                     /db_xref="InterPro:IPR009580"
                     /db_xref="JGIDB:Spoth2_2300547"
                     /translation="MLLADPVTSMSSALVKGAAAQAQAQAQAAFAKSASLAPRTTLRP
                     VQIRQTPLAQTARHALPALLAGLFALRFRALVADPVSTMATTTLPLTAALQVAYAVWC
                     LPAPGGPGTAAAGSAAGAGAHAAGGGGGGGAAGAAGTAGTAAAKAGRKQRPGESSLRK
                     RGAAESSGSSAVTTAVLSLILSLLVTPFLYVAMILFGAPFLTHAAHTFLCAAHLAVLV
                     LLPLFYVHGVDGSAWAVVGGFGAPLDETFGGLVGGLVGAWLGAVPIPLDWDCDWQKWP
                     VTIMCGLYGGYVLGRVIGGTLAWGKSF"
     gene            1265370..1266835
                     /locus_tag="MYCTH_2300548"
                     /db_xref="GeneID:11511987"
     mRNA            join(1265370..1265844,1265965..1266835)
                     /locus_tag="MYCTH_2300548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661260.1"
                     /db_xref="GeneID:11511987"
     CDS             join(1265706..1265844,1265965..1266803)
                     /locus_tag="MYCTH_2300548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661308.1"
                     /db_xref="GeneID:11511987"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2300548"
                     /translation="MTVQTPAATSASGQQPPPPTQPQTTTSNKNYKGFVAGVFSGIAK
                     LSVGHPFDTIKVRLQTTNANRFSGPLQCLTQTLRNEGLFGLYKGATPPLVGWMFMDSV
                     MLGSLSVYRRLLRDHVFSPHPPPGHPPPPLPAHGHGLAGILAGATVSFVAAPVEHIKA
                     RLQIQYAARKSDRLYSGPLDCLAKIWRHHGIRGVYHGLQATLLFRSFFFFWWGSYDLF
                     SRWMRQHTSLSAPVINFWAGGLSAQVFWVMSYPSDVVKQRIMTDPLGGGLNDGVRRFP
                     RWKDAAKAVYRESGAMGYWRGFLPCFLRAFPANAMALVAFEAAMRALPE"
     gene            complement(1267063..1267926)
                     /locus_tag="MYCTH_2300549"
                     /db_xref="GeneID:11511988"
     mRNA            complement(join(1267063..1267230,1267294..1267490,
                     1267562..1267603,1267714..1267926))
                     /locus_tag="MYCTH_2300549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661261.1"
                     /db_xref="GeneID:11511988"
     CDS             complement(join(1267104..1267230,1267294..1267490,
                     1267562..1267603,1267714..1267728))
                     /locus_tag="MYCTH_2300549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661309.1"
                     /db_xref="GeneID:11511988"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="JGIDB:Spoth2_2300549"
                     /translation="MAPIAKKTGAKKGPKVTKKFIINASQPASDKIFDVSAFEKFLNE
                     RIKVDGRVGNLGETIKISQQGEGKIEIIAHNDLSGRYLKYLTKKFLKKMQLRDWLRVV
                     STSKGVYELKFFNVVNDEAEEDEE"
     gene            <1268248..1270890
                     /locus_tag="MYCTH_79688"
                     /db_xref="GeneID:11511989"
     mRNA            join(<1268248..1268345,1268529..1269040,1269123..1269730,
                     1269782..1270890)
                     /locus_tag="MYCTH_79688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661262.1"
                     /db_xref="GeneID:11511989"
     CDS             join(1268248..1268345,1268529..1269040,1269123..1269730,
                     1269782..1269808)
                     /locus_tag="MYCTH_79688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661310.1"
                     /db_xref="GeneID:11511989"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="JGIDB:Spoth2_79688"
                     /translation="MPRDPLIGLVGKPSAGKSSTLNSLTDASSKVGGFTTIDPQRAIG
                     YLQIDCACARYGLSDRCKPNYGSCVNGRRSVPIELLDVAGLVPGAHQGKGLGNKFLDD
                     LRHADALIHVVDVSGTTDAEGKNTRGYDPSVDIAWLRSEIVAWIKGNLMEKWGSIKRR
                     HVAVKATAVETLQNQFSGYGSTSAVVARTLDKLGLKEPLEEWSEETIDRVVNAFTDEK
                     FPTVIALNKIDHPDADKNIAKIAKMQDPNNIVLCSAISEIFLRKLAKQGYIRYTEGSE
                     FVDTREDLIAEGDPDGGGLKELDEKNRARIENLRDMVLYRFGSTGVVQVLSKAAEILG
                     LVPVFPVRNTTTFGSGSGDSKAVFRDCVLVKKNSTVADVARKIMGDAPIAYVEGPGGI
                     RIAEDQIVSVGKNDILSFKVGK"
     gene            complement(1270866..1271435)
                     /locus_tag="MYCTH_2314489"
                     /db_xref="GeneID:11511990"
     mRNA            complement(join(1270866..1270942,1271091..1271199,
                     1271270..1271435))
                     /locus_tag="MYCTH_2314489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661263.1"
                     /db_xref="GeneID:11511990"
     CDS             complement(join(1270895..1270942,1271091..1271199,
                     1271270..1271286))
                     /locus_tag="MYCTH_2314489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661311.1"
                     /db_xref="GeneID:11511990"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="JGIDB:Spoth2_2314489"
                     /translation="MPLTASDICKIIFAIILPPLGVFLERGCNADFFINILLTILGYL
                     PGIVHALYIICKY"
     gene            complement(<1274059..>1274886)
                     /locus_tag="MYCTH_2125036"
                     /db_xref="GeneID:11511991"
     mRNA            complement(join(<1274059..1274295,1274369..1274657,
                     1274819..>1274886))
                     /locus_tag="MYCTH_2125036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661264.1"
                     /db_xref="GeneID:11511991"
     CDS             complement(join(1274059..1274295,1274369..1274657,
                     1274819..1274886))
                     /locus_tag="MYCTH_2125036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661312.1"
                     /db_xref="GeneID:11511991"
                     /db_xref="JGIDB:Spoth2_2125036"
                     /translation="MVSTIHNTFVHVLFMDSFPTDSKSPSKSLPRRQVLLLCFARMME
                     PIAFFSIFPFVAQMVQRNGRLPESDVGFYSGLIKSLFSAASAPAGSCAPAAPPTGSPL
                     PATPSSTGCSGANPAFWPPRTLGTLNALALTVSSAVRAVAPGATSALYAMAVRSGLLD
                     GQLIWFGLAPLSALMGVAAGGLPKERKPREADEVGKP"
     gene            1276479..1278015
                     /locus_tag="MYCTH_2300553"
                     /db_xref="GeneID:11511992"
     mRNA            join(1276479..1276881,1276987..1278015)
                     /locus_tag="MYCTH_2300553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661265.1"
                     /db_xref="GeneID:11511992"
     CDS             join(1276600..1276881,1276987..1277943)
                     /locus_tag="MYCTH_2300553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661313.1"
                     /db_xref="GeneID:11511992"
                     /db_xref="JGIDB:Spoth2_2300553"
                     /translation="MLCLVLRAIWQWIETQVPHSLPEFRHVLGSWRPDFLVGDVVQGG
                     PYPSGEIFCLTEINARFSFNGFMHEAYGRQALVNLGVEKRGLRSETSSPKILDGLCSL
                     FRLDRPLHLLKGEEAGIDIHMFVDFLERRSGLRPRIIAPKDLRLVPDDGALEGYKLCC
                     LAPSSSSPPSASTRLLSFGGETLEEIHQVGLELHQRELFALPRDVLRAVALRCFNDLR
                     AVLLVHDKRMLGLVREELDSLVARSVLSETQADALRHGIAETLLPGSPAIRELLRRCA
                     ESPDLRREYLLKPIRGGKGAGIIFGDELSASEWMAHLQQLENAAQLVPGRPTWIAQRL
                     VKQRSYDVVLGSPAKSARQPLVGTYHVVHGELLGFGTWRAGPGRICAVSNGAAWICSV
                     VQEDASDSESSSEWPTNTQI"
     gene            1278753..1280353
                     /locus_tag="MYCTH_2300554"
                     /db_xref="GeneID:11511993"
     mRNA            join(1278753..1279077,1279224..1280353)
                     /locus_tag="MYCTH_2300554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661266.1"
                     /db_xref="GeneID:11511993"
     CDS             join(1279023..1279077,1279224..1280104)
                     /locus_tag="MYCTH_2300554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661314.1"
                     /db_xref="GeneID:11511993"
                     /db_xref="JGIDB:Spoth2_2300554"
                     /translation="MQHLLHPLKHSGVGALPTRVLAAAAATTATTTTTTTSNAVPHLS
                     VSRLDCLQQPGHIQEVNQLLEREGMVKLSLGFPDDESRYLHGLIVGLGRFHGHGQPVD
                     HSATRGWFWDIRPSASRFQSNGCQARSETMREFPWHTDCSYEDRPPRYFALQVLQPDR
                     RGGGVFSALAARHVLRQLSPAARDALSRPDFRIAVPPEFVRSSGRTHLVGSILAPGCS
                     ASASASASASASIRFREDIVTPLSEAAARAMDELKRALQSPEARRETLHLTSETLPRG
                     SVLLLDNRRWLHARNEVRDPERHLRRVRWDAVPFV"
     gene            complement(1280794..1282920)
                     /locus_tag="MYCTH_2300555"
                     /db_xref="GeneID:11511994"
     mRNA            complement(join(1280794..1281146,1281260..1281871,
                     1281980..1282375,1282547..1282920))
                     /locus_tag="MYCTH_2300555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661267.1"
                     /db_xref="GeneID:11511994"
     CDS             complement(join(1281034..1281146,1281260..1281871,
                     1281980..1282375,1282547..1282742))
                     /locus_tag="MYCTH_2300555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661315.1"
                     /db_xref="GeneID:11511994"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="JGIDB:Spoth2_2300555"
                     /translation="MMTPAAAELLSHERVDVLIRRRIAELRETPFAPEADLPFVVADS
                     TRTLGQHQRWMHHLPHIQPFYAVKCNSDAHLLRFLADLGLGFDCASPAEIELVLGLGV
                     NPSRIVYTHPCKAASALHMASDRGVLLTTFDNADELDKIASVSPDMRLLLRIYADDET
                     AAVCLSNKFGASLHATRPLLLKARALGLQVVGVCFHIGSGATDPKALHAAVRDARRIF
                     DQARDVGFDLTILDVGGGFTDANFEAMASALRLAIESEFPSGDRVRIIAEPGRFYARS
                     FYTLACKIIARRTHDHDNNDDDGDGTGAVDGPQLDMLYQNDGVYGCFMNRLVEDEVFV
                     PTLIPVDDDDKEEKDQPGAPPRRARAQGKHLYSVWGPTCDGFDCVSERATLPCEARIG
                     DWLKYTDMGAYSVTCATTFNGFPNTYEILYVNPGPEVVYRNGENRS"
     gene            1283589..1285823
                     /locus_tag="MYCTH_2300559"
                     /db_xref="GeneID:11511995"
     mRNA            join(1283589..1283902,1284046..1284279,1284493..1285823)
                     /locus_tag="MYCTH_2300559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661268.1"
                     /db_xref="GeneID:11511995"
     CDS             join(1283721..1283902,1284046..1284279,1284493..1285603)
                     /locus_tag="MYCTH_2300559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661316.1"
                     /db_xref="GeneID:11511995"
                     /db_xref="JGIDB:Spoth2_2300559"
                     /translation="MKPGAYSLNEVLAVARIHPFYNPAVQYPPDEEGIRAVLESAAKE
                     QSAPDLGRVPLTTKKDLYKTIERLAGDASPDNTYRRSAYLSITGGGSGGLPMLFATDA
                     AENRAQRARMGNLIRNCRLIGPGDWVLTTHASGHFYRSLDLTLEILGNAGASVLSAGH
                     NMEPAEVAAALAHYRVNVLTGDGSQVVRIVRHIASLPADERHRIRLTKIIYTSEPLTP
                     SQRAYIADVLGPGVAIGSMLGSSEAGPWAVGPLRAPLEATAEEAEQKQQHEDASAAAD
                     AGATDFVFDTRTMVIEILDPSSLSSSSSSTTTTTAAASASASEANRTSQQPVPVPVPE
                     PVPEGTPGIVVQTSLQRLKNPLVRYVSGDVGSRHPLPASLAAVVPEGEREHMRVLRLR
                     GRDRRFSFKWYGAYFEFDRLAAFLRAPEWGILQWQVVLASVEASSPEVALEIRLLLPS
                     GPARHGAAESELVRAIETFFFVQAESRHLFRIKFLKDITEFERSCTGGKVMNFVDKVH
                     "
     gene            complement(<1286237..>1296986)
                     /locus_tag="MYCTH_2116710"
                     /db_xref="GeneID:11511996"
     mRNA            complement(join(<1286237..1288552,1288610..1291231,
                     1291289..1293085,1293143..1293662,1293732..1295328,
                     1295436..1295612,1296974..>1296986))
                     /locus_tag="MYCTH_2116710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661269.1"
                     /db_xref="GeneID:11511996"
     CDS             complement(join(1286237..1288552,1288610..1291231,
                     1291289..1293085,1293143..1293662,1293732..1295328,
                     1295436..1295612,1296974..1296986))
                     /locus_tag="MYCTH_2116710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661317.1"
                     /db_xref="GeneID:11511996"
                     /db_xref="JGIDB:Spoth2_2116710"
                     /translation="MAAQSEDVEFSPIRTELHWSQTQFDNVKFADFNNVQVAQYGEVQ
                     YFQQPPDSDEENANGVNGEGDGAGSGSHPEGGEAPVEEAVPAAGASASKKKKKKNKKK
                     GEKAAEKAAEPEPAPKPEPTAEPEPEPAPEPEPEVKQEPEEPTTSGGNKKKKKNKKNK
                     DEKDAKSKSPTEEKATEPESATQSVEEQPKKEEVTSEPQPSDSVETAAATESKSDDEP
                     KAEDPAAASAAATGPEPEPQVTESKTEDSPAAEAPSSDKTIDTAPGTEATPAEPTAES
                     TEAKAAAENAPPPAEEAAQAEKQNEPVPADAEVPATGGPAAEATKELAAAETPDAAPA
                     AEASAETEKSQETQETPAAEGEATKTGEPAAEPEQIAEEKASAPESEEAPAPAGEAKP
                     ADQSQNAAEPESEAAEVKEQSAPEAKEGTSEVKDEPAPEAKEEPAEAKEQPTPEAKDE
                     PAPEVKEEPLEVKHETAPETKEEPAETKDEPAPEVKEEPAEVKDEAATEAKVEPAEAK
                     EQPATEAEETPAPELATDAKEDPTPETTETSPPEPQADEVKEESEPAPEKKDEPAPPS
                     ESAEEVKEEPAATDAAAAEVASKFVDEPSEVTEKDGPAEAAASEEGLAPEAATEATPA
                     EPEIKEEAPATTNEETSDSAKSQDTPAKEEGTEAIPETEMESAAESADAAAKDTPAEK
                     SEEPADAKESADPSAEEAAVADKASPAEPAPAEVAKSEPATEAPEADESKAAEAPEPE
                     KAETNEQSTEAVSKAEEKAEEEKPAVDNGTAVEAEKPAEVNPAEEAEPAQTTAEAESA
                     PATEGDVDKPEEKAEDTPAAEVKAAEPQEVKAEETAAETAVTAADQQEESKPAPAEET
                     PAGKEEVAQSEKQATPEKVEEAKPESVEEDSKAESAEESKPEPPAEEPKTELPAEESK
                     AEAEADVKAEPVEEAKAAPAEEGKVEPAGAPQAEVQEEAKAESTEEAQAEPTEDAPDA
                     EIKAEPVEAAKDEVKEEPIEDRKAEAVKEPETEVTEEAKPDSVVELKVETEAATTDAE
                     PAVEQETKAETAEAANAEPAEESQPAPVAEAAVESAEEAKTAPTQEAPAAPAEEPAPV
                     EVAPASTEEVKAELVEETKPEPAEEAKTAEEVKVESDEGKAKPAEEEAEPTEEAKPQP
                     VEQAKSESLGQEARPETAPEPAQEVAVEPETTKPAVEGALPSAEEKPADTPTPAPSQD
                     EKAEDPKANGKEGPETAPAPAQEETTLEEKPKESKTEDGESKDTVGPIPSEQKVAEKK
                     ATGEAHPVLLDTPGGSGTAEQNAPECISQPTDTDLDLQLPDTHDTQDTSLTTSTVNDD
                     TPDTPKQLNTGATAGDNENDAEKVCSDAGAEQVHEIATSERTADGEQAGSATATTAGT
                     EGSTNPQEPLPQAASEIAPTTEVETQTEAKVEAEAEAEAQVTSAGEPGESVAGQSLAQ
                     ESGDDKPQTDVETTTTEPQQQTEQTSAGEEALPAEASNADVPAPVTQEDGHLPSTDIK
                     EAASEQTSAQSVEAAEEELQAEKSAAPGAETSEEAVLEKIVPEVAEGESTAEKEERVP
                     VEEDITEAGDVPLQTSHDADAAAEAETVSEPVQVDEKEAPVTVTTEESTQAPEVQETV
                     QEPTSDTAEDKKTASVVEEPAAPNVAAEEPAQVLEAQDSKNNATVVPHDVKEPEPKAD
                     DLAVDTSRSLESDATAAAEVASSVPAVEASPETPAAAKAIDEAAAGSPTPEATVPGEA
                     TVPEEHPSTEDPKLVAQPGAELTAEEVQAIAQVATTTQDPTTEPSVPEPTQATVDKPG
                     SEVEAVATENVEAEGPANIDAPPGVEGPVTAEPPPIVESSPSATGTGEVDDVQKGQTT
                     EIPEADGVVQVDSPSAEETVAVEELTPAEDSVQAADAVSTKQLAEADQHAVVDDPSVA
                     EEPASTPETVAPAPSVEAEEAIQAAGAVEAPKPAEAEEHAHAEPIAQAEADTKAGESV
                     AHTEGVPAEQSVILAEPAAVEEPTKGNEAEDVVARAVDETVSKDAATVEEPAVKEEPD
                     DNLEPTSQATASEAATEAAAETEVTEPDLKATHLETGKPEPSEVSSPRETEQVGPETA
                     SEEYVMVEEAASIPHDNQSIVTPTAEVPAAAEQSTASSLEKVIVSEQPEDGQDVATSR
                     DLAADEPVAAGTESFQLVGESGLIDQSAASSQHVSTSELPSQEGVPAADAAADESIVV
                     LSAQTSHLSTEGPVVLEQQPSQDTAITAAVDVEQTRATAEDKIISPSEQVANEAGQLE
                     TITAKPNDAPGVAVNETTLAPSVVEEKPSVQVAVADYAVAYNATAANFGIASQVGGDS
                     PVERVVHGTASDYDPRDTTLSLKTETTYPLPTETTLTLPTDTTLSLPHGAAGPLPDDK
                     AEIAATEDLSAKKLAVGAGIAGAVGTVGVATALVAHNLSDKLDVPPTISRLEELASKL
                     DGPAASDAVTAEEIPGEGARPDKVPPSHKPAEQAEAMESSQVVVDKVAPLSESFHIVE
                     KDAPAQEEAAKGEEKKGASSEDGEESVARFAVVAGGEETKADDGSLGAPRPTTEETGS
                     GQQGDVVLDFRVPTPAVILPDLDDPVAKQLGRMRSLRRQRRKTIKQAEEMVAAAVVLY
                     ATAEAFSPPGSPRLASPETSVLGSPEMHSDAKGKGKEAEVHAASPQDDPSGIEQDRGR
                     SRSRDLPEPVADLSVDAKIREPLKAEDSRIAHSSRRHSHHSSRHRSHRDSRDGSKDGS
                     RRSHRSRSDSHASVRSRGEDEPPRTPIREDAGFGEHRSSPHSRRHRTPEEQAAHEKRK
                     EERRRARELEKAKDGAPSSPASADRDRDGSAPRERSERSSEHHRHSHHRDSRRHSQSR
                     HSMEPRPSNVSIPPSPAASKRFFDIKNGQSVLEVNFGVGPRDTSASNGPPPTSSGSAS
                     KTTVTGGGAPPELRRSSTSRVRRSEERGSRENKDRDRERERERERERERESERDRPST
                     AEQKATKASVASAGEAAVAGSSSSASGGDVDSQAHRAKRQEKRERAKEKEAKEKGGIR
                     AAIKRFFSSSS"
     gene            complement(1297818..1300308)
                     /locus_tag="MYCTH_66289"
                     /db_xref="GeneID:11511997"
     mRNA            complement(join(1297818..1299189,1299255..1299463,
                     1299532..1299736,1299800..1300308))
                     /locus_tag="MYCTH_66289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661270.1"
                     /db_xref="GeneID:11511997"
     CDS             complement(join(1299104..1299189,1299255..1299463,
                     1299532..1299736,1299800..1299983))
                     /locus_tag="MYCTH_66289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661318.1"
                     /db_xref="GeneID:11511997"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Spoth2_66289"
                     /translation="MSGIWGWFGGGAAQKRKDTPKNVILDLRTQLEMLQKREAHLTRQ
                     IEEQEQIARKNVNTNKTAAKAALRRKKIHEHNLEQTLNHIGTIEQQVNAIESANINQE
                     TFLAMQRATEAMKSIHGKLTPTKVDETMDQLQEYNRLNEEIADAMSNIAVGPQVDDTE
                     LDEELEALQQQDLEDKMLETGTVPVDSIQQRLPTVANGEIKGKAPAAATAEDDEEAEL
                     RRLQAEMAM"
     gene            <1300645..>1301245
                     /locus_tag="MYCTH_100975"
                     /db_xref="GeneID:11511998"
     mRNA            join(<1300645..1300733,1300909..>1301245)
                     /locus_tag="MYCTH_100975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661271.1"
                     /db_xref="GeneID:11511998"
     CDS             join(1300645..1300733,1300909..1301245)
                     /locus_tag="MYCTH_100975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661319.1"
                     /db_xref="GeneID:11511998"
                     /db_xref="JGIDB:Spoth2_100975"
                     /translation="MSFGPRPSQLCLLSNLPEKQVGDKVRFLGCVTSYIPASGVLALE
                     HRLPEEARSVHALVDVNLVLESLGPEQTRVGEWVNVIGYITDIAPLANRGNESAPGTQ
                     IVHAQAVLLWSAGPFDIRRYEASLKTLMQTGSTRYRTPS"
     gene            complement(1301933..1302818)
                     /locus_tag="MYCTH_2089975"
                     /db_xref="GeneID:11511999"
     mRNA            complement(join(1301933..1302505,1302571..1302618,
                     1302673..1302818))
                     /locus_tag="MYCTH_2089975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661272.1"
                     /db_xref="GeneID:11511999"
     CDS             complement(join(1302290..1302505,1302571..1302618,
                     1302673..1302798))
                     /locus_tag="MYCTH_2089975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661320.1"
                     /db_xref="GeneID:11511999"
                     /db_xref="JGIDB:Spoth2_2089975"
                     /translation="MSSSSSMNKYWIPHLDIHKKVITRELQYYLGPEATVRSFTRNGE
                     DGFLITTPGPCLTDEQIDDICVKSREMWEKQAAARSSGTANKVLKRPLHQPVVVSKAG
                     SSDSTKRRRDSRRSNETRSRRDNRRQS"
     gene            1305996..1308309
                     /locus_tag="MYCTH_2300572"
                     /db_xref="GeneID:11512000"
     mRNA            join(1305996..1306488,1306556..1307244,1307300..1308309)
                     /locus_tag="MYCTH_2300572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661273.1"
                     /db_xref="GeneID:11512000"
     CDS             join(1306723..1307244,1307300..1308088)
                     /locus_tag="MYCTH_2300572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661321.1"
                     /db_xref="GeneID:11512000"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="JGIDB:Spoth2_2300572"
                     /translation="MGWFINACSSAIFLLSIVLSIPIAFDVGGRDAGLAYSLSLFLFY
                     FFYSLTKLLTPEKSRVRWFFRNLVGLSQWVVIPTLLIWSLNRFSVDAGSTGWVSRTFS
                     QITSTHHKTWKEWFFGQDGFVETVALGAWDNTLSYSSPVFQLLEGFCSLLVIQAAGQI
                     TRWLVNRGRSDTWVIILLVLSGSIISSAAYFLWRVISFPQVSNLDATLIGVAMTSAAF
                     LAAFGIASGRGNPIESSLLFAYAVLCVYQIFTDYQPSPEAAAAAEQAAAAQPEFPPLP
                     PIIMASYSTLVHILSSLPTAVSSSFQFLYAAFQTITPSVIISLTYRIIVFYCATRIIP
                     AVRELGATAIMEEPTLEDTDSANRLIGFLSWFSPSMLIAVYTSLLLQHFSVSSGDDAG
                     WTLRAGEVGGSTWRWVNLAATMGLYAVELYLGGDGDGGGHWKTD"
     gene            1309278..1310552
                     /locus_tag="MYCTH_2300573"
                     /db_xref="GeneID:11512001"
     mRNA            1309278..1310552
                     /locus_tag="MYCTH_2300573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661274.1"
                     /db_xref="GeneID:11512001"
     CDS             1309696..1310346
                     /locus_tag="MYCTH_2300573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661322.1"
                     /db_xref="GeneID:11512001"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_2300573"
                     /translation="MASTPPPPSTEAAPKRKRGRPPLSPSQRKPKPAPTGRPRGRPKG
                     SGTKSAKKTSALTAPAGVQKTSPADATPRRGRGRPRKDGSTSSSSSAAAAAAAAKKEE
                     KLLEAAVSARQQEKEAAAGPATPAGQVKRGRGRPKGSGKKQKQMAASAAMKAEAAATS
                     GAKKNGPGRRSVGSSSADAEGFFNVEDDDEEQNEDAEEEEDEDGDADSEEQEEDEE"
     gene            1311685..1316212
                     /locus_tag="MYCTH_2300574"
                     /db_xref="GeneID:11512002"
     mRNA            join(1311685..1315737,1315852..1316212)
                     /locus_tag="MYCTH_2300574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661275.1"
                     /db_xref="GeneID:11512002"
     CDS             join(1311807..1315737,1315852..1316132)
                     /locus_tag="MYCTH_2300574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661323.1"
                     /db_xref="GeneID:11512002"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="JGIDB:Spoth2_2300574"
                     /translation="MAKKGKNSSSASAPAPSSASSKSNKKDAKNKGSSEGDFIVFTNS
                     DKDSKKGGRGGSSNKQGGGATFNNNSENPDGAPRPTARQLIGGASWTGKLPVNLLSEH
                     CQKQKWERPEYSTIKTKEGYSVLVSLSARNPKTNEITRLPPFKLPPSHVHMAYKPTAL
                     EAKHFAATYALYRVCSMKNLHISLPPDYKALWKDFEALKKQDIKEGRAWMYEADPFQA
                     AREREEAKAAAEKKRAQAQAARDKAAAEGNGQPGVSLAFRGSAGAGGGEGGGGGGAHS
                     LTRGWATVPKIEMGNKTRAQLEDLLRRETVWNPHGVVMPPEQKEAIVREFKELGFRQS
                     HVEEAVEECKDREEALEWLLVHIPEDDLPRWALPEKYTAGVTVAATDLRKEGVIKRLS
                     ESGYSIDLCRKVLDASGGDEGRAAEALQQMLLSSGTGKDAPQSEEQVDSWRSPDESWD
                     EEMATLEASFGDKYTRLSPDVCQIRLESVVNGANTDVETYLQFRKTPQYPTQVVLSIV
                     APLPAYIKLSIIKKALGYATESLQGEEAKIYYLVSWVQENINEIIERPGALRDVSAVS
                     SGASEEPTSAAKPSRRRPRYPKPVDWTPNPQSRKEWLARTEAPAYKRMVAQRERLPAW
                     QVRADVIRTVLENQVTIISGETGSGKSTQSVQFILDDLYNRGLGNGANIIVTQPRRIS
                     ALGLADRVAEERCTQVGEEVGYSIRGESKTGPDTKITFVTTGVLLRRLQTSGGRVEDV
                     VSSLADVSHIVVDEVHERSLDTDFLLSIVRDVLYKRRDLKLILMSATLDAASFRDYFV
                     ADRQDITVGMVEISGRTYPVQDYYLDDVIRMTGFSVSNRYDYQDDGAGTPAGDQADPV
                     NKTILKLGTRINYDLIVETVKSIDGDLSSRQEPGGILIFLPGVAEINRACNALRSTPS
                     LHVLPLHASLETREQRKVFAPPPPGKRKVVVATNVAETSITIDDIVAVVDSGRVKETS
                     FDPANNMRKLEETWASRAACKQRRGRAGRVRAGKCYKLFTRNLEFQMAERPEPEIRRV
                     PLEQLCLAVRAMGIRDIGHFLSRAPTPPEATAVESAIAMLRRMGALDGDELTALGQQL
                     AMIPADLRCGKLMVYGAIFGCLDECVTIAAILSTKSPFLSPAEKRDEAKQAKMRFARG
                     DGDLLTDLRAYQEWDSMMADRSVPQRRVRQWCDENFLSFPTLSDIASTRSQYYASLAE
                     MGIRPPSSPPSTPPSTPLLRAVTASAFAPQLCRIQFPDKKFATSVSGAVELDPEAKTI
                     KYFSQDHGRVFIHPSSTMFDSQSFSGNAAFVSYFNMMATSKVFVRDLTPFNAYTLLLF
                     TGPITLDTQGRGLLVDGWLRLRGWARIGVLVSRLRGVIDRLIERRIENPNAGLSSSSE
                     GGGGGSAAEIIRLVTKLVELDGLDA"
     gene            complement(1317049..1319478)
                     /locus_tag="MYCTH_2300575"
                     /db_xref="GeneID:11512003"
     mRNA            complement(join(1317049..1318290,1318346..1318855,
                     1319153..1319478))
                     /locus_tag="MYCTH_2300575"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661276.1"
                     /db_xref="GeneID:11512003"
     CDS             complement(join(1317388..1318290,1318346..1318855,
                     1319153..1319386))
                     /locus_tag="MYCTH_2300575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661324.1"
                     /db_xref="GeneID:11512003"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="JGIDB:Spoth2_2300575"
                     /translation="MADRYIPEHRRTQFKAKSTFKPEELRRRREEQQVEIRKAKREEN
                     LAKRRGIGTGEDRPGASLGAAPDSDDENAPSETQLNEDLPQMVAGVFSDQIDLQIQAT
                     TKFRKLLSKERNPPIEEVIKTGVVSRFVEFLRSPHTLVQFEAAWALTNIASGSASQTQ
                     VVIEAGAVPIFVELLNSPEPDVREQAVWALGNIAGDSPQCRDYVLSQGALRPLLNLLG
                     DSRKLSMLRNATWTLSNFCRGKTPQPDWNTIQPALPILAKLVYSLDDEVLIDACWAIS
                     YLSDGSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINC
                     GALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQAVIDANIIPPLIHLLTHGDLK
                     TRKEACWAISNATSGGLQKPEQIRYLVNQGCIKPLCDLLACPDNKIIQVALDGLENIL
                     KVGELDKQAAGEGADAINRYALYIEECGGMEKIHDCQTNANEEIYMKAYNIIEKYFSD
                     EDEAADDAMGQNQQFGFGAANGAQQGGFNFGANGAESMDM"
     gene            1319897..1322390
                     /locus_tag="MYCTH_2300579"
                     /db_xref="GeneID:11512004"
     mRNA            join(1319897..1320310,1320375..1322390)
                     /locus_tag="MYCTH_2300579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661277.1"
                     /db_xref="GeneID:11512004"
     CDS             join(1320133..1320310,1320375..1322236)
                     /locus_tag="MYCTH_2300579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661325.1"
                     /db_xref="GeneID:11512004"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2300579"
                     /translation="MPAGASRKSAEGAAPPESSIPPSFVQIRPILDEVVSPGGLVNVI
                     GVVKDCRLPIPTNGNDHKCTITLYDLSTDEDNHDINFVVFRPEADMPRVTAGDVVVAT
                     NVKVQRYRGDLSLITNRTTSIRVYTASKIPPRPQSAKIALAPASKRDTHVPTVAETAY
                     VSHIYHTIDKYSLPGEHEFQARAEQSLNVKQKFSLLKDVQEGKFCDLIVQVVRDPYDG
                     LTALTLYVSDYTENPRFHPRAWEGLSDSGLGDGDPYGYTTGVADVPNKEWVGPYGRMS
                     LQITCFEPHATFIREEVKAGQWVGLRNVQIKYGRDGRFLEGFLREERGSSSRRVNVDI
                     LDLANADTIDPNLKEAIRRCRDYHKKKRQQIKAIKAAEAAGMKRKASLSSKKEDLPPN
                     SKERRKQKRTAKEQSESEEVLNQEPPHLGLNDHITCETHNAQYSTIESILEPVSYETT
                     INNQTASFVVPFVCAKYRAVVRVVDFFPPSLEDFACSRKQTVYDMLSDNEADSDCVSS
                     TSDEGGAVDGDRIWEWRFALQLQDPAPPGHTKQAERPPRIWVLVDNIEAQCLTGLDAT
                     DLRQDPETLQKLRERMSLLWGNLEEHKAQTAEKRRTEKGAENVGQNRFRHHLRLQKPP
                     LQSSPAEDNEGEGIEGFVSNRPFACCIKQYGVQGEGGAWVRCFGLFGTKILVTGP"
     gene            complement(<1322691..>1326712)
                     /locus_tag="MYCTH_2142867"
                     /db_xref="GeneID:11512005"
     mRNA            complement(join(<1322691..1325840,1325965..1326173,
                     1326265..>1326712))
                     /locus_tag="MYCTH_2142867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661278.1"
                     /db_xref="GeneID:11512005"
     CDS             complement(join(1322691..1325840,1325965..1326173,
                     1326265..1326712))
                     /locus_tag="MYCTH_2142867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661326.1"
                     /db_xref="GeneID:11512005"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="JGIDB:Spoth2_2142867"
                     /translation="METSENAATSSPAPTSTTRRSGRVTKAPAKYTPEAPTATKRKRN
                     AEPDDEGAENESPGEVDDVSDANDDDTDDTAADEPRSAGKKKRPSTTTTSSLSSQTAK
                     SRKPAAKKPKTNGDAPAADSVHAAQLPSRPKKAVRIAIARGDADGLYADIFASGDSPD
                     KVATEWYHKYQADDAAAVTDLVNCILLSAGCDQQVTQDDIRDPENCSNRLADLQNVYT
                     EEGITDYPLISRAKSTKSFRDLLVGFFRSLVTVLHETDVLYKDSALMENIARWVASMS
                     SSTLRPFRHTATTVALAMEAALVEAAKKLDDRITRMTQQVDAEKSRKGKNKERLAVIQ
                     KNLQEAEQSRQICQEQITDFFETVFVHRYRDIDPKIRTECVEALGTWIWLLPTFFEKP
                     EYLRYLGWMLSDITPQTRQEVLKQLARILKRDAEKLGHFIDRFRPRLVEIATKDADVS
                     VRVAALSVIQILKDIGMLEPDEIDSIGRLVFDSELRVRRAVIDFFAGCVNDSIETKVE
                     EIGGADAVDELFGDEQDDDYSSPRRDWISIKCLAELLAAYDAQLEEENKTPPVRALDI
                     AVGMVQAVAPETRVSLASQVLYEKIDQVRNWELLAGYLLYDHTTSTKSRSASKRKTNE
                     AALKSAVAPDSREESVLLEVLASAVKLSLASSEADRGKRKQRPDAGDGGDDSAVHLAG
                     IIPRLLSKYGAEASTAVIVLRLEHSLPLDVFQQLRQDSTTYGRLLDEICAQFNRHVDR
                     GVLAEAATALLHARKYDELEEMTDTKISELWETVINALRHFDKTHELNDRGNMEAAAI
                     AQLGNVLLKASKLSSIADCVDLLEADGQSEDSPNPVIELLIRTVHRGKLDQVDEALDD
                     LEDEAVSYAIQAINFYFMWKVRSLIAAVQSAADIPAHTIERLSTFRRTFTNNLIWTLS
                     SRGTNDELRLFATGALCDLHVLFASLRETVKQSLSSSRSQPQPQPQSQSQQPPPHPRH
                     DYKELEPLYEPIQPGLINELIEIYNAAERAYARITKRTLNEPAPDERRRHQNQNQQDP
                     DQPPVDDDDDEEEDEEAVGEDEDDEDEEEAAADAALSPAERKGKELKLERALCELAGK
                     LILAILAKMVDHQGPHAGKLRRRMVRNQTRLGANLRETLAFLDEGKLRERAAAAAAAG
                     GARKKKTKAKAKAEAASAGAGAAAAAGKPGAGASRKKAARSDEIVVAGDDDSHLSEIE
                     EAEPEPEPEEGSAEDLRRRELLDDPIEEDEQEQEQDRGGGGGGGGGSGGGGGDKMDED
                     ESVLGD"
     gene            complement(1327045..1328390)
                     /locus_tag="MYCTH_2300582"
                     /db_xref="GeneID:11512006"
     mRNA            complement(1327045..1328390)
                     /locus_tag="MYCTH_2300582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661279.1"
                     /db_xref="GeneID:11512006"
     CDS             complement(1327178..1328176)
                     /locus_tag="MYCTH_2300582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661327.1"
                     /db_xref="GeneID:11512006"
                     /db_xref="InterPro:IPR002669"
                     /db_xref="JGIDB:Spoth2_2300582"
                     /translation="MNSPFPQSSSADGKGRIVVRRLPTGISGLETFEYQYPLKLVTPK
                     RPRETSALVYLLSYGGGLVGGDKVSLEIEVEAGARLSLATQGHTKIFKSASPDIVTRQ
                     TMRVKIAAGAAVCLLPDPIQPFAHSVYEQIQVFRLARNASLCLLDWVTEGRSALGEHW
                     SFVKWVGRNEVWTMGDGQATQDRLLVRDIAILDSKRAYPQLPTLRESMNGLTVFGTLI
                     LRGPLMKSVGEFFLAEFAALPRLGARDWRSDDAKGQKDAGSDDLSPREKWREERVQRE
                     KENKVLWSAASIRGCVVVKFGAPTFEAGRLWIGSMLAQEGSIAQHFGEQALMCLRW"
     gene            1328658..1330879
                     /locus_tag="MYCTH_2300583"
                     /db_xref="GeneID:11512007"
     mRNA            join(1328658..1329278,1329357..1330879)
                     /locus_tag="MYCTH_2300583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661280.1"
                     /db_xref="GeneID:11512007"
     CDS             join(1328702..1329278,1329357..1330579)
                     /locus_tag="MYCTH_2300583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661328.1"
                     /db_xref="GeneID:11512007"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="JGIDB:Spoth2_2300583"
                     /translation="MPPKTTTRGRGRGRGGTGRGGAAATTAAVDDAASRDAAPASEAA
                     AESSPAMTTATMRTTTTTTTTTMTTTTSGDTAGPPGPAPVPIMTVESTPEAATAPSTS
                     RVSSATPAPSSTRGSTSKFKPKAVRRSEAERARLAEEQLRIQEQRNAEEARRLARLNR
                     GRGRGRGRGRGGLLRGNLRSSAAAGPLSAGMTFGGGGASGYQGTGGYAFASGSSSGSG
                     FVKSEGETKGVKGAYGQSGIIDNSRINADMLYNYVEVSDEEDRSSITSTKKKKAIMPM
                     GIRRVEHKEEAVTLTTAAEIEAQEKAGASDESDEEGLFVGGPAQMEDFEETVKEEGAA
                     EAAQTREIKREEGDGGAMDLDQIPERIKAPESPEMKKKGVATEQKPKKKSAKPKDPEA
                     EVMAEDLQRMVELFTLQGDDTTAEDGITNNAALEGHMFLFQFPPVLPPLRAVPHDGTS
                     SNPIAIKPEPDDDVVMLNQPPVNIDLTRDEGKIKKEGDGEEEDGGQDKENGDDIIKEG
                     GFLGNLTVRKSGKVELSWGGQKLELMPGTQTNFLATAVLIEQADVKPGDSSQTAGVAY
                     GMGKIQGSFALAPVWGDEEEWVVDPKDLEIPEH"
     gene            1331056..1333157
                     /locus_tag="MYCTH_2300584"
                     /db_xref="GeneID:11512008"
     mRNA            join(1331056..1331573,1331810..1333157)
                     /locus_tag="MYCTH_2300584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661281.1"
                     /db_xref="GeneID:11512008"
     CDS             join(1331421..1331573,1331810..1333003)
                     /locus_tag="MYCTH_2300584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661329.1"
                     /db_xref="GeneID:11512008"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Spoth2_2300584"
                     /translation="MSDQASAGEGIHLIVIGAGLAGLSAALSTKLANPAHRVTVLEAA
                     KELQEIGAGLQITPNGTRLLAAWSLFPRLAPRAAEPRSLSVRRYDGTRLLAHEPALQD
                     SVRARYGGYPFWDLHRVDLQQAMVARCAELGVEIRLGSPAVRVDFAEARVHVLGDNGG
                     DNGGAGAVVEGDVVLLADGLWSRIRGQFLGRPSPALPTGDLAYRITIRADELEGEDAE
                     ELRAFIRDAAVNFWIGPRSHCVGYSVSAGEVYNLVLLCPDDLPGGVVKREGDKDEMRA
                     RFSGWDPLLGRLLKQVRGVVHKWRLMWLDALPEWANEEGTFFMAGDCCHPMLPYLAQG
                     ANSSLEDGAVFGSLLGRVKKSEMARQLPRVSALYQRLRIERSRKIQIETFKQRDDSHM
                     EDGEAQERRDALMLSMLGKEVKAPFPSRWTCPEIQAFLYGYDAYAEAEKAYQENPF"
     gene            complement(1333158..1334789)
                     /locus_tag="MYCTH_2300587"
                     /db_xref="GeneID:11512009"
     mRNA            complement(join(1333158..1333824,1333879..1334789))
                     /locus_tag="MYCTH_2300587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661282.1"
                     /db_xref="GeneID:11512009"
     CDS             complement(join(1333312..1333824,1333879..1334685))
                     /locus_tag="MYCTH_2300587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661330.1"
                     /db_xref="GeneID:11512009"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2300587"
                     /translation="MAAVPDIEKSAQVSRPPSRHGDVSETQGEEMATPLPEGDFQPPD
                     GGLVAWSQVLAGVLINMMAWGYPSTFGVYQLYYRDTLKLPESQISWIGSLQVFLAFAM
                     CTVSGRLADAGYVKSTIIAGSFMVVLGTMMTSLCKQYWQIFLAQGLLTGLGLGIVFMP
                     PLSVINSYFVTKRSSALAISATGTGLGSVILPATIQYLIPQVGFPWAVRCAGFVTLFV
                     ATLSVLILRPKLRPRKSGPMVEWDAFREGPYLLYTLGAFLFFWALYFGFFYINAYARN
                     VIHFSTTDSVQLLLITNGMSVPSRPLTGYLADRYFGPINLYTFQTLVLGCMIFAWTGV
                     KTRTGMYVFAAFFGLTVGAAQGLYAGSLASLTKDPRKMGTRFGMVCTIVAFASLAGPP
                     TAGAIIDKSDGRYLWAQIWAGLVIVLASLVLTATRCAVTGFKLWVKI"
     gene            complement(1337379..1339734)
                     /locus_tag="MYCTH_2300589"
                     /db_xref="GeneID:11512010"
     mRNA            complement(join(1337379..1338760,1338823..1339734))
                     /locus_tag="MYCTH_2300589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661283.1"
                     /db_xref="GeneID:11512010"
     CDS             complement(join(1337618..1338760,1338823..1339560))
                     /locus_tag="MYCTH_2300589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661331.1"
                     /db_xref="GeneID:11512010"
                     /db_xref="JGIDB:Spoth2_2300589"
                     /translation="MSAMSPNGTGPMPAGSHSGSVSPRTVTAAAPKAVQFVLVLQHSP
                     YQARLPLRVSIYPHDSTDSIITTVKNFYGLYSGPGISKGVSFEDENGNTMIARYENFT
                     NNMIVRVRVIDEPLGPDFHAALGGAHYHANGYPTQGSQHLDAHASRSTSRTPRMRSPS
                     PNGGRGRRSTSTGGNPASGKKGRSRSSKNRSRVNGDGHGDSFNGYSSSDGTAGPSSRA
                     KEQLGNTDISVENIVEGGRRKRTKFESSELPLFAPPQMPATTSNPSLSPARRLDPHRS
                     SLPLIPSGQNPFSNPHLLHSPRALSNGYAHPGAYSTPSSDNRRSREGLGFLPGPGDGS
                     VMPTPEPTVRSAMSEEDKDVAMQLMRMSTHGRASGSTQDDAFSGRADASSSAGATSDA
                     DSCDEDERLATRRQRLDVSGNHKNVFDTSEGHLAVPRDSAETSGEEAYSSDGPDDSTT
                     AASAGKGVKPKVTSVVAAKPPSQSSNKTKSYKAPKPKAKKPTSIAGPMTPASLPASRK
                     QSIASNPTFPSASAEEEQPDLSTKPRCQRCRKSKKGCDRQRPCGRCRDAGIPAELCIS
                     EDEGNGRKGRYGRHMGVPIKKDDMPPPAMNLLPAAPIASDALGLSMPSSSIMDKNKKR
                     KR"
     gene            1344407..1347180
                     /locus_tag="MYCTH_2300590"
                     /db_xref="GeneID:11512011"
     mRNA            join(1344407..1344618,1344789..1345958,1346108..1346647,
                     1346701..1347180)
                     /locus_tag="MYCTH_2300590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661284.1"
                     /db_xref="GeneID:11512011"
     CDS             join(1344607..1344618,1344789..1345958,1346108..1346647,
                     1346701..1346994)
                     /locus_tag="MYCTH_2300590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661332.1"
                     /db_xref="GeneID:11512011"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Spoth2_2300590"
                     /translation="MDARRPLRAVAANSNNENIVSSKQPAHYRQKSVGNLKAMAPTGA
                     LNAPPKRTAFGDVSNTARARVVEPAGKAGTRETVKPRGKAITTLVSARDARLEDKENR
                     KGGTKENRSKPTAASKGVSHGSKPQPNGARQAANPTSRANANYVPTGTSLAQPPLRNG
                     ASKKTTAVYSDRKEEQVNAGTEAVSPVDDLAIPVVKPIKSPRHYKSQPLLRIEQHRMG
                     CQEAKFPVQPENVVDIENEGDIDDNATEAAYEDAVEELSQGAECAVRGTLAEMEQADY
                     KSLRRDEHDTSEQSKALPELPGASELEEYWDEEEEQELYDEQGYTTAHSYRSHGDNTT
                     NGPTTLLAPHVTASVREELEMAKAYVAEHQTEEEIEEEAWDVSMVAEYGDEIFEYMRE
                     LEAQMLPNPHYMDDQTEIQWSMRSVLMDWLVQVHHRFCLLPETLFLTVNYIDRFLSVK
                     VVSLGKLQLVGATALFVAAKYEEINCPSVQEIVYMVDSGYSVDEILKAERFMLSMLHF
                     ELGWPGPMSFLRRISKADDYDLETRTLAKYFLEITIMDERFVSCPPSFLAAGAHCISR
                     FFLEKGDWTLAHVHYSGYTLSQLKPLIKLLFECCQYPTKHHSAVYEKYATPKYKHSST
                     FVESKIASGLTLSQLFAGAAHQDTSSIVGDSKTNQYQAPRVLIPTHG"
     gene            1348437..1351177
                     /locus_tag="MYCTH_2300593"
                     /db_xref="GeneID:11512012"
     mRNA            join(1348437..1349030,1349099..1350280,1350355..1351177)
                     /locus_tag="MYCTH_2300593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661285.1"
                     /db_xref="GeneID:11512012"
     CDS             join(1348842..1349030,1349099..1350280,1350355..1351083)
                     /locus_tag="MYCTH_2300593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661333.1"
                     /db_xref="GeneID:11512012"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2300593"
                     /translation="MSKAATVKEAVKETLVGSKEPEKFSAQTRARFNRHAVKDPETGE
                     LYLGPEQFIDAIAPPHEDYHKIKREQYSILFHVADRTNKGRLSLADYGYFENLLSKPD
                     AEYEIAFRLFDVERLGTVKYEDFRRLYELNKGPDSIPFDWDCEWAKLYIGSKSNRHSL
                     NYQQFSQMLRGLQGERVRQAFQRFDTDGDGFIEPEEFATIIQQTARHKLSDHLLENLH
                     TLCNISQGSKVSYANVRAFLNMINEMDLVELIVRRACSNSKDGRITRTEFLNQAAKIT
                     RFSLFTPMEADILFHFASLDEPSGRLGLKDFTKVLDAAWRRRDEEDDGRVVPEARSTG
                     QNVLAQTMESAYNFALGSLAGAFGAFMVYPIDLVKTRMQNQRGADPGQRLYKNSIDCF
                     KKVVRNEGFRGLYSGVLPQLVGVAPEKAIKLTVNDLVRGWFTDKQGKIHWGAEVLAGG
                     AAGGCQVVFTNPLEIVKIRLQVQGEVAKSVEGAPKRSAMWIVRNLGLVGLYKGASACL
                     LRDVPFSAIYFPTYSHLKRDVFGESSTKKLGVLQLLTAGAIAGMPAAYLTTPCDVIKT
                     RLQVEARKGDTTYTGLRHAAKTIWKEEGFRAFFKGGPARIFRSSPQFGFTLAAYELLQ
                     SVLPFPGKQSEAKVAAGVAEAMSNLKEKAVDSPFYRSRNALKILLDLDEHFGRTPLGP
                     NSRGWKSLPGWMNAKTA"
     gene            complement(1352114..1353361)
                     /locus_tag="MYCTH_2300594"
                     /db_xref="GeneID:11512013"
     mRNA            complement(1352114..1353361)
                     /locus_tag="MYCTH_2300594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661286.1"
                     /db_xref="GeneID:11512013"
     CDS             complement(1352184..1353212)
                     /locus_tag="MYCTH_2300594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661334.1"
                     /db_xref="GeneID:11512013"
                     /db_xref="JGIDB:Spoth2_2300594"
                     /translation="MPRDPPTFLTLPLELRLEIYSHLLVLPPPPPRESLRPIYRCSFA
                     ASRALGSPTGTNSKPTLHPQILRVNKQTYHEALPILYGQNTFSAHPVQFTARPTLYHP
                     YCSPCRPVTTVTPVGVEYDHPKSSSSTHAPGAEGRKEGENEAGRGKRTALALTNPNIR
                     LIRKWHLRVRLDGPASPAPGVPAAATPAHSPEEQGGDDASPASMSLPSIATASAIATG
                     DDTIPTSSNRSKPATQPEGPPGPPYSNPIAAAFSNAESLTLDLWRGGFTTSGHGAATA
                     ATGGGGGDDEGGGEEVGGPAALRPFEDVRGVRRVRIVGATAGIEEYLGWLQERMTVPT
                     TTATKVSG"
     gene            1354410..1355565
                     /locus_tag="MYCTH_2300596"
                     /db_xref="GeneID:11512014"
     mRNA            join(1354410..1354731,1354792..1355565)
                     /locus_tag="MYCTH_2300596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661287.1"
                     /db_xref="GeneID:11512014"
     CDS             join(1354584..1354731,1354792..1355477)
                     /locus_tag="MYCTH_2300596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661335.1"
                     /db_xref="GeneID:11512014"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Spoth2_2300596"
                     /translation="MGLLDFLSAFFGVIYFAAWSVSFYPQPMLNLRRKSTSGTTVDFP
                     LINTLGFTAYLTSNMAFYYSPLIRAQYAARYKGLTPTVKFNDIAFAAHGLLLSAITTS
                     QYFYARAWGFAPSMGSRPSRFILSIFFGCVVGAVIIILVILGSPDRDNTREGVSSWIW
                     LDAIYAISYVKLLITLIKYTPQVIVNYRNRSTQGWSILQILLDFTGGILSIAQQSIDS
                     YLQRDWSGITGNPVKFALGNVSMIYDLVFMTQHYVLYRNADGKPQEGESLLREDEEIR
                     I"
     gene            <1357238..>1358471
                     /locus_tag="MYCTH_2108644"
                     /db_xref="GeneID:11512015"
     mRNA            join(<1357238..1357434,1357546..1357634,1357798..1357820,
                     1358113..1358178,1358400..>1358471)
                     /locus_tag="MYCTH_2108644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661288.1"
                     /db_xref="GeneID:11512015"
     CDS             join(1357238..1357434,1357546..1357634,1357798..1357820,
                     1358113..1358178,1358400..1358471)
                     /locus_tag="MYCTH_2108644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661336.1"
                     /db_xref="GeneID:11512015"
                     /db_xref="JGIDB:Spoth2_2108644"
                     /translation="MSVPLPMVAAGAATSPTTTPAATESRTSTKTTMTMTTTTTKATK
                     ATKALRGSVRSHETRARLKISWSRELRIAVEVATNERNSAIADSDEESDIEALSLVLL
                     QRPRLLSTIATGTRRSLADTARAELPSWWWLLGLYYFIWMGTHRTY"
     gene            complement(<1359203..>1360835)
                     /locus_tag="MYCTH_2116734"
                     /db_xref="GeneID:11512016"
     mRNA            complement(join(<1359203..1359219,1359388..1360447,
                     1360539..1360562,1360746..>1360835))
                     /locus_tag="MYCTH_2116734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661289.1"
                     /db_xref="GeneID:11512016"
     CDS             complement(join(1359203..1359219,1359388..1360447,
                     1360539..1360562,1360746..1360835))
                     /locus_tag="MYCTH_2116734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661337.1"
                     /db_xref="GeneID:11512016"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2116734"
                     /translation="MESARRVPRPRLYHTKSRTGCTRCRSRRVKCNEARPVCNNCHRH
                     GVSCYYDKDPSKPLQARQPSQPILRPPLSNGDADADARGPPRSGPHASADYWELRAFH
                     HFAVATVGTLPGSHIPSVRQCWAMQVPVLALSYRPLWNQLLALSALHLVASGGDDPGL
                     LACRAASLDATLQSYRPALDQLTPETAEAACFTSILLSVDTFASLQHRPLAGDYEAPM
                     QWLRFTQGARAVFEASTSAAADPASNIVTIIASSNHNRPVPSDRPHRTPDFSYLLQPL
                     PDETQSSSRGVAQAYQETVDRLNLIRAAAEAGEPMLALCRRLMSFACLVPPLFLELVE
                     QKAPRALGILGHFFALSACVKDLWWVGETPVREVSAIRTYLAPELQYLMEWPDWFVTI
                     QGLG"
     gene            <1362033..>1363032
                     /locus_tag="MYCTH_2059044"
                     /db_xref="GeneID:11512017"
     mRNA            join(<1362033..1362268,1362397..1362664,1362766..>1363032)
                     /locus_tag="MYCTH_2059044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661290.1"
                     /db_xref="GeneID:11512017"
     CDS             join(1362033..1362268,1362397..1362664,1362766..1363032)
                     /locus_tag="MYCTH_2059044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661338.1"
                     /db_xref="GeneID:11512017"
                     /db_xref="JGIDB:Spoth2_2059044"
                     /translation="MTTNALLTAELAIYAVLSLPVLYLLIRHSPAGLLGWFYLFTFCT
                     LRIVGGAVSASPASIISSIGLSPLLLAGSGILHEARIYHSRVNRAQEWSLVAVFHLLV
                     ATGVALVGSGASGLQSDHPTNRDLKLVKVGIGLLTASWAVLCLWTGISCMPSQRDKSA
                     PRHRQGITLLRAVAFSLVPIGIRVLYALVALTTRRRSLNPVTGSLAARVVLGLLPELI
                     TTLVLIIAGMRTRNASRVGNEKAEELMGDSSQGRHQLS"
     gene            complement(1364783..1367143)
                     /locus_tag="MYCTH_2300600"
                     /db_xref="GeneID:11512018"
     mRNA            complement(join(1364783..1365531,1365678..1366581,
                     1366713..1367143))
                     /locus_tag="MYCTH_2300600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661291.1"
                     /db_xref="GeneID:11512018"
     CDS             complement(join(1364926..1365531,1365678..1366581,
                     1366713..1366888))
                     /locus_tag="MYCTH_2300600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661339.1"
                     /db_xref="GeneID:11512018"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2300600"
                     /translation="MARVLALDENGAPRQDGADQAGHQGGSSSSSSSSNNNNSNNNRE
                     PIREYSVERVEKVYRKLDLRIIPAFWALYFLSSAIRSNIGIAQTMNKTEGHDLASVLR
                     LSPRDTSTALALFYVSYVLFDLPSNLVMSRLSPRVWMARIVLAVGVVGTCFAAVNDAW
                     SLKLLRFLLGVVTAGMWPGMAYYLTLFYPPSRTGKRIGMYFTASQVSAAVVGLVSAGF
                     QKMDGLRGLVGFRWMFLVYGLCGVVLGISLLWWLPDRPLAPGEVRARSWYATFLPPSP
                     EPLRGEDAVVHYHDLRRVYHARPWNLRDLWQVLIDWRLWPLVLMYFGVVGVGIGTQLY
                     GNVIISAIDPTFTGVEVSLLFAPIWMMDFFAILLVTPISDRFHRHRAAFFSAAVCVQI
                     AGLLTVTFALSNPWARYGGLLMVGFGLGPTVPICMTWTNEIFQRRHGEVGVAAASALV
                     SGLGNLGSITTTYALYTGWPEDAAKGPHQYRKSNFTMIGILCMSIASSLVMTVLLQIF
                     GNQPSNKIKNSSSSSAADPDEYLDGAARREAQQRGFSRMWWNKASSSSPPGDA"
     gene            complement(1367370..1369174)
                     /locus_tag="MYCTH_2300602"
                     /db_xref="GeneID:11512019"
     mRNA            complement(join(1367370..1368512,1368650..1369174))
                     /locus_tag="MYCTH_2300602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661292.1"
                     /db_xref="GeneID:11512019"
     CDS             complement(join(1367654..1368512,1368650..1368837))
                     /locus_tag="MYCTH_2300602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661340.1"
                     /db_xref="GeneID:11512019"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Spoth2_2300602"
                     /translation="MATVELPEPFASIPREILTFGPSPIQHLPRISQALGGKVNVYAK
                     REDCNSGLAYGGNKTRKLEYLLPDALAQGCDTLVSIGGVQSNHTRQVAAAAAKVGLEV
                     ALVQEHWVDWEDPGYTKVGNIQLSRLMGADVRLDPSGFGIEHKPTLARLKEELAAKGR
                     RPYYIPAGASDHPLGGLGFARWAFEVAMQEREMGVFFDTVIVCAVTGSTMAGMVGGFK
                     LLEKKMGARKRKVVGIDASAKVRQTFEQVLRIAKQTAARIGLDESDVSEEDIVLDDRY
                     HAGTYGIPDERTIEAIKFGARTEAFITDPVYEGKSLAGMIDMIRKGEIAEGSNVLYAH
                     LGGQLALNAYSALE"
     gene            1370974..1372607
                     /locus_tag="MYCTH_2300604"
                     /db_xref="GeneID:11512020"
     mRNA            join(1370974..1371653,1371716..1372607)
                     /locus_tag="MYCTH_2300604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661293.1"
                     /db_xref="GeneID:11512020"
     CDS             join(1371259..1371653,1371716..1372244)
                     /locus_tag="MYCTH_2300604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661341.1"
                     /db_xref="GeneID:11512020"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2300604"
                     /translation="MSVVYEPRNFIHDGSYPPMDDHHDPSPEADRFTDPTDAVVNELA
                     TTVATFTAPHSQFVDTAETRLDLPAAPPTTTATSPPKEESPNATTPQRIKAIPKPDRE
                     VTRNLEGKFICTWPGCSEEPKEFVRKCEWNKHMDKHDRPYKCGAAGCEKLPGFTYSGG
                     LLRHEREVHGKHGGPKNSFYCPHPNCKRHSGKGFSRQENLNEHLRRVHTQNGTALNGT
                     EGETDDGASDNAVAGGQKRKREDRSEKDGDLREEIKRVRQENEELRRQVQAQTQQTVI
                     MMQKITALQQALETRMPTAVPTAPMATATMI"
     STS             1372654..1374038
                     /standard_name="ha3288"
                     /db_xref="UniSTS:515673"
     gene            1374689..1376457
                     /locus_tag="MYCTH_2300608"
                     /db_xref="GeneID:11512021"
     mRNA            join(1374689..1375281,1375473..1375639,1375726..1376457)
                     /locus_tag="MYCTH_2300608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661294.1"
                     /db_xref="GeneID:11512021"
     CDS             join(1374827..1375281,1375473..1375639,1375726..1376225)
                     /locus_tag="MYCTH_2300608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661342.1"
                     /db_xref="GeneID:11512021"
                     /db_xref="JGIDB:Spoth2_2300608"
                     /translation="MSLNTSGLPPPPSVSRTTVQMAGLLVDVYGLAELPPAATRVSCL
                     WLHHPRTRSKEHMADIAARCVGAWNARRRQQHSENDDDRRGGGGGGGGAGEQQRQTRG
                     LIALAYDQRNHGTRKVDERANGSWREGNPMHAVDMFGVVQGMVADQRGLLDLVEGYLF
                     AGDGGRRKIDQHLALGVSLGGHSVWQLMFAEPRVTAGVVIVGCPDYLNLLSDRARLSK
                     LSTYTADDGGASFLGSKDFPPSLVDACKKFDPKAIFFGTDPVPDITESSSKYHGTALQ
                     IMRERVRGKSFLLCSGGEDKLVPYRCSKPFVDWFSQAGRSWFREEVLSLSVSDRVYPG
                     IGHEFSPDMIRDSVQFIVDTVASVDLRPSSTHGQGSSKI"
     gene            complement(1376416..>1377384)
                     /locus_tag="MYCTH_2314496"
                     /db_xref="GeneID:11512022"
     mRNA            complement(join(1376416..1377117,1377192..>1377384))
                     /locus_tag="MYCTH_2314496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661295.1"
                     /db_xref="GeneID:11512022"
     CDS             complement(join(1376499..1377117,1377192..>1377384))
                     /locus_tag="MYCTH_2314496"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003661343.1"
                     /db_xref="GeneID:11512022"
                     /db_xref="InterPro:IPR003848"
                     /db_xref="JGIDB:Spoth2_2314496"
                     /translation="MAPTHLIIVCGHAVWIGGPKNGWDEAEWLIEGFQRGETPTFIEH
                     IKAGVRLLQQDGDATLVFSGGATREQVSLSEARSYYNLGRANKWFGLLPSGGPSTPHP
                     APESRMLLEERALDSYDNVLLSVIAFWRRHAVWPQRVTIVSHEFKRERIVDGHCAAIG
                     FPLEKVAFVGINPPGVEPAGSASSGASDEKREAMKGVQLALGQWADDPHGVGSQLMGK
                     KMERNHWGTRQPLFDSDEERQRSGVATRWLWDGIHEGLVPGVKMPWGGESK"
     gene            complement(1377507..1379069)
                     /locus_tag="MYCTH_2300611"
                     /db_xref="GeneID:11512023"
     mRNA            complement(1377507..1379069)
                     /locus_tag="MYCTH_2300611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661296.1"
                     /db_xref="GeneID:11512023"
     CDS             complement(1377590..1378804)
                     /locus_tag="MYCTH_2300611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661344.1"
                     /db_xref="GeneID:11512023"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="JGIDB:Spoth2_2300611"
                     /translation="MIDLGLARVGRLVQHTPQTWKAIHVAGTNGKGSICAYLSAMLSA
                     SGLSHARFTSPHLIDRWDCIAINGRPVPEAVFRDAEEVVKQRDRDGRIGATEFELLTA
                     TAFEIFHRQKVEYGVVEVGLGGKLDATNVLKQKAVTVIAKIGLDHQSFLGSTIEEIAL
                     QKAGIMRPGVPCVVDASNQPSVLSVMEKHARAVGADLHYASTAGVTDAVAGEKFEPHQ
                     IQNLACAHTAFCLARPGHEQPLADFLPAIRHAQWPGRLQKVDISKITGRQQEVLLDGA
                     HNPQSAEVLAQYVEKHLRSRDKPITWVLAATQGKDMNGIFSLLLKPGDQVTAVRFGPV
                     DGMPWIKPADPAELLGLAVRHGAQEATIHNAGDDVKGAMIWASQVAKDGPMVISGSLY
                     LVSSVLRALRDS"
     gene            1379671..1381449
                     /locus_tag="MYCTH_2300613"
                     /db_xref="GeneID:11512024"
     mRNA            join(1379671..1379859,1380058..1380568,1380626..1381449)
                     /locus_tag="MYCTH_2300613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661297.1"
                     /db_xref="GeneID:11512024"
     CDS             join(1379849..1379859,1380058..1380568,1380626..1381228)
                     /locus_tag="MYCTH_2300613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661345.1"
                     /db_xref="GeneID:11512024"
                     /db_xref="JGIDB:Spoth2_2300613"
                     /translation="MGLRLYQASVESDSQSKFKADDRSARSRSSIRRALDRNEDRIRE
                     RRRRLLATAAAYNSFDARRGQASADLGSAPPATTDSAGTRSGSEHGRRTLRDANRRRA
                     LFGDGTVTIFGEPWAHLHAEPHPGPFRDDGHVLFPALSMAVESDFLPPRTQARPEPTY
                     ALSNMRSTQASNHTSRSTSRHQPRPLWSRVHRHSTRLDGLRDDVSSGRASPWAVDADG
                     LGDRNRSLSPEGDTDWGTLLTTLTPDPQPPSVGSSFASASASAATTQRTAAPTSSRTS
                     FTTPDTAENSSFEHPCESGCDNSDTEGDEEDEMDPMSISGLNSLRRSSALRGDSDDPV
                     ELLGGMQRIVRNLARREDIPDEWWADAGLSRTLSREASRN"
     gene            1383476..1389281
                     /locus_tag="MYCTH_2300618"
                     /db_xref="GeneID:11512025"
     mRNA            join(1383476..1383667,1384103..1384237,1384300..1384325,
                     1384400..1384464,1384522..1384960,1385024..1385342,
                     1385401..1385903,1385957..1386460,1386518..1386661,
                     1386718..1387204,1387256..1389281)
                     /locus_tag="MYCTH_2300618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661298.1"
                     /db_xref="GeneID:11512025"
     CDS             join(1384598..1384960,1385024..1385342,1385401..1385903,
                     1385957..1386460,1386518..1386661,1386718..1387204,
                     1387256..1389078)
                     /locus_tag="MYCTH_2300618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661346.1"
                     /db_xref="GeneID:11512025"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2300618"
                     /translation="MTQVLQGLQYLHDQGVIHRDIKGANILTTKDGTVKLADFGVSTS
                     TLAGPDKEAQVVGTPYWMAPEIIQLSGATPASDIWSVGCTVIELLQGKPPYHNLAAMP
                     ALFAIVNDDHPPLPEGVSPAARDFLMQCFQKDPNLRVSARKLLRHAWITGCRRSDAPV
                     AKAPSNFSQAVEEVKQWNKALKSSEGNLRASTGSDIPGHRANPGRMPLSLTTKQRPPA
                     DAFPAPELTDDDNWDNDFATTISPSALQLPQIKGQDNFGGLLSGDRLKAFASTDAQRE
                     DSENWDSNLEGELVTIKGLGHWSEVDPQEETIRPTPKRAEKTRESRLKLPESQGHRRQ
                     RSRQGASNAAQPKSPGRPLAMKFELPPRPDVIYREQSTEDYSDLFADNDHVFDRRLSL
                     AHKETPQLFHPSDLTTSAPKSAHSSSGGSSRRSKTTSRPALLAPDQPVRRTRSTVEIT
                     KFAEDEGDEDFSDIFGAAGDGLTEPEESDRGSETEGQGGQLVLSRLSNNSWLGDDEDE
                     DDPFAMMDPGWDEMDLQANIARDRHARLVQRVEELVKSLKITEGEEVVAEVAEDLLGL
                     LWENSEVKNLIIGAHGLLPILEILEPCTLKSRQHMILQLLRIVNAIILDDVELQENLC
                     FVGGIPIVTKFAARQYSNDIRLEAAAFVRQMYQTSTLTLQMFVSAGGLNVLVEFLDED
                     YETAQDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLAAILHKVLDEERDEL
                     SELVEGRIVNIFYLFSQAEPYVKEAVAERQVLKTVLKDLRRMTPAHQITMLKFIKNMS
                     MCSTVLDALHSADAIDFLIDVLSLSMKKGQKNFREISNQVLNTMFNLCRLSKERQEYA
                     ASNGIIPLLLKIMKTDRPPKEFVLPILCDMAHSGSKGRRYLWQNNGLDFYVSLLADQY
                     WQVTALDAIHVWLQEETAKVESHLLEGGFTAAIISCFNPTKANAFDPNLLEPLLKVLR
                     LSPAVAASLAKAEIYAGIAQKLSHKKAVVRLNLLRLVRNIMDGCEANNLPMSALGTSG
                     TGRQLRILFDNIQTLADKDPAVLVRNLASELIRSHVDVELQHDAMSLGNMGLGAVSSA
                     ASNAGSGPRSRSGARRNTSYTPPGLHLSMSMPPTPTHGHRLTQSFSAAYIEVAASPKR
                     SAAGLTQERDPSFYRPRSRDGGMPIPASSIPRRVSDTPPLASPDGTNSADSSSTPASR
                     SRLPRTSTAPQQQQYQPLSRPSLPTAASAPPISIASGGQGAGAAGGAAGGGGGRRAGS
                     GGRSESFSHHLSSSYKENYSSQGYLQLQAGRLRSGSSVTVASVSSAGGASSGTQYSAS
                     PTGSAVSAGSGNGGLMPPVVPGYGVSGAGEVSGGSSGSSGKRRSRAPSSNSNAGSEGR
                     WP"
     gene            1391579..1393378
                     /locus_tag="MYCTH_2300626"
                     /db_xref="GeneID:11512026"
     mRNA            join(1391579..1392094,1392247..1392617,1392699..1392957,
                     1393051..1393378)
                     /locus_tag="MYCTH_2300626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661299.1"
                     /db_xref="GeneID:11512026"
     CDS             join(1392046..1392094,1392247..1392617,1392699..1392884)
                     /locus_tag="MYCTH_2300626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661347.1"
                     /db_xref="GeneID:11512026"
                     /db_xref="JGIDB:Spoth2_2300626"
                     /translation="MTRTVVYSVALVALLAATSMTITSLVSPKWVTLTVPSPSGGTVT
                     DTIGLHRRCSASTTGRKCVPFPEQWRCDGDERSFCSMWRTTGFLMNLAVVAELAALAG
                     FVVILVGGRVKREGSGWKALGGMLAAVAAAEFLGMAIVAYAFDHDDLFLVPGYRLDSS
                     WYLCTFSAGIALLAGVGLAISAMVLPPEDGYQLLLGESDGV"
     gene            1393610..1396400
                     /locus_tag="MYCTH_111214"
                     /db_xref="GeneID:11512027"
     mRNA            join(1393610..1393813,1393899..1395513,1395625..1396400)
                     /locus_tag="MYCTH_111214"
                     /product="Delta(24(24(1)))-sterol reductase like protein"
                     /transcript_id="XM_003661300.1"
                     /db_xref="GeneID:11512027"
     CDS             join(1393779..1393813,1393899..1395513,1395625..1395636)
                     /locus_tag="MYCTH_111214"
                     /note="orthologue of Saccharomyces cerevisiae ERG4p;
                     orthologue of S. cerevisiae ERG4p"
                     /codon_start=1
                     /product="Delta(24(24(1)))-sterol reductase like protein"
                     /protein_id="XP_003661348.1"
                     /db_xref="GeneID:11512027"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="JGIDB:Spoth2_111214"
                     /translation="MSSRYSLRQTPRKKELFDGMVETPGRRSTRRKAQVLPESDAEST
                     SAIEVMESKQVRRRPAPKFTEHIDELTPPDTPIDSDASEVASVKNSAKANGKLSDAEE
                     KPKVIDHTLTRFSGEYEFGGPWFVSLMIVGFPCLMWYMWIGATYYDGGFPVREPGQSW
                     GDFAKHLVHLVYTGAFPHTKAWLIYWIFFVVEGIFYCLMPGIWAYGKPLPHEGGKQLK
                     YYCSAYTSWYATLAIVAALHFSGVFPLYTLIDEFGPLLSVSILSGFLVSIIAYVSALA
                     RGAQLRMSGNHIYDFFMGAELNPRMFGILDFKMFFEVRMPWYILFLLSCAAAARQYDR
                     YGYVSGEVGFLMMAHFLYGNATAKGEELIVTTWDMYYEKWGFMLIFWNLSGVPLSYCH
                     CTIYLANHAPETYRWNRWALAFLYVSYLFVYWVWDSCNSQKNRFRAMERGTLIKRNTF
                     PQVPWQTLHNPKTIETGLGDKILADGWYGMARKVHYTCDVYFATTWALITGFKSPFPW
                     FYPVFFVVMIAHRAWRDIHRCRQKYGEAWREYERQVPYLFIPYVI"
     gene            complement(1396457..1396541)
                     /locus_tag="MYCTH_t76"
                     /db_xref="GeneID:11512028"
     tRNA            complement(1396457..1396541)
                     /locus_tag="MYCTH_t76"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:complement(1396506..1396508),aa:Lys,
                     seq:ctt)
                     /db_xref="GeneID:11512028"
     gene            complement(1397025..1398467)
                     /locus_tag="MYCTH_2314502"
                     /db_xref="GeneID:11512525"
     mRNA            complement(join(1397025..1397475,1397531..1397794,
                     1397862..1397991,1398136..1398148,1398329..1398467))
                     /locus_tag="MYCTH_2314502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661301.1"
                     /db_xref="GeneID:11512525"
     CDS             complement(join(1397411..1397475,1397531..1397794,
                     1397862..1397991,1398136..1398148,1398329..1398345))
                     /locus_tag="MYCTH_2314502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661349.1"
                     /db_xref="GeneID:11512525"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Spoth2_2314502"
                     /translation="MSSDACPVYAPFFGAMGCTAAIVFTCLGASYGTAKSGVGIAAMG
                     VLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDGLKQDNYALFTGFIQLGAGLAVGLA
                     GMAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLMNSKATINI
                     TC"
     gene            1398700..1399925
                     /locus_tag="MYCTH_2300637"
                     /db_xref="GeneID:11512029"
     mRNA            join(1398700..1398994,1399052..1399068,1399122..1399230,
                     1399288..1399925)
                     /locus_tag="MYCTH_2300637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661302.1"
                     /db_xref="GeneID:11512029"
     CDS             join(1398878..1398994,1399052..1399068,1399122..1399230,
                     1399288..1399431)
                     /locus_tag="MYCTH_2300637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661350.1"
                     /db_xref="GeneID:11512029"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="JGIDB:Spoth2_2300637"
                     /translation="MSAQNESAAWPKAEDPALVQELLDCVQQASHYRQLKKGANETTK
                     SINRGTSELVILAADTQPLSIVLHIPLISEEKNVPYVYVPSKVALGRACGVSRAVIAV
                     SLTSNEASDLNSKIRALRDKVERLAM"
     gene            1399927..1403565
                     /locus_tag="MYCTH_2300639"
                     /db_xref="GeneID:11512030"
     mRNA            join(1399927..1400414,1400585..1402481,1402553..1403565)
                     /locus_tag="MYCTH_2300639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661303.1"
                     /db_xref="GeneID:11512030"
     CDS             join(1400195..1400414,1400585..1402481,1402553..1403498)
                     /locus_tag="MYCTH_2300639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661351.1"
                     /db_xref="GeneID:11512030"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="JGIDB:Spoth2_2300639"
                     /translation="MPGLARKIIICAAVDGLVLHPLNARKDSHQRSAALPPVRIKYGD
                     ASISPIPRDAAPDPSSLPPNSSFEAFGIVGLVTVFHYSYLISITRRQQVASIRGLPVY
                     VVTEVALTPCTSQHEAAEAIARTAASLRGRRESLEDGDDGSADASTAAASADEEGILS
                     GSDERGGGGGDEVGGRDDDGEVMSDTEAATAGATTGSAADAASDGRRRSVVQDVIGKK
                     GSYGRFAQKWFSRSGWAMDQKRMMGLSADDRAAPRGSGDSSSSKGEGKASGEAAKLGA
                     ASGTGGTAAAAISLLPKLLRTSQLLFGSSKTFYFAYDHDITRSMTNPKVPETPLVPLH
                     EHVEQTYFWNRSIIQPFIDAGVDSLALPLMQGFVGQRTFVVDSNPPQDDGAYKDSVEL
                     SDFSSSRAASPSPADKASADMRPTEKRFDITLISRRSIKRAGLRYLRRGIDEEGNVAN
                     SVESEQILSPADAAWDPNAKVYSFVQTRGSIPLFFTQSPYSLKPVPVMQHSPESNFAA
                     LKKHFEGLRKRYGSVQVVNLVEKHGVEAPIAEVYEKNIQQLNEEAGPGADKVEFEWFD
                     FHDVCRGMKFENVSFLLQTLGGQLERFGSSVSVNDRLETRQKGVLRTNCMDCLDRTNV
                     CQSSFAKYMLDLQLKEEGFDMAAQKDQENVWFNTLWADNGDAISKQYASTGAMKGDYT
                     RTRKRNYRGALTDAGLSLTRLFNGMFNDFFLQASIDFLLGNVTSLVFEEFEATMMTKD
                     PAVSMQNMRQQAIELCQKRVVADEDEEFVGGWTLLTPHVPDTVRSASMEEAVLLLTDV
                     ALYLCRFDWNLDKVSSFERVDLAHIRKIKLGTYITSTISPAQTDDTRNVGLVIEYRPG
                     LTDITRVNTRSLSSMSSSTAQARDSEEGGAPTAAAAAAAPARDAGSAPAASGLAGLLS
                     RRPQTAAPRKIALKALHSQTSAADPSSRSMQDEPGAITRLTEIQQVLLIAAEIERLAI
                     RNQPRLAGKSPEEAGLVEKGDIISLAEAKKNTTLLEQLGHSIKKLVWA"
     gene            complement(1403554..>1404982)
                     /locus_tag="MYCTH_2133149"
                     /db_xref="GeneID:11512031"
     mRNA            complement(join(1403554..1404842,1404936..>1404982))
                     /locus_tag="MYCTH_2133149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661304.1"
                     /db_xref="GeneID:11512031"
     CDS             complement(join(1403633..1404842,1404936..1404982))
                     /locus_tag="MYCTH_2133149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661352.1"
                     /db_xref="GeneID:11512031"
                     /db_xref="JGIDB:Spoth2_2133149"
                     /translation="MDLNLHSEMRLKRSTPAANTKSRPKKGPATLSSKETEDERGQKR
                     TISPEERKRQQRVLDVFRHAFSEVLSSPSFTDTLQSVKQALYDRDFARAFGNPEYLEV
                     YAARWSPTRALCYASVLERIRDHLQSLSCPAPNNTVQNQEVHQDGDGEGEPLAHDLLT
                     PRQLNIFSIGGGAAELVALGAFLSHQPSSSSSSSSPPLSGAITLLDSGPWEAVVTKLT
                     EALTTPPPISKYASEAARLANAAMVPPSRFAASVLRQDVLALDRSSLPAVLGAAPLLV
                     TLLFTLNELFTAGGLRRTTTLLLNLTAAVPVGSLLLVVDSPGSYSEAAVGKEAKRYPM
                     HWLLDRVLLATRDEPVGGRRWAKLESHESLWFRLAGEQGGGLDYPIALENMRYQMHLY
                     RAEDANQDEDEEEEEEEERDGDKNDD"
     gene            1405546..1408759
                     /locus_tag="MYCTH_2300643"
                     /db_xref="GeneID:11512032"
     mRNA            join(1405546..1405963,1406138..1406184,1406266..1406361,
                     1406431..1406515,1406579..1408234,1408307..1408759)
                     /locus_tag="MYCTH_2300643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661305.1"
                     /db_xref="GeneID:11512032"
     CDS             join(1405910..1405963,1406138..1406184,1406266..1406361,
                     1406431..1406515,1406579..1408234,1408307..1408423)
                     /locus_tag="MYCTH_2300643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661353.1"
                     /db_xref="GeneID:11512032"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="JGIDB:Spoth2_2300643"
                     /translation="MGYTDVDKLTINTIRVLAADATFHANSGHPGAPMGMAPVAHVLF
                     NRFMRFNPKNPKWLNRDRFVLSNGHGCMLQYALLHLYGYDLTIDDLKAFRKVDSITPG
                     HPEAHDTPGVEVTTGPLGQGISNAVGLAIAQAHTAAVFNKPGFDIVDNYTYCFLGDGC
                     LMEGVSAEACSLAGHLQLGNLIAIWDDNKITIDGDTNQAFTEDVLKRYESYGWHILSV
                     GDGDNDLEGIEAAIRKAQEVKDKPTLIQLKTIIGYGSKQQGTHGVHGSPLKADDIKQL
                     KEKFGFNPEESFVVPQEVYDHCRKVAAAGAAKEEEWNKLLAKYAEQYKAEYEDLTRRL
                     KGDLPEGWEKNLPTYTPADAAVASRKLSETVLNKIFDAVPELVGGSADLTGSNLTRWK
                     GAVDFQPPSTGLGNYAGRYIRFGVREHGMGAILNGLAAYGTIIPYGGTFLNFVSYAAG
                     AVRLSALSRVRVIWVATHDSIGLGEDGPTHQPIETLTHFRALPNCMVWRPADGNETSA
                     AYYVALTSKHTPSILALSRQNLPQLEGSVIDKAIKGGYVLHEQEGADITLVSTGSEVG
                     ICVDAVKELAKQNIKARVVSMPCWEVFDTQPKEYQLSVLPDGIPSLSVEVMSTIGWER
                     YTHEQFGLNRFGVSGAYKDVYKKFEFTPEGVAKRAIATINFWKDVPNIRSPLNRAFQQ
                     IL"
     gene            1409089..1411379
                     /locus_tag="MYCTH_2300649"
                     /db_xref="GeneID:11512033"
     mRNA            join(1409089..1409760,1409854..1411379)
                     /locus_tag="MYCTH_2300649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661306.1"
                     /db_xref="GeneID:11512033"
     CDS             join(1409167..1409760,1409854..1411020)
                     /locus_tag="MYCTH_2300649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661354.1"
                     /db_xref="GeneID:11512033"
                     /db_xref="JGIDB:Spoth2_2300649"
                     /translation="MRKAKAKKAGASSKKGGDAKAPAPAPPTEDAPPSPAAAEPTVAE
                     APEKKEEDDEERGKEVKEEEPQEQEKTTEEFPSVPEDAAAESAPVTTPSLAQQSKARS
                     TSFRQGSGSLSSGAPLSPGAGAAGLGLLSPEGETAPDIYRKHVLRIEELEKENKALAK
                     ELKDAEKRWQKAEGELADLREGEGTAAGGDRGGEVEKLKNEIAALQRQNSQLQAQLSR
                     RHGSSPSLSMSSPPATSELEAQLRSKSVTIENMELEMSRLRAQVERLSVSASTPSEQI
                     TALEEKLARADKAAGLAQRELHDLKIELEQASKKAVKEGSERASAETKARALEQQAAE
                     AAAARDELARKAEALEKKVATLTTLHKEQDGRTQALRRDKERAEKEAAELRAKLDKAE
                     AEILRLRKKDAAEGGGDDDGVDELEDEERQRLEKRIRELEAENTDLRRGVWREKRRQM
                     QVGPDEDVVAAAAAAAAGGAAGGAFETVDLGGASAPPARKSAAGLGEFLASGLNALTG
                     AAGGGHGYGHGHDDGLLEDDDMEFDEEAFRRAQEEEQKQRIERIKEIKRSLKNWEGWR
                     LDLVENRRGGGEGIGEIFEV"
     gene            1412833..1413658
                     /locus_tag="MYCTH_2300650"
                     /db_xref="GeneID:11512034"
     mRNA            1412833..1413658
                     /locus_tag="MYCTH_2300650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661307.1"
                     /db_xref="GeneID:11512034"
     CDS             1412914..1413402
                     /locus_tag="MYCTH_2300650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661355.1"
                     /db_xref="GeneID:11512034"
                     /db_xref="JGIDB:Spoth2_2300650"
                     /translation="MVADLEKRVRHGKIEDQMKAYLSAMDACGDNEYGTDDLTGKLGC
                     LVSDVLRNKDFSVPILERVVAECEKVVASLDETLSLFVAVKQDLLETGSTSLKRLNRL
                     WENKWLAQTHSDLLDVNTQEDVDSLRQALTRITLCYYGPLGHAQELMRNLKLEIHEAS
                     WD"
     gene            complement(1413984..1415237)
                     /locus_tag="MYCTH_2300651"
                     /db_xref="GeneID:11512035"
     mRNA            complement(1413984..1415237)
                     /locus_tag="MYCTH_2300651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661308.1"
                     /db_xref="GeneID:11512035"
     CDS             complement(1414022..1414987)
                     /locus_tag="MYCTH_2300651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661356.1"
                     /db_xref="GeneID:11512035"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="JGIDB:Spoth2_2300651"
                     /translation="MPPTRIPTKEDFASILPSHPTYQGRRQQQQQQQQQQQQQGKGGG
                     QPDDDPISLVYPNPPESTTSILLLFHGLGDTEAAFAAFARNLALPGVLAIAVRGTAPL
                     PPALLPADDDDDPDPDGGRARARARARAGYHWGDDLVFSRDGDGVDPDPGFDRARAWV
                     VDRLIGEVLVRRCGWAAGDLMLFGFGQGASFALGLASALRAGDRVVEVVATTTGAAAA
                     AGQGNGYGNGMAFKGVVAIGGALPVSMVPTVGGLGKSKTPVLVCCGRESEAVDEDAVE
                     LLEREFEDVKVVRWKRTDDGMPRNRDEALPMMRFFAERLRNVWQR"
     gene            complement(1415238..1417739)
                     /locus_tag="MYCTH_2300652"
                     /db_xref="GeneID:11512036"
     mRNA            complement(1415238..1417739)
                     /locus_tag="MYCTH_2300652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661309.1"
                     /db_xref="GeneID:11512036"
     CDS             complement(1415489..1417465)
                     /locus_tag="MYCTH_2300652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661357.1"
                     /db_xref="GeneID:11512036"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="JGIDB:Spoth2_2300652"
                     /translation="MRETTAQVQVQSSDHESHDAAISDVTVTVVGADHPDAPIRDAPR
                     VEGLEQDSRPPTPRFIQDAGSWKRFKWVPYPVRRIIKATAKWARGPSHPGRYRIDPLL
                     PQVQYAPIVLLDMYLPRKRHKVLAVFGFWGVWLLTFALVMRQGLIAAEIPDWGTPTQI
                     GCGSTYWVSGNGCGVDGVDCRPFTDGGFPFRCPANCASYHVLNPRAVGDQEIIYRPLV
                     IGGPPEAGNGTAVYRGDSYICGSAIHAGAISNANGGCGVVRLIGRGARYNSTTRNGIT
                     SIAFDSYFPLSFAFEPGIQCDARDVIWSLLSISVVFTAVFSVFVTSPALFFFPVFTVL
                     FWTVGMATDTPNHSNIASLFSIEIGRFLPAMFVAWVMYDKMGVRRTLKGLTAQIEKTI
                     LWLGAAWVGALTNHTLDFIPIQRLTPHDLNQQPGARAALAVIIIIILVIASAQVWFFR
                     QEGRLVRNLELYGLLALGIIICAALPDLNLRVHHYVLALLLLPGTAIQIRPSLLYQGL
                     LVGLFVNGIARWGFDPILQTDYALRGDAPLDSPLPSIRPPVIVGNSSITFSWDPPPAA
                     YDGISVLVNDVERFRKYFDDGDGTDVSNVTWVRDAEDSNMNEYFRFAWMQGSQRGDYT
                     RAGTWDAKGRWSQMAPGPSKLRTRDEGGDMRRRA"
     gene            1418280..1420195
                     /locus_tag="MYCTH_2300653"
                     /db_xref="GeneID:11512037"
     mRNA            join(1418280..1418611,1418741..1420195)
                     /locus_tag="MYCTH_2300653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661310.1"
                     /db_xref="GeneID:11512037"
     CDS             join(1418377..1418611,1418741..1420038)
                     /locus_tag="MYCTH_2300653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661358.1"
                     /db_xref="GeneID:11512037"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="JGIDB:Spoth2_2300653"
                     /translation="MTADTQSPDSAAMRFDILKGALKDGVAARVGRLAFAGRLPMDTP
                     NFIGITSRGALPHLTPDNVSKHLQTVGAYMALEDFIERPQQYSQRTPPIYGTPTTAKH
                     NTRLHRFTAMPQTVTTVLGARRIPAVPSPMGNTNASISVFTSTGFQVLTTKEYLSAVD
                     ALSPDIAIPLADLTHSTITPNSKRALRMAERTDEWVVEWFSSLSESGTTPPPRRTSTF
                     APILPISYSIQWEYVSRLAEDYLPTGQLAGLAIHDPDVLPDLAEHCPALLPLPRLSLS
                     NPPTPHHILRQIALGVDVFALPFINALSDAGLALSFTFPPPPRPPSSSTPSSPPSQSS
                     PASAGTGTGTETETGTGLLPLAIDLSHPSHATSLEPLAAGCACYACAAHHRAYVHHLL
                     SAREMVGWTLLQVHNHAVVAAFFAGVRAALAAGEGKGEGEGSPEAFDEAVRRFALTYE
                     PDFPEGAAERPRARGYQYKSVGGGEGKRNKPAWGKLEPAAEAEAESGSGRGADTTAGV
                     AA"
     gene            complement(1420196..1422901)
                     /locus_tag="MYCTH_2300655"
                     /db_xref="GeneID:11512038"
     mRNA            complement(join(1420196..1422616,1422673..1422901))
                     /locus_tag="MYCTH_2300655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661311.1"
                     /db_xref="GeneID:11512038"
     CDS             complement(join(1420353..1422616,1422673..1422817))
                     /locus_tag="MYCTH_2300655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661359.1"
                     /db_xref="GeneID:11512038"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Spoth2_2300655"
                     /translation="MSLLYECINGIIQGGFLGSGEDFSAREEVASLCVSKLRGMVSTN
                     SDPNLKYVALLAFNRIVVTHPFLVAQQEDVILECIDSEDITIRIKALDLVQGMVSSDN
                     LVSIVSRLMRQLRASSAAASQQQNGPDTQDQESDSSDERGGNAGRRRKPLGRAPPLPD
                     DYTVDVIGRILRMCSQDNYANMVDFDWYLDVLAQLIRIAPPPRTKDLDADASAPSQAG
                     DISEKIGNELRNVAVKVKAIRAAAVRTAELAISRMSTEASPTRPVRAGALKPVAWVVG
                     EYASQLLSPDDTLRHLLDLLPRIEHPECLATILQAVMKLFACVTGDDRAPWTPERKSS
                     VTLLMARVIHVLEPFASHPYLEVQERAVEFVELLKLTAEAAAGQPPSTDEVQQDPPLL
                     LTQAIPSLFAGWELNSVAVGTQQNVPVPDDLDLDEPIHPDLNRLLSQADSLMLPAQGD
                     DEFEAYYNQKPAATSIASEPAINRLMDGPDEVPTGSYQQSEESYLDPDIIARRKAERM
                     ERYRDDPFYIPDSTASGGRSTPIHNILQKENGPDLDIDSIPIMKLELLNPSDSASPAE
                     KQSAQQQQQLKPKPRQRVVVAPDETLGFGSSGSGLSTPRAYDSDNNNNINNAKARKVK
                     QQSLLQITSSQLDDLSLEEGGPAGGDVRLAHERQQREEAEMAQALREVQRLRLEMQRA
                     NERIQVAQGVPAEGVVVKKKKTKKKGTGTGTGTGKEAKVDEKGDGGEEAVVKAKKKKK
                     KEKAKSGVEGEEVGEAPASVGEGEPVVKAKKKKKATRVVRLDEGEGAAAGGGGGGDGG
                     GGEG"
     gene            complement(1423279..1423873)
                     /locus_tag="MYCTH_2300657"
                     /db_xref="GeneID:11512039"
     mRNA            complement(join(1423279..1423769,1423829..1423873))
                     /locus_tag="MYCTH_2300657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661312.1"
                     /db_xref="GeneID:11512039"
     CDS             complement(join(1423610..1423769,1423829..1423830))
                     /locus_tag="MYCTH_2300657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661360.1"
                     /db_xref="GeneID:11512039"
                     /db_xref="JGIDB:Spoth2_2300657"
                     /translation="MFEKSLYDLIRGLRNHKGNEKEYIQSCLKECRTEIRSQDMGQST
                     AAPFKGPPS"
     gene            1424440..1426417
                     /locus_tag="MYCTH_2314506"
                     /db_xref="GeneID:11512040"
     mRNA            join(1424440..1424874,1424946..1425152,1425210..1425368,
                     1425425..1426417)
                     /locus_tag="MYCTH_2314506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661313.1"
                     /db_xref="GeneID:11512040"
     CDS             join(1424497..1424874,1424946..1425152,1425210..1425368,
                     1425425..1425661)
                     /locus_tag="MYCTH_2314506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661361.1"
                     /db_xref="GeneID:11512040"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Spoth2_2314506"
                     /translation="MSSMVLQTPVQLSPAAALALSQQAPAILRSSPSTASSSPFSTLL
                     SGSEKPEQWLQYENLILACLRTGDDRAAHACLSRLVARFGDDNERVQALRGLVKEAEA
                     KNNGALEDVLKEYDQILSENDTNIPVAKRRIALLRSMGRISDATSALVQLLDYSPTDA
                     EAWSELSDIYLSQGLYPQAIYAMEEVLVLAPNAWNIHARLGELQYMAATAPGVANGSY
                     QKYMAEAIKRFSRSIELCDDYLRGYYGLKLVTKKLLDDGGKPAKQTDESDFWLPDTNT
                     IERLNELATAKLSEITRRSTANDRGWRGYSEAEVAAARELLADDAAATER"
     gene            1429027..1432390
                     /locus_tag="MYCTH_2300662"
                     /db_xref="GeneID:11512041"
     mRNA            join(1429027..1429190,1429324..1431040,1431105..1432390)
                     /locus_tag="MYCTH_2300662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661314.1"
                     /db_xref="GeneID:11512041"
     CDS             join(1429183..1429190,1429324..1431040,1431105..1431884)
                     /locus_tag="MYCTH_2300662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661362.1"
                     /db_xref="GeneID:11512041"
                     /db_xref="JGIDB:Spoth2_2300662"
                     /translation="MPLKHRSPARGQKRTPASATSSEYDEETSSQHSEDYDDSLADED
                     DEDDEDQWGDEYDELDPSDSASISQEYKQRALPRSHSPRPLRGQPRNHRIPVGRQSYS
                     YYSPSVPPMSLDPSEDYPAYARGYGGPPQPQNQGAFYGARGGHQSAGYAQSHVGYMPN
                     HYASQMVPYNEYRNPFAPAPMAGTGPGFFGNEHRGGHGHYDIMPYHQGPGYYGAGGGA
                     GYGIPPPHLQPYLYNAPPPPPTEAPAPKPPTPAPPPPEKNPEVEALKAQLAKFEEEEK
                     KKAEKERLEELKRRMQEEAAEAIKRQMEEMKRVQEEQKKAVEQAQAEAAKRAREQLEE
                     ERRKEEQRRKEQQEQLERIQRETRERLEAERKAAEEQRRREAEAAAKAEADAQARIKK
                     AIEEEQARIKAQIKAEEEARAAAEKKAAEEQARLKRIEEEAQKKIEAALKEQEEKLAA
                     AVKAEREKFEAAQKAEAEAKAAAAKKEAEEAEWRKKLEAEAKLKAEIEAREKLEAERK
                     KAEEERLAEEQRKKEEEALKQRLLEEAKAKAKAEEEAEKKKEKAPIKFKDAVGRKFSF
                     PFHLCQTWQGMEELIKQAFLHVDVIGPHVQEGHYDLIGPNGEIILPSVWEKVIEPDWA
                     ITMHMWPMDKAPLRNQQVPPMPPGAIPRPPHHNGRTVHANGPVPFVRPPSAHPGGAGG
                     MQIPRPPPNGVWPNGGAVPVGAPRGARPSAAPHIVTVEPEKPKRKDKGAPQGMLSWMV
                     GAKPKSSSTKKYVGPIPPKGARRPDSAQARVPTPASAPAPAPAPALAPLPPSKHKPKN
                     KARPSSQKHYPSYILYPAHLWLPKSVAFPPLVEFGL"
     gene            complement(1432392..1434093)
                     /locus_tag="MYCTH_2300663"
                     /db_xref="GeneID:11512042"
     mRNA            complement(1432392..1434093)
                     /locus_tag="MYCTH_2300663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661315.1"
                     /db_xref="GeneID:11512042"
     CDS             complement(1432919..1433803)
                     /locus_tag="MYCTH_2300663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661363.1"
                     /db_xref="GeneID:11512042"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="JGIDB:Spoth2_2300663"
                     /translation="MASRLPTRARHLSATRIAVRSPLPPPSPLLQSHLLQQHPPSQPK
                     PAAAGTTTAIRHVSTTAPRPWLLSALPNLVPGANSGPPPPKTVRARRLLPYTPAQVYA
                     LIADVDSYKHFLPHCAHSRVTKWTTPPKHPPAQAAATTTTTPTRYPALADLTVGWGPF
                     TQTYTSRVYCVPGEVVEAVSGSADTSIPREVLRSVGYELGEECGGGRPPRMEGIFESL
                     VTRWTVKPAGVGHGGGGPAARGRGEGPASCWTEVTLSVTFQFANPALGFAVGQVADEK
                     VDEMAEAFEGRARRLYGR"
     gene            1434477..>1437684
                     /locus_tag="MYCTH_79619"
                     /db_xref="GeneID:11512043"
     mRNA            join(1434477..1434709,1434782..1434859,1434930..1435832,
                     1435899..1435971,1436039..1436295,1436494..1436581,
                     1436707..1436741,1436812..1436823,1436892..1437008,
                     1437075..1437114,1437169..1437372,1437442..1437489,
                     1437557..>1437684)
                     /locus_tag="MYCTH_79619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661316.1"
                     /db_xref="GeneID:11512043"
     CDS             join(1434656..1434709,1434782..1434859,1434930..1435832,
                     1435899..1435971,1436039..1436295,1436494..1436581,
                     1436707..1436741,1436812..1436823,1436892..1437008,
                     1437075..1437114,1437169..1437372,1437442..1437489,
                     1437557..1437684)
                     /locus_tag="MYCTH_79619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661364.1"
                     /db_xref="GeneID:11512043"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="JGIDB:Spoth2_79619"
                     /translation="MGHLVTVATCSLNQWVLDWEGNLARIIESIHQAKAAGARLRVGP
                     ELEICGYSSLDHFHELDVYTHSLEMLRQLLLDKSTHGILLDIGMPILHRNLRYNCRVI
                     CLDGKILLIRPKMWLANDGNYREMRHFTPWMRPRETEFFHLPKMLAELQGETHVLFGD
                     AVISTPETAFGAETCEELFTPKAPHIDMALDGVEIITNSSGSHFTLRKLDTRLQLITE
                     ATRKSGGVYLYANQQGCDGERLYFDGCAMIIVNGDVVAQGSQFSLNDVEVVTATVDLE
                     EVRSYRAAISRAMQAAASTAKYQRIQTPFELSSEADDSDVSKAPTLPIQPRFHSVEEE
                     IALCGGCYLWDYLRRSGAAGYLVPLSGGIDSCATAVVVYSMCRIVMQAVEQGNQQVID
                     DVKRIARYGGEGVLPKTAQELCNQVFTTIYMGMRKQSSRETRQRAKDLSEAIGSYHVN
                     LDIDDEFGQILPTARGRPGGGSLLILGSANVGEVSLRGYLTKYDCSSADINPIGSIDK
                     ADLKRFIAWAEKSFDLPCLHDFLTAVPTAELEPITQDYVQSDEADMGMTYQELTIFGR
                     LRKLNKLGPFGMFQRLVHDWSIDRERKPDDDAPYYTPAQVAEKVKKFFHYYAINRHKM
                     TTLTPALHCNDYSPDDNRFDLRPFLYPPFWKSWSFKRIDMELEKIEKKRASKKQ"
     gene            1437952..1439510
                     /locus_tag="MYCTH_2300670"
                     /db_xref="GeneID:11512044"
     mRNA            join(1437952..1438473,1438737..1439510)
                     /locus_tag="MYCTH_2300670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661317.1"
                     /db_xref="GeneID:11512044"
     CDS             join(1438140..1438473,1438737..1439491)
                     /locus_tag="MYCTH_2300670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661365.1"
                     /db_xref="GeneID:11512044"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_2300670"
                     /translation="MTVNSAEAVAGQNDAQEKLAAQASSLEIAQDKPEQDKQQQQSQV
                     PPHRSHDPQYNQKRSDPFQFGSRYLGEDDDVFEFNAWDHVETDDAYKEYAEQQYAMQR
                     QSPVSEFDKMRFNSDPAKWWNLFYKNNTANFFKDRKWLQQEFPVLHKVTREDAGPVTL
                     LEIGAGAGNTAFPVLAQNKNPKLKLHACDFSKKAVEVMRNHESYNPEFMQADVWDVAG
                     DELPPGLEEGSVDVAIMVFIFSALSPQQWKKAVENVYRVLKPGGEVCFRDYGRGDLAQ
                     VRFKKGRYLEENFYIRGDGTRVYFFEKDELERIWSGKLSEPAEGEAQGLQPSFEIENL
                     GVDRRLLVNRAKKLKMYRCWIQGRFRKK"
     gene            1440106..1445419
                     /locus_tag="MYCTH_2300672"
                     /db_xref="GeneID:11512045"
     mRNA            1440106..1445419
                     /locus_tag="MYCTH_2300672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661318.1"
                     /db_xref="GeneID:11512045"
     CDS             1440285..1445300
                     /locus_tag="MYCTH_2300672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661366.1"
                     /db_xref="GeneID:11512045"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="JGIDB:Spoth2_2300672"
                     /translation="MATPANNPFGAPPSQVLNNPFGAPAPAPAPAPASSQPAPAPNQQ
                     FQNPFGAAASQTNPFGSPAANPFGAPVKNPFGAPASGTKQQPSSGAASGAPPAPRSAF
                     GSPAVSPGSSSRQLSPAPPLQLNNPFGTPPTGPKSSRSPSPSGSRAQPTEPSSRSSGS
                     KSAEANTMARKNKSAGGKPAAPANSGGSGGQGGGQGTKGGAAGKGGSSNGGFGGRQGH
                     DQGTQLANPFAGANPFAKQPMAQQPAGASSTQSRQNVRGKQQAGRQERHQPPSSSRAS
                     GQKMVDRGPTERTKELSSFAYDYANKLYDHLKKEGIHPPKWPADPGDPSKRAAIENLK
                     EAYKKYRARVYASLRKADLIDDPEKRRKLEDALPFKGICESMCPEFEQVSRIAEYDVK
                     TEEKELRPDGLTMWPDPAKMVKKFGRSAAGQDAPLPMDVRSVDALRRTTDYLFNDLLQ
                     SESNLPSMHNFLWDRTRAVRKDFTFHSQKSAEEMKDMVYCFETITRFHATALHLLSKK
                     GVANEDFDQKQEIEQLGRTILSLIEAYDVCRDKRVHCENEAEFRAYYLLLNAHDPSIA
                     RRIPTWGAEFWFESEEVQTALSLIQAMDDVREPKGPIKPRVGTTLSDTSFTNYFAIVE
                     DPRVSYTMACIAEIHFTSVRQAILRNLVRGYARHRDAPRTITASDLNAMLRFDTPDEA
                     VEFAELHGFEFSTWVPDGRNPVTEPYLLLNNKKKTVPSPRVRQAFSGTLVERKRTTQS
                     LPYVIYNTIFEEPAEKPPGGGSPDSLFSEDSGLFVTQTPASEPLAETNLAPLPPPPSK
                     QSASPTTSSWSFGTPASSTPFSMGTSTTAPAFSGFSAPKPTASLFPGSSAASGQPTPQ
                     PRVGQSPFSSLSSQSAAAAAAAPTTITTTTIGTDAKPATTPAQVQPAPTEQTTTTSTT
                     TASPFAPAKPTEGSSPFGFLKSSSSVPSLPNFAQPTQPQPSTTSPSVPSPLGNAAPKP
                     TTTFGPSQDTATAQKKPPDSALSTSNLGSTNPPAGASPFPATTLPGQATQQSTASPSA
                     VPTIYITPPSFTAPTTQGLQPPVPASPSKPFGQEPQRGVDAGATAPSTVAPKPPPPPK
                     RDLLGDFTKWFVKGDDGLMEQFTEEFLRHILWGVWQDFEREREERKRKEEEKESWRLA
                     REHQTYRLRLKYFYRWRNNARALATKRILREGREKMRLYREQQKEVRRRQQEEKEKAD
                     REAKRAAKRQLMEDTHRFSLLASSSAAAGRRRRGSVAYSADYVSNNDPEEQLLASGVF
                     SGLGDDPRSLARRVVREAAGDADNEAWATGSATRSFRYPESELELELEPPRTSSPDTS
                     SVGGGKREGWKTRSLREKFGLEPRRSLSAGGGSLSSLSSRFRQSLPGTNSRTTNFAAS
                     LSSSSRKRSAAAGGEESDDDPGARRLLQYGGAKAAAGSGLVRSTHWDLRARGFVPMPD
                     GKWLPEALANKQLQQQQQQQQQQQGLGSPEDGLVDAAPDVDMASDAGRAASPTPSDWR
                     LRLAKLKRYRPLAQHGHSSRHSVDLPQQTPTTTGLSTPPRGILSTSPPHPPFTSASAA
                     AAAATATATIMQPPPLGGWRGEDGPIGGVGKRKRGPDDTGENEDEGHEDGAQQQRRSR
                     EPSPSAKKKAAAAAAAAAATGAVVVPGRAETYAMVENTKRMLRELREAMDRADRDARE
                     EVY"
     gene            complement(1446083..1448096)
                     /locus_tag="MYCTH_2300674"
                     /db_xref="GeneID:11512046"
     mRNA            complement(join(1446083..1447271,1447339..1448096))
                     /locus_tag="MYCTH_2300674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661319.1"
                     /db_xref="GeneID:11512046"
     CDS             complement(join(1446292..1447271,1447339..1447963))
                     /locus_tag="MYCTH_2300674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661367.1"
                     /db_xref="GeneID:11512046"
                     /db_xref="JGIDB:Spoth2_2300674"
                     /translation="MAKSALYTLLFFLFLVPHLSTALQVTPNSPCASVCQDLRGLDPS
                     DPDSSTTRNSDITCEDADYSSAAGTKFKKCMTCLQTSTFSQDGESDTMWFLCMSRRLS
                     FAPDWPNGEKSTLTLLLLKPKDNLRYTAAYCVFGYPNATNFSPTPCTTRTACGDLEAN
                     MRHGIPNPKGTTAYSYCHAGDGNAMDFSHFESCIACTSALGTTDYLANYFAALGVACQ
                     QQPAPGTLLSLNDTIFAHTPIGPGNDDDDRGSGLATPAVVGIVAGVLAFLLLSAGMTL
                     VCLRKRRKQYLRAGADAGYNNFSHHRHHSSMSFQCQTHMLSPRFWSAVAEDGVPTPMT
                     ENFGAVPAIWTPHHPDDSYIYHHQHHYQDDTTTTTTTTFTPAPNNKSSSSSTISRSSS
                     IRKPAQLQITTTTPPTPPPQAYYSSPSSSPEKVYHYSPSDFRSPLSADTVTRASALLP
                     PYPSHSPVAAPPVPAERHSGGRHGSGSGLGSGFPLRLGRKSPKIGSGGGGGGWGGGKG
                     VVVSGSSGSPVESRTIQTTFAAPPKR"
     gene            complement(1449574..1451195)
                     /locus_tag="MYCTH_2300677"
                     /db_xref="GeneID:11512047"
     mRNA            complement(1449574..1451195)
                     /locus_tag="MYCTH_2300677"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003661320.1"
                     /db_xref="GeneID:11512047"
     CDS             complement(1449802..1451100)
                     /locus_tag="MYCTH_2300677"
                     /note="CAZy_ID 268020"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003661368.1"
                     /db_xref="GeneID:11512047"
                     /db_xref="JGIDB:Spoth2_2300677"
                     /translation="MAALVAVIYLLLALLLPSFSSSSYSSSSRATRAARAKTPLLSVD
                     FPDPCIVQDASSGTWYAFATGGWWTPPPPPPTAAPNNNNNSSSADNATAATLEAAAAA
                     VYKNIQAASAPHPAGPWTYLASADPLPSAGAWALSGPDAQVWAPSVARLNASAYVLYY
                     AALLAPGYVGSAANEGNSSSSSSSSSSSSSSSSSASASRLHCIGAATSTTSSPLGPYR
                     PQREPVICPAGEGGAIDPAGFADPATGRRYVAYKVDGNALGRGGECNNGVAPSRRTPL
                     VLQEVEVDGAEGVRPVGPAAEILDRDADADGPLVEAPDLLYLPPSRDADADADGDGGR
                     SRPGRYVLFYSNRCWDGPGYSVNYAVAEGSIMGPYKRAAGSGEGPPLIGTGDRFDVTA
                     PGGAASVPGGDWLLFHGNCPQGRCLFGAEMEVVGGRVTVW"
     gene            complement(1451819..1453980)
                     /locus_tag="MYCTH_2090056"
                     /db_xref="GeneID:11512048"
     mRNA            complement(join(1451819..1452483,1452563..1453232,
                     1453308..1453363,1453446..1453980))
                     /locus_tag="MYCTH_2090056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661321.1"
                     /db_xref="GeneID:11512048"
     CDS             complement(join(1452027..1452483,1452563..1453232,
                     1453308..1453363,1453446..1453735))
                     /locus_tag="MYCTH_2090056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661369.1"
                     /db_xref="GeneID:11512048"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="JGIDB:Spoth2_2090056"
                     /translation="MADSKALVKKAGDNGEEEYAIKPQSTVPTIDTSTWPLLLKNYDK
                     MLVRSGHFTPIPNGSSPYKRDIKSYISSGVINLDKPSNPSSHEVVAWLKRILRVEKTG
                     HSGTLDPKVTGCLIVCIDRATRLVKAQQGAGKEYVCVIRFHDTVPGGEAAFAKALEIL
                     TGALFQRPPLISAVKRQLRIRTIHESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLG
                     LLLGVGAHMQELRRVRSGVMSEDDGTMVTLHDVLDAQWQYDNGGDETLLRKVIQPLET
                     LLCTYKRLVVKDSAVNAVCYGAKLMLPGLLRYDPGIEAHEEVVLMTTKGEAIAIGIAQ
                     MSTVEMTTCDHGVVAKVKRCIMERDLYPRRWGLGPVAMEKKKLKADGKLDKYGRPNEA
                     TPAKWTQSYTDYSAPDVAAAASSAAPAAADAPAAEAASPEKKAESAPEERADEEKKKR
                     KKHEGETPEEKAERKRLKKEKKEKKKAEKSKESKEAEESD"
     gene            complement(1454454..1456417)
                     /locus_tag="MYCTH_2300681"
                     /db_xref="GeneID:11512049"
     mRNA            complement(join(1454454..1455744,1455840..1455903,
                     1455970..1456417))
                     /locus_tag="MYCTH_2300681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661322.1"
                     /db_xref="GeneID:11512049"
     CDS             complement(join(1454490..1455744,1455840..1455903,
                     1455970..1456228))
                     /locus_tag="MYCTH_2300681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661370.1"
                     /db_xref="GeneID:11512049"
                     /db_xref="JGIDB:Spoth2_2300681"
                     /translation="MRLGTVHLYVAAAVFAPLAASIFIAAPDSPCSKYCGNVQSSTAT
                     DEMVCDDAGLASSEGVVWEQCIGCLLTSTYVSGGHSDLQSLLYNLRFNVGYCLFGGET
                     NPCVTSTACAPLGRAVSYKNMSTSVGALDYCSKWDQGFYPPCSECLIPLQQDHLHGIY
                     QNNYVTILEAACEQRPDPGFTVSIAGDPFDPNVAVSIVEPHPDASSVPTPDYGPVSLG
                     ARVGIAFGGLAFILVVAGVCIVCNGKRRRRAFLRELERRHGGQGWPHPKTRYGGSSSS
                     GGGPDMFETPVSQRPLRGWETESPVSAHTDAPFPRYFSPYSSQYASPVTSPEAPGSIH
                     HQWPTLVPQRTEQQQQQQQQFNQMTQTQSPSTHGSPPPAFSQWPTSNQEQIHAQHVQG
                     QNEPAIGIALGGDEASLRSKASNLNLNGYPIDSKGKQRDEAYEMHEVESPYGYGNGTA
                     NGNASWNGNGNGDSKDHRHYEYPFRMPAEPQAPVLHHPGYGRHHGSRTGPGGADAGAG
                     VVGVGQYPDYQRGYPVS"
     gene            complement(1457867..1461240)
                     /locus_tag="MYCTH_2300684"
                     /db_xref="GeneID:11512050"
     mRNA            complement(join(1457867..1460258,1460310..1460649,
                     1460734..1461240))
                     /locus_tag="MYCTH_2300684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661323.1"
                     /db_xref="GeneID:11512050"
     CDS             complement(join(1458260..1460258,1460310..1460649,
                     1460734..1460878))
                     /locus_tag="MYCTH_2300684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661371.1"
                     /db_xref="GeneID:11512050"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="JGIDB:Spoth2_2300684"
                     /translation="MRIACLQFSPQVGDVDDNLNRADAVLDRVDPEELDSLDLLVLPE
                     LAFTGYNFKSLQDIAPFLEEVGSGISSLWAQTTALKHDCTVVVGYPEKVDVSEKWPAS
                     PGCYNSAVIVNGEGDTVGNYRKSFLYYTDETWALEGANGFFEGEIPKLGSVALGICTD
                     LNPYKLEAPWDAFEFGFHILKSEANLVIMSMAWQTHHDRSVFNFNPAEPDLETLVYWV
                     QRLEPLIRADTEEEIIVVFCNRAGSEEEVTYTGTSAVIGIRRGEVFVYGVLGRGVDEL
                     LIVDTDQPPMSKLTDADAVAGDEEAVAEEKKAPDTEIKGGLPAPPIPENRHSRESEVT
                     PRHLASPGLSSPRQPTSPRLPWLAQPTQPGETPTDNRSPTRLQIPTRPPADEVYTAID
                     TAFTDDNIIIDTPAMAHTPAFARRLQRPTLTIPASPGWRFPSKQSPYPWQHHDGSHSS
                     VFGAGATMTPITPFDEDGWSSTPIDQKAPPQWFWRHEPTLSALKESAVEEEEKENGSD
                     SPQHVALPSAQERKQDASDARTHESSDYHTRAQQAEPEERVMDWKTQEGGEDVREEGQ
                     DPAEERTALKNDWADLAHVLEGLRARPGSVLDVSSSPDDRPSSPKSRNVSRSSSPFRS
                     LERWGPRYGGQEHDNASGGPGGPADGEAARPHQGPRQWQRQRQRQPSRLRHVVSRDVA
                     DAASSRDMDDTTPPLSIDPAAAAAAAGEARGGERGGKRGGVETGTDGIPIQDATTTPS
                     LCSATSATSTSTFSDDVVEPRDPVVFVRDGGDSTGSDSVADAAVLPPGLVAAVEGGGK
                     GAADPGANGSLEMEGGSAGLEIGRPAVHG"
     gene            <1464327..>1464773
                     /locus_tag="MYCTH_2032303"
                     /db_xref="GeneID:11512051"
     mRNA            <1464327..>1464773
                     /locus_tag="MYCTH_2032303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661324.1"
                     /db_xref="GeneID:11512051"
     CDS             1464327..>1464773
                     /locus_tag="MYCTH_2032303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661372.1"
                     /db_xref="GeneID:11512051"
                     /db_xref="JGIDB:Spoth2_2032303"
                     /translation="MRHDAKTYHSVAARPETPPTAPSSPSSSSSLSTPSLLDLGFMRE
                     DTDLSRSQQPRTPDRRSVDTAAALRSYGHERGPHKHSGLGGNQQADIPFIAELPAMPP
                     LQQTSAPPPTPPPTTPPRKGPAVPMRKEVGGAKPITYLNPVGEPWVN"
     gene            1466021..1466092
                     /locus_tag="MYCTH_t57"
                     /db_xref="GeneID:11512052"
     tRNA            1466021..1466092
                     /locus_tag="MYCTH_t57"
                     /product="tRNA-Met"
                     /note="Anticodon: CAT"
                     /anticodon=(pos:1466053..1466055,aa:Met,seq:cat)
                     /db_xref="GeneID:11512052"
     gene            complement(1466239..>1468188)
                     /locus_tag="MYCTH_2090061"
                     /db_xref="GeneID:11512506"
     mRNA            complement(join(1466239..1466954,1467111..1467527,
                     1467660..1467828,1468044..>1468188))
                     /locus_tag="MYCTH_2090061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661325.1"
                     /db_xref="GeneID:11512506"
     CDS             complement(join(1466618..1466954,1467111..1467527,
                     1467660..1467828,1468044..1468188))
                     /locus_tag="MYCTH_2090061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661373.1"
                     /db_xref="GeneID:11512506"
                     /db_xref="JGIDB:Spoth2_2090061"
                     /translation="MRIGCLQFAPKVGDVTNNIAQAEAVLSSADQDELKNLDLLVLPE
                     MAFSEPENYNSLIVVDRDGETLANYSKSFLYYTDATWAREGRGFYGGKLGDLGQTAMG
                     ICTPYKFEAPWDAYEFAFHILRVRANLVILSTAWLTNDERTGFLACPDAPDLYTLTYW
                     AQRLEPVIRTGASEETVVVFANRSGVEDEATYAGTSTVLGIRDGQVSVYGILGRGVEE
                     LLVVDTDKPPLGRLVYRPAVPGDGSPTQTSALPTTASRRRLTAAKAAGAEHKPAGSTH
                     PRPKLTLQTDLPRLRTPPAASAELDPTGHGPSASHCRRRSPFSSTTPAARPTTPPSRS
                     RAFRHGGGGGPRCRLLPAAAR"
     gene            complement(<1468986..>1470140)
                     /locus_tag="MYCTH_93131"
                     /db_xref="GeneID:11512053"
     mRNA            complement(join(<1468986..1469091,1469221..1469347,
                     1469525..1469527,1469542..1469964,1470062..>1470140))
                     /locus_tag="MYCTH_93131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661326.1"
                     /db_xref="GeneID:11512053"
     CDS             complement(join(1468986..1469091,1469221..1469347,
                     1469525..1469527,1469542..1469964,1470062..1470140))
                     /locus_tag="MYCTH_93131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661374.1"
                     /db_xref="GeneID:11512053"
                     /db_xref="JGIDB:Spoth2_93131"
                     /translation="MRLFPLLLPLASAEALVSWTISSLACQSAAATYTPCTYTLALDI
                     SPPDRDAPRICTITITSFLDDGEGASLTLVPADTARNLCAFFGYTDAGRVGSSGAAAE
                     SRSEAGFTAGSLPGSSPPDDSGEKEYDDGRMRAKSGRRMATDTKRGLNTGSEERKEWQ
                     VKGLTRCIQAPTSDPVGSFYGIPCSSDDDPGFKASWGYNSDTDSAVMTICYAPNGTDA
                     WFGFEQVSKNQWLGDSKKEPVYFTGCA"
     gene            1470970..1471494
                     /locus_tag="MYCTH_2300688"
                     /db_xref="GeneID:11512054"
     mRNA            1470970..1471494
                     /locus_tag="MYCTH_2300688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661327.1"
                     /db_xref="GeneID:11512054"
     CDS             1471180..1471344
                     /locus_tag="MYCTH_2300688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661375.1"
                     /db_xref="GeneID:11512054"
                     /db_xref="JGIDB:Spoth2_2300688"
                     /translation="MIGPLALRLIASGPAAVLLVPGGGQRTGTGAKPWGCRTTQLDWH
                     KTQRCRQRLL"
     gene            1472991..>1474485
                     /locus_tag="MYCTH_107095"
                     /db_xref="GeneID:11512055"
     mRNA            1472991..>1474485
                     /locus_tag="MYCTH_107095"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661328.1"
                     /db_xref="GeneID:11512055"
     CDS             1473208..1474485
                     /locus_tag="MYCTH_107095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661376.1"
                     /db_xref="GeneID:11512055"
                     /db_xref="JGIDB:Spoth2_107095"
                     /translation="MTLAGMRVLPRDGEAGSAPLTTGAIAGIACGAGALFLGATSLFI
                     VYFRRQRRYAREDYSDSDSFDDTMPRRAMAPVVTYTMDYKIDNPQHHEGSSYIYSPEQ
                     ASYILSPQSTSDAASAMPTHPAYIPRALVRGSSTPSNRSVSTTSPPPPFLSLSPPYPP
                     SISHSSKIQPDDSMIGAYLAAAAQAGPQAQSQDSPPEESDAASSSSGPAIRPAPPRSV
                     SPTDGSSSDHNNHQQQQQQQQFPLPNGLQPLPARRKPRAYTPPRLNLAEGTAQNRSRR
                     ERPLLGKEHATISGPLAFPQFSHPPIGPPPPPAVPPAAAAASRSGWRREEVAADIWDG
                     EGEEQWHSHASPPGDGRRTFRSRIALAGGGGGGSGSGSGSGSNSGRGRGRGRGNGNGK
                     KKHGRKKSDRGSGGYGSNRHYTEVEIGRGSDIW"
     gene            complement(1474712..1476342)
                     /locus_tag="MYCTH_2300690"
                     /db_xref="GeneID:11512056"
     mRNA            complement(join(1474712..1475394,1475761..1475858,
                     1475918..1476342))
                     /locus_tag="MYCTH_2300690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661329.1"
                     /db_xref="GeneID:11512056"
     CDS             complement(join(1474939..1475394,1475761..1475858,
                     1475918..1476146))
                     /locus_tag="MYCTH_2300690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661377.1"
                     /db_xref="GeneID:11512056"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="JGIDB:Spoth2_2300690"
                     /translation="MSSEIMDAYWAAPPMARTLATAILVTSISVHFGFVSFVWFYFTE
                     DRLLRFPPEIWRLATTFFLSRPKLGIIMDPYFAFQYLRDLEVANSRFPRKEDVLWYLI
                     TVGGFIIFLNRTFLGGGFFLDALIMALAYTATQDQRGIRSNFFFFTVPAQAIPYCMLV
                     SSLLMSPAAIPLQITGIVAAHLYDFLSRLWPEFGGGRNILATPRFVSYLVQTPRVLKR
                     DYGTAIRQPNAPTAGSSTGASTGSVLPDSWKTRGAGHRLGGN"
     gene            1476517..1478517
                     /locus_tag="MYCTH_2300695"
                     /db_xref="GeneID:11512057"
     mRNA            join(1476517..1478129,1478195..1478304,1478360..1478517)
                     /locus_tag="MYCTH_2300695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661330.1"
                     /db_xref="GeneID:11512057"
     CDS             join(1476852..1478129,1478195..1478304,1478360..1478387)
                     /locus_tag="MYCTH_2300695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661378.1"
                     /db_xref="GeneID:11512057"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="JGIDB:Spoth2_2300695"
                     /translation="MAMAGFNGCLLNQLRQSRVQLARHIGRAPSRAYSALPNGSIPAA
                     KKKYVPTTGTYPLGFRASGTIVGVKPSNTTKPDLALLTSDAPCAAAAVFTKNKFQAAP
                     VTFSRDLLKRKSNQGIQGVIINSGCANAVTGKGGLEDAAKMAQAADKCIGQSDSTIVM
                     STGVIGQRLPIDKILSKVPAAHGALGGSHEHWLTAAKAICTTDTFPKLMSRTFTLPSS
                     PGIEYRIAGMTKGAGMIHPNMATLLGVIATDAPIAAAALPPALKHAVDRSFNSITIDG
                     DTSTNDTVALLANGAAGGKEVVEGTPDYGAFRAVLTDFAAKLAQLVVRDGEGATKFVT
                     IRVTESASEEAARRIASTIARSPLVKTALYGKDANWGRILCATGYSLLSEPGQPVNEV
                     PEIVPEKTNVSFIPTDGTAELKLLVNGEPERVDEARAAEILELEDLEILVRLGQGDKQ
                     ATYWTCDYSHEYITINGDYRT"
     gene            1478650..1480239
                     /locus_tag="MYCTH_2300696"
                     /db_xref="GeneID:11512058"
     mRNA            join(1478650..1478857,1478920..1479140,1479212..1480239)
                     /locus_tag="MYCTH_2300696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661331.1"
                     /db_xref="GeneID:11512058"
     CDS             join(1478757..1478857,1478920..1479140,1479212..1479960)
                     /locus_tag="MYCTH_2300696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661379.1"
                     /db_xref="GeneID:11512058"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="JGIDB:Spoth2_2300696"
                     /translation="MPAVRAEEKGESSTAPHKALTADNNANPTYELPWVEKYRPVFLD
                     DIVGNTETVERLKIIARDGNMPHLIISGMPGIGKTTSVLCLARQLLGDAYKEAVLELN
                     ASDERGIEVVRQRIKGFAQKKVTLPQGRHKIVILDEADSMTSGAQQALRRTMEIYSNT
                     TRFAFACNQSNKIIEPLQSRCAILRYAKLTDAQVVKRLLQIIEAEKVEYSDDGLAALV
                     FTAEGDMRQAINNLQSTHAGFGFVSGDNVFKVVDSPHPIKVQAMLKACYEGNIDSALD
                     TLRELWDLGYSSHDIISTMFKVTKTIPTLSEHAKLEFIKEIGFTHMKILEGVQTLLQL
                     SGCVARLCKLNMDPKKFELPKK"
     gene            complement(1481116..1482425)
                     /locus_tag="MYCTH_2300697"
                     /db_xref="GeneID:11512059"
     mRNA            complement(join(1481116..1481920,1482026..1482425))
                     /locus_tag="MYCTH_2300697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661332.1"
                     /db_xref="GeneID:11512059"
     CDS             complement(join(1481508..1481920,1482026..1482302))
                     /locus_tag="MYCTH_2300697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661380.1"
                     /db_xref="GeneID:11512059"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="JGIDB:Spoth2_2300697"
                     /translation="MSSSQPAPRWAAFARDTNETKIQIALNLDGGAFPPDTDPRLQVG
                     DAGGHAAQSSKSQTITINTGIGFLDHMLHALAKHAGWSLALACKGDLHIDDHHTAEDV
                     CISLGYAFARALGTPTGLARFGSAYAPLDEALSRAVVDLSNRPYCVANLGLKREKIGD
                     LSTEMIPHCLHSFAGAARITLHVDCLRGDNDHHRAESAFKALAVAIRQATSRVAGREG
                     EVPSTKGTLSV"
     gene            1482614..1483405
                     /locus_tag="MYCTH_2300699"
                     /db_xref="GeneID:11512060"
     mRNA            join(1482614..1483001,1483072..1483405)
                     /locus_tag="MYCTH_2300699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661333.1"
                     /db_xref="GeneID:11512060"
     CDS             join(1482687..1483001,1483072..1483380)
                     /locus_tag="MYCTH_2300699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661381.1"
                     /db_xref="GeneID:11512060"
                     /db_xref="JGIDB:Spoth2_2300699"
                     /translation="MAPTRTIKNKYATSKGGAGGGKGSSKQSGSGGITKSKGRAGSKA
                     NVPATQVKGRPNLPGLDKDKKKKQRVYTEKELGIPELNMVTPVGVTKPRGKKKGKVFV
                     DDRESMSTILAMVQAEKEGQIESKMMRARQLEEIREARRIEAEKKEAERKAKLEETKE
                     SLRKKRKRNKGKARKEEEEGESVKEVAATGTKAAKPKKKKRVSFAPE"
     gene            complement(<1483756..>1485318)
                     /locus_tag="MYCTH_45273"
                     /db_xref="GeneID:11512061"
     mRNA            complement(join(<1483756..1483896,1483952..1484080,
                     1484135..1484249,1484316..1484430,1484486..1484621,
                     1484683..>1485318))
                     /locus_tag="MYCTH_45273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661334.1"
                     /db_xref="GeneID:11512061"
     CDS             complement(join(1483756..1483896,1483952..1484080,
                     1484135..1484249,1484316..1484430,1484486..1484621,
                     1484683..1485318))
                     /locus_tag="MYCTH_45273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661382.1"
                     /db_xref="GeneID:11512061"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_45273"
                     /translation="MDWFGRAKIAFTHSPTPLTLQRKDGTVTDLLKVCEASTPPCQLN
                     PLLFNGDIQTMWTAVQEHGPPIFYRRRIFVADHKTYTGTFAVDFAVEPHTDVDEGLPP
                     RTAFYSDEDFAKIASDDSRPMLIVLHGLSGGSHEIYLRHAIAPLVLNGGNWEVCVVNS
                     RGCANSKVTSGLLFNARATWDIRQVVKWARETFPNRPLFALGFSLGANILTNYVGEEG
                     ANCPLKGAIAVGNPFDLEVANKSLQRTFLGKQVYSRVMGSNMKKLINAHKDAILKHTN
                     LNFDRIQQVTYLHEFDREVQTVTWGYPTENAYYRDASSSDAVLAIRIPFLAISALDDP
                     IAVYDAIPFQEFTQNPYTVLLTTSLGGHLSWFELGGGRWHARPICNFLNRMVTEINLD
                     AITPDANGTKLETQFVTEFNPVRRKLQILNN"
     gene            1486137..1489223
                     /locus_tag="MYCTH_2300704"
                     /db_xref="GeneID:11512062"
     mRNA            join(1486137..1487301,1487361..1487476,1487527..1488087,
                     1488146..1488237,1488298..1489223)
                     /locus_tag="MYCTH_2300704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661335.1"
                     /db_xref="GeneID:11512062"
     CDS             join(1486216..1487301,1487361..1487476,1487527..1488087,
                     1488146..1488237,1488298..1489124)
                     /locus_tag="MYCTH_2300704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661383.1"
                     /db_xref="GeneID:11512062"
                     /db_xref="JGIDB:Spoth2_2300704"
                     /translation="MPPGEAYGNQGQQQHPQQHQFQVHPQARQLHPQPQHLPPLHSGP
                     QAPPLPQPSLLPHPQYANPYPGGHQQYQQQHRQHQYQHLHQHLHQQQHVQYVHPAYAQ
                     QQQPAPFYPNDTPQQPYRNYNGAFHQFTPAPAPATAPAPAPIPNPTLAPQSAPLPHPT
                     HTSTPMPAPIQFVDPSYMQHGPATRPPGVPPPVSQPPSAPLLNPQLSRPAAQPKAPCP
                     MPVNPSPKLEEKWPPSRGTPKLLTKEPRRPSSSAGVTKSPATPQAPAHVETLPLLLSV
                     AEDCFEKANAAAQRLARTMGPSEVAEHHKLIAIGLGCLDVALKSNKLWPRLEARLCLR
                     YTSILIEETTNITEAETALTRGISVCEKHRFLDLKYSSQFLLMKTLFQRNQKAAFKSV
                     ESHIADCTTYKHVPWIYAFRFLKASFHLQSGTAADNHAIENLRKIAGIASQRNDKAIF
                     VVAMLLEGLAHLSTMKDDWATRVQMCIAQVSKLQLDESIRIPQTDVLLLMLDLACSLH
                     QKTHQISAQKLSALQRRLEELKQASNWSSQHGEMLLPINRMQNTQQIVSADTRAVLRP
                     GDDRVDYLVISALGKQEAWALAYVLNGIVAHYRATTPGRSSGMWGEAIRLLEESKTGP
                     SSYSLPEALKQAEWAKELSCYAHVLTGLQAATLSDWAKVKACLKAIEQQKPESELLDV
                     LTLYLEGVFHQGTAALDKATEIWKDKQFEMDWSGAPKPAGNRIATELSILAALNRLWI
                     MQDPAQADDAETAELVDLLRPICEDNPDQEIRTVYNLVLSSIRTNPPLSINQVKRHIQ
                     QSLSGAQQTSNTQYLAIALNIMRARLFENVVGEQALKSARAGSAQARKSGNVLWMSVA
                     EGMLAQSFEMQGALAEARVAHETGVRLANEAFAKTQV"
     gene            1490319..1491370
                     /locus_tag="MYCTH_2300706"
                     /db_xref="GeneID:11512063"
     mRNA            1490319..1491370
                     /locus_tag="MYCTH_2300706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661336.1"
                     /db_xref="GeneID:11512063"
     CDS             1490337..1491086
                     /locus_tag="MYCTH_2300706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661384.1"
                     /db_xref="GeneID:11512063"
                     /db_xref="JGIDB:Spoth2_2300706"
                     /translation="MSSLDPPAQASPPSAPPPSSSSSSSPSSSGEEPNRNQNRNPILH
                     NAALAMAILCPVALVLPTRGGGRAKSTLQNAVLGGGAFWGVNQLAEDYTGKSITARSA
                     ERWGALLGVSVGGAGAGAGDGSGGNHKGDSSESSSSSSKVGFMHNLPTERAARNKELM
                     EAERRRRAEAEGKEYVPKKKAPGSLWERLWMGGEEEGWKERRLEEERRAIESGKGYGD
                     LIADQVTEVWRGKSGAADGNGGKDGKGNKKE"
     gene            1493117..1495338
                     /locus_tag="MYCTH_2300708"
                     /db_xref="GeneID:11512064"
     mRNA            join(1493117..1494951,1495086..1495338)
                     /locus_tag="MYCTH_2300708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661337.1"
                     /db_xref="GeneID:11512064"
     CDS             join(1493338..1494951,1495086..1495127)
                     /locus_tag="MYCTH_2300708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661385.1"
                     /db_xref="GeneID:11512064"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="JGIDB:Spoth2_2300708"
                     /translation="MANEYYNQKPLPDPVSPVYDSDRPAPSYSSYSTPAPSSNSRQHL
                     APGDRPPQGVSPSPFDTVFDDHVYPASTHSSMHRLSQQDTGYHGHSPVSNDGIPLQDR
                     QRLSFKDAEMQDHVYDAPQPKTSRRGRVRFGELGMLGSNRKKIPFVVYFFTLVQVAVF
                     IGEIVRNGEQIPFPPSFPSSALSLSLSLSLSLSLSLSFPFANPRMAVATNGTRPATET
                     GSPIMTQPSFNPMIGPSPYVLINMGARFVPCMHNVDGIQNANRTLPWPCPSTTTNDPN
                     SPENQCTLGDLCGFGGVPEPAYKPGTPLDTKPAPNQWFRFIIPIFMHAGVIHIGFNML
                     LQLTLARDMEKSIGSIRFFLVYMSAGIFGFVMGGNYAGNAVASTGASGSLFGIIALTL
                     LDLLYSWKDRVSPVKDLVFILLDVIISFVLGLLPGLDNFSHIGGFLMGLALGICVLHS
                     PNSLRRRIGDDVPYAHSDVSGGFAAQGTPPSFLKNPVGFFKGRKPLWWAWWLIRAGAL
                     VLVTVVFIVLLNNFYVDQRTCSWCKYLSCLPIHDWCSIGELNL"
     gene            complement(1495959..1500042)
                     /locus_tag="MYCTH_2300709"
                     /db_xref="GeneID:11512065"
     mRNA            complement(1495959..1500042)
                     /locus_tag="MYCTH_2300709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661338.1"
                     /db_xref="GeneID:11512065"
     CDS             complement(1495963..1499913)
                     /locus_tag="MYCTH_2300709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661386.1"
                     /db_xref="GeneID:11512065"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="JGIDB:Spoth2_2300709"
                     /translation="MLQLTRQARSAWKTGFICTSCRALLASGATRLPGAVARLCAARH
                     YSSPPDQHPPPPPPSPPPPTPPSQQEQQQQKDTQTAEQQTAEQAKTPKRSKPSKRQRK
                     RKARRSRASSASASASSPTTTHQLWRETLNVLKEIKADQRQSTPQTKDAHAGTETETP
                     QTAPASGSSSEEKPGKGKGSSSSSPQDEKTLEGALVMLKKVLRQELRDDAQLVKQTAE
                     HAPCEKAPAAAPKEAKTATTKRQKSLAEALGFAKAKAEAKAEAKADAEPAEPAAEKPA
                     KKPTQEPAKPAEKLSAKASSKTPKSTSKSKPAASSSKASKTLSSLTPLSAVARHAKRK
                     GKGTTGFVVNRIDAAKIELTPIEKEQPPVPRLAYGLDRVLFNPGVYHIRDPRSRVFNF
                     DPYLERIMPIKEFDFEAIKQYVTSSKDMTLIKTAAEHQKKYTGSTSSMTSTLAHFHYL
                     LSAWRPINPCMLSKNFEIDSYRFTRIMRAPAATFLHWKDGTYAIDADKEFDTANILSM
                     LGKSMEKFLTLPKQEFEKYRKINSDQLTEEERNGPESYHYTTLGDFLMRSQLDAYDPR
                     LPGTGMFDLKTRAVISIRMDAQDFHKGLGYEIRTRFGNWESFEREYYDMIRSAFLKYS
                     LQVRMGRMDGIFVAYHNTERIFGFQYIPLQEMDLSLHGQENTTLGDREFKLSVYLLNK
                     VLDKVTKKYPGRSLRLHFETRGEETPFMYIFAKPVTPREIEEIQGATRAKVEEFERQM
                     MGVVEEARALDEEDGGEESLDDAEEHDMDESDGEEITSSAAWEEVMLKVEDELEDEEH
                     GVTFVREAIEDALQESGLLRNAASDETQRYVDAFLEALTGNGRRAAPEDHDAPEPAAS
                     GEAEPAVERSAGSGATPSIVPEATEQAEQSSGEPHEYDAQPAATESSSAEEPTLKDLI
                     VKLATQIRAAPSEQRTSLKEREDVIDEDESEYALKLRKIERLLSELTDQPPQGDKAGE
                     GAGSGVVETGEVLAEDGQQVKPTEPSVSAGPTTRPEHAEAKGETAVNTKEAPVTPPKD
                     SAAASPTSAEAAEAGKHSEKEKSQPTGTTESPTARPTESAPIPFPAPAAKDAGEAPAT
                     PPKASSQPKSEPEPKAKQAATESPPAAADAPGKAKFPAEERDTGELYGLILTVRNKVD
                     GQYVTRPEKLHPRQRWQVEYAIEEVKPERAHNLYKMVLKRRKNLLYPEDAADANRWRE
                     MFSGRLEKYSARGRKFRRREDERLRGQPVHVYGEDEPLPFESVYGEAALGGYGKGNGN
                     GNGTGKGGGNGKEKDDGEEDESPEKEKEKKEVEKAERNEEDDDNRAGRKGKRRS"
     gene            1506434..1508687
                     /locus_tag="MYCTH_2300711"
                     /db_xref="GeneID:11512066"
     mRNA            1506434..1508687
                     /locus_tag="MYCTH_2300711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661339.1"
                     /db_xref="GeneID:11512066"
     CDS             1506538..1508292
                     /locus_tag="MYCTH_2300711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661387.1"
                     /db_xref="GeneID:11512066"
                     /db_xref="JGIDB:Spoth2_2300711"
                     /translation="MSAHSASPSPLQSPANGLADESRMPKGHCRYILLQPEIKGQRCA
                     CVNFTLNKGIPGSTCECGHLACYHNREPDVSADQRQELEQLKRRLQHLEEQLSRGQED
                     VLDSVVSRLNEVEEHLEKSKEEVGEQIKGAYRNVSISWRSIEQAERRSQQHDEQLRHI
                     YDKLRDHDEQLDRVHAGQLELRDADLSLEERIENLTETLEEEEEARLAAALAARPQRR
                     RSTSDTSRPSVPLGPLGAGAAHQVPYPSPTGGPISTSTFSEVCDGTGRDAKRSTRHFC
                     RHPSSPRPALSPPVRPTGPWTVHISLLPHASVPMPFERNTTAYQRCLSRGLHRMVAVQ
                     GRDAASFKEAVEKAFGQFLRGREWMPLQAKLCDAATLQGLPMLRRLDDPKRRNPRLVL
                     GGDPACDHEFLRRHCAVVDPHGVIDSLYIAMRNHTISWHTLRHAPVFMEGLEDCWAYD
                     PLLDKDPFDDADIAVDDEARPAAGDITTALPPSAGGVAGLKRPLSEMSRSNSFGSDGN
                     SSGAAAALQGSSSSSSSSSSSSSSSSSSSSSSSNTTSTAAATGDMMGDEARVKRPCPA
                     PPSASIVEIRRRDTIKTA"
     gene            1510083..1511898
                     /locus_tag="MYCTH_2300713"
                     /db_xref="GeneID:11512067"
     mRNA            join(1510083..1510415,1510481..1511480,1511640..1511898)
                     /locus_tag="MYCTH_2300713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661340.1"
                     /db_xref="GeneID:11512067"
     CDS             join(1510314..1510415,1510481..1511480,1511640..1511866)
                     /locus_tag="MYCTH_2300713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661388.1"
                     /db_xref="GeneID:11512067"
                     /db_xref="JGIDB:Spoth2_2300713"
                     /translation="MDLDIEMDVDDVQDMPVPAIPAAYTEDVVAEDEQEPGEVEEGPN
                     GGDNGDASDKAKAPVPYKVHIKGLDTFNPDDVKGYLAEHYSTSELNRVEWIDDTCANY
                     IFKSDRIAQEALVALAAVEIADVTQLPPLENIPAKSYSQKPECSLLVRFAVEGDKKVA
                     GAAERSRFYLLHPEYDPGERRRRGELGRGRYRDRDDRYRRDRRNDRRRDSRDEEEPES
                     FDVNLYDDDESALATRARRRSRPRRRSMSRSSDTRGAAQRNRDKELFPDKLSGSLGRS
                     LRDRSASPVRDRDGDAEMDLDEAARAAAAMRSRERGRSIKERLSRDNSTKELFPSKEI
                     NRKKELFPSKVNSSGGGGTAQMDKVNDTTVLTTASLADRITAPSAGGFSIRGMANKRS
                     DDQGIAIKGTGPTVRELFPEKFGTNAGKELFAEKLEGRGKRRQKAEDMFT"
     gene            1512945..1515465
                     /locus_tag="MYCTH_2300715"
                     /db_xref="GeneID:11512068"
     mRNA            join(1512945..1513871,1513947..1514266,1514322..1515465)
                     /locus_tag="MYCTH_2300715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661341.1"
                     /db_xref="GeneID:11512068"
     CDS             join(1513204..1513871,1513947..1514266,1514322..1515355)
                     /locus_tag="MYCTH_2300715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661389.1"
                     /db_xref="GeneID:11512068"
                     /db_xref="JGIDB:Spoth2_2300715"
                     /translation="MADNTNPTSSWFRPFGRSNTSNTNQQQQQEQRQSPPLQTRQTSH
                     HVLTHISTSTESPTNESPPRGHGHHSHHHQNQHHQHHHRKSAGATLRTVSSFLNLKSS
                     TSKSGGGTGKSHVWQLSRSGNGAATVATLEDDPRIRTPASLSMLPLTEVDYGSPSSCV
                     DGWYGTEVGTRSRSGSGRSGGRESRDAEGGGERTWHNPNVMQMTEMLSSVMTRMAPGD
                     RLDPTYHSCIFSLIEGFYKLTRRLQDVEEQLAEIKDLRERELDQFRGMTEEWMETSEA
                     YKAEVKRLELALAKESKDGVASVALARHGSLVDRVGSKRFHARLERLNGLHDQDTTGE
                     EHAPHAGTQPVGLAEETTSYRTLSTYEYVQTVVLETKWTRGSIPRILDSQNDVTLSRI
                     LEQRELEERMAHQRRGEGRVRAAPVLIHPRGAPEPRDFLGDTLRAGRQPPVAVVERDP
                     LAAKAQENPTADSTVRPGPESHSSSSIGNESSSSSSSTPSSDSQTDAREEFAHSSISS
                     GKSNDLPRKRRQKQSICSESSYQAYHGNGEFPRAGEGTGESSGQQGQQGQQSLLGPPL
                     REKGRRRRYSFEIGDDELLSIAPRSGSEVRHHPRVPSAGEETCVEGNQSLGITPDSGV
                     AQVSAAKPSSNWSSGSISHSTSADTVRWVGEDGSPESSNTRQGQTKAKP"
     gene            <1516765..>1518594
                     /locus_tag="MYCTH_2125110"
                     /db_xref="GeneID:11512069"
     mRNA            join(<1516765..1516858,1516912..1516978,1517033..1517166,
                     1518428..>1518594)
                     /locus_tag="MYCTH_2125110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661342.1"
                     /db_xref="GeneID:11512069"
     CDS             join(1516765..1516858,1516912..1516978,1517033..1517166,
                     1518428..1518594)
                     /locus_tag="MYCTH_2125110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661390.1"
                     /db_xref="GeneID:11512069"
                     /db_xref="JGIDB:Spoth2_2125110"
                     /translation="MPGGKERAEERRENKRRPKEVQMRRTKEDPRVGIGRKEVPTFFN
                     KVTLSREREGLTDPYWEAHRYRCRCRRTRAAPPHQAKYAEAVMTRGRMGTGIGDAKSK
                     GGAGQGETDRGFSAWLTQKMAYYIIIVIIVIIVIINVLRLMLTTTCQTRVL"
     gene            1524665..1526670
                     /locus_tag="MYCTH_2300719"
                     /db_xref="GeneID:11512070"
     mRNA            1524665..1526670
                     /locus_tag="MYCTH_2300719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661343.1"
                     /db_xref="GeneID:11512070"
     CDS             1524890..1525924
                     /locus_tag="MYCTH_2300719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661391.1"
                     /db_xref="GeneID:11512070"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2300719"
                     /translation="MLSEQSLNKRNWEGKEDLLLLELHAAYGPNWTRIAGGMGIRSAK
                     QCRERYTQHLKPGLNRTPISDEEGRQIMKMVSECGQRWAQIARNLGTNRSDNQIKNWW
                     NGAKRKETSKRQEASQEQQHAHQQQHHHHQQPQPQPQPQHQQHQQQQQFHQQQQYQYP
                     QDLSPSTGVAALSERRGILPPVPLELPLDAARARSSPARSYDSERPPSLVSDSGSSWS
                     ISQPASASCSPTSLSLPPLQYAPPTPPTANNCLPPPSALGHGFGPGPVRRSSDAMQPA
                     ASSYSPRSRYATTAPTTPVGRAPSFSSRWEPYPTKGRRPSTGYSSQGHHGYESESGKA
                     DKGSLSFLLN"
     gene            <1526965..>1528476
                     /locus_tag="MYCTH_2108695"
                     /db_xref="GeneID:11512071"
     mRNA            join(<1526965..1526995,1527054..1527303,1527354..1527530,
                     1527883..1527925,1527999..1528205,1528297..>1528476)
                     /locus_tag="MYCTH_2108695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661344.1"
                     /db_xref="GeneID:11512071"
     CDS             join(1526965..1526995,1527054..1527303,1527354..1527530,
                     1527883..1527925,1527999..1528205,1528297..1528476)
                     /locus_tag="MYCTH_2108695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661392.1"
                     /db_xref="GeneID:11512071"
                     /db_xref="JGIDB:Spoth2_2108695"
                     /translation="MADTVHTSDASGKTAKSRPTLPGVPASWGELNNGHDEQDRPQSA
                     APMQRCSRQKPSGHRPTSHAHHAVIAPCLQYPGTAAIRPKTRRTIRVTLVVETVPGIP
                     AEATRGGNDFTNATSGTTRSATSQTHGILHFIIPSVRPKLDVDPTIATEDRMTTETVS
                     RGEAKPRGWRQSAVNEEGSARGLHEDSTLVDPVDRDPIRITYTTYIEGTQEISTVFSR
                     IEEPTTQLDALLHQSPYASCPDPGEFYITLSGNIGFSSASHGRPQSRSLHGAVDPADQ
                     PCDVTRKVRATRLFSSRAF"
     gene            complement(1532356..1537756)
                     /locus_tag="MYCTH_2300721"
                     /db_xref="GeneID:11512072"
     mRNA            complement(join(1532356..1533315,1533371..1533983,
                     1534051..1536042,1536097..1537756))
                     /locus_tag="MYCTH_2300721"
                     /product="glycosyltransferase family 41 protein"
                     /transcript_id="XM_003661345.1"
                     /db_xref="GeneID:11512072"
     CDS             complement(join(1532680..1533315,1533371..1533983,
                     1534051..1536042,1536097..1537580))
                     /locus_tag="MYCTH_2300721"
                     /note="CAZy_ID 270122"
                     /codon_start=1
                     /product="glycosyltransferase family 41 protein"
                     /protein_id="XP_003661393.1"
                     /db_xref="GeneID:11512072"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Spoth2_2300721"
                     /translation="MVQPPLDFLGSHQGHLKPGYPPHHHHGSHHLSRQPPSPYSSDST
                     PRAVAIRNAQHAPELHRITTSFTRLHAHDQAEHSLRRKTPSGTIDNGYDGSLTHLASG
                     PPPPKHMIVPGSSETYPASVLHEAPNNQAAGGMLQQPLAGPWAYSAPVPTAKFNHGVD
                     AMNGRAGPPRGWGMPTPNSSLDPSIGDRVNSLQPAAQHTYHAVPGMQPVLGQGYQQSL
                     SQTVYSPGGYQQPAVWRDGSFGYQTMIPLANNYPMQNSVDGAFMAAQAPIPHGLPNAP
                     GSGQARYFGPSMRGHPLDDGFARYGPGHMAQHVAHAGRNLMPMMPGTAHLAKGATLDE
                     VGSPTRFKERALQSAHKAYNDLLIHLTHTRGVQDGRFVSMSRPTSKIMVYPKPSTAPA
                     GSGGQAQSLSAFSDPAASYMQRMAQNEAAARMFAHGHNPQRAYELSSPVHNAKASLDM
                     LSNLCEQSGWKWIDGMLLGGCLHYGLERYEEAMEWFRRIVSLEPSHVEAISNMAATLY
                     CLNRLEEAEQHWWKAVKLRPSYLEAVEHLVSLLCSLQRNAAAVKAIEFVQRSLRISES
                     DVSRDQASETASEAEIASPVTLAESDPDSYVLDADSIDSPEQRFVAMTEDRKLPGFGS
                     SGYRIPGSENGRMVLLIHAKGNMLYSLKDVDRASDAFEEVVMISAGKHKQGIKGLIKR
                     IQAVLAPVDPRSGQRLTSTQEDLSAPLLLPPDKAKLTAQVVFASTRGQLPGLQYVPEG
                     AHKRSVVATTSNSLLSLAKIYQDAMSNSGPSSGIIRHPAGVGDILSLYYLSLSLQESP
                     STANNVGILLAGVQQTAPAQYLSPSDMSLAASVPGIVPGSGLALALAYYQYGLTLDPN
                     HVHLHTNLGSLLKDIGQLDMAISMYEQAVACDGTFDIALTNLANAVKDRGRVSDAIKY
                     YQRAVAANPDFAEAVCGLSTALNSVCDWRGRGGVLLAGGKYDRWHVDEKGMLLDGKTQ
                     GQGSGLMKRVVDIVRRQLKESSTWGCGVLQEQSIRQLAAELRDAGASVTDASLDLEAE
                     LRKWAGLPGEGYRVLRLIERSTVAAMRCWYQDKHIKGTPSPTGYRRPKPPASLSVPSA
                     PTVLPFHTFTCPLPAKDVRKISQRNALRISFSTLRSPWIPAVVYEPPDPPNPHLNVGY
                     VSSDFNNHPLAHLMQSVFGMHNPKRVKAFCYATTASDGSIHRQQIEREAPVFRDVSTY
                     SPDRLVQQIVQDKIHILVNLNGYTRGARNEIFAARPAPIQMSFMGFAGTLGAEWCDYL
                     LADTTAIPPSALRPHRSNLTLEDVFRDEVDAEAEDWIYSENIIFCRDTFFCCDHAQSA
                     DGHDERNLTWDEEQRRRWKMRKDLFPNLPDDAILLGNFNQLYKIDPTTFRSWLRILAA
                     APKAYLWLLRFPELGETHLRRTARDWGGEGVASRIIFTDVAPKLQHISRARVCDLFLD
                     TPECNAHTTAADILWSNTPLLTLPRYEYKMCSRMAASILKGALPKGEAGEQAARELIA
                     RDEAEYEEFAVRLANGMTYRPRGGEYREAVGRLAELRKLLFDAKWTCALFDTRRWVRD
                     LEEAYEIAWGRWERGEGGDIYL"
     gene            complement(1541659..1542974)
                     /locus_tag="MYCTH_2314521"
                     /db_xref="GeneID:11512073"
     mRNA            complement(join(1541659..1542039,1542142..1542466,
                     1542574..1542694,1542816..1542849,1542917..1542974))
                     /locus_tag="MYCTH_2314521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661346.1"
                     /db_xref="GeneID:11512073"
     CDS             complement(join(1542026..1542039,1542142..1542466,
                     1542574..1542694,1542816..1542849,1542917..1542920))
                     /locus_tag="MYCTH_2314521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661394.1"
                     /db_xref="GeneID:11512073"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="JGIDB:Spoth2_2314521"
                     /translation="MPPKFDPNEVKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGE
                     DIAKATGDWKGLRVTVKLTIQNRQAQVSVVPTASSLIIRALKEPPRDRKKEKNIKHNK
                     SVSLDEIIDIARTMRFKSFSKELKGTVKEILGTAFSIGCQVDGKSPKAISDAIEAGEI
                     DIPEE"
     gene            complement(1543392..1546341)
                     /locus_tag="MYCTH_2300729"
                     /db_xref="GeneID:11512074"
     mRNA            complement(join(1543392..1543716,1543791..1544885,
                     1544952..1545729,1545789..1545919,1545978..1546178,
                     1546252..1546341))
                     /locus_tag="MYCTH_2300729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661347.1"
                     /db_xref="GeneID:11512074"
     CDS             complement(join(1543486..1543716,1543791..1544885,
                     1544952..1545729,1545789..1545919,1545978..1546070))
                     /locus_tag="MYCTH_2300729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661395.1"
                     /db_xref="GeneID:11512074"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="JGIDB:Spoth2_2300729"
                     /translation="MDYDALKEQWGEVEDRDGVRLSWNVFPSTRMEASRLVVPIGALY
                     TPLKEKPDTPLLQFEPVTCKQPCRSVLNPFCQVDVRARLWICPFCLSRNPLPPHYKDI
                     TANAIPPELHPSNTTIEYRLSRPAPSPPIFLYVVDTCQEEDSLAALKESLIMSLSLLP
                     ENALVGLITFGTMAQVHEIGYTECAKSYVFRGNKEYTAKQVQEMLGLVQPAMRPGMPP
                     HHQPGRPMPMGPASRFLLPVAQAEFQLTKALEQLQKDPWPTTSDRRNLRCTGVALSVA
                     VGLLETSFQNAGGRIMLFAGGPATEGPGMVVGPELREPIRSHHDIDRDNVKYYKKALK
                     FYDNLAKRTAHNGHTIDIFAGCLDQVGLLEMKGLCNSTGGHMILTDSFTSSMFKQSFI
                     RIFEKDGDDNLLMGFNAVLEVLTTKELKVTGLIGHAVSLNKKSTSVGETECGIGNTCS
                     WKMCGIDPRSSYGIYFEIAQGGPSQHQQSPQKGMIQFLTYYQHSSGQYHLRVTTIARN
                     LSGPAGDPAVAQSFDQEAAAVLMSRIAVFKAEVDDSPDVLRWVDRMLIRLCSRFADYR
                     KDDPSSFRLEKNFTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVSNSLIMI
                     QPTLDSYTFDQEGGQPVLLDSTSIQPTHILLLDTFFHILIFHGETIAEWRKAGYQDQE
                     GYENFAALLEQPKEDARDLITDRFPLPRFIVCDHGGSQARFLLSKLNPSTTHTSGAGA
                     YGGVGAQSAQTIFTDDVSLQTFMEHLMKLAVSGTN"
     gene            1546974..1547746
                     /locus_tag="MYCTH_2300733"
                     /db_xref="GeneID:11512075"
     mRNA            join(1546974..1547553,1547616..1547746)
                     /locus_tag="MYCTH_2300733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661348.1"
                     /db_xref="GeneID:11512075"
     CDS             join(1547403..1547553,1547616..1547728)
                     /locus_tag="MYCTH_2300733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661396.1"
                     /db_xref="GeneID:11512075"
                     /db_xref="JGIDB:Spoth2_2300733"
                     /translation="MPRSTVLILAVLSAFANAIPQSHRPRSLLSSRQANGVPDNSVFL
                     RRAHHASAVLNGRVYIDGGEFSYQDKDGVAYEYCTTGSSLASV"
     gene            1547748..1548999
                     /locus_tag="MYCTH_2300734"
                     /db_xref="GeneID:11512076"
     mRNA            1547748..1548999
                     /locus_tag="MYCTH_2300734"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661349.1"
                     /db_xref="GeneID:11512076"
     CDS             1547862..1548860
                     /locus_tag="MYCTH_2300734"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661397.1"
                     /db_xref="GeneID:11512076"
                     /db_xref="JGIDB:Spoth2_2300734"
                     /translation="MWAAPRVRTLYTGFAGTSPHFGDRAFSPQGLWSFRRDSSAGGSW
                     QCLNGSTDGWFTSQPRPHPGQAASGHGYGFFVGGMPASRTPVVSPSLTPMVTGNGTGD
                     QRQPGNMIIMYGMSDKKITVIANHGPSDSRVPTHAGITYVPNWGNRGILVAVGGSQDR
                     RDSNEDSLGTFRTVRIYDIDKQRWYDQQSTGDVPDPRKDFCFAGSPSSNRTHEFLVYA
                     GWAGQLGSAAVPYDSAYVLTLPGFYWAKADYPPAHPRHGLSCNAVGGSQILTIGGVDT
                     AQDGNDSYAAGFTTRDPFTQGLAVFDLGALAWSPAYRAGRSAQPPAPRFREYYDTK"
     gene            1549000..1550063
                     /locus_tag="MYCTH_2300736"
                     /db_xref="GeneID:11512077"
     mRNA            1549000..1550063
                     /locus_tag="MYCTH_2300736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661350.1"
                     /db_xref="GeneID:11512077"
     CDS             1549289..1549873
                     /locus_tag="MYCTH_2300736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661398.1"
                     /db_xref="GeneID:11512077"
                     /db_xref="JGIDB:Spoth2_2300736"
                     /translation="MEDTTHANGGDTPACDDGLEEGVVMGAAAAATTGRKMSRTTREG
                     RANSGVDGDGDGSGGKKSGGGGGGGGVATDGDDYYDHVVVDDDGNDGDKYDDGGGLYR
                     GVIPTRAAIAIAAANRRPLLLPPLPPQPPPPPLTTPGPAELASRPVCELEAAGIEPPP
                     YELAGDLAAPESRDNRSRRGAAGERVGEEGRREE"
     gene            complement(1550088..1551239)
                     /locus_tag="MYCTH_2300737"
                     /db_xref="GeneID:11512078"
     mRNA            complement(join(1550088..1550429,1550500..1550671,
                     1550807..1550964,1551035..1551239))
                     /locus_tag="MYCTH_2300737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661351.1"
                     /db_xref="GeneID:11512078"
     CDS             complement(join(1550345..1550429,1550500..1550671,
                     1550807..1550964,1551035..1551063))
                     /locus_tag="MYCTH_2300737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661399.1"
                     /db_xref="GeneID:11512078"
                     /db_xref="InterPro:IPR001129"
                     /db_xref="JGIDB:Spoth2_2300737"
                     /translation="MAIVIPSDYGYVLLAATSTFVVNVVHGVLTAKSRKAAAIKYPNA
                     YASAEQAEKDPRAFTFNCAQRAHNNYTENLTPFLGALLISGLKYPTFAATLGGAWSAS
                     RLLYAIGYTSKGPDGRHLGGAVGSLINLLLIGTSAYSALSLARGW"
     gene            complement(1551883..1554182)
                     /locus_tag="MYCTH_2300738"
                     /db_xref="GeneID:11512079"
     mRNA            complement(join(1551883..1553005,1553090..1554182))
                     /locus_tag="MYCTH_2300738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661352.1"
                     /db_xref="GeneID:11512079"
     CDS             complement(join(1552032..1553005,1553090..1554026))
                     /locus_tag="MYCTH_2300738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661400.1"
                     /db_xref="GeneID:11512079"
                     /db_xref="JGIDB:Spoth2_2300738"
                     /translation="MEAHSDARSRKRSASHMALSFPIIFLLSANLGSQELQELEEQIP
                     TLTYDINEAEVVLGRIFRKERAMFELRKHKLVTEEVDPSERSAPASPGRKRARMATPA
                     LTSSDLDSDSDTASDGEIQRRLTGPGPGPAAPAVTVKVVRLGWFTDSVKAGQVLPIDD
                     YVVYQGRKVPRTPAKAPQPVPAERAAERAADVMKRALADAGGQSRSPRPGSSSSRGAR
                     GETYTSHPVRPPLVRQTTSEHEIDAQLPPIPDFLHTTYSCQRPTPVHPPNEAFIEELA
                     KIKTARTLVGDKIGVRAYSSAIATIAAYPYTFQTAQENRSTEVSRLPGCGNKIALLFQ
                     EFKDTGQIREAREDESDPKLAVLKLFYNIWGVAETTARDFYNRGWRDLDDIVEYGWET
                     LTRVQQIGVKYYDEFQQRIPRAEVEAIANVILAHANQIRDGFEMVIVGGYRRGKEASG
                     DVDVVLSHRDESATRDFVGRLVVRLERAGYVTHTLSLSTANSERGQVPVSWKGNDRSR
                     AGTGFDTLDKALVVWQDPVRATTGEARNPNSNPHRRVDIIISPWKTAGCAVLGWTGGT
                     AFQRDLRRYCRREKQLKFDSSGIRSRTDGSWVDLESGPDGSPAPDMLTAEKRVFAGLG
                     LEWRPPEERCTG"
     gene            1555125..1556276
                     /locus_tag="MYCTH_2300740"
                     /db_xref="GeneID:11512080"
     mRNA            1555125..1556276
                     /locus_tag="MYCTH_2300740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661353.1"
                     /db_xref="GeneID:11512080"
     CDS             1555207..1556217
                     /locus_tag="MYCTH_2300740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661401.1"
                     /db_xref="GeneID:11512080"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="JGIDB:Spoth2_2300740"
                     /translation="MEIAQTLVRAVMRAFYSTQEILVIEALVTHSVLRDDELAYLMKM
                     NLKDMHRLCATLRDARFLVVHTRPEMQEGKTRPINRTYYYIDYRQTIDAIKWRVYKSD
                     KDMQGSVQPADESKEYSCPRCRAQWTQLEVLDSVSPAGFTCQRCGTVLELSKEKETPG
                     HQQLSRMNNQFKFMTDMLQEIDRVVVPECSFDKAMMAHRPIVRASTHEVLPSVPVEPG
                     MNKPSAVKGLANVGPKTMQVTISDDNEQERLEERKRKERLLKENALPSWITESSVPAI
                     SQTTQSFEMRDAPDEDMLPSKRVKLETGSPTSAPADDKGNAMSFKMEDEDEDDLEFED
                     VV"
     gene            complement(1556953..1560992)
                     /locus_tag="MYCTH_2300741"
                     /db_xref="GeneID:11512081"
     mRNA            complement(join(1556953..1557132,1557223..1557897,
                     1557997..1560992))
                     /locus_tag="MYCTH_2300741"
                     /product="SMC1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661354.1"
                     /db_xref="GeneID:11512081"
     CDS             complement(join(1557115..1557132,1557223..1557897,
                     1557997..1560963))
                     /locus_tag="MYCTH_2300741"
                     /note="1| putative SMC1 protein [Sordaria macrospora]
                     Contains conserved domain Smc[COG1196], Chromosome
                     segregation ATPases"
                     /codon_start=1
                     /product="SMC1-like protein"
                     /protein_id="XP_003661402.1"
                     /db_xref="GeneID:11512081"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="JGIDB:Spoth2_2300741"
                     /translation="MDAISFVLGIKSSHLRSSHLRELVYRGRVMKTSKIQDDGTAVPA
                     TNGQVNGHEDGDDEDSSQRASRNDPKTAWVMAVYEDDAGEEQRWKRTITSSGASEYRI
                     NDRVVTAQQYNEALEEENILIKARNFLVFQGDVEAIASQSPQDLTRLIEQISGSLEYK
                     DEYERLQAEVEQAAENQNFQLHRRRGINSEIKQYQEQKREAENFQKKTQERDEAVITH
                     ILWKLYHFQRVMDESSAQIQEHHENLKEFRRNVETFEKRLEAARKEQATVGREVSHIE
                     KSIKSKEKSIENRDNSLVPIDEKITQSSQDMAILRKRISDVKKDRDDKATNIQKLKKD
                     LATIEKAQQQFEKQWSETLKKQGKELSDADRKEYTSLQAEAMRKTSDNRAKLANLERQ
                     LKGDEVTVNSLKGRIDNFEAAIEKLQSEAQVIKDRRDAIQDSVGQTARDIDAKKKEFN
                     SVQSERIRINNTHTELEEKLRDVLRKLDDADMGRRQNEKETKMRSMISDLKRIYPGVR
                     GRVGELCKPKQKKYDEAVITALGREFDAVVVDTEKTGVDCVQYLKDQRFPPVTFIPLD
                     NIKVNTSNSAVKGISGARLTIDTIDFDPSLERAIAYACGGSVVCDSLEIAKDIVYNRK
                     IQVKAVTLQGYVIHKAGTMSGGRLPEEKGGKRRFEEHDVQNLERLAEKFRDEIAKLPR
                     PGRRGVAEESLQNEIAALEQRLRLQESELAAFEKNLKSKEKELEHAKQQLREYQPKYA
                     EKEGELQRTRATVEKFEKAISEVEDKIFANFCRRLGYENIRAYEAQQGSLEQEAAQKR
                     QDFGLQKQRIQNNLTWETSQHDAANERVRAMETTLKRHQKDLEAYEREKRSIEEARAQ
                     DQDELAALQESLEEVRASYAEKSKKVADAKQDLQKKTREIESRLKEISNLEGTVQKNS
                     TQKFALLRRCKLEQIQLPLRKGSLDNIPNEDVLLQRDQDAMDIDGEADEDEVLENAMD
                     DYGIEIDFDGLDEDLKKPDDDIEDRLQEKITSLTSELEKLNPNMRAMERLESVKSRLE
                     ATEKDFEDSRAALRAAREAFAKVKEKRFELFNRAFTHIQEQITHVYKDLTRSDAYPLG
                     GQAYLDIEEDTDTPYLSGIKYHAMPPLKRFRDMEHLSGGEKTMAALALLFAIHSYHPS
                     PFFVLDEVDAALDNANVEKIKKYIREHAGPGMQFIVISLKPTLFQDSESLVGVYRDQE
                     ANTSRTLTLDLRKYV"
     gene            1562499..1564716
                     /locus_tag="MYCTH_2300743"
                     /db_xref="GeneID:11512082"
     mRNA            1562499..1564716
                     /locus_tag="MYCTH_2300743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661355.1"
                     /db_xref="GeneID:11512082"
     CDS             1562661..1564397
                     /locus_tag="MYCTH_2300743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661403.1"
                     /db_xref="GeneID:11512082"
                     /db_xref="JGIDB:Spoth2_2300743"
                     /translation="MAEPENRNITIPIPNSGDNSKWEGTSTDSEAVPTPEMSGTPPEG
                     TSLHEHDLATPTMGPVPASPRRSRNPSFSGSSSYQEDWDPFPPLERLTVLDILDNFAL
                     SQQIEKLQKGISAQTEKVRKSREALGNRSRIARERMVDEWRRRVPSAEEQLDRYRKRM
                     RASVEKLGARWNDTKAITLREKISFIFGVMNILVSGYLIGGLPEWFHLWYTVQILYFM
                     PIRYYTYHKRGYHYFLADLCYFVNLLLLLSIWVFPSSKRLFTAVYCLAFGNNAVAIIM
                     WRNSLVFHSLDKVTSLFIHIMPCATLHCIVHLIDPVVQRARFPAIWTIKTSSAAGSSP
                     DYASPLFMLAWSTIPYAFWQLAYYFFITVRRRDKIAAGRPTSFTWLRKSYSKSWIGKI
                     VLSLPDALQEPAFMLIQYTYAVLTMLPCPLWLFSRWASATFLTVVFAWSVYNGSTYYI
                     DVFGKRFQKELEAMKAEVAKWQHSPDMWPHEEGGAATPIVGPGAGAGAGAGAGNGTGT
                     DGEGKSGSVADVISGKALLDDDSRRAAGSVDNIPLLNDERTSSVLVTGVDVDGGARDV
                     ARERRTGSGESL"
     gene            complement(1565971..1567993)
                     /locus_tag="MYCTH_2300744"
                     /db_xref="GeneID:11512083"
     mRNA            complement(join(1565971..1567287,1567347..1567471,
                     1567532..1567993))
                     /locus_tag="MYCTH_2300744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661356.1"
                     /db_xref="GeneID:11512083"
     CDS             complement(1565993..1566988)
                     /locus_tag="MYCTH_2300744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661404.1"
                     /db_xref="GeneID:11512083"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2300744"
                     /translation="MLLAPRRQHRTVAKVPIKVLDAPNLAEDFYLNLMDWGSSDVLAV
                     GLGAGVFMYNAQNGKVAKLCTLEDDKVTSVSWIQKGTHVAVGTKKGLVQIWDAQKFKR
                     LRTMTGHTARVGCLAWNAHILSTGSRDRTILHRDVRAPDQWVKQLTGHKQEVCGLKWN
                     CQDGQLASGSNDNTVMVWDKAMDQKPLWCFNEHIAAVKALAWSPHQRGLLASGGGTAD
                     RRIIFHDTVRGSVRNDVDTGSQVCNLMWSKNSNELVSTHGYIQNNLVIWKYPSMTRVA
                     SLTGHTYRVLYLAMSPDGTQVVTGAGDETLRFWEVFKPKQPVRLLGGSIDLPVIR"
     gene            complement(1570992..1572188)
                     /locus_tag="MYCTH_2300745"
                     /db_xref="GeneID:11512084"
     mRNA            complement(1570992..1572188)
                     /locus_tag="MYCTH_2300745"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661357.1"
                     /db_xref="GeneID:11512084"
     CDS             complement(1571227..1571946)
                     /locus_tag="MYCTH_2300745"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661405.1"
                     /db_xref="GeneID:11512084"
                     /db_xref="JGIDB:Spoth2_2300745"
                     /translation="MVRNLVLLSGSSHPTFVDRVASVLGIAPSSRVLGKFASGETRCE
                     IRDSVRGKDVYIVQSFGVGGHTVPARGVTGYDDGWAEGEGVDNSGGGASNGEGKHTVN
                     DYFIELCIMISACKTGSAKRVTAVLPLFPYSRQPDLPFSRVGAPQRDGKGKLEVAERG
                     SYTELDHENPSSSSTTTMMMMMMALQAKPGHEHVTAHVGSLAADLLTCAGADRILTCD
                     LHEKAYQGFFDIPGTSVDTTA"
     gene            complement(1572802..1574705)
                     /locus_tag="MYCTH_2300746"
                     /db_xref="GeneID:11512085"
     mRNA            complement(join(1572802..1574125,1574198..1574705))
                     /locus_tag="MYCTH_2300746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661358.1"
                     /db_xref="GeneID:11512085"
     CDS             complement(join(1573059..1574125,1574198..1574519))
                     /locus_tag="MYCTH_2300746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661406.1"
                     /db_xref="GeneID:11512085"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="JGIDB:Spoth2_2300746"
                     /translation="MVMPTLVTDRFTALDYTDFTNNHVFLKSCNNGFFDYNQHVHHDH
                     HDGHRVNLAKQLIGEALRERVESIDHELCEPGEEDTFFVADLGEVYRQHLRWKLNLPR
                     VKPFYAVKCNPDPKLLELLSALGTGFDCASKAEIEQVLGLGVDPSRIIYAQPCKTNSY
                     VRYVASQGVRQMTFDNADELRKIARLFPGAELFLRILTDDSSSLCRLSLKFGASLDST
                     DGLLALARELGLNVVGVSFHVGSGASDPGAFLKAVQDAHVVFQQAASHGFCLKTLDVG
                     GGFCSDSSFEQMAGVLRAALDEYFPAHSGVNLIAEPGRYYASSAFTLACNVIARRTIE
                     DVSSASYMLYVNDGLYGNFSSIMFDHQHPVAKVLRCGGRTLYNTPAAEASDGPGCIEY
                     SIWGPTCDGIDRITESIRFAQLLDVGDWLYFEDMGAYTKCSATTFNGFTNSHDVIYVC
                     SEPGAKALLGMP"
     gene            complement(1577022..1580508)
                     /locus_tag="MYCTH_2300751"
                     /db_xref="GeneID:11512086"
     mRNA            complement(join(1577022..1579999,1580068..1580508))
                     /locus_tag="MYCTH_2300751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661359.1"
                     /db_xref="GeneID:11512086"
     CDS             complement(join(1577254..1579999,1580068..1580354))
                     /locus_tag="MYCTH_2300751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661407.1"
                     /db_xref="GeneID:11512086"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="JGIDB:Spoth2_2300751"
                     /translation="MLRGTAKRAAKAVTDLSQYPKIGEKLHGFTLLRTKHVPELELTA
                     LHLRHDKTGAEHLHIARDDSNNVFSIGFKTNPPDDTGVPHILEHTTLCGSEKYPIRDP
                     FFKMLPRTLSNFMNAFTASDHTFYPFATTNAQDFKNLMSVYLDATLRPLLKESDFTQE
                     GWRIGPENPQAITAGVEVTPEDRKLVFKGVVYNEMKGQMSDAGYLFYIRFQDHIFPDI
                     NNSGGDPQKITDLTYEQLKKFHAEHYHPSNAKVFTYGDMPLADHLKEIDAQLGAFERI
                     RGDMTIHRPIDLSSGPREVRLQGPVDPLVDLNKQFKTSVSWILGDTSNVVESFSLALI
                     SALLTDGYGSPLYKGLIETGLGTDWSPNTGYDSSAKVGIFSVGLTGVAEADVPKLKPT
                     VQNILRGVRDKGFDRSKIDGYLHQLELSLKHKTANFGMSLLHRLKPKWFAGVDPFDSL
                     AWNDTLAAFEAEYAKGGYLEGLMEKYLMNDNTLTFTMAPSAEYVQELAQEEEARLKTK
                     ISKAVEAAGSEEQARAALEQRELALLAEQSKSNTEDLSCLPSVHVRDIPRRKEPLVLQ
                     SETVGEVELQLRQAPTNGLTYFRAISTLENLPDELRSLIPLFTDSIMRLGTKDMTMEQ
                     LEDLIKLKTGGISVGYHSASRPTDFTQAKEGLSFSGMALDRHVPVMFDLLRKLVVETN
                     FDSPEAAQQIRQLLQATADGVVNDIASSGHAYARRAAEAGLTWDAFVREQVSGLSQVK
                     LVTNLASRPESDLLEDVIGKLKLIQQFAFAGSMRVAITCDAASVADNTAALSRFLDSL
                     PSHTANFPTRQGRDFSRNIKSFYPLPYQVYYGALALPTVSYTSPDNAPLQILSSLLTH
                     KHLHHEIREKGGAYGGGAYSRAIDGIFGFYSYRDPNPVNTIKIMRNAGQWAVDKKWSD
                     RDLEDAKISVFQGVDAPRAVNEEGMSNFVYGITEEMKQTRREQLLDVTKDQVREVAQK
                     YIVDALAQGSERLVFLGEKRDFVDKSWTINEMNINGSA"
     gene            1581145..1583162
                     /locus_tag="MYCTH_2300753"
                     /db_xref="GeneID:11512087"
     mRNA            join(1581145..1581235,1581297..1581604,1581748..1582019,
                     1582089..1582237,1582288..1582531,1582589..1583162)
                     /locus_tag="MYCTH_2300753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661360.1"
                     /db_xref="GeneID:11512087"
     CDS             join(1581334..1581604,1581748..1582019,1582089..1582237,
                     1582288..1582531,1582589..1583080)
                     /locus_tag="MYCTH_2300753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661408.1"
                     /db_xref="GeneID:11512087"
                     /db_xref="JGIDB:Spoth2_2300753"
                     /translation="MASATPAPRPATPVANGTPNQPTPDAGQANGNHAAGNENRPAPA
                     PPAAASGKKGKQKKAPEPTEASKLIAQRISQLELDAAGEKDQEAEIEREVRKANRELH
                     NQTSKMSDLQKIEHLTKRCSDLLSDMKRHERESIKNKKRGDQLQKDKDNSRNELNKTV
                     SLKEKLEKLCRELQKENNKLKNENKTLSDTQIRSQNTWDERYSGLLRRMDDYQEEKDN
                     PRKQVVDMEIEELFAQRFKSFIDQYELRELHFHSQMRTKELEVQYNLARYEREKKNYE
                     AELARSRQLNAQVQTFSKTEAELRQQLNVYVDKFKQVEDTLNNSNDLFMTFRKEMEDM
                     SKKTKRLERENENLKRKHDQVNGNILKMAEERNKNLAEIEELKKKLEKLNGIIKQMQQ
                     QGRGIPQGMTGTVENGYAEGSVEGDESEYEDDEYDEGEDEEVSDEEDEYDDETEDELH
                     HQQQQPQPYGPAPPAPVAATTNGHR"
     gene            1583872..1586003
                     /locus_tag="MYCTH_2300756"
                     /db_xref="GeneID:11512088"
     mRNA            1583872..1586003
                     /locus_tag="MYCTH_2300756"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661361.1"
                     /db_xref="GeneID:11512088"
     CDS             1584328..1585917
                     /locus_tag="MYCTH_2300756"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661409.1"
                     /db_xref="GeneID:11512088"
                     /db_xref="JGIDB:Spoth2_2300756"
                     /translation="MAFIQDPRLRQTWNQLSQTTETVTSDAAAGIWAFGHRYVQPCLS
                     SLAGAVDSCTAICLGDREERARRARERDRGARGSRRSVGGGRGLLSRPEYSFDFYDDW
                     EEDLFIAEQLAEDQDDDDGLLDRGAAASSRRGGGILGGDWDRLLAGSGHRSRLGAGGG
                     GIGGTGDVVDQPRRKRGMSYGTRGGVRRKVSGEEDPNVIPRTAPLGFLGRLPFKIMGS
                     LRYKPSAANLREHPGGHGHHHHHHHHQGTARDDEQEPLLGSSNEEAATTGQKGKRPRS
                     DTTNSGDTSSSYRSRGDLFPSDGEGDEDAVPLDDEFTVALERVDDRGSTRTRSSKGKR
                     TDERGKDRDRNRDKGLSRTVSRTTISSTNTPDETKWDSNPVSPVQELGYDDDGDNDDN
                     EDDNDDAPQVPSLEDLRREEEQAEREEAEEIERRRRAASRLARERGLKTDDAHVPESV
                     GEANGDAQDAESGRPPGRIGTEVAESAADDAGLEEVQEVKPPPSAATPEPAPPQTNKT
                     DGELQAESTVVPARLPRFGQR"
     gene            1586849..1588423
                     /locus_tag="MYCTH_2300757"
                     /db_xref="GeneID:11512089"
     mRNA            1586849..1588423
                     /locus_tag="MYCTH_2300757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661362.1"
                     /db_xref="GeneID:11512089"
     CDS             1586922..1588043
                     /locus_tag="MYCTH_2300757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661410.1"
                     /db_xref="GeneID:11512089"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="JGIDB:Spoth2_2300757"
                     /translation="MATPTKTTTRTTTTTTTTTTTAATGPITTPLTTLLGIRHPILLA
                     GMARVSNGRLAAAVSNAGGLGVIGGFMYTPEQLREIVAELKAHLRSPDLPFGIDLALP
                     QVGGSARKTNHDYTGGRLDELVDVTIESGARLFVSAVGVPPRRVVDRLHAAGVLVMNM
                     VGHPKHAVKALDLGVDMVCAQGGEGGGHTGDVANSVLIPAVVDVAKRYRPQLLGGDRP
                     ALVLAAGGICDGRGLASSLMQGAVGVWVGTRFVASVEAGCSDQHKEAVVSCGFEDTER
                     TLVISGRPLRMKTNDYIRKWHAQPDKIRELCSKGIVPLEHDLDQGNEVDMPHLMGQVA
                     GAITKIQPAGEIVDEMVAEAVEMLKLANVYLNGGKASKL"
     gene            complement(1588635..1589995)
                     /locus_tag="MYCTH_2300759"
                     /db_xref="GeneID:11512090"
     mRNA            complement(join(1588635..1589550,1589621..1589995))
                     /locus_tag="MYCTH_2300759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661363.1"
                     /db_xref="GeneID:11512090"
     CDS             complement(join(1589147..1589550,1589621..1589789))
                     /locus_tag="MYCTH_2300759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661411.1"
                     /db_xref="GeneID:11512090"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Spoth2_2300759"
                     /translation="MANFRRFRPEDLNKLSKCNLDPFTETYDLGFYLQYYAKWPSLFQ
                     VAEDQHGNIIGYIMGKLESSPDVYRFSEHYLPWHAHITAVTVAPEARRLGIGRLLTEQ
                     LEMAADANDAWFVDLFVRVSNHKAIAFYKSMGYSVYRVVKDYYGEHSSDPTLSSEDAY
                     DMRKPMKRDVKRQHVRDDGEKHEVNPSDVW"
     gene            1591078..1592842
                     /locus_tag="MYCTH_2300760"
                     /db_xref="GeneID:11512091"
     mRNA            join(1591078..1591931,1592073..1592842)
                     /locus_tag="MYCTH_2300760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661364.1"
                     /db_xref="GeneID:11512091"
     CDS             join(1591246..1591931,1592073..1592580)
                     /locus_tag="MYCTH_2300760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661412.1"
                     /db_xref="GeneID:11512091"
                     /db_xref="JGIDB:Spoth2_2300760"
                     /translation="MSSPRTPLHSPQPSVDYSAASYASYSPQERRQSKASSFNDSSMD
                     LGIPAGGAGAEGGGGGLGNLADELAGAFSDGEDDYDGYEEGDYDDEAAGEQGSEGRAP
                     AINPQEPAAQSPRKEDGVRDSGVDVGGSPSGAGKGHDSKRSLEPPTPNGRGHRRKGSE
                     YDGSEYGSESDFESTGMPARLIERMDEVESLARRGTERTGSAADGAFKRVTEGLRDLS
                     SQANVEGSATRLITAHTALTTHLTHQTRQLHNLTFPLLSPLAAPPTEETVEALLPMLL
                     TLTELMPRPSAPALQSLASLHALTADLAQTLNYLSDTLHMSRQTTTAAARRLRAAREV
                     VAELRRDEELREEGERWLARGGWGERLARRECALVCGDVVGGFEKVCESWRERLMKLD
                     ESSQA"
     gene            complement(1592844..1597095)
                     /locus_tag="MYCTH_2300761"
                     /db_xref="GeneID:11512092"
     mRNA            complement(join(1592844..1593323,1593448..1596466,
                     1596996..1597095))
                     /locus_tag="MYCTH_2300761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661365.1"
                     /db_xref="GeneID:11512092"
     CDS             complement(join(1593126..1593323,1593448..1596426))
                     /locus_tag="MYCTH_2300761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661413.1"
                     /db_xref="GeneID:11512092"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="JGIDB:Spoth2_2300761"
                     /translation="MTAQRRPRFRKVQSFRTDYAPTTITQYESERSGMQVIVADRKGP
                     KINGYFTLATEIFDDSGAPHTLEHLIFMGSKSYHYKGLLDKLAGRAYSNTNAWTAVDH
                     TAYTLETAGWEGFAQILPVYLEHVIVPNITDDACVTEVHHIDGEGNDAGVVYSEMQAV
                     QYRSNELMELRARRLLYPENVGFRYETGGMMEALRVLTPQRIREFHKAMYQPQNLAII
                     IIGEADHADLLRILDDFEESIKDDIPPPDPHFKRPFVDSAQPPPLEETIVETVEFPEE
                     DESTGEILVAFFGPSCIDQVQGTAMNIILTYLCGSSVSVIENVMVEKEQLASSISYGW
                     DSRPNSVIWFQPTSVATEKLAFVEQRLISLLREVASKPLDMGYIKECLQREKRLVKLQ
                     AESSEGFYATNIITDYLFGERSGATLKDLETLREYDVLDGWTEEQWRSFLKKWISDAH
                     HISILGKPSMELANTLKANDEARLAKRREDLGKEGLLKLAERLEKAKKNNDRPIPPDV
                     LDQWPVPGTSSIHFIESATARSGKARSLGVSDNAAQRVIDAAPQAGLPLFVQFEDVPT
                     NFVHLTVHLGMSQTPIKYKPLMPLFADIFFNSPVTRHGQRLEFEEVVKRLERDTISYH
                     ITSSSRLGDYEGVAIQFQMDREKYATIIGWLRTLMFDLILDPVRVKAAVVKALADVPE
                     AKRDGRTMAQEVDMAIHLKPESYLAAKRTLVKAVYLRRLKKLLEREPDTVLSWFDELR
                     KSLFTFDNMRVLVTSNVAKLDNPVAAWDSLTRDNPGFGGAKDILPLTKPYSMLSAEGR
                     SPGSFGAVVIPMTTLKSSYSVSTATGLKSYSDPRLPAYLVALGYLEAVEGPLWNAVRG
                     NGLAYGVSFSREIDGGYVQFKVYRSPDASKAIAASRATVARLASAEVPLDRHLVEAAV
                     SGVVFGVADEQATMEAAAQQNYVVGVVRGLEHDWYRDILARVREVTEDEIRAVMRDVL
                     LPVFEPGKSNVVVTCAPVMEETIAKALGTAGYKTQVQTLSHFYDDYGLKGDEDGEGEE
                     EEEDEDEDDDENDEDGMDEDSNFDEDSE"
     gene            complement(1597790..1600191)
                     /locus_tag="MYCTH_2300767"
                     /db_xref="GeneID:11512093"
     mRNA            complement(join(1597790..1598367,1598597..1598655,
                     1598740..1598857,1599004..1599370,1599518..1600191))
                     /locus_tag="MYCTH_2300767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661366.1"
                     /db_xref="GeneID:11512093"
     CDS             complement(join(1598063..1598367,1598597..1598655,
                     1598740..1598857,1599004..1599370,1599518..1599730))
                     /locus_tag="MYCTH_2300767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661414.1"
                     /db_xref="GeneID:11512093"
                     /db_xref="JGIDB:Spoth2_2300767"
                     /translation="MPHPYMTPTTRHFGRATTETLPGPDNVGPYLLRVIWAMAGLSTL
                     FLGLRVYCKLSRRRRLWWDDNFLIAGWIALIYAISLLTVAVHHGLGRHYEDLSEEAIA
                     SMGMFSMAGGFGNILATCWTKTSFAITLLRISEGGMRRTIWFIIISVNLVLGSNGVIH
                     WIQCWPVQKTWRSYLEGSCFTPDIVRNYNTAVAVFSGVMDIVLALLPWKIIWSNTINR
                     RERLGALVAMSAGIIDGVMAFLKIQTMYVIGNANTTTVDLQIFGTAEPATAIMAASIP
                     MLRVLIQRDDSSKPSQPEFVQLRTTSSTARGTDLLSNDTDKKRSTGSSWPGLDVQAVE
                     EVHVRQGDEKDKKSIGLAV"
     gene            complement(1601464..1602411)
                     /locus_tag="MYCTH_2314529"
                     /db_xref="GeneID:11512094"
     mRNA            complement(join(1601464..1601723,1601779..1601860,
                     1601938..1602038,1602172..1602189,1602325..1602411))
                     /locus_tag="MYCTH_2314529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661367.1"
                     /db_xref="GeneID:11512094"
     CDS             complement(join(1601643..1601723,1601779..1601860,
                     1601938..1602038,1602172..1602189,1602325..1602369))
                     /locus_tag="MYCTH_2314529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661415.1"
                     /db_xref="GeneID:11512094"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="JGIDB:Spoth2_2314529"
                     /translation="MAATKNETPRTGLAAGLNKGHKTTPRVTKPRVSRTKGHLSKRTA
                     FVRELVKEVAGLAPYERRIIELLRNSKDKRARKLAKKKLGTFGRAKAKVEDMTRVIAE
                     SRRAAH"
     gene            1603725..1605991
                     /locus_tag="MYCTH_2300775"
                     /db_xref="GeneID:11512095"
     mRNA            join(1603725..1603932,1603984..1604981,1605038..1605240,
                     1605333..1605991)
                     /locus_tag="MYCTH_2300775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661368.1"
                     /db_xref="GeneID:11512095"
     CDS             join(1603783..1603932,1603984..1604981,1605038..1605240,
                     1605333..1605901)
                     /locus_tag="MYCTH_2300775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661416.1"
                     /db_xref="GeneID:11512095"
                     /db_xref="JGIDB:Spoth2_2300775"
                     /translation="MSLEDAVIGLKAFKEVDRRMSRLWDGINDAVLLPRMDITKDTLP
                     GIHTQDNYMELRGSADKTVHSLFADLEQVFSFLVHKLPPDLIETISSTLLPEIIGKVT
                     NVWLDSAIPSSLQAMDRFEEVIGAAKDFCTRLEALGLSNLGGLNQWTENAPKAWLSKC
                     KEAALDSVRTKLSQGLGASKRVEKVEKQMVSKSEGQQLVSNSAAALASDEDHGWDAWD
                     DGEETAQAATADKGADVPPDGDDDGADAWGWGEEEATVDEPEGSKEGPGESKAEDEDD
                     PTEAWGWGDEAEAGEPEAPENPPAPPPAPQTRELVLKETYSISSLPQPVLDLIFSIVE
                     DGAALTQDRYVDSPVAAQAAGLFSLPTLALAMFRAVSPHYYAPSVGGNMCLYNDSTYL
                     ADQLAEFAAAWKTRSDISTRARQMLRLDNDIKLLRSFANRAYTNELGIQKTVLRDLLG
                     GEQNLVHQPDAAASISSATARVRALATAWEDILARSVWQQAVGALVDAIASKMIADVT
                     DLASIGQEEAYHIAGLISSVEELDELFLPSRWQGDKKKKKEGGNEGGGEGEGEEEVPV
                     TAQFAGNWLRLKYLSEVLQSNLRDVRFLWVEGELSLYFTAEEVVDLVKASFEDNPRTR
                     EVIREIRGNPRPLGE"
     gene            complement(<1613751..>1615503)
                     /locus_tag="MYCTH_2108717"
                     /db_xref="GeneID:11512096"
     mRNA            complement(join(<1613751..1613875,1614262..1614265,
                     1614494..1614644,1614873..1615038,1615207..1615209,
                     1615371..>1615503))
                     /locus_tag="MYCTH_2108717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661369.1"
                     /db_xref="GeneID:11512096"
     CDS             complement(join(1613751..1613875,1614262..1614265,
                     1614494..1614644,1614873..1615038,1615207..1615209,
                     1615371..1615503))
                     /locus_tag="MYCTH_2108717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661417.1"
                     /db_xref="GeneID:11512096"
                     /db_xref="JGIDB:Spoth2_2108717"
                     /translation="MPSNPRPSPATLLAMLHIIPLQQARMNKDRRPGRRQPRFTSCCE
                     TWVLCRGDGRVFGPTTILQLQGPSQIRLTQYAQGVHGVQAHQGTTFQNHAGDLGEEQN
                     IPRAEVPDAGYQYSWCAPPPQKTSLQNTTKSARSAVSEPSQDTLFHYYCQNIEFLRRS
                     AETMQPFGDSYSTSLHKGHVPGHEDAAAAAARE"
     gene            complement(<1622593..>1623169)
                     /locus_tag="MYCTH_2125134"
                     /db_xref="GeneID:11512097"
     mRNA            complement(join(<1622593..1622710,1622794..1622903,
                     1622951..>1623169))
                     /locus_tag="MYCTH_2125134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661370.1"
                     /db_xref="GeneID:11512097"
     CDS             complement(join(1622593..1622710,1622794..1622903,
                     1622951..1623169))
                     /locus_tag="MYCTH_2125134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661418.1"
                     /db_xref="GeneID:11512097"
                     /db_xref="JGIDB:Spoth2_2125134"
                     /translation="MTSRAETTRDQQAAGRNRASRPVVVERYLRVQVRKETAGTDMYV
                     VLRRLSGEAKGPGVARVVTARGLTTAPDEDAGSGGGRKAQGPQKPGASEMYPFPRQGE
                     RETELAAAWDQVCVQRFPRPFEGNGMRRHGLQRCRVAALLGKTAGQ"
     gene            1623344..1626986
                     /locus_tag="MYCTH_2300779"
                     /db_xref="GeneID:11512098"
     mRNA            1623344..1626986
                     /locus_tag="MYCTH_2300779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661371.1"
                     /db_xref="GeneID:11512098"
     CDS             1623568..1626903
                     /locus_tag="MYCTH_2300779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661419.1"
                     /db_xref="GeneID:11512098"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="JGIDB:Spoth2_2300779"
                     /translation="MAPESFQTRRARPTRVKTDLATQTQLVAMPPSAISISSASPASQ
                     HGSPAQSVETIGTGMTTGSSIQASPEVAEGCLDKEIDDLDQLVTPFQLPESISVKQQS
                     EPATAYMSRRTSTASLSQPSFRSSGTTAMGEAVKMSIVRRASNTVRKAAGLMNRRPSS
                     THPRSRDGSVGPSVIRRRGSMSNPTTPYENISTFDSDSENEVAFAAEDRAGDDATLPE
                     TGSILSSTSSDGFGLIPLSLRQGMTLTKVSKKKSTKRITLYLDPDTAKIWWDRNKYIY
                     IDDIKEIRTAEDIRQYRLDAALPESVESRFFSLIYTLPGKSNTKLLHLIADSDESFQQ
                     WVEALETISKHRQDFATSLMSFNDKAVRAYWGMEMERQLGKVRSAEDEHIDFAGVERV
                     CRSLHIHVSTEELRRKFDMAKGRRNSSDDLPSSAKHSSRLNFDEFLEFVRLMKTRSDI
                     RAVYQAHASEPAGGMTRDEFFQFLREVQREDVDEDLAHWESVFARFARKGRPRDAEKQ
                     GILGEEGLTMSETAFAGFLTSTSNEPIPKEPQDYVLDRPMNEYYISSSHNTYLIGRQV
                     ASISSHEGYISALMRGCRCVEVDCWDGEGNQPVVTHGHTLTTSISFLEVIKTINKYAF
                     VKSRFPLWISLEVRCNPITQINMAKIMIDVFGDKLVRAPLDPTSDRLPSPSELMERIL
                     IKVKKPDESMRGADRPTGRRRGNSMPSPYQRALALDSMPVPTPSSPLLSPSPTSMSNR
                     QINTIAEGLVHEPVSSSPSECDSEGEAGAAKKANSKIHPILGELGVYCMGIHFDGFDS
                     PDAKKFNHIFSFKEKTFAEKNQPGEAKRALYRHNMRYLMRVYPNGGRISSSNFDPLIY
                     WKRGVQMAALNWQTFDTGMQLNQAMFDGGTAHSGYVLKPLEGRQIQVMPNLAPDECVG
                     KRPRKKVAFEIEVISAQQLMRPHNLGEKRTLDPYIEVEVLMADDKRNKADAAAYAAAQ
                     QTQLKQRTNIVRDNGFNPEFNQTCTFDVTTKYPDLIFVRFSVKLADRGGYNDKAPFAT
                     YTVKLSNLKQGYRTIPLYNHKGERFLFSTLFCRIKKGPVTDIMVSYQEDAPRNGGNKL
                     KNIGRNVFANTSPKSSMDSSRTT"
     gene            complement(<1629283..>1631368)
                     /locus_tag="MYCTH_2142918"
                     /db_xref="GeneID:11512099"
     mRNA            complement(join(<1629283..1631141,1631215..>1631368))
                     /locus_tag="MYCTH_2142918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661372.1"
                     /db_xref="GeneID:11512099"
     CDS             complement(join(1629283..1631141,1631215..1631368))
                     /locus_tag="MYCTH_2142918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661420.1"
                     /db_xref="GeneID:11512099"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Spoth2_2142918"
                     /translation="MPSVRRWARRLERSCCACAKYLPLVFVYGLTTWAVYVLVTLCST
                     PSKVSWLDTPAATAGVVLYLLLNWCYTTAVFTPPGSTTNEHGYSTLPTHNAPNITSLT
                     VKSNGELRFCKKCQARKPDRAHHCSTCRRCVLKMDHHCPWLATCVGLRNHKAFLLFLI
                     YTTLFCFYCFAAAGSWVWEEILDTTATTVDTLMPVNYIILAIVSGIIGIVIGAFCSWH
                     IYLASKGQTTIECLEKTRYLSPLRRSMHQTYINQHTPGRGVPLPSYGQQLLDIHQNAL
                     PGITRPEEGEELRPEPAHSPRFNSNGSSSNNNNNNRDLESGTRSRNPELQAGSRRFTP
                     NEMERYRARKRYEEYLDEQDSAKLPNAFDLGPKRNLLHLFGPSPWLWLLPVCNTTGDG
                     WSWEPNPRWLDAREKLARERAEQAARERAAGWGPADDDDEDEGESDGLLRIPGGAGRH
                     YLQPQPRPQSHLLQAQQSRQTGGGNSPLSKTPSPLPSPGARKTPSKADRILGRDPNLY
                     ADDDSHYMNGNSNSNTPLLPPGQGEAVSLKRLSPATGRTIEDELDDIDRDDVHSDDAY
                     FLSDGDRIIDENQRQPNGVGTQQQQQQQQQQQRAEAERRALNVVTNGRWGTRAASGAG
                     PGVGASTLLRGPASPALRVAGGSDADRTRSSSGGNSNDNDVDDGVD"
     gene            1633697..1635083
                     /locus_tag="MYCTH_2300782"
                     /db_xref="GeneID:11512100"
     mRNA            join(1633697..1633885,1634011..1635083)
                     /locus_tag="MYCTH_2300782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661373.1"
                     /db_xref="GeneID:11512100"
     CDS             join(1633831..1633885,1634011..1634951)
                     /locus_tag="MYCTH_2300782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661421.1"
                     /db_xref="GeneID:11512100"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2300782"
                     /translation="MSTTTPKFNSKSPTIRRILREAHELTSSPSADYHAVPLETDLFE
                     WHFTLRGPPKSPFESGIYHGRIVLPPGYPLRPPSFRFLTPSGRFETNREICLSISGHH
                     EETWQPAWGIRTALVALRTFMETDVKGQLGGLESGEAVRRRLAAESRAWRCGVCCGGK
                     TNAEILAECEERVKESGGEGRGREEEVQVPEELRMGWRDEMEADQRGSGQQSQDDRDG
                     ESDALAEGFVQTTPSGETSASGQHQLHDQQRQQQQQQEQQQQQQQQQFAQGSTVPQPP
                     TRTTPSSSPLEATTAGPALQQARQGPVDETTVWLDRLIFAVAVLLAAVVAKVMLA"
     gene            complement(1635337..1642570)
                     /locus_tag="MYCTH_2300783"
                     /db_xref="GeneID:11512101"
     mRNA            complement(join(1635337..1636915,1636966..1642165,
                     1642385..1642570))
                     /locus_tag="MYCTH_2300783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661374.1"
                     /db_xref="GeneID:11512101"
     CDS             complement(join(1635487..1636915,1636966..1642165,
                     1642385..1642454))
                     /locus_tag="MYCTH_2300783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661422.1"
                     /db_xref="GeneID:11512101"
                     /db_xref="JGIDB:Spoth2_2300783"
                     /translation="MSGVGLEVLLEDLIPEIAYSGQKGVSITELLKIVRRYHLSLNGQ
                     DASSHDDAAGGLRGSIDDADIEKTLTEAEMASARWAWDWLRSRPQILINGNRRWNRLE
                     LSEALALPEADSVDPAIASASAHGKEIDHAKGDKSKKTLTTRPRIYPAEDLVWQTLTR
                     HGVDYKRVPALEWACLQGIASSRSEGILQSDLRRLVDQDKRSLPKRTDSLARKGYIAK
                     RTVVVQKMKTSRLWLIDFAPPLVEAETHGLDLSPETLSKDLEPVPWHGRWTGNNIDMD
                     ALGRTAVGVVKAFNVIRYADLRLKMGVSGKRWQMKTLAKNCQRLVDIGVLKYTAASFP
                     GSRKIFKDCLKFVRDPSAEEWDKFLATGKKTSLYSDPTRHREPKPNALALYGKSGEDG
                     QGSGDARSKVRRIFSGWTPEKPLAQTVFEVIRSAGPEGASNPQVSVATVGYQHRRYLS
                     SYLTKVAETQQPPHLKKFQVVSKLVRTGKTSAYMFSAPGATGQAALPGIDERESTTDQ
                     VATGDLEDSTSADPYGFGTVRPKAFSSSEDFTLSDMSRIARKSKPSAKRKLLPRIRPE
                     YVSTAEGSTGGTAGQDAVVPDREEHNVQSASAGSLKRPFDEMTASHEGVEENPVNPSD
                     PQEQGTVSTSTTLDKAANVPTDEELVLNVRYNGVPGKLQLDRAQRKVTFTRSGRGLKK
                     PVTIPVDSNLDEPAIQDVPGGDEKVLLLTTREKDGLQPQTYPFNFDTDSQNSAVWIQQ
                     EVTRMRSPDYQEPSPEKSAGTSEEITVVAVSSEPPRGRGHGAGRGKGKRGQASSAGAK
                     PYVCELCGGSWKNDIGLKYHQQKAQVSCNPNFDPAVLLERSRKRRRLTPVPPSDANSE
                     AGEEDGIGRTRKPKGGNKGEKRTFHLHSKVRAAMRCVRGPAHKFRGLNLPDAGDEETV
                     DWELERPKNMPAGMSGSEGPGLAWNNTVPPSSSSALGPGTPFNAETRPQTPAGVLSYT
                     EHMHEAEGDAAQKSSASVGDSATAMVAGDKPLEKGLSRPTASTALWRSRASEGAPMTG
                     APFSNKEASRTEPEEFTPQPSGKAPYPDEYGEGSPSRQDLGRHQSEPPKSEYPEPPYP
                     QDVQELGTAETSTSLPDQGLYKPFTRSSNYERMTSDAKRRTAQAFDIINYLLDNNLGV
                     FPGDKALFYALTNVFLKEFKNQMPPTWKNCTSAVKALENRKLASVHTHMLKTERGRLQ
                     TCTLLIRTGVDPNGIIATRMKQKMRESYPGIFIPPAFSPTQEELALLQELDRKTHDKN
                     IVNSKPNTNGQKFRSRRKIEDVEIFDAPYYKNTAPVISPRKDPLWIRDTERLAEEGTG
                     VRKRPVGDDTWTEPPQKKARTDPEADAYPDIPVDPSIIGDTQSISQPDQRDGHSVLEA
                     IKTYSLLPVKPGSRGSRRRLSYPYKPLAKLSPELGRTRNPGLRSLPDEFFKNLPSPAA
                     VQFVSPEVLMLEPNTSLEDEDEEQAQERQGQSQVSSRETTEGSVGEVEVEAEVEKAIE
                     EPKAFRFTSPAVLEPMSKGTWPDLTLGFFEHYEGSFALNGWMPSLKWLQTQNLPTSTE
                     EMAQKQKADRIKLRGWVDKEYAKFCSVVNQCAAWEQSRVGTAVMLGGKVPPGFSYINV
                     SPPASKANSKPITLAWSDETQYDLETLPYEELEDDDYGDVTCVEDSERAARDGEPSSK
                     KRRPQKAPGQVRRMQGRPPKLKLTAIKTMREHTAYPRSEEDFLRGDGEELDWSSENVR
                     LAAFVAVTTLLGGVDRVVDWGLMMRLVPDQTISQLRHYWCALKKDRLSTIVGLTEKFR
                     RAFLKAYENNEIPPIDYDNVLAYDWKSLIKWTTKLDMAERRMLPSTRKELDDKFVVTK
                     FRHGNRPWREAFYHPQRSIFNKFQDATSESLALPVDNNPEPKLSTDMIVAMSWTRSLC
                     VTPVEAYPAEAVVRRRNSLFPNRAKTEITELMIKGVDQLQRQGVISKSSSKWSNGRRW
                     RFNTRVIDALEKAAQQEKFAKATQFKKELDQAFRAGETKKRVTYITNDGMIMALLNLQ
                     ANGRVRVETTGQPYVPMGHEPGNYETRKYTKKYMHFRLDIVPTDSYLYDEVTMTAAEG
                     EAWKGREDTTLADLRSRIKATPPPTCGPGGAVPVWCDVFGKVDVDRWLKYLSAVLITL
                     ASRGSMRAEELTETLKPVIMLFETELIMEWLAGLGLLKPQMGAMAPAVMEWWWVAVEV
                     QREGLSEKGNVATAAAATGGTPSGVNGDGTGEVRAIVGEDGK"
     gene            complement(1642722..1644054)
                     /locus_tag="MYCTH_2300784"
                     /db_xref="GeneID:11512102"
     mRNA            complement(join(1642722..1643909,1643965..1644054))
                     /locus_tag="MYCTH_2300784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661375.1"
                     /db_xref="GeneID:11512102"
     CDS             complement(join(1642976..1643909,1643965..1644005))
                     /locus_tag="MYCTH_2300784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661423.1"
                     /db_xref="GeneID:11512102"
                     /db_xref="JGIDB:Spoth2_2300784"
                     /translation="MPHKHTRREKDESTFDLPPTQIAKPLPPTTISKKKAAERKTVDA
                     GKKSGQKRKRSEKDLDDAPRAFKRLMALANGKLPRSGLDNGDAPENGKGKGKGKKAKS
                     TANSTEAAKSTSGSVTAEDLKIRPGERLSEFSRRVDAALPISGLVNKTVKNGKDPLGL
                     KVRQTRKERKMQNMYAEWREIDRKIRERREEERELAEEKEMENEAALGVSWKLELEGQ
                     GKKKKKKKGKRGKFIGEQGDPDEDPWEELRKKRGEQKIGLHDVAQAPPELKLPKKNLL
                     VRGATVAVEDIPKAAGSLRKREELQSIRQEVVASYRKLMSERRPTVGT"
     gene            1646611..1648400
                     /locus_tag="MYCTH_2300786"
                     /db_xref="GeneID:11512103"
     mRNA            join(1646611..1647308,1647369..1648400)
                     /locus_tag="MYCTH_2300786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661376.1"
                     /db_xref="GeneID:11512103"
     CDS             join(1646947..1647308,1647369..1648377)
                     /locus_tag="MYCTH_2300786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661424.1"
                     /db_xref="GeneID:11512103"
                     /db_xref="JGIDB:Spoth2_2300786"
                     /translation="MRPGSVGLVEAGSQEPAADATLAEVAIAGDSHSSLLTARPRSAG
                     HKHQPESSDIFSNFWSAMAPWRSDKSKSAVSAEYAAVAGDAKEDEDDSSGALRNRAGQ
                     QRPGIPRAWQTCILGLAMVAVTFLVVRVSESTASHCSEWLRAKRNPFANWGKPGTGTE
                     DLAWYPTDFLRDVLPIPCHSHNDYWRKIPLFNALYAGCTGVEADVWLRNGDLLVGHDK
                     ASLQPNRTFQSLYVNPLVEILTHQNPKTPFFRGKNNGVFDTTPDQPLVLLVDIKSDGR
                     ETWPLVSKQLAPLRERGWLSYYEKERFHRRPIIVVGTGNAPFDLVVGNSSYRDTFFDA
                     PLDKLENSGYNWTNSYYASVDFWRAIGPVWWTSGPSQWQLDKIQAHLREARRRGLVSR
                     YWKLPSWPIHVRNKVWEVLVEEGIGMLNVDDLDAASKQDWTKLEVLEKDGMIKSATRE
                     GEQVAG"
     gene            1648738..1650210
                     /locus_tag="MYCTH_2300787"
                     /db_xref="GeneID:11512104"
     mRNA            join(1648738..1649020,1649159..1649554,1649981..1650027,
                     1650134..1650210)
                     /locus_tag="MYCTH_2300787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661377.1"
                     /db_xref="GeneID:11512104"
     CDS             join(1648943..1649020,1649159..1649554,1649981..1650027,
                     1650134..1650155)
                     /locus_tag="MYCTH_2300787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661425.1"
                     /db_xref="GeneID:11512104"
                     /db_xref="InterPro:IPR003712"
                     /db_xref="JGIDB:Spoth2_2300787"
                     /translation="MTESQRARRGSIVAIAEQRQNLASLDSSILDRLPAYSATLFEAK
                     TQKRLTFEAIAEYLGRSEVAVAAIFYGQARASPEDVDKLVRLLGLSAESNVAAQMMGF
                     PDRGRAGPMPPVEPLIYRLYEIVQNYGYAFKAVINEKFGDGIMSAICFNSKVEKEVDE
                     TGTPWVVITLKGKWLPFSRF"
     gene            <1650995..>1651613
                     /locus_tag="MYCTH_2125144"
                     /db_xref="GeneID:11512105"
     mRNA            join(<1650995..1651065,1651269..1651327,1651447..>1651613)
                     /locus_tag="MYCTH_2125144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661378.1"
                     /db_xref="GeneID:11512105"
     CDS             join(1650995..1651065,1651269..1651327,1651447..1651613)
                     /locus_tag="MYCTH_2125144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661426.1"
                     /db_xref="GeneID:11512105"
                     /db_xref="JGIDB:Spoth2_2125144"
                     /translation="MPSTTTQPKVPQTSINFSGYCVVILRAQETDSSSRPTGGTTQST
                     AKNQQKSFPPFSPPIAINTDLSQLGYFTHSLPFGFRLPAGLCYEFDEFVLAEDE"
     gene            1652325..1652396
                     /locus_tag="MYCTH_t58"
                     /db_xref="GeneID:11512106"
     tRNA            1652325..1652396
                     /locus_tag="MYCTH_t58"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:1652357..1652359,aa:Thr,seq:agt)
                     /db_xref="GeneID:11512106"
     gene            <1652965..>1654531
                     /locus_tag="MYCTH_79542"
                     /db_xref="GeneID:11512507"
     mRNA            join(<1652965..1653420,1653502..1654054,1654197..>1654531)
                     /locus_tag="MYCTH_79542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661379.1"
                     /db_xref="GeneID:11512507"
     CDS             join(1652965..1653420,1653502..1654054,1654197..1654531)
                     /locus_tag="MYCTH_79542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661427.1"
                     /db_xref="GeneID:11512507"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="JGIDB:Spoth2_79542"
                     /translation="MAKKGATQSPKAGSKPKAQVTDNKPQKQKGDRRKSNEPAVEKVV
                     KDEEEREDESNEEEAPKSNGSKTNQAKYGNQETSEEGSDSESSDSEGSDSESSEGNEH
                     GGINLEGINESDSESELDSDEEGPEKNGDGQKKKKNEGKEKDEDDDGDEEEEEEEEEE
                     IDVEELSAEDEEDEEQIAAGTRVRQTINNKEGLLTALRRFALDTNPKTVPFAFHQSIV
                     SSKKTEDSIPSIEDDLQRELAFMNQSLEAARQARTLLRKEGVPFTRPTDYFAETVRSD
                     ETMQKVKAKLIEEATAKKAAAEARKQRDLKKFGKQVQVQKQLERAKQKRETLEKINLL
                     KKKRKEGGSAALGATEADDLFDVAVDNELKSSGNSKKRSADGRPQPNPKRQRKDAKYG
                     FGGKKRHIKSGDAISSGDLSGFSAKRMKSNSFGGKPKKAGKAQRPGKSRRQAMKR"
     gene            complement(1656012..1658242)
                     /locus_tag="MYCTH_2300790"
                     /db_xref="GeneID:11512107"
     mRNA            complement(join(1656012..1658106,1658182..1658242))
                     /locus_tag="MYCTH_2300790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661380.1"
                     /db_xref="GeneID:11512107"
     CDS             complement(1656106..1657968)
                     /locus_tag="MYCTH_2300790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661428.1"
                     /db_xref="GeneID:11512107"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Spoth2_2300790"
                     /translation="MREANFSIPNVNKASVGITTALYDRRALDCTSTLPLINSLNHLA
                     YLTTSSARIRDILTVDGGIERLVCILKEGRSKDMMDMWKWNLAFQCVVNIGVRGTEAV
                     RTRVVEADMVPVIATILDNYIKVIEKVREKAEEAKQRSDPHRHRIGGSSRVHKSSSFS
                     SRSGTLDVDQRTFRRQAPPPSIDVSAALAGPSTAAASRSAADPTPTAPQFQVTPPADR
                     TPLTAHRHHHHHHHHAVTSPGPQTAPLAPVVPSMDAADGLARTIRDTDRLGSMLPFSR
                     SAAVTSQPASPTTPLPPPQLRSPTVRPTSMLTAAARPPRRPSIRHQHSTGAETDDMNA
                     ESIASDESPDAEMSGTNDMQSDVNVQDVAVEDGDSIMASGTLDLTTPTASETQDAGTF
                     NITHQGPVDGSANTNNTRTPVPAMGLSPNRPTLVAPPQPAMPNASVPRYLLDRQFSPN
                     PQVLAAMPREEDVLMSLQLLAYVSKYCNLRKYFQKSHLVPRLKIGKEIRLLDGGDPAA
                     IEAELQQEEEELEEEYCLPNDLNIFPLVEKFTVRYHSTDMQYWAGVVMRNLCRKDDTR
                     GGIRQCAYYQCGKWEEFTRQFAKCRRCRRTKYCSKECQKSAWAFHRHWCIAATQ"
     gene            complement(1662373..1664353)
                     /locus_tag="MYCTH_2300792"
                     /db_xref="GeneID:11512108"
     mRNA            complement(1662373..1664353)
                     /locus_tag="MYCTH_2300792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661381.1"
                     /db_xref="GeneID:11512108"
     CDS             complement(1662620..1663390)
                     /locus_tag="MYCTH_2300792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661429.1"
                     /db_xref="GeneID:11512108"
                     /db_xref="JGIDB:Spoth2_2300792"
                     /translation="MTPRPGMDDYHPRSATSNSDQGATPTAPQVLSPNMERPKPDAAR
                     QAADRSPSMSYSTTDDEDALHMSRSNPATLPIPRSGNPSVSLSSSSAISLPHPERGSI
                     SSGSESYYLARPPGGGLSSGGSAMGGAISSTQRRRSATIQRAKSPLALTSLATPLPQP
                     DAEWDYSETEWWGWIILLVTWVVFVVGMGSCLGVWSWAWDVGTTPYAPPELEDDPTLP
                     IVGYYPALMILTGVMAWVWVVVAWVGMKYFRHAQVSGD"
     gene            1664381..1666668
                     /locus_tag="MYCTH_2300793"
                     /db_xref="GeneID:11512109"
     mRNA            join(1664381..1665179,1665276..1666668)
                     /locus_tag="MYCTH_2300793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661382.1"
                     /db_xref="GeneID:11512109"
     CDS             join(1665081..1665179,1665276..1666619)
                     /locus_tag="MYCTH_2300793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661430.1"
                     /db_xref="GeneID:11512109"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="JGIDB:Spoth2_2300793"
                     /translation="MTTEDGTANNGGSTPKNPFNFQTQFISTGPVRPNIGQRRGHRYK
                     HSSISAQHQIFQEPPPRPPPVLPASLPIPTLKEAWASMQSGQRARLWWCCCHAVVAMY
                     VFFSAEGSLAMTALSHLVFFDVGSAAVCVAVDVLGNFEVWRRSSIRHPFGLQRAEVLA
                     GFAMSVFLVFGGFDLISHNLKHFLETVGDHAPHHPASSTTATSHSGGAVHLDGHGHAH
                     GVRYIPPGTVDFTSLAAVVSTLVSAYGLRNHGRIRRVMRVPFPYLARLLPGAGILANP
                     FHFLTLCFSFIMLLLPLLSIPLFVWLDRLICAAIAASMFVLGTRLAVAQGLMLLMSYS
                     DLPSSTATAKPSSSGSGSSNNNNNTIATTIKSALVSDDQKKTDGDVGGSGNATTSVSS
                     VIREIESQPQVAKVEEAQFWEVHYGLAMANLKVRLAQGCSGNDDGMLSQLRSRLARVV
                     QNRLAGEGGYGRGGTRRWEVTVQTCSSSDG"
     gene            complement(1666671..1668935)
                     /locus_tag="MYCTH_2300796"
                     /db_xref="GeneID:11512110"
     mRNA            complement(join(1666671..1667660,1667712..1668456,
                     1668521..1668616,1668687..1668935))
                     /locus_tag="MYCTH_2300796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661383.1"
                     /db_xref="GeneID:11512110"
     CDS             complement(join(1667014..1667660,1667712..1668456,
                     1668521..1668616,1668687..1668701))
                     /locus_tag="MYCTH_2300796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661431.1"
                     /db_xref="GeneID:11512110"
                     /db_xref="JGIDB:Spoth2_2300796"
                     /translation="MCRFLVYKGSDEILLSKLVLDPAHSILKQSFDSRLRLDTRRGQN
                     NADGFGIGFYTDPKLGAAPCLFTSTTPAWNCVNLQRLATKTASRLIFAHVRATTEGSF
                     SEDNCHPFCHGSLMWMHNGGLGGWKQIKRRLGERLADKWYLNVVGGTDSEWAFALFLD
                     TLERMGHDPSSQPENGFGPTVLRKAMLKTIAVINELIDNIPESVILAENVDTRSLLNF
                     CVSDGHSIICTRYVGSSTDEAASLYYSSGTLWETKAPTPDSSDYQMERSDKGADVILV
                     ASEPLTFERENWVNVPTNSILTIHNQTVMVHPIMDQYYNRNPQHRRSAAFVRTKGLSA
                     NEKATSRSGTPFGPPASIPPVTSVPHLPGNPESHKQRLRGSTIPAGLLNTRTPDGPSS
                     TSSLPRSRTPLSHAETITPEPSSLQSPTADVRELTAPPIIRAASQQPPAQGNIKKKRA
                     TLGTVEAMHGGGGGMALAQYLDTSPVTPEPVRTEFGNPEKIARMFPELAL"
     gene            1669690..1673095
                     /locus_tag="MYCTH_2300799"
                     /db_xref="GeneID:11512111"
     mRNA            join(1669690..1670304,1670357..1672387,1672503..1673095)
                     /locus_tag="MYCTH_2300799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661384.1"
                     /db_xref="GeneID:11512111"
     CDS             join(1670004..1670304,1670357..1672387,1672503..1672927)
                     /locus_tag="MYCTH_2300799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661432.1"
                     /db_xref="GeneID:11512111"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="JGIDB:Spoth2_2300799"
                     /translation="MSAQLRAARAMAPIARRVTVRAVRQFHQLPTGGIQRAELAIRGS
                     RRSLQFPSNAYHNAVIVRNASFARLLPKLALKFVRIPALFGGLMIGAVGWIQYQAIQV
                     SNSAQEMYSNMKNTVTSTASSLWGSAKEIAEQTKQGWDNTRQQFEIPEWLDKIMRGGG
                     DGSSGEGGPGGQGRPEPPKQSRAGAAAVAGASAAAYGFDHSDETDERTPGEILKDDHM
                     MYITKRMIEIRNLLQKVGQSSTVTLPSIVVIGSQSSGKSSVLEAIVGHEFLPKGSNMI
                     TRRPIELTLVNDPQARTDYGEFPDLGLSKVTDFSLIQKTLTELNQSVPESLCVTDDPI
                     RLTIHSPRIPDLSLIDLPGYIQVAGENQPRELKRKISELCDKYIRGPNIILAISAADT
                     DLANSTALQASRRVDPRGERTIGVITKMDLVEPEKGAAILTDKQYPLRLGYVGVISKL
                     PSQTGLFRRETGNLLAGISRNEKSYFSSYPSQFGPDTGVNTGTMTLRKKLMQVLEQTM
                     SSKLQETTESIQRELEETTYQFKVQYNEQPMSAEAYLAASLDDFKHQFHTFATSFGRP
                     QLQSLLKDALDQKVLDQLAARYWNRPIEDLTVALPEPDSIADLPKADPKSAYWHRQLD
                     AACSGLTRLGVGRLAATVAAAAIQSNVDKLLDKSSFSKHPAARKVISEAASTVLADRS
                     YATSDGIEISLKPYKFDPDIQPNEWAQGREHVVGVLQGELEQCQAAMKSLENSVGGRK
                     KLKEVMNFVDKARKGEIIVEGDHPSGAGGFSAALLARGREAVFLRDRANIINMRIMAA
                     KSRQCKTLENKYYCPEVFLDAVATKLAQTAVLFLNVEMLNDFYQRFPREVESKLHEHM
                     AGGGLERFAREDPKVRRHLDLIHRKELLELVLAKIEDLHRLPGAVGGRELADPAKRRG
                     RRFF"
     gene            complement(1673251..1674915)
                     /locus_tag="MYCTH_2300802"
                     /db_xref="GeneID:11512112"
     mRNA            complement(join(1673251..1674032,1674127..1674584,
                     1674680..1674915))
                     /locus_tag="MYCTH_2300802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661385.1"
                     /db_xref="GeneID:11512112"
     CDS             complement(join(1673726..1674032,1674127..1674584,
                     1674680..1674751))
                     /locus_tag="MYCTH_2300802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661433.1"
                     /db_xref="GeneID:11512112"
                     /db_xref="JGIDB:Spoth2_2300802"
                     /translation="MVNFKWSSLALLALRVATAFAADDADAEPVTSVPVEEPELKADI
                     ETTFPDADIFGVKIVNGHVTKALVEITNHEETPIDVAFIGGALKTTKPLPEDAPASAA
                     ILRNLTAVRYDVSIPPGEKHQLPFQFVLDMMPQDVIIELVAIITNAATNQIFQVQAHS
                     GTASIVEPPTSLFDPQIIFLYLFLTGVFGATLYFVYKTWIEALFPQAKKAGGRAGGKK
                     GRKGAAAAAADADPLSGNESAGATSGGEGSKSYDESWIPPHHINRPVARRVKSGASGK
                     SK"
     gene            1678803..1680033
                     /locus_tag="MYCTH_2300806"
                     /db_xref="GeneID:11512113"
     mRNA            join(1678803..1678872,1678943..1679703,1679894..1680033)
                     /locus_tag="MYCTH_2300806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661386.1"
                     /db_xref="GeneID:11512113"
     CDS             join(1678828..1678872,1678943..1679703,1679894..1679990)
                     /locus_tag="MYCTH_2300806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661434.1"
                     /db_xref="GeneID:11512113"
                     /db_xref="JGIDB:Spoth2_2300806"
                     /translation="MAASEPGGHAFQEQQGFIDDQFDIFDWYPYFQSCVRYFLEHAQF
                     DGPVQALAAYLNIQLPFQRAQNALLRASPNPGVPGALGGIQIQHPGPGGRLSPAAAAA
                     AAAGAGYPPQPRHHHHRAWQYQNISLHPYIRRLVATGFDAPAVLHGFFGDDWELGVRP
                     LHEQERRNYLFAAKSGSWLEVKRAYDTAHGPAAGPFSFFPPSAAAAVPPSAPVSPPAP
                     PPPPPLHPFSSSSWAAEDESVPFLRPLRNVTEAEIVAAEAGWSEWLAMQDWMLGPRAI
                     GVSRGAGTSSAGSGGPVGIKREED"
     gene            1680911..1685016
                     /locus_tag="MYCTH_2300809"
                     /db_xref="GeneID:11512114"
     mRNA            join(1680911..1681819,1681898..1682145,1682210..1682272,
                     1682334..1682846,1682901..1683441,1683498..1685016)
                     /locus_tag="MYCTH_2300809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661387.1"
                     /db_xref="GeneID:11512114"
     CDS             join(1681087..1681819,1681898..1682145,1682210..1682272,
                     1682334..1682846,1682901..1683441,1683498..1684912)
                     /locus_tag="MYCTH_2300809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661435.1"
                     /db_xref="GeneID:11512114"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="JGIDB:Spoth2_2300809"
                     /translation="MDSHSSRERLSAAVAAWSQLVHRALVKRTAPDQFAAFLPLHFAE
                     HPLPPVIVADVLLRPSKRQRYSLDPRVPIYLDALLKQRRVDVASVLRALYKYSSAHLK
                     VQSPDPGVLDGGENGRKEGGEGEGGKGAKEVKQGTPKGSKIVRWQNSYEDEEMILWRL
                     AQAVHQGSGIRTAKNVIQIAKVLAKWMPLFAEAAAAFSRDAFDSLHGLQVRDETADAR
                     TAFVLLLIAFSDNPLVQATLEKPACKDVCKMLSDALQAFIPCVMQVLPEMASRLEVFR
                     NETLGKHLAAEKKDADVNNYMDNLMGMDSLQIPEVPVVNSRAGLYIHLSAALVGRPVI
                     DDSALFAYLHNRYQGDVQSTAVQLILASFDLLANAVFRNEGPKTGHLLKSFVVNKVPL
                     ILVSLTAAAMYPFDPEMCIKEALGQVDTNVFPTLSGMFEMSNTNSSFHDSVRQDFCFS
                     CQLHGLLSQAAIENLLGEITYQSLPDEGRYSKDNLVHACLQDVDRTQKLIGELDNMNG
                     NVGAAAQAIIEVIGSLCRNKETMTLKQLCSQLAAKPLSLDVLLLFDKPEKILHPLCEL
                     LDNWAGYEEDQGEYQPVYEEFGSILLLLLAFVYRYNLSPADLGIRSPDSFVGKLLSGG
                     AVCRPLEDLSEQEKSHLNGWIHGLFDSEAGALGDDLMASCPPQDFYLLVPSLFHQIVV
                     ALSAGYLTDDMLKNGLEYLVDVLLLPSLVPAILYLSNQLWVSSPQLQSSIIKILQVII
                     RPSSSSNEAWTMLSSVLNIVAKPLEHALRSYQRQDPKSQEVEPLLRAIQDNLLLSRRT
                     GGADHTELESWCSTHINHGATPHSGLSAAVRHTMQNLIQWAQNPQLNGMPAPYTHRQT
                     LAAVKMLGAKRFLAILLDELRALADSPQAGIAYDVATALICAPDVTNDASLSGASGGA
                     PSTTNNNNNKNKNSNNNSGNNTNSNTNANTNNTGNSSNNNNNNNSNNAGTPPTDDPAA
                     SSRQQQQHRHTSLRDALKSEADEWKKTQKADPVMAETVVRLYRRVEAQMAPAPPSAAE
                     AAAAAAAAAAMLEPPELGGLGGVPGDIGGALGDAIAAAVGGEHHGLHGHEGMVMDGGG
                     GGGGGSNGGGPDGATAAAAGAAGGDQQQQQQQQQQQQQHLGGFGGDVMTGSDLGADGL
                     FSSLSGNGSDFGADFGAGWDIDMS"
     gene            1686679..1688713
                     /locus_tag="MYCTH_2300813"
                     /db_xref="GeneID:11512115"
     mRNA            join(1686679..1687146,1687250..1687418,1687477..1687495,
                     1687596..1688713)
                     /locus_tag="MYCTH_2300813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661388.1"
                     /db_xref="GeneID:11512115"
     CDS             join(1686900..1687146,1687250..1687418,1687477..1687495,
                     1687596..1688468)
                     /locus_tag="MYCTH_2300813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661436.1"
                     /db_xref="GeneID:11512115"
                     /db_xref="JGIDB:Spoth2_2300813"
                     /translation="MKRALGCAALSCAVGLIDAKALKWSDDDPRWVPAQETQLGFMGA
                     LDINPPMPTAAPETSRLRKALEARGATDNTCGFVSGVFTASLWCSTTASCVYNSINSH
                     IGCCDEGEISDCLIPTVCYDYTDSKRYSTNNGLTRWCGDSSYPHCTTYIYQDRVFTGY
                     TLLGCAVAAGTGKVWYTPLDTSRTSSSSTSESSTTFFDTSSTSTSSDSSTSTSSSSSS
                     TTTPVPPDPDPDTPVGAIVGGVVGGLGAIALIILVVWVLLRQRNKQKNAAAAAGVIHP
                     PPAPPAAGGQPHYDPHMSQMPPQAYYGAGGAAAGGFDPRASIAQSNGGTTSAPYGPSA
                     YDQKTATGSSPPGSPPAPSSFGNYDAHHSTPSPPPQGQQQQYGQHGYGNVSPSAASPT
                     MQAGGVFPQQQQHPQAYGADQQGPAPVELPVTRGDGELRELQG"
     gene            complement(1688644..1690647)
                     /locus_tag="MYCTH_2300817"
                     /db_xref="GeneID:11512116"
     mRNA            complement(join(1688644..1688979,1689111..1690647))
                     /locus_tag="MYCTH_2300817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661389.1"
                     /db_xref="GeneID:11512116"
     CDS             complement(join(1688819..1688979,1689111..1690554))
                     /locus_tag="MYCTH_2300817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661437.1"
                     /db_xref="GeneID:11512116"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Spoth2_2300817"
                     /translation="MSQTISPSELSSHNTVSSLWIAIDGLVYDLTEFAPTHPGGLSVL
                     LEHAGKDGTEAYHAVHSPSLLRSNLPVSKCLGRLSSPLPASSPSRPSPAPKPPLSSLI
                     SVHDFRQAAHTFLPPKTLAFVSSAATDCHTHGRNSSAYSDITLRPRVLVDVSAPVSLE
                     TTILGQRVASPIFVAPTSLGKTVHPEGEREIARACKELGGVAQVVSTSASFSVSDVVQ
                     AALDHPFPPAAAAGAAAAGDPGAEPPNVPVFLQLYVDKHAPNTEALLASLTSPDPADP
                     AAASKIKAVFLTVDAPVPGKREADERVPVPVPTPAAAAATTTTTTTTSTTTTTTPMAT
                     QLSPTADSSGAALGRLMASYISPSLSWESTVPWLRRRLPRSVPLVIKGIQTAADAVRA
                     ARAGADGIVVSNHGGRSLDTAPATVLVLLELQRCCPWVFERLEVFVDGGVARGTDVFK
                     ALCLGARGVGVGRAVLYGLGYGKDGVKRVLEILNAELVTTMKMCGVTKLDELHPGLLN
                     TRAVDHLVPDSLSEDHPYAKWRRSKI"
     gene            complement(1690649..1691725)
                     /locus_tag="MYCTH_2300820"
                     /db_xref="GeneID:11512117"
     mRNA            complement(join(1690649..1691304,1691405..1691725))
                     /locus_tag="MYCTH_2300820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661390.1"
                     /db_xref="GeneID:11512117"
     CDS             complement(join(1690884..1691304,1691405..1691484))
                     /locus_tag="MYCTH_2300820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661438.1"
                     /db_xref="GeneID:11512117"
                     /db_xref="JGIDB:Spoth2_2300820"
                     /translation="MTRWLGLREPAASPALQLACRAQHFRRWELPRSSYPMTRAGYLT
                     WRAKQKAQAAAQVAELLSSSADIQPPLPPEEVERVAALVRKEDLKNNDETQALEDVAC
                     LVFLDDQFDEFEKKSEIDEEKMVGILRKTWAKMTEKGRELALGMELSERAKALIGKAL
                     ESENQS"
     gene            complement(<1693802..>1694758)
                     /locus_tag="MYCTH_2057198"
                     /db_xref="GeneID:11512118"
     mRNA            complement(<1693802..>1694758)
                     /locus_tag="MYCTH_2057198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661391.1"
                     /db_xref="GeneID:11512118"
     CDS             complement(1693802..1694758)
                     /locus_tag="MYCTH_2057198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661439.1"
                     /db_xref="GeneID:11512118"
                     /db_xref="JGIDB:Spoth2_2057198"
                     /translation="MASSDIDQKFLGRLAKAVEHDNPLLASVLFRILGLSISLSAQLI
                     KARKQRWQDASQAAAALDLTCHIVWLSREGLVLLQQYVLPMVGNYVELKVLAYKLRAS
                     FYHVFVLFHNTPPVSTMGVHTPEAQSTSAVSGPSPRADKGKGVARDDHDETSGKGGPV
                     APPPGFGPAPPTAFLMKPGDYLPEAHRYFREAVQLADQLLWGSHSLRLSVKTEYAAFL
                     YECVHDAEASRKVAKDTIAEVYEATEGIDNDMFNDACELVTVLGKMMKRGLGPSSTTV
                     RSKAAHGGSGSGTSHGAAAPQVEHQHQHQQQGEQGGAPPGMI"
     gene            <1698402..>1698680
                     /locus_tag="MYCTH_48424"
                     /db_xref="GeneID:11512119"
     mRNA            <1698402..>1698680
                     /locus_tag="MYCTH_48424"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661392.1"
                     /db_xref="GeneID:11512119"
     CDS             1698402..1698680
                     /locus_tag="MYCTH_48424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661440.1"
                     /db_xref="GeneID:11512119"
                     /db_xref="JGIDB:Spoth2_48424"
                     /translation="MCRYYAHQHACKHTQFSFAAFCDPASLIQNPCGERHIWATIVLG
                     DPCDDCRAAVTAAAAGATGGGEGGDSGNRGGAYERGYPFAHGYGQGRQ"
     gene            complement(<1699039..1702932)
                     /locus_tag="MYCTH_2300826"
                     /db_xref="GeneID:11512120"
     mRNA            complement(join(<1699039..1700148,1700204..1702611,
                     1702698..1702932))
                     /locus_tag="MYCTH_2300826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661393.1"
                     /db_xref="GeneID:11512120"
     CDS             complement(join(<1699113..1700148,1700204..1702611,
                     1702698..1702705))
                     /locus_tag="MYCTH_2300826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661441.1"
                     /db_xref="GeneID:11512120"
                     /db_xref="JGIDB:Spoth2_2300826"
                     /translation="MLCTTEAPVLVPDHPLRKLFWRYGTWAARHVNIVLPLSGTVIFF
                     FLYLFAFLYTTEATTNTNGVPHLPHHVWTAAQPLSAGSDVEPDVIMRSIWIHGSYMKA
                     IDRDVLLGALEIQDEILGPTVNFNPREAHGHPSPLDTDGDLSRQQRDSFHISNGVTNQ
                     SWFFHSPLQYWAGSAENIAADDDLVATVNEKKTQSTLANTTLRHSIVFSGKRFEERRL
                     VAADALVITLIHMHDSPVGRQWVAKAGALAQNSKQDCKWRVIPPDGRSPSSQLYKFQF
                     QPMSSYDWAMLTLAYSLALANLLLRLSKLRAVKSRLGLIVTILTQIAASIVSSFTVCA
                     IFKINLSRVPHYAYPLVVLAISIENSFRLINAVMMTSSTISTSDRVGEAFGTTAHIAI
                     ANRVLNSLLLYSLSKVTSPGVSAFCTFVAIATLFDFLYLATFFLAVLSVDVRQRELVE
                     LEKASLRRARLSQGGLRRQSRLYGVYPSRLGDTTMSTTIAGSIVVLGFVLIVQAHYSS
                     EGGRQWLNQLLNLSWGRVRNHSKPSLLIDFHQARSPTSWLGLQDHETAQEVIKAIKPW
                     AHSYIARVYDPIIFVMKGADRTPHTKEPFLLPAVYDFIHHQIPLFVVSLLTTLAALRL
                     FTNYLIKAQFEHGYGSGSDDEHLLSMQSLSRGHTLDVAMLAASPRGQLVSVGLDRTIQ
                     IWDVSSGSRSRVLSDPDVPLENPFPVLNLALDDRSGLLALVSWQRVLVWNVEKQQWTR
                     AINIDLGGHRPEAVFFVTDAPGAVPSLVLVRRDGIGLEVQVMTGDVRDFAICRTPLVW
                     AVHFTAGANAQQRSPHPAILTASRRSCIHLVRQQDNEWLSVEVKLKGNPGPGAVHCLL
                     PLAALSRFLVGRSHSVDLVDMDSSTIIHTFHTETMQPRTLKQITLMRIHRTGLASFTL
                     SYTSAETGDLVIHTYLPETGDQHQPRPPSSPPELIPLDAWTLTREHIKHISYPGAWEA
                     LPSGSIVGVRRQQTTPLSPTITPSRIPGLRRRGAYGTIMDDPNPTSSTTTTNAQSQAW
                     EAWVLNLRPGAKSEFETRPLDEDADVDQQQQHLMISELGPMTRLGTMSVAVGFGDVIK
                     VLSVGHEHFDRARGGSFSFSDEGLQEVMASRKKKGVGASGVGRSGGVPAGGGGTGQGV
                     KSGP"
     gene            <1703938..>1705369
                     /locus_tag="MYCTH_2024024"
                     /db_xref="GeneID:11512121"
     mRNA            join(<1703938..1704185,1704364..1704508,1704647..1705134,
                     1705197..1705256,1705312..>1705369)
                     /locus_tag="MYCTH_2024024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661394.1"
                     /db_xref="GeneID:11512121"
     CDS             join(<1703938..1704185,1704364..1704508,1704647..1705134,
                     1705197..1705256,1705312..>1705369)
                     /locus_tag="MYCTH_2024024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661442.1"
                     /db_xref="GeneID:11512121"
                     /db_xref="JGIDB:Spoth2_2024024"
                     /translation="EEAKTEDPIAELIKNYHELNSSVIEEFDEEPSALEFMRFVARNT
                     PFVVRGAALNWEATRTWNVNYLKEVLGDEPVNIAVTPVGNADAPTPYTHPDGTTTLVF
                     AKPHEEDQPFDGFLTYLTTQEKHFTQQPPIRYAQTQNDNLRHEYRALLDAVPPSIPWA
                     RIALARDPDAVNLWIGNSRSVTALHRDNYENVYVQVAGRKHFVLLPPVCQPAVGEREL
                     RSAVYVRDPDPDPDPDGEQEEEGLRLVLEGGEDAVVPFPTWDPDRPAENATPYSALVR
                     PMRVTLNPGDMLYLPCMWYHKVSQSCSPEGVCIAVNYWYDMDFTGPLYPLSTFVRSV"
     gene            complement(1705311..1708496)
                     /locus_tag="MYCTH_2300833"
                     /db_xref="GeneID:11512122"
     mRNA            complement(join(1705311..1705722,1705788..1706122,
                     1706173..1707399,1707450..1707729,1707793..1708089,
                     1708145..1708496))
                     /locus_tag="MYCTH_2300833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661395.1"
                     /db_xref="GeneID:11512122"
     CDS             complement(join(1705504..1705722,1705788..1706122,
                     1706173..1707399,1707450..1707729,1707793..1708089,
                     1708145..1708312))
                     /locus_tag="MYCTH_2300833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661443.1"
                     /db_xref="GeneID:11512122"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="JGIDB:Spoth2_2300833"
                     /translation="MAIQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYGFLEK
                     SKVVLDLCAAPGSWCQVCAETMPKDSIIIGVDLAPIKPIPKVITFQSDITTEKCRATI
                     RTHLKTWKADCVLHDGAPNVGTAWVQDSYNQAELALHSLKLATEFLIEGGTFVTKVFR
                     SKDYNSLLWVLNQLFTKVEATKPPSSRNVSAEIFVVCRGYKAPKRIDPRLLDPRSVFE
                     DLADPAPNNEAKVYNPEVKKRKREGYEEGDYTQYKEIAASEFIQTTDPLAILGQYNRL
                     TFEQPKNGDVALAALDKLPETTQEIRHCCADLKVLGRKDFKLLLKWRLKVREIFGLPT
                     KKTTKAPLVEEVAEVENMDEELKIQEELQRIKDKELAKKKKERRKENERKHKEIVRMQ
                     MNMTAPMDIGMEQEGPRGADAMFRLKSIDQTEALRRIAKGKMATITEVDAKKDRDSGI
                     GSSGETDDESDEELDRLERELDNMYESYKERKAAADAKYRAKKARKEYGDDEWEGVSA
                     SEKEESDDDDEILEEESSDDSDAEERGDTSKPLLRDLDNTPQDGAGLSKRARGFFNQE
                     IFRSIPGLLDVPEDTEGEDEAKNADEGAASNGEDSDNDVPTIEEQKKMRKEKAARKEK
                     EKEDDFEIVKQDQDSDDDWEEKEKKKKTKDGKPNIDIITAEAMTLAHQLARGEKSKHD
                     LIDEGYNKYAFKDRDGLPDWFLDDEAKHDKPHKPITKEAAAAIKEKLRAYNARPIKKV
                     AEARARKKLKQAQKLEKLKKKADLLAGDEGMSEKEKATSIAKLMSAAARKKRKPPVKV
                     IKATGVNRGISGRPRGVKGRYKMVDPRMKKEMRALKRIAKKRK"
     gene            1708761..1711499
                     /locus_tag="MYCTH_2300837"
                     /db_xref="GeneID:11512123"
     mRNA            join(1708761..1709586,1709642..1709752,1709807..1711499)
                     /locus_tag="MYCTH_2300837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661396.1"
                     /db_xref="GeneID:11512123"
     CDS             join(1708950..1709586,1709642..1709752,1709807..1711317)
                     /locus_tag="MYCTH_2300837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661444.1"
                     /db_xref="GeneID:11512123"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2300837"
                     /translation="MADRVPSSPTRKSVASNASIASSPPRAPSSRAKERRNPSITPRK
                     FQRFFTPRSRVSSKPSAARKALCDLTAPALNRCQTPSSPLKPISEESLPHSEDAHRGK
                     RRKFNHSTPEKQAGAYLPSPLNSSPLLPTADSKPGLRSPIQSLKSRHVLRDGVLRDDD
                     VSEDEEEEQEVVAAPAKGPVQLYRRGLGAQLVQRMTGSMRYASERLLECPVGDWRTET
                     ADFQSRPEDVHFSSSHEGAARAIPFCTTACHKNSLVAVGDEEGFIRLLDSEKDFSKIH
                     LSFRAHGNAIIDLAFSEDDHLLATASGDQTSRVIDMMTQRPVSILGHHTASLKQVRFQ
                     PGRGASCVLATSGRDGSIQIYDLRCRGGPVQDFSIVSEAGLHHSIPKAVNPGCVVNSI
                     YDAHARTTRQGKSQQQPASNLGDVARLGEVPGRAGEVSVTALQFLPPGREHLLLSACE
                     ADASIKLWDIRAVHTSRHHKASTPISLTSPPPGHVAFRPFGICSMVLGGDGARLYALC
                     KDNTVYAYSTAHLVLGHATELTPARPGTEPPRRRHHPHGAAHEGLGPLYGFRHPLFHA
                     TSFYVKAAIRPAAADGRSELLAVGSSDGAAVLFPTDERYLRDAWSLPDADRDEETYYV
                     GSPTDEAPVARPRPGLRSASSAAPASLARANSMSHMFSSCRQGGGGGVTPVVRRGTPL
                     VRGHGKEVGAVAWTSGGRLVTVGDDFLVRCWSEDREKAADLRLGGETGGRRWGCGWAD
                     VGDQWAGDADDW"
     gene            complement(1712004..1713901)
                     /locus_tag="MYCTH_2300840"
                     /db_xref="GeneID:11512124"
     mRNA            complement(join(1712004..1712363,1712416..1713249,
                     1713346..1713901))
                     /locus_tag="MYCTH_2300840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661397.1"
                     /db_xref="GeneID:11512124"
     CDS             complement(join(1712091..1712363,1712416..1713249,
                     1713346..1713558))
                     /locus_tag="MYCTH_2300840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661445.1"
                     /db_xref="GeneID:11512124"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="JGIDB:Spoth2_2300840"
                     /translation="MHQGADLGCQLFRSLSAATTSDSRTTTGASTGSGSSMREKLGLG
                     SIARRTLGITLLLIVVFLWTLSNFLASYIFSDGTYNKPFFLVYVNTSCFAISLIPLTI
                     RYVKQNGVGGLVTAALQLWREKRSGLTLLKTADEEGRRCGAAYDDGDAAERLLVDDEA
                     GLDVLPPGKDEKLSVGETARLSLEFSLLWFAANYFASACLEYTSVGSVTILTSTSSIW
                     TLVFCALTKVETFTLRKLVGVLASLVGVVLISSVDLSGANDDSRGSFPHKTTVQIAIG
                     DSMAFFSAIIYGVYVTVMKRRVGNEERVNMPLFFGLVGLFNVLFLWPGFFILHYTGIE
                     PFELPPSASVWTIIAVNSMASFFSDILWAYAMLLTTPLVVTVGLSLNIPLSLIGEMIQ
                     YSQYSSWLYWVGAGIVFISFLFINNETYEETTGGDDGQVRGVEGSAA"
     gene            complement(1714419..1715936)
                     /locus_tag="MYCTH_2300844"
                     /db_xref="GeneID:11512125"
     mRNA            complement(join(1714419..1714754,1714805..1714907,
                     1714967..1715191,1715269..1715364,1715437..1715490,
                     1715549..1715936))
                     /locus_tag="MYCTH_2300844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661398.1"
                     /db_xref="GeneID:11512125"
     CDS             complement(join(1714645..1714754,1714805..1714907,
                     1714967..1715191,1715269..1715364,1715437..1715490,
                     1715549..1715578))
                     /locus_tag="MYCTH_2300844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661446.1"
                     /db_xref="GeneID:11512125"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2300844"
                     /translation="MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSASYKATIGAD
                     FLTREVLVDDRQVTMQLWDTAGQERFQSLGVAFYRGADCCVLVYDVNNAKSFDALDSW
                     RDEFLIQASPRDPDNFPFVVLGNKIDVEESKRVISTKRAMTFCQSKGGIPYFETSAKE
                     AINVEQAFEVIARNALLQEESEEFSGDFQDPINIHIENDREGCAC"
     gene            1716099..1718019
                     /locus_tag="MYCTH_2077534"
                     /db_xref="GeneID:11512126"
     mRNA            join(1716099..1717184,1717410..1718019)
                     /locus_tag="MYCTH_2077534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661399.1"
                     /db_xref="GeneID:11512126"
     CDS             join(1716408..1717184,1717410..1717823)
                     /locus_tag="MYCTH_2077534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661447.1"
                     /db_xref="GeneID:11512126"
                     /db_xref="JGIDB:Spoth2_2077534"
                     /translation="MADPQLLDKIHGLGDLELAVLLCLIAREHCLISTEFDSVDDLAE
                     ELRLVASKTFNLSSAIVSCHTHTTLEEFATGLFVQPARVPPSPGNTRSVSPYRPRNEA
                     SQLSTGGASSPGSYVPMNPSPRIGGHMTPLSPPAGGSSSSIAQARIANVVLAKDLDSA
                     PRAVQIQALELLRTRRIFTRTSVQTAPKQFLFIALVGANSGGQARVNPHLNDFFYLSH
                     WHDPAEDGFPYLDEEFSPKSGDQGDDPDEAASTISSSSVVKTPVFTEHEISHLSELSR
                     TAHTSISVTRYQANLVAFLRTHRAVAPGSGVTPAATRHLAQLARSLAPLHGLDYVTPS
                     LVALALRKVYLHRLNLVMAAGRPERERSVQWGSDVPTVRGMLEGWTVEDVLEDVLESV
                     QVST"
     gene            complement(1718197..1720439)
                     /locus_tag="MYCTH_2300848"
                     /db_xref="GeneID:11512127"
     mRNA            complement(join(1718197..1718416,1718519..1719890,
                     1719982..1720439))
                     /locus_tag="MYCTH_2300848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661400.1"
                     /db_xref="GeneID:11512127"
     CDS             complement(join(1718359..1718416,1718519..1719890,
                     1719982..1720210))
                     /locus_tag="MYCTH_2300848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661448.1"
                     /db_xref="GeneID:11512127"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="JGIDB:Spoth2_2300848"
                     /translation="MRRTSVSLPTKHIAHDPHEKPDRYRNPREQSLIMKMQSAWVSQS
                     QRARYIKTGAIIFLVFILFYCFSPSGVDIYNGALGGQKSNQGQTPSDSSYGTDRCTRS
                     YSKDKPIVQYVSMIDAGSTGSRIHVYKFNNCGAAPELEGEILFKQTEKIEGKSSGLSA
                     YKDDPEAAAKSLDPLLDAALKVIPDKLKACSPIAVKATAGLRLVGPERSDKILAAVRR
                     RLETNYPFPVVSQEQGGVSIMEGSDEGVYAWVTVNYLLGKIGGPDRSETAAVFDLGGG
                     STQIVFQPSFEGLASGGMPDKLAEGDHKYDLDFGGQRFTLYQHSHLGYGLMSAREAIH
                     ARLVQDLHEANKPDTAWTKQPVINPCLAAGTSKTVTVKLADNHPLGATVELNMTAPST
                     AAPAQCRSLAERILRKNAECKLAPCSFNGVHQPSIAKTFSREDIYLLSYFYDRTQPLG
                     MPESFTLRELADLARSVCGGEPAWDVFASVPGALDELRDRPEHCLDLNFMLALTHTGY
                     EMPLDREVRIAKKIKDKELGWCLGASLPLLSKGSGWQCRITETH"
     gene            1721074..1726243
                     /locus_tag="MYCTH_66088"
                     /db_xref="GeneID:11512128"
     mRNA            join(1721074..1721356,1721420..1721478,1721535..1721644,
                     1721715..1723047,1723371..1723399,1723734..1723981,
                     1724165..1726243)
                     /locus_tag="MYCTH_66088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661401.1"
                     /db_xref="GeneID:11512128"
     CDS             join(1721143..1721356,1721420..1721478,1721535..1721644,
                     1721715..1723047,1723371..1723399,1723734..1723981,
                     1724165..1725861)
                     /locus_tag="MYCTH_66088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661449.1"
                     /db_xref="GeneID:11512128"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_66088"
                     /translation="MDVHLLVYDLSRGLARQMSMGLLGFQLDAIYHTSIELNGLEYVY
                     DGNVVAIKPGSSHLGQPMERIHLGRTELPMDVIEEYLDSLREIYTVEAYDLFRHNCNN
                     FSNDFATFLLGKGIPSHIINMPQAVLNSPFGQMLMPTLTQQINANKRGGGILGIEKQT
                     PGSSVKAPSQLHHPPGKVHIVSNLGRLDELLAAFQKSCAVVFFTSATCPPCKTLYPLY
                     DELASEFGEKAALIKVDTSQAFDVASRYSITATPTFITFLKGKQENRWSGADPSALRG
                     NVRLLVQMAWPPHPHQALDLPTFTNPDAEYVTFTKIPPLEKLLAKMGPTAADPLIQSV
                     KKFIETRDSDGPAETTLPDLAAFGSLIRSCLTSLPTDSLFAVVDLLRCALVDPRVSGY
                     FAEEQPAHQTITSVLEHVVGITVPPRTCPYALRLVTLQLACNLFTSPLYPAQVLAHAP
                     LRAAVTQLLSSSFLDDAHANTRVAAASLLYDVALANSRRRRDGPGDLLPEDEQVELAA
                     SVLEAIAQEEGSRDALEGMLRALGWLAYCLPPDGEVADLLRAMDAGGLVLKKGEKGQI
                     GEGLGLPPPSPWTWRRNLEQRFRDVVADINETLIGISLEPRLMPNSAGYLDVVAPRPV
                     RSSASTPSLRSRDGTVPPHARADPGGNVRVVVRVRAFLPREIERGAECLIHMDPVTQR
                     TTLRPPTSDADPANARARSRKVVEEKSFTFDNSFWSHNPADEHYATQEDIYDSLGEEF
                     LDHNFEGYHTCIFAYGQTGSGKSYTMMGTPEQPGLIPRTCEDLFERIAAAREETPNIS
                     YNVRVSYFEVYNEHVRDLLVPVLPNQPPYYLKIRESPTEGPYVKDLTEVPVRSLGEIL
                     RYMRIGDSNRTTASTKMNDTSSRSHAVFTIMLKQIHHDLETDETTERSSRIRLVDLAG
                     SERAKSTEATGQRLREGSNINKSLTTLGRVIAALADPKQQRARAGRKDGGSASVVPYR
                     DSILTWLLKDSLGGNSKTAMIACVAPSDYEETLSTLRYADQAKRIRTRAVVNQVDSVS
                     AAERDARIAAMEAEIRALQLVVGDSRRREKDAREAEERLEEYQERVRSLQRAMEERSL
                     VAEGKIRSLQTENETLRLHLRLALDSLKNPIPIPPLAGPGRDGIGEGRQGNEKAEQGP
                     NGSDDDDGYASGGTAAEDGNEYAGGEENAGYDTYERHADDMHEHMSGLLRDLSLFRRK
                     IGDDKMRFMDELSRRRPLGQRTNII"
     gene            <1727483..>1728177
                     /locus_tag="MYCTH_2125169"
                     /db_xref="GeneID:11512129"
     mRNA            join(<1727483..1727488,1727776..1728053,1728141..>1728177)
                     /locus_tag="MYCTH_2125169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661402.1"
                     /db_xref="GeneID:11512129"
     CDS             join(1727483..1727488,1727776..1728053,1728141..1728177)
                     /locus_tag="MYCTH_2125169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661450.1"
                     /db_xref="GeneID:11512129"
                     /db_xref="JGIDB:Spoth2_2125169"
                     /translation="MAAWESGLLSAQDRALVCRQLGDYFGQLRAFKSPDGLICSFGGL
                     PAVDARRMARREGGPFAGEAAYNEFLLSGLVGHPVVRDMIRAQMRADHPTEQRLTLPI
                     NWRL"
     gene            complement(1728421..1730344)
                     /locus_tag="MYCTH_2077546"
                     /db_xref="GeneID:11512130"
     mRNA            complement(join(1728421..1729817,1729935..1730344))
                     /locus_tag="MYCTH_2077546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661403.1"
                     /db_xref="GeneID:11512130"
     CDS             complement(join(1728610..1729817,1729935..1730256))
                     /locus_tag="MYCTH_2077546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661451.1"
                     /db_xref="GeneID:11512130"
                     /db_xref="JGIDB:Spoth2_2077546"
                     /translation="MTPQIRIVVKDRGLFGPELPGKPFVASKAVQPVQQPPRSKRGDL
                     AMLRLGLDIALEYFNSDGSLPISTLTTKARLWADRYFKGYPYASKRPTALLRTFPNLF
                     NLNIEPHLRLVPRTMSPPSSPEPEGTSSRDLRRAERRAMNSEAFPEFAEPTLASDSEI
                     DRIINLPNRRTAPATKPTMRVDAAMLRGSGLMSTLPEFLGQLARANLELETKLATNPE
                     SVRIELDEEQAASQQHVEMNLFSGLVEAQRRRHRRRIVLPGDLDLAVKPPGATQHDGS
                     GQDSGSSGGEQSPPRETSDDEEDSGDETDASTSTTASLRANLKKRKAAASVADEDAEA
                     DSPPNKIRLHYHYPTPKLRHYDMKRRKLVSRPNPDAAPGDPFKALPDKPAAAVRRPAA
                     DESITVATTERPGSSGSDSSSASASSSSSTGPVPITRIRVPSRSPDGSRSSSPDRIIM
                     LRHPVVPSATPSRDASEEPASSSSSSSSSGSSPGRRTKIKVVQRERPDAERRRLIEEV
                     E"
     gene            1732761..1734413
                     /locus_tag="MYCTH_2314543"
                     /db_xref="GeneID:11512131"
     mRNA            join(1732761..1732882,1733128..1733730,1733814..1734413)
                     /locus_tag="MYCTH_2314543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661404.1"
                     /db_xref="GeneID:11512131"
     CDS             join(1733199..1733730,1733814..1734178)
                     /locus_tag="MYCTH_2314543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661452.1"
                     /db_xref="GeneID:11512131"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Spoth2_2314543"
                     /translation="MSMRPSLFTRGLSGLSQSSDPNSPMSSVSSPAEQRIDAKQNFLK
                     AMRPLPTQHYWNVWFDRQQPRDQTQQQEQQQQQGSNNNSSSNGEYHAHLEQLGGSIES
                     VQDFWRYNNNTPVDQIRMRESIYLFKAGFKPIWEDRRNILGGSWTFRVPKSIGPDVWT
                     RVQLLAIGEKLQSVLEEGDQICGVGLSVRFNSHLISVWHRDASRKKSIDNILQCVLEE
                     LPPELRPKPDSYFYKRHSDHAGFKAPPELQAVIDSQRAREAAAKAAQEQQQQQQQQKQ
                     QAAAEKQEQAPDTTQAPSSGTQ"
     gene            complement(1734703..1736065)
                     /locus_tag="MYCTH_2300863"
                     /db_xref="GeneID:11512132"
     mRNA            complement(join(1734703..1735481,1735622..1735842,
                     1735932..1736065))
                     /locus_tag="MYCTH_2300863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661405.1"
                     /db_xref="GeneID:11512132"
     CDS             complement(join(1734950..1735481,1735622..1735842,
                     1735932..1735934))
                     /locus_tag="MYCTH_2300863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661453.1"
                     /db_xref="GeneID:11512132"
                     /db_xref="JGIDB:Spoth2_2300863"
                     /translation="MPPRRRNPAAGASSAAAASSPASKSGARLSKLAKENDITAEEEA
                     EIREAFSLFAEPMEGEKEGVMPIGEVRRALIALGIPPTSPAQLAEFTAALDPEDEGFA
                     TYEGFVGICALQLHARRDNDGYGGYGGDGAEEAHRAELDEAYALFVGDRRGPDAPAIT
                     LADLKRVAALLQLDEESQQKQQQQQVGGRGDSIGGLLTGSKGKAGKGDVPTVVTEELL
                     RDMILEANDGAGVGKGVSKDQFDRVMRRAGVWR"
     gene            complement(1736086..1738163)
                     /locus_tag="MYCTH_2314544"
                     /db_xref="GeneID:11512133"
     mRNA            complement(join(1736086..1736554,1736631..1736910,
                     1736971..1737132,1737193..1737284,1737341..1737551,
                     1737617..1737650,1737714..1737785,1737857..1737944,
                     1738018..1738060,1738129..1738163))
                     /locus_tag="MYCTH_2314544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661406.1"
                     /db_xref="GeneID:11512133"
     CDS             complement(join(1736824..1736910,1736971..1737132,
                     1737193..1737284,1737341..1737551,1737617..1737650,
                     1737714..1737785,1737857..1737944,1738018..1738042))
                     /locus_tag="MYCTH_2314544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661454.1"
                     /db_xref="GeneID:11512133"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="JGIDB:Spoth2_2314544"
                     /translation="MHIQSIPMWVGRSDNYAYLVVDDKSKDAVIIDPAHPAEVAPVLK
                     KAIQNGSINLKAIVNTHHHWDHAGGNEELISELGQPLEIIGGKDCKKVSRTPKHGETF
                     NIGSIAVKALHTPCHTQDSICWFMQDGDDKVVFTGDTLFHGGCGKFFEGTGEEMHKAL
                     NETLGSLPDDTRVFPGHEYTAANAKFGLSVLPSGPLKALEAFAKANKETQGKFTIGDE
                     KQHNVFMRPQDPEIQKATGETDPVAIMTKLREMKNNFK"
     gene            complement(1738482..1740376)
                     /locus_tag="MYCTH_2300873"
                     /db_xref="GeneID:11512134"
     mRNA            complement(join(1738482..1739515,1739798..1740376))
                     /locus_tag="MYCTH_2300873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661407.1"
                     /db_xref="GeneID:11512134"
     CDS             complement(join(1738636..1739515,1739798..1740282))
                     /locus_tag="MYCTH_2300873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661455.1"
                     /db_xref="GeneID:11512134"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="JGIDB:Spoth2_2300873"
                     /translation="MVQYIFTPWRNRRELLAVRRQFYPDRHPQRQPPRRQTPGQAQLS
                     STNTAATAYSTYRATTVNELPPPPLPPPSSSSSSLTTAKQQAVGRRRSHGEKQEAVAR
                     VSMWMQRGGCPHMVESTALLTAAILSDEVTGGPGAGSDDGLARASRAYAVRAAYSAAF
                     SRFVTGLLDSHQDRQRKMSMYDVAKSVGLPATFVELRHQATHEQLPSLARLRAAADKA
                     LDWIWEYYWRGLTAGDSDSDSDEHESDADEDEADASGREESGAEAMEGVLGEGDGDGE
                     NDGPDVTMREEDGCGGSGGGVGDGHKPAQEKEIRTLLEGYLEGNEKQPQEEEEEEEEK
                     LKRELGRFDEGLVLMVLDSITDNTRDSKVLRRALVLGRRILEWKGNQEHVSGADRMEE
                     DGPAGDDSSRTGMDTREKMATEEGEEEDDKEEVEDEEEDEDDRPAWVLYDAETWVPKP
                     IGVV"
     gene            complement(1740691..1742642)
                     /locus_tag="MYCTH_2300877"
                     /db_xref="GeneID:11512135"
     mRNA            complement(join(1740691..1741784,1741866..1742153,
                     1742234..1742316,1742482..1742642))
                     /locus_tag="MYCTH_2300877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661408.1"
                     /db_xref="GeneID:11512135"
     CDS             complement(join(1740823..1741784,1741866..1742153,
                     1742234..1742316,1742482..1742495))
                     /locus_tag="MYCTH_2300877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661456.1"
                     /db_xref="GeneID:11512135"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="JGIDB:Spoth2_2300877"
                     /translation="MASQKKVLMLGAGFVTRPTLDILSDAGIPVTVACRTLASAQQLA
                     AGVKNAHPISLDVTDEKALDAEVAKHDLVISLIPYTFHATVIKSAIRNKKDVVTTSYV
                     SPAMLELDAEAKAAGITVMNEIGLDPGIDHLYAIKTIDEVHREGGKILSFLSYCGGLP
                     APEDSDNPLGYKFSWSSRGVLLALRNAGKWWQDGSVVEVSGKDLMKTAKPYFIYPGFA
                     FVAYPNRDSTQYKERYAIPEAQTIIRGTLRYQGFPQFIKVLVDIGFLEDAPLDVLSRP
                     VPWKEATQAVVGAASSSAADLEAAILSKATFESDEDKQRILSGLRWIGLFSDEPISPK
                     CNPLDTLCATLERKMQYEEGERDLVMLQHKFEIEHKDGSRETRTSTLCEYGDPKGYSA
                     MAKLVGVPCAVAVKQVLSGQLKDKGIVAPMNSRINEPLMKELKEKYGITMVEKTIS"
     gene            complement(1743263..1745368)
                     /locus_tag="MYCTH_111173"
                     /db_xref="GeneID:11512136"
     mRNA            complement(1743263..1745368)
                     /locus_tag="MYCTH_111173"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661409.1"
                     /db_xref="GeneID:11512136"
     CDS             complement(1743866..1745110)
                     /locus_tag="MYCTH_111173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661457.1"
                     /db_xref="GeneID:11512136"
                     /db_xref="JGIDB:Spoth2_111173"
                     /translation="MMPSLVGANMLGMPHQQTAGGTYTVDAFLNQLSRQLIGNTRRYS
                     RGANGQQRGGNGMRISKPGSASNSPRSSTMQARRRTLIGDGFRGGLQTMSPAMEQIPL
                     PTPAAETPNEHFYERQTTRPARPVSWHPSSQNAQQPLYALPDAAAYPYAAYNDAEILA
                     SLQQFPPTPAIYSGYASPAEPFSPLSLPYSSFSSSQQPVYSPVSQPLQMPHQQQAPPF
                     SPVTCSSDHPAAAALSDIPYLPLPQAAAEVPAWEQAQPAVAATFSQQTAPPTPEDFAC
                     SLGPSLAMETAAGQQQPTKPDAAAEQTCQPVIYEEDDDDEPEGEILYGMGLYDAPDHG
                     KELTLHQSVVLSLLGSTRDQEEDGDTGKGLGLKLEDPWEPPASDDEDEGEGEGEGEGE
                     GEGEGEGENENGENDDGQNEED"
     gene            complement(<1751612..>1753456)
                     /locus_tag="MYCTH_2116851"
                     /db_xref="GeneID:11512137"
     mRNA            complement(join(<1751612..1751759,1752057..1752144,
                     1752270..1752324,1752456..1752614,1752775..1753189,
                     1753407..>1753456))
                     /locus_tag="MYCTH_2116851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661410.1"
                     /db_xref="GeneID:11512137"
     CDS             complement(join(1751612..1751759,1752057..1752144,
                     1752270..1752324,1752456..1752614,1752775..1753189,
                     1753407..1753456))
                     /locus_tag="MYCTH_2116851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661458.1"
                     /db_xref="GeneID:11512137"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="JGIDB:Spoth2_2116851"
                     /translation="MKHLILVGACYLDTILTVPHFPAEDSKLRATSVQVRRGGNCPNS
                     LEVLVQLLAAGPRPGLPLKLHLVSCLPDARAAATAKILSSLGADKGAVDCSHCLYREG
                     YEEPASSYVIRSAETGSRTIVNFNDLPEMTAREFEKIADTFVKQGEECWWHFEGRIPE
                     TTLQCIRYLRRVTPKSTISVEVEKPNREGLVELAAEADVVFYSRSWAEPRVQEPRGLS
                     QGRSGVIEEWGAGALSLPSGEYIHHRAAQSEGRVPVIDTIGAGDTFIAAMLYGLHADA
                     WSRETKLSFGVDLATKKVQREGFAGLVP"
     gene            1754314..1756860
                     /locus_tag="MYCTH_2300889"
                     /db_xref="GeneID:11512138"
     mRNA            join(1754314..1754656,1754712..1756218,1756270..1756860)
                     /locus_tag="MYCTH_2300889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661411.1"
                     /db_xref="GeneID:11512138"
     CDS             join(1754576..1754656,1754712..1756218,1756270..1756715)
                     /locus_tag="MYCTH_2300889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661459.1"
                     /db_xref="GeneID:11512138"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="JGIDB:Spoth2_2300889"
                     /translation="MEKTSPKRVSFEDGRSSPSDDDRIPVEVVFDESNPYRRKSSLVA
                     NESIPPHLRREPPPPPKKTECLVHQFLADQWKAHPPAHHRRHNHRGTTTHVDHRFDGT
                     ASREADDISSEVGLERPLDPKNGHFDGHDQVHVHHHKPEEKDRPSTTPPPPSPPPPPQ
                     QQQQQQWERGREEEDQDEDEDEPCHPRATVLRSSLTSSDVDSSSISDDNYDDGGSGSS
                     NTSSHGPGQLDEKHWRRSMVGDSVGGGPGVRSPAPSQLDRRSVSDDAPNSRLLTKKQL
                     SEMAWGVRELSRRLGSMRLKFRVKNIFLLTKIYDPELISKTRELCRWLLDRQRDVRYT
                     IYVDRKLKENRKFDVAGLLEELRQDYVASGEVSEEASWDIAKRLRYWDGDTCRARPHT
                     FDFVITLGGDGTVLYASWLFQRIVPPVLSFALGSLGFLTKFDFEDHQKILTNAFNEGV
                     TVSLRLRFEATVMRSQKRRSRPRQDRQHAGNGADEDHEEPLRDLVEELIGEEKDDEHT
                     HRPDGTYNVLNEVVVDRGPNPTMSSVDIFGDDEHFTSVSADGICVSTPTGSTAYNLAA
                     GGSLCHPENPVMLVTAICAHTLSFRPIILPDTIVLRIGVPYDARTSSWASFDGRERIE
                     LVPGDYVTVSASRYPFACVQPRGRRSEDWVNSISAKLAWNTRQRQKSFKTWEK"
     gene            complement(1757207..1758518)
                     /locus_tag="MYCTH_111172"
                     /db_xref="GeneID:11512139"
     mRNA            complement(join(1757207..1757884,1757987..1758518))
                     /locus_tag="MYCTH_111172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661412.1"
                     /db_xref="GeneID:11512139"
     CDS             complement(join(1757682..1757884,1757987..1758239))
                     /locus_tag="MYCTH_111172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661460.1"
                     /db_xref="GeneID:11512139"
                     /db_xref="JGIDB:Spoth2_111172"
                     /translation="MKQPKSRVYKASGLPATWGHRIWPYLFLFFSPSVSCAQSTSSDQ
                     AILVSLVSYRSLQPLVGVPGRFILLVYPLDTRCLLSPEWSGDGEISFGGRQDVSSLVT
                     ALEGASLNAAAGAASAANAASTASDGAAEGGTSSTAAVSSKPLPLPLYR"
     gene            1759323..1761198
                     /locus_tag="MYCTH_2300892"
                     /db_xref="GeneID:11512140"
     mRNA            join(1759323..1759480,1759618..1759825,1759996..1760092,
                     1760189..1760821,1760878..1761198)
                     /locus_tag="MYCTH_2300892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661413.1"
                     /db_xref="GeneID:11512140"
     CDS             join(1759746..1759825,1759996..1760092,1760189..1760821,
                     1760878..1761171)
                     /locus_tag="MYCTH_2300892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661461.1"
                     /db_xref="GeneID:11512140"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="JGIDB:Spoth2_2300892"
                     /translation="MVKETKLYNLLNVSPAATQDEIKKAYRKAALKWHPDKNPGDNKA
                     AEKFKEVSQAFEILSDPEKRKLYDQFGLEFVLRGGAPPPDAGAGAGGAHPFAGAAGGM
                     PDGFASFFSGAGPGGARTFTSHFTFTDPNDLFRNTFRDAGLGGDFFEDIFGGPRPSAS
                     SAASGASGGERRRARESFGESMRGARATTPEVTTVERPLPISLEDMFSGVTKKMKIKR
                     KMFDETGKRITTDTVLEVPIKPGLKKGSKIRFKGVGDQEEGGQQDLVFIVEEKPHPLF
                     TRDGDDIIHTVDLDLKEALTGWRRTVTTIDGKNLNIEKAGPTQPGSSDSYPGLGMPIS
                     KKPGQRGNFVVKYNVKFPITLSPTQKEQLREIL"
     gene            1761934..1763821
                     /locus_tag="MYCTH_66068"
                     /db_xref="GeneID:11512141"
     mRNA            join(1761934..1762177,1762234..1762262,1762326..1763821)
                     /locus_tag="MYCTH_66068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661414.1"
                     /db_xref="GeneID:11512141"
     CDS             join(1762009..1762177,1762234..1762262,1762326..1763459)
                     /locus_tag="MYCTH_66068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661462.1"
                     /db_xref="GeneID:11512141"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Spoth2_66068"
                     /translation="MPASLRTFTPLLRAARLSLRQSQSPLVSLQRESRTPVLNFARAY
                     AVYERTKPHVNIGTIGHVDHGKTTLSAAITKRQAEKGLANYLDYGSIDKAPEERKRGI
                     TISTSHIEYSTEKRHYSHVDCPGHADYIKNMITGAASMDGAIIVVAASDGQMPQTREH
                     LLLARQVGVQKIVVFVNKVDAIEDAEMLELVEMEMRELLNSYGFDGENTPVVLGSALC
                     ALEGKRPEIGEQKIDELMNAVDEWIPTPERDTEKPFLLSIEDVFSIGGRGTVVSGRVE
                     RGVLKRDADVEIIGKGTEVIKTKVTDIETFKKSCDESRAGDNSGLLLRGVRREDIKRG
                     MVVAAPGTVTAHKKFLLSLYALTKEEGGRHTGFHQNYRPQMFIRSADEACTLTFPEGT
                     EDPDSKMVMPGDNVEMVAEIHKPIALEAGMRVTIREGGRTVATGLITRIIE"
     gene            complement(1763946..1764935)
                     /locus_tag="MYCTH_87600"
                     /db_xref="GeneID:11512142"
     mRNA            complement(join(1763946..1764429,1764538..1764637,
                     1764772..1764935))
                     /locus_tag="MYCTH_87600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661415.1"
                     /db_xref="GeneID:11512142"
     CDS             complement(join(1764421..1764429,1764538..1764637,
                     1764772..1764833))
                     /locus_tag="MYCTH_87600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661463.1"
                     /db_xref="GeneID:11512142"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="JGIDB:Spoth2_87600"
                     /translation="MAHESVWNSRPRNYGKGSRSCRVCNHTAGLIRKYGLNICRQCFR
                     EKAADIGFVKYR"
     gene            1765293..1767041
                     /locus_tag="MYCTH_2300901"
                     /db_xref="GeneID:11512143"
     mRNA            join(1765293..1765904,1765958..1767041)
                     /locus_tag="MYCTH_2300901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661416.1"
                     /db_xref="GeneID:11512143"
     CDS             join(1765391..1765904,1765958..1766553)
                     /locus_tag="MYCTH_2300901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661464.1"
                     /db_xref="GeneID:11512143"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_2300901"
                     /translation="MVLLKSFVLAGLTAVAAAKSAVLDLIPDNFDKVVLKSGKPTLVE
                     FFAPWCGHCKNLAPVYEELALAFEHAKDKVQIAKVDADAERDLGKRFGVQGFPTLKFF
                     DGKSDKPTEYNGGRDLESLSSFITEKTGIRPRKKAAKPSNVVMLTDSTFKNQIGGDKN
                     VLVAFTAPWCGHCKRLAPTWESLADTFASESNVVIAKVDADAETGKRTAAEYGVSGYP
                     TIKFFPAGSTTPEDYNGARSEESFVTFLNEKTGTHRVAGGGLDATAGTVEALDTIVAK
                     LVGGTALAEAAAEAKKVAESLTDEVQAKYAKYYLRVFEKLSKSEEYAAKELARLEGII
                     KKGGLVPTKLDELTIKTNVLRKFVEKATDGEKEEL"
     gene            1767429..1770744
                     /locus_tag="MYCTH_2300902"
                     /db_xref="GeneID:11512144"
     mRNA            1767429..1770744
                     /locus_tag="MYCTH_2300902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661417.1"
                     /db_xref="GeneID:11512144"
     CDS             1767736..1770378
                     /locus_tag="MYCTH_2300902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661465.1"
                     /db_xref="GeneID:11512144"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2300902"
                     /translation="MPQLPRENARLWFFLFLVLVTLMSRNDAPGLIAAPFFGAPRLGR
                     LWAAHSILNSTEWGDFSPGAAKDGAPPWEAPRYLNLTGFRETDGYVWGDLDYFKDRCR
                     QWSRHAYPPPKGAGDWAHGHVWKTWQNATGTVQGKWVRRPGSVTKHARSYNLSAIAPG
                     VHWVDDDDAWGWNVTGSHGTILLRLSEDASDPVYEEKEGDDKRRSSGRMARSISVEAT
                     IQDEDHSASSFVVKLYGVHWPRQGSILLTTTTEKFSGIFGLPHLAPSPEFYRSGQMLL
                     NRTVGEVLSRKEQSRFADASNPWTPLVEEEVSVPVPRCEYVMYLQLHPLDPRFIGKDG
                     VDNKFVPLIDQMERELRFPTGAPSRGKAELRMSLVAWSPDCGYYLESKGPPLFPSVEG
                     NHLVGVKSEVLLSRTKSWMFAFAAVLMAQLWLLKVQMRESNTPSTLARISFHTVAVML
                     LADGLIFACSTTWSLSASNTFLPSLILTFAAFMSMTLGAGFLSEIYKHQEPERRREQA
                     RAADTASPRTTPAAPASTTATTPGTVPPPAPNTATRPPSPPIIIPSDQDIDAEIAENT
                     ARGAAALPTPATATTTAAGPFQAPDVGTFASITGVFVLVGIAILLLIAVSLSWPPRAR
                     SLFFHFLAFAYLSLWIPQIRRNVWRNSRRAFSWRFIVGQSVLRLAPFAYFYLREDNIL
                     FVETDVTAFLVLVGWVWCQLVALAVQDVLGPRFGLPKSWMPEVWEYHPVLRESDVEAG
                     GLPIGLVASLSSPYGGEEGDGSGSAAGSPVVTTAGRTRSWSAGSSSGEVGAQRRERAK
                     ELERHGMMLREIDCAICTEVLEVPVVRANARDPSAAGGLSGVLARRAYMVTPCRHIFH
                     TKCLEGWFRYKLQCPICREELPPL"
     gene            1771577..1772697
                     /locus_tag="MYCTH_2300903"
                     /db_xref="GeneID:11512145"
     mRNA            join(1771577..1771795,1771882..1772697)
                     /locus_tag="MYCTH_2300903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661418.1"
                     /db_xref="GeneID:11512145"
     CDS             join(1771787..1771795,1771882..1772613)
                     /locus_tag="MYCTH_2300903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661466.1"
                     /db_xref="GeneID:11512145"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_2300903"
                     /translation="MSKINTILLDCDNTLVLSEELAFEGCAELINEIAAAKNVPLEKP
                     FTGESLIVEFVGQNFRGMLLSLQKRYGFPLTDAELEDYVRREEDVVIAKLKEKLVSCP
                     GVDDVLAKLAASGEYKLAVVSSSALRRVQASVDKVGQSKYFGGDIFSAATSLPKPTSK
                     PDPAIYLHAMEKLGKKADECVAVEDSKSGTLSGTRAGIKVIGYVGPYKEAEREKMVKV
                     LTEAGAVIIMHDWSEFEDCLAKVQRGEV"
     gene            complement(1772698..1774699)
                     /locus_tag="MYCTH_2300905"
                     /db_xref="GeneID:11512146"
     mRNA            complement(join(1772698..1773866,1774008..1774042,
                     1774190..1774699))
                     /locus_tag="MYCTH_2300905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661419.1"
                     /db_xref="GeneID:11512146"
     CDS             complement(join(1772782..1773866,1774008..1774042,
                     1774190..1774518))
                     /locus_tag="MYCTH_2300905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661467.1"
                     /db_xref="GeneID:11512146"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="JGIDB:Spoth2_2300905"
                     /translation="MPAPTLDQVIFPEPVHHNLSRILGDLKRSNLSITNRLRSISQDA
                     AFVEQVADALRLPLIANERCGSWYIDPARKAGSAYFKSTDGHTGQWKFSLRRLNLHLL
                     PLIGENNGIIIVDSTRRGKRMPDALSKTVPTWCAVLNRALFPSLADSHELYTPPNAVS
                     ASEASQIAALLPAFVSSFLSLQLDLAPLRAQLGGRPLRPFWVTQEDDLSVLADGPLGA
                     AHRRRDGDGDGDGDLAGFHPVVCCTASRRVVGTGTEAAEAGGYIQGAGDDTENWALGL
                     TAGIFWRWKEDLLAAGEGELPDLIGELVAREDRERRRGEGGVLKEVVKGKGLFVGLLG
                     AEVGEEACVVRLVPKATAREGWVKGKRCLEVGIGKSRAASRLLRDALGQVCEFVLAYL
                     REPDPVGKDAPQKKAVVVLCETGKDLSVGVALAIYCWCFDDAGNVREDDGTEVSFNKA
                     GIRVRLGHIVTAFPEANPNRATLQSVNSFLMD"
     gene            1777622..1780285
                     /locus_tag="MYCTH_2300906"
                     /db_xref="GeneID:11512147"
     mRNA            join(1777622..1777755,1777825..1778070,1778143..1780285)
                     /locus_tag="MYCTH_2300906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661420.1"
                     /db_xref="GeneID:11512147"
     CDS             join(1777952..1778070,1778143..1780141)
                     /locus_tag="MYCTH_2300906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661468.1"
                     /db_xref="GeneID:11512147"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2300906"
                     /translation="MASTMDPALPPTLPADASGDAPRRKRRSSKKVKSGCASCKQRRI
                     KCGEERPECYNCRRSGRVCAGYPPPPRSARPFEEIKIAPKPIAADTASAPPPNHRPVQ
                     LPPRRLTKPYRRTTPPMTPGAAGAPVMLYRPSVSLPFTDQEGQYFHLFREQTASELSG
                     FFDSTFWTRSVLQECHSAPAIRHAVVALGALYKTLEKSNESPPTSPYPDRDPGDNAMR
                     HWEMAFRQYSNACNALVKAETADSTSNRTRLMASVLLACFDSFVGDHKQAIVQIQAGL
                     GLLERLRAQRKSAFLSASDEPVEEELTQMFTRLAIQAKSYDMAFHFPQPWVVRLTSSQ
                     GQDPGSPASDASSPIGISQEPIPDRFASVMEARLAWDRLCERIFRFTEIMFAHAQNGV
                     MGVLPASLQQYGVSFKKDIEAWSHAFEHILASRTAPGVSSQEKAAIAVLKMFQTMGKI
                     LFLMTFSDSEMHFDNFTPYFKTIVELALEVVGDEERRAAAKRCPDPAFCRHQSRCAPN
                     IFGGREYAARHIKPSFSADLGIVPPLYVVATKCRDPHIRRQAIQLLRSSARREGMWDS
                     ELTARIGTWIAEVEEEDARLFDSTYGNTMPTPGSSPVETNARPYAGGDSPHSRSRSEF
                     ADGQWGRSVSPSAASSRASSSSTHSLQQNQAKTIPIPEEKRVMVRAVEFDLRERSAVI
                     QLGSRNLKTGTPDLKTRVTRITW"
     gene            1782629..1783270
                     /locus_tag="MYCTH_2314555"
                     /db_xref="GeneID:11512148"
     mRNA            join(1782629..1782834,1782900..1783270)
                     /locus_tag="MYCTH_2314555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661421.1"
                     /db_xref="GeneID:11512148"
     CDS             join(1782713..1782834,1782900..1782993)
                     /locus_tag="MYCTH_2314555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661469.1"
                     /db_xref="GeneID:11512148"
                     /db_xref="JGIDB:Spoth2_2314555"
                     /translation="MDTIKQAGNYVSDKISSATHAASKEANKDVAKNENANIGTRVQA
                     AGDAVADKVKEHKDDASAEANKQAATH"
     gene            1786850..1788751
                     /locus_tag="MYCTH_2300911"
                     /db_xref="GeneID:11512149"
     mRNA            join(1786850..1787283,1787343..1788751)
                     /locus_tag="MYCTH_2300911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661422.1"
                     /db_xref="GeneID:11512149"
     CDS             join(1786885..1787283,1787343..1788578)
                     /locus_tag="MYCTH_2300911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661470.1"
                     /db_xref="GeneID:11512149"
                     /db_xref="JGIDB:Spoth2_2300911"
                     /translation="MHADAVTAVFIAPYTQLVFGVEIAIRALRKKPFAPRGKYNVSIC
                     LSTVGMLLLANFLIADFDRSPNFCLSSLFWFVAHYSVLCFGLLVAITSIVLGSALTLF
                     VRLYRSIKIEVTARVAASRMVYYLALAAISDSFMIPFFFVQGFRNDRRQFGNALDLAM
                     IASVVANVSGLMTGGLYLFLKSSTMSTIGPRDKVGEYENTRARYKITRQYSNDSDNSD
                     DDNYDRHIMNPVTGPRSLRRVTSEEILMGTEKEEEVLDSRAPLQSRGQSRDSVRSNKL
                     VSAVASVLLPKAPEPARISSTSAGTHARKRPYSLFPRGAVASKASMLLPATTYSPADS
                     LKPPPSMANLADIRHRRDSSLVSSATVQIGLRLSSVDDMPPLAQTKPAADDSVVHTLD
                     CPNVPNNPSMRSPKRAGTIAVRSATRPAPTVSTAPTQPAEKTDNNGQREPVQDARMGR
                     LPAFPKTDSQVPSIEAAKEKGEFTLSPKIYSPSSPNKAKLQSPQDVGFGVPPGSKLPG
                     GRSRSNSNSPPRSPPRRRDTGNTTSPLPTVAKSDWI"
     gene            complement(1789862..1793752)
                     /locus_tag="MYCTH_2300913"
                     /db_xref="GeneID:11512150"
     mRNA            complement(join(1789862..1790787,1790862..1791280,
                     1791352..1792185,1792258..1792346,1792402..1792532,
                     1792614..1793752))
                     /locus_tag="MYCTH_2300913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661423.1"
                     /db_xref="GeneID:11512150"
     CDS             complement(join(1789878..1790787,1790862..1791280,
                     1791352..1792185,1792258..1792346,1792402..1792532,
                     1792614..1793695))
                     /locus_tag="MYCTH_2300913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661471.1"
                     /db_xref="GeneID:11512150"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="JGIDB:Spoth2_2300913"
                     /translation="MNALWSSSASADGAAGGEKPSADTPAEETKAGPTEDTSPAEPAT
                     SNGPENEKAPKRPGLRRNHPSVPPPPVPTAPSSSSSFYSSFPSSDSNTKDEITDDSKN
                     NNSGSRSSSSSQNGSSSPPAPARERQAQSLPQSKQQQQQQQQQQLGQGQPPQDSLSLA
                     QLRRIVAEFPRAEPIAYDYVYADMAPLEEEVDEWFMYNFWQWVRLNAANRAFYSAWAR
                     LFPPPPPPPPPAATSAGAAADSGKGSGGTPPAPKWDRADEEGEEEAAERKRVFVRALL
                     EGFRSSDRIARAEAIGAVVYLVLGRWTETVKAAGVLGAAVLEGKARSAATPQQLEAMK
                     EGVRLVAECGGLELVWEALRAVFELFWSDDLPQNVQMVAEELIHLMTILYMAMQEALD
                     DPEGMAEVRQRLLALNPSLTSFLLQVVVKLRWDETGILPQTQIFLLFWKSILLVFGGS
                     KDLAEAKKATSEMIGCDDKNIITASPLDYHAFRQEITSKYPAYIPPQPLLPLEPDQNT
                     IIPPLPNHPTRNNAANGIHPGPPGPGGGASILHQPVHIATPAPSPPPSPGVGGKGGKK
                     QNYQTNQNFPFMYPPLDATSNSAGGKGGAALQDLLVGRKWEGSDVPASILEAGELFSK
                     RVRMSRATRQLWEEREEFLKFERGYDADDDIVDELDLSSLTLEEREELGLAKASDDKP
                     RKPSNSGPDYGPRGISQQIKERLDAVEGFYKEALPHLQSLVIVFLRQITAMTSNLVSP
                     QNANGPQGPPSARPNGGQQNGHNGPNGGSKGDPSSPLDADVDELRSREIAAKAVTGTL
                     ILLLKWFKLSHVLKFEYMTQLLLDLNYLPMALKIFAMYDVQQVVESRTDRLEHSFFYF
                     CGSRAGVIPQQHSVPNPTATDFEDISDDDAAPPPIKRRRSPPNAHSEAGASSSSTDPS
                     SNASSASSSSSSSSSSSTTNEPPPRPEVDELGYPINPLPAEPITDFSRRNFFSLINYL
                     RIMQKICKHRAHRNLLMVQYKSSNILRKSLKVPQHELRLYTLKLFKNQVPYTGRKWRQ
                     SNMRVITAVYLHCRPELRDEWLVGSAVEDQVDEAVPLEQALRSLTHWFNLRRYPDRMA
                     GAGPGGAAMLRQAMKEEHDFFVRELEKADWSWLSDGGAPAGANGGAGGDEAGGPEGSM
                     GWEEGSWG"
     gene            complement(1794100..1795787)
                     /locus_tag="MYCTH_2300915"
                     /db_xref="GeneID:11512151"
     mRNA            complement(1794100..1795787)
                     /locus_tag="MYCTH_2300915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661424.1"
                     /db_xref="GeneID:11512151"
     CDS             complement(1794425..1795582)
                     /locus_tag="MYCTH_2300915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661472.1"
                     /db_xref="GeneID:11512151"
                     /db_xref="JGIDB:Spoth2_2300915"
                     /translation="MFELPDAKRYVCRPPSLTLGSQGRAHATTAVPATDGLTNRVRRE
                     DLFDSASERHSSPELQDEEAAELRAKLNERLAGLLSISIPPPPPAAPAPAPAPEPEPG
                     PEPAETAADADAEDSGEEPQRPQQREGGAKQGADKLEFEFRLFSTPAGAPAPATTSGT
                     GAGASAPPPQKVVQKVVLLPDDEAEAPFDGPAIAPRPLSHYIRGELSEREREQFRRAA
                     VTGREVLSWAAQRAWGLEVPWRVTRVTVSVGSGSAQGSRLGGGGTRGEDPGVVEVEGR
                     RKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRR
                     QKEREKKMAARAAGAAATATATATAATAGGDKEGRGPSASASASEGSDGED"
     gene            complement(<1797200..>1799650)
                     /locus_tag="MYCTH_46530"
                     /db_xref="GeneID:11512152"
     mRNA            complement(join(<1797200..1798193,1798349..1798720,
                     1798815..>1799650))
                     /locus_tag="MYCTH_46530"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661425.1"
                     /db_xref="GeneID:11512152"
     CDS             complement(join(1797200..1798193,1798349..1798720,
                     1798815..1799650))
                     /locus_tag="MYCTH_46530"
                     /note="Contains conserved domains NDT80_PhoG[pfam05224]
                     NDT80 / PhoG like DNA-binding family and PAT1[pfam09770],
                     necessary for accurate chromosome transmission"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661473.1"
                     /db_xref="GeneID:11512152"
                     /db_xref="InterPro:IPR007888"
                     /db_xref="JGIDB:Spoth2_46530"
                     /translation="MAELRAESQHGGMWSNYGNPVQMTGRFNPQDPSVSVAPPASSHL
                     VRPRSHTMDYPQYQPGRPGQEEGEPYDRYPHPSLNIPSINTLKRPYSQVDQAPYTEMV
                     QDLREDYKPPNHDQKLLSFKKVGDKHTIVDAKGRIHEIEIEAQLHGMFFLSEFPSTTG
                     DGNVLNAELTCYRRNLFQISGSICFPQIPLSVLLESGETSQIKNMEVSISAIESVDGH
                     PVRLIVIPWKTPPPNSPETSQAPDQEPPTLPLIPPSEDEEESGGDHYAIYPIGWRRLQ
                     FRIATANNGRRKELQQHFVLHLKLHGTLANGQKLVLSELTTAPIVVRGRSPRNFQARK
                     EIPLLGSSAGSRGQTLVETGHGIVAQAVILNKPPYDSRPRLSSLDVPRSAFTFTAPKQ
                     MPQSPMQMRSNSYPTAWNPPPQVSMPHTPGSASYTTSTMPPDPYPKMPLSGAPAFTAE
                     PQEMPMQPSSMGPSVQLPLSASHDPHQHQHQPQHHPHPHAHAHAHAHAQQQQPTQPPI
                     RTQFATYTSAPPNHLSLSSTTGGGSTTSPDNSLAVPRHIGDANPRPSKSPRHASHQSV
                     TSSISNETASGEYRYGPPPPQPQAAPASGYPAPPPETSPQSHHPALPPPPQGTAGGYG
                     APAADNGAGGANPAAAAAAAAAAARDYIPASQGWAAAATAPGAAGSGDPANPGGDRPY
                     GYPATAGGSAGGPPHAVKTDGHPHAGAAAAAAAVGQAGAAQAGYGYTWNAA"
     gene            complement(<1804512..>1806002)
                     /locus_tag="MYCTH_2125192"
                     /db_xref="GeneID:11512153"
     mRNA            complement(join(<1804512..1804675,1804807..1804964,
                     1805672..1805754,1805874..>1806002))
                     /locus_tag="MYCTH_2125192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661426.1"
                     /db_xref="GeneID:11512153"
     CDS             complement(join(1804512..1804675,1804807..1804964,
                     1805672..1805754,1805874..1806002))
                     /locus_tag="MYCTH_2125192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661474.1"
                     /db_xref="GeneID:11512153"
                     /db_xref="JGIDB:Spoth2_2125192"
                     /translation="MPSRTHWHFASNVVPALGEHQLPGAPDAWGERVNVHDERLFGLS
                     PGQAKAMSRPAVPGKTSGLSSCGVLVLHGTARYGPSQHLRLLSSYGIGQGVLLCVENY
                     EESTSQQEKPLDGQALRAPLRVANPHSHSWLKREAAKKCAYIKEQFLQNDTNVNLTWI
                     ILNRCHIATIGDERNPS"
     gene            complement(1811960..1814750)
                     /locus_tag="MYCTH_2300922"
                     /db_xref="GeneID:11512154"
     mRNA            complement(join(1811960..1813679,1813768..1814750))
                     /locus_tag="MYCTH_2300922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661427.1"
                     /db_xref="GeneID:11512154"
     CDS             complement(join(1812151..1813679,1813768..1814374))
                     /locus_tag="MYCTH_2300922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661475.1"
                     /db_xref="GeneID:11512154"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="JGIDB:Spoth2_2300922"
                     /translation="MADDLDDPRDAELITLAAIYPEIQQMHPDDPYGIALEVPVNPSK
                     PVNVFFRASADDDALSQAPNGAPSDAAAGSNQQGAVAVDSHELAYLPPVRLEITLGPN
                     YPAEQPPQVRVSTSPSWIPVETIKRLEDDASRLWEELGRGIVGFTYIDHVQQAAADAF
                     GLVDGRGSLELDSRYRTAILGHDISARKAAFDNETFGCGVCLEPKKGSVCHRMLDCGH
                     VFCVDCLQGFYNAAIREGDIAAVICLEPNCAKDRAKAASPGSKRKRVRTFIHPSELLQ
                     IPLDQDVVKRYLMLKYKIELESDRSTVYCPRKWCNGAARSKKHKKPQGLELPEASDKS
                     ASEGEEEDDKDSPEGEDKPKTRERLAICEECSFAFCARCLQSWHGELNFCPGSREERL
                     AAAELASLEYIRLHTTPCPKCGVPAQKIQGCNHMLCSRCGTHFCYLCSTRLDPANPYR
                     HFNTPPTAARSEPCYMRLWELGEGDGADVPGFERVAWGPAHPARGAPAMAHAREVIPE
                     RGRPREEAHADRNGAAAAPAQGGHANGGGEVVGIAREGPLVLRIAADPPAVPGRGGPD
                     GRQPAPAAAAAGRGAQRGAALREPGAARNQPAARGGGRLRQQQQQQHQHQQAARGAGA
                     DAGGAAAARRGRRRGGGAAAAAPGHRQHNNIRADRGARGQRRNHDLADAWDMGWDGEL
                     APAHEEWVRQFVLLALNDEEHLLFGEDED"
     gene            1815722..1816969
                     /locus_tag="MYCTH_2300923"
                     /db_xref="GeneID:11512155"
     mRNA            join(1815722..1815876,1816026..1816969)
                     /locus_tag="MYCTH_2300923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661428.1"
                     /db_xref="GeneID:11512155"
     CDS             join(1815817..1815876,1816026..1816895)
                     /locus_tag="MYCTH_2300923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661476.1"
                     /db_xref="GeneID:11512155"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="JGIDB:Spoth2_2300923"
                     /translation="MAADDDITPLASLSLTHVYYNPTDPLSTASAFLSLLPQALCVVY
                     ATLLWSTREAEVLLMFLGQLACEAINFALKRLIKEERPPRLGVGKGYGMPSSHAQFAA
                     FWAVALALFLCVRHRPARLGPPRRPPRLRLGGRAVVPPGKGDRAAATVADGNRNGNGN
                     GDAEPRLSDVHRAYVSGGLAAASRSIEAYSHSHWTMAQRVVVSAGALLVAGLVAWSRV
                     YLGYHTVRQVVAGSAAGAGCAAAWFAVTYLMRETGMVAWALELPPARWFRMRDLVVEE
                     DLCQAGWEKWQEKRQLALEREQSRERVREKKGQ"
     gene            complement(1816985..1818214)
                     /locus_tag="MYCTH_2300924"
                     /db_xref="GeneID:11512156"
     mRNA            complement(join(1816985..1817006,1817063..1817521,
                     1817619..1818214))
                     /locus_tag="MYCTH_2300924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661429.1"
                     /db_xref="GeneID:11512156"
     CDS             complement(join(1817131..1817521,1817619..1818088))
                     /locus_tag="MYCTH_2300924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661477.1"
                     /db_xref="GeneID:11512156"
                     /db_xref="JGIDB:Spoth2_2300924"
                     /translation="MGAAKGIALRGLMFLLRAIQFCCAAIVLALFSYFLATLTNHNMH
                     IPTWARAVAGISGVGVLYTILALLMLCCVPGRSFPSFITMVLDVAFIGGFIYIATANR
                     GGASSCNGEVDTVYGKGDANTNVVDNGSGGFTALPSLRTACKMESACLAVSIVAVILF
                     AITPFVSLALVRHRRKEARFGPSPANNYTEGYGRRKRFNWFGLGRKRTAPVDGIPDPN
                     ALPQHSTPEDLRNSYATEQTRVGSGGGYGGLGNGSTKSPYGAGNDIPLGSYPNGSAGY
                     RYDNPGVYHR"
     gene            1821151..1824993
                     /locus_tag="MYCTH_2300931"
                     /db_xref="GeneID:11512157"
     mRNA            join(1821151..1821493,1821634..1822543,1822595..1822789,
                     1822848..1823805,1823874..1824035,1824141..1824993)
                     /locus_tag="MYCTH_2300931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661430.1"
                     /db_xref="GeneID:11512157"
     CDS             join(1821270..1821493,1821634..1822543,1822595..1822789,
                     1822848..1823805,1823874..1824035,1824141..1824865)
                     /locus_tag="MYCTH_2300931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661478.1"
                     /db_xref="GeneID:11512157"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_2300931"
                     /translation="MRTKATLLTGLLSLAAQTGRADPTWPAATDHMEEIVFQLQGFKG
                     SLFNDIITPCNNEAAGPGRITASEWLRVGFHDMAPHNRYFGTGGLDGSLQFELNNGEN
                     TGPGHRTTLEFLANYLSSRSSLADLIAAGVYASVRSCGGPIVPLRLGRKDAITAGSAG
                     VPQPQNSVVTFRQQFDRMGFTPTEMIQLVACGHTLGAVHSTEFPQIVPANVGQIPFDT
                     TNATFDNRVATEYVSGNTQNPLVVGASIGVGRNSDFKVYNSDQNVTITTLTDPDVFRD
                     TCRVVLQKMIDVVPAGVTLTDPIAPYAVKPVDMQLTLNSGGTTFLLTGHIRVRTTELP
                     ASSIKNVVLTWKDRNGGNDCGSSSTCSTTSTLQGVATGFDDTFGFFPIEATIPVASGI
                     SSFTLVLNLNDGSSRTYDNNGNSYPMSDAVILQKPQSCLLQGPGALTVSALLRNDLSN
                     LPVNLVVSYLTPRNTPDDNPVPALNEATVQMTKGDCVGPYTFYSGSFTIPGGLSYNAR
                     ISVTAGSNVTAYTDDFNKASDLSGTCGTFTGGATCSDVTPPSTSSVTSSTSTSSSSAS
                     VTSTTSGSSSSTASTTASTTASPTPAVKPTVGGYVFVSCWTEGTGVRALSGATFAYDE
                     MTLESCMANCTGFDYWATEYGRECYCGNSLHPSSSEAPVEECNMVCGGDPTEFCGAGN
                     RLELYSTTATRTTSATPTPTGTLAVKPTVGDYTFVGCQTEAATGRALSGKEVYADDSM
                     TLEKCATYCAGFTYFGTEYGRECFCGNSLNAGSVPAPEAECDMVCAGDPFEYCGAGNR
                     LELYRLSSVSSTAGPSSEAATTSTTTGPATSTTIPSRAPTVSPFTHVGCWTEGAGVRA
                     LAAKTYASADNMTLENCAAFCTGYRYFGTEYAAECYCGNALAATSSNASLADCSMPCS
                     GDPAQYCGGPNRLELYEDPTVPPAPTAQPTQPATVTATATGAGGSTTWTWHGCMTEAT
                     GVRALGKASTASDELTLEACAAFCEGHAFFGAEYGRECYCGDEFAEGAVEAPEQADCS
                     MPCAGDATQLCGDGNRLSVYAKAEPAA"
     gene            complement(<1828901..>1829286)
                     /locus_tag="MYCTH_2125197"
                     /db_xref="GeneID:11512158"
     mRNA            complement(join(<1828901..1829012,1829099..>1829286))
                     /locus_tag="MYCTH_2125197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661431.1"
                     /db_xref="GeneID:11512158"
     CDS             complement(join(1828901..1829012,1829099..1829286))
                     /locus_tag="MYCTH_2125197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661479.1"
                     /db_xref="GeneID:11512158"
                     /db_xref="JGIDB:Spoth2_2125197"
                     /translation="MPRQEALACITREFRIVSQQGARDESSLSSDPWLGHGPPLHNAG
                     SAGPHKKTTKITGSFPPVLTVLAVGKKRSMPHSAKRRVEKPISAPRLIAEPRPHV"
     gene            1829820..1833925
                     /locus_tag="MYCTH_2300935"
                     /db_xref="GeneID:11512159"
     mRNA            join(1829820..1830476,1830754..1830953,1831195..1831679,
                     1831745..1833925)
                     /locus_tag="MYCTH_2300935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661432.1"
                     /db_xref="GeneID:11512159"
     CDS             join(1830178..1830476,1830754..1830953,1831195..1831679,
                     1831745..1833568)
                     /locus_tag="MYCTH_2300935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661480.1"
                     /db_xref="GeneID:11512159"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2300935"
                     /translation="MSDHGDSPSPRSSSGPAGSVSPPPAPATAPTSTASTETAASPKK
                     RMSGSTEGKVTKRRAARACVSCRARKVRCDVVEGAPCGNCRWDDVECIVQESRRRKKN
                     LPYNCGPAAVGARAGTAEALRTKSIGAAPPVITANLTKPAFAPNGSFSLPLNGVDGGQ
                     AAGGLLYQQTPGGFGTPGSAAASAALTGFPPVAPGIAASPALLHPLLRTAFEQASEWP
                     AFIKPFPDRVLAEDRQYLAQKQVFSLPSLPLQNALIAAFIEYVYPYMPLLELHDFLRV
                     VNDRSGASGKISLFLYHAVMFSATAFVDETLLKDAGYASRRDARRAFFSRTRLLYDFD
                     YETDRLILVQGLLLMTYWYETPDDQKDTWHWMGVAISLAHTIGLHRDPAKTPMIPRKQ
                     KLWKRVWWSCLMRDRLVALGMRRPTRIKSEDFDVPPLNEDDFDIDPLPAENTLLGPEC
                     ALIRDVGMQRELAVMCIEKAKLCMLIGDMLRVQYSVLSRSGVRPEHTINSTHMLLPNK
                     NPENMQEVEKVDQNLRDWFAGLPEPCRYRPLDSVTITDANKVIAVQRNLLHMIYHTTV
                     SALHRPLFLPASPTEGPRTPVEVQETARKRVREAAEHITRMAAEMRQHSLDRFLPTTG
                     VTVILPAMIVHMLDTKSLDPDTRANAVRGLKECLVVMTNLRNIYAAADFATGFLDALL
                     RKGMLGQAPQPQPPQPTPPLVAMPGARPGKILNRVLAPALNLVPERPSTPPPENVFLN
                     LRTASNNNNANNNNNGTTASSLFPPQSHHGPIATTQAFMPNVSDDAGDPSALAAAVGA
                     TTPPHTDSEDVDMDVDVSMADEVMGNGGSSSSNGGTGLDFTAGTPAGLGGTSGDSTAP
                     GLLAGAGAGAGAGAGGNNFDFDQWLQFPAEGGLSTSDDSFMGGMFSAGPGDHPHQAGL
                     EMGGGEGAIEQWMSLPEGISH"
     gene            1835180..1838405
                     /locus_tag="MYCTH_2300938"
                     /db_xref="GeneID:11512160"
     mRNA            1835180..1838405
                     /locus_tag="MYCTH_2300938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661433.1"
                     /db_xref="GeneID:11512160"
     CDS             1835452..1838316
                     /locus_tag="MYCTH_2300938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661481.1"
                     /db_xref="GeneID:11512160"
                     /db_xref="InterPro:IPR003108"
                     /db_xref="JGIDB:Spoth2_2300938"
                     /translation="MNESPSARTPGLSAPSRGRRLRSTSESSPTRQRNTDDLLSNLTP
                     RTVVDAFRNPSGSLKACIEAATPAEQAFALRVAIASNTIHEWLSELSSWPWPAGGGSA
                     GFEMPADKRKAIPGLGTSQASDQEYNGSLPAADVARYEKRIDEIAQGLEELNIEEIKS
                     QVLNNHILPLSRPGTPVIDSGRSAMSLSSITRLGDLTALVTATTLQALPELSRLTKLM
                     NAWSLRLLVLRKIPVFLASVSDAEAALQSGWNALGPDRRIQSGSTGAPSAVSPLDDLE
                     VMKSVIGQKVAKAGRDLDAMLDILEGQPDTLPEDWIDRVDTLEHGYGEWTVACDRKMK
                     QTDLISSIVQAAPATGASVPPQHSEADRSGPSVAANKSLASDSLEREQTQVPEGERPP
                     DGAQKPDSRPDVSPPVIKIQSTTEDQAQTPEDDYPNTDSELVQSASDGSSGAGPHTVL
                     ASEPSKAHHNHGARPEDAPGSSFSSDSELWDISGHGAPQPAQSGRRASGVSESSTVLN
                     EAPSMFMDSFSSDLLDQGVSDSFDHGRVDQEEGPNRSLLSTRSRSVSFNDHPTVTELP
                     SFPSPPGTPTTSTTLDDDDATEPGTPSERQMPGMDDQLQQQISEILESVPAKIRLTAE
                     PPAVNLNPPDFKMPTARRSSRSDAIPRTQSNGSMRSVYSRSATPSFTLAPARNSRPRH
                     QRDNREIKVYHLSRSNGEALIKLFIRCVGEHGERVMVRVGGGWADLGEYLKEYASHHL
                     RRSAGAATDGKVEVRDIPRTGSVRPPDATPPSRPASAMDAHSPVSPLKVRKTRRSPTV
                     NSDEQNHQQLPAAIRPKTPLANLGRLDATPPSDASSSMRSRSSSRISWEEDDGTFALG
                     MAGPRAKQIEMSEESRAWVESIKEKVRIASSERKPPPPPPPSSSFSSVPSVAGAEGGA
                     AAGGVKGLEASLMDRGDGSGRTTFGELGKVGSTKRLFKRG"
     gene            complement(<1839014..>1840290)
                     /locus_tag="MYCTH_100838"
                     /db_xref="GeneID:11512161"
     mRNA            complement(join(<1839014..1839074,1839120..1839656,
                     1839773..1839877,1839952..1840114,1840218..>1840290))
                     /locus_tag="MYCTH_100838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661434.1"
                     /db_xref="GeneID:11512161"
     CDS             complement(join(1839014..1839074,1839120..1839656,
                     1839773..1839877,1839952..1840114,1840218..1840290))
                     /locus_tag="MYCTH_100838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661482.1"
                     /db_xref="GeneID:11512161"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="JGIDB:Spoth2_100838"
                     /translation="MKSLLTFLPLASVALGAPSLWGRQAAITEEQLNELELYVQWAAA
                     AACNGNQAPNQPVICNPTLCSRFASHNATVVASFIGPETDIWGFIGLDPVDERIVVSF
                     RGSSSIQNWITDFDIIQRPCNLTDDCLVHTGFDRAWEEVANEVLNGLTAAAAAHPSYR
                     IAVTGHSLGGAVATVTAAHVRRAGFQADLYTYGSPRVGNEAFADFVTRQPGAEYRVTH
                     ADDPVPRLPPLCLNYRHTSPEYWIDPDDKDVVSIDEIRYCPGYSNTDCNGGTAGLDTS
                     AHGWYFQNLSGCAQEISRYAEMDVKLAANLNAQGQP"
     gene            <1843191..>1846185
                     /locus_tag="MYCTH_2059579"
                     /db_xref="GeneID:11512162"
     mRNA            join(<1843191..1843444,1843598..1844025,1844108..1845753,
                     1845802..>1846185)
                     /locus_tag="MYCTH_2059579"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003661435.1"
                     /db_xref="GeneID:11512162"
     CDS             join(1843191..1843444,1843598..1844025,1844108..1845753,
                     1845802..1846185)
                     /locus_tag="MYCTH_2059579"
                     /note="CAZy_ID 267948"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003661483.1"
                     /db_xref="GeneID:11512162"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="JGIDB:Spoth2_2059579"
                     /translation="MVYRASAVWLSLVLSLSAPPTLARTIGPRDKVPEGFYAAPYYPT
                     PHGGWLDSWKDAYAKAHALVSRMTLAEKTNITSGVGIFMGMPCVGNTGSADRLSFPQL
                     CLQDSALGVASADNVTAFPPGITTGATWDKALMYARGVAIGREFRGKGANVHLGPSVG
                     PIGRKPLGGRNWEGFGADPVLQAKAAALHIKGVQEQGVIATVKHLIGNEQEMFRMYNP
                     FQPGYSANIDDRTLHELYLWPFAEAVHAGVGAVMTAYNAVNGSASSQNSYLINGLLKD
                     ELGFQGMVMSDWLSHISGVGSALAGLDLNMPGDTNVPLFGFSLWQYELTRSVLNGSVP
                     LDRLNDMATRVVAAWYKMRQDKDFPRPNFSSNTRDRNGLLYPAAIFSPIGQVNWFVNV
                     QEDHYKIARQVAQDAITLLKNDGSLLPLTGSGKITVFGTGAQVNPAGPNACLNRACNK
                     GTLGMGWGSGVADYPYFDDPITAIRKRVPDVEFHNSDEFPLFFTGEAPAPDDVAVVFI
                     SSDAGENSFTVENNHGDRDADKLAAWHGGDGLVKKVADKFPNVVVVAHTVGPLILEPW
                     IDHPSVKAVLFAHLPGQEAGESLAGVLFGDVSPSGHLPYSITRAETDYPDSIAKLKGF
                     TLGQVQDTYSEGLYIDYRWLNKRSIKPRFAFGHGLSYTTFAFTNATIRAVTAPLDPIP
                     PPRPSKLPTPSYPTDLPAASEAYYPDGFKPIWRYLYSWLPKSEADAAWAIGATGKQKY
                     AYPDGYSTTQKPGPAAGGGEGGHPALWDVAWEVDVTKKTTGGVGGPGGLPRFFPGPAR
                     ASVQAYVQYPPGIPYDTPPVQLRDFEKTPPLAPGESQTVTLRLTRKDVSVWDVELQNW
                     VVPGATLGGGGKGPGRYTIWIGEASDQLFLACYTDTGKCEQGLEPPV"
     gene            complement(1847084..1848558)
                     /locus_tag="MYCTH_2300943"
                     /db_xref="GeneID:11512163"
     mRNA            complement(join(1847084..1847283,1847364..1847739,
                     1847811..1848052,1848129..1848558))
                     /locus_tag="MYCTH_2300943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661436.1"
                     /db_xref="GeneID:11512163"
     CDS             complement(join(1847216..1847283,1847364..1847739,
                     1847811..1848052,1848129..1848474))
                     /locus_tag="MYCTH_2300943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661484.1"
                     /db_xref="GeneID:11512163"
                     /db_xref="JGIDB:Spoth2_2300943"
                     /translation="MPHQLPHLSQLSHSTGHPSSAQSRPFNSPVDENRGSRSQQQEQQ
                     HELNATVEAWIDHVIKAGGQTIIMPDGPDSLPTAELVVTPRQSNKRQRQASIDFRNDD
                     LDDLETTPRPLQFCRDQTLSDVQSTSTADTNGTSRSGRSSPRKKEVALRRTLDWPIAR
                     VNITELKSIPAMLESLALDLKKIADGRQSLIPDIFRESMSADAGIFDQPHPDWFYTAR
                     DGLEELRAVHRQMRRICRNSRKCKDKMEYTPAWNDLVHCRVLEEALEGQDAVDFRNIT
                     LCHTLKAFHDDDPALRENKADYGIFLQPARGGDGLSERLSDLASEGQADRGFRATRQL
                     GARPLPTAC"
     gene            complement(1848686..1849870)
                     /locus_tag="MYCTH_2300945"
                     /db_xref="GeneID:11512164"
     mRNA            complement(join(1848686..1849496,1849580..1849870))
                     /locus_tag="MYCTH_2300945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661437.1"
                     /db_xref="GeneID:11512164"
     CDS             complement(join(1849142..1849496,1849580..1849692))
                     /locus_tag="MYCTH_2300945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661485.1"
                     /db_xref="GeneID:11512164"
                     /db_xref="JGIDB:Spoth2_2300945"
                     /translation="MPSVSLQPPLLLQGALRRVTAQLLPRRLPAPTKSTTARTFSHLP
                     SLRPTLAAPSPIFRAPNINSTPSTTTTAATMLASTPTGEVLDVVAKSSVTSHPALAGC
                     GSQIRCGPRPTMSGASRLIQKRRHGFLARKRSRTGRNILKRRMAKGRKKLSHG"
     gene            complement(1849895..1851654)
                     /locus_tag="MYCTH_2300946"
                     /db_xref="GeneID:11510291"
     mRNA            complement(join(1849895..1850520,1850572..1851501,
                     1851562..1851654))
                     /locus_tag="MYCTH_2300946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661438.1"
                     /db_xref="GeneID:11510291"
     CDS             complement(join(1850080..1850520,1850572..1851501,
                     1851562..1851576))
                     /locus_tag="MYCTH_2300946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661486.1"
                     /db_xref="GeneID:11510291"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="JGIDB:Spoth2_2300946"
                     /translation="MDFLQRLARFLDRPLFPWKKLIIGFSIGQYVFEAFLGYRQYKVL
                     QKTKPPKVLEHEVSQEVFDKSQAYGRAKAKFTGVNGLYGQLQNLAFYHFDVLPKLWSW
                     TGSLLLRFAPARFTGEISHSIVFILAFIVIQQILSLPSSIYNTFVLEEKFGFNKQTPK
                     LFISDLIKTNILAFVLAPPILAGFLSIIKKTGSQFFYYLWLFGAALQVFMITIYPIAI
                     LPLFNKLSPLEEGKLKTDVEDLAKKLKFPLHELYVIDGSKRSAHSNAYFFGLPWKKHI
                     VIYDTLIEKSENDEVVAVLAHELGHWSLGHTTKLFGISQAHFFYIFALFSVFVNNNSL
                     YADFGFSNQHPIIIGFLLFSDILGPLDNVIKLLMNILSRRFEFQADAFANKLGYNIQL
                     ARSLIKLQIQNLSTMDADWMFASYHFSHPILTERLKALNWQPTEKVEAKGGDKTEDKE
                     GIATATGRDEL"
     gene            complement(1851826..1852333)
                     /locus_tag="MYCTH_2300949"
                     /db_xref="GeneID:11510292"
     mRNA            complement(join(1851826..1852151,1852202..1852333))
                     /locus_tag="MYCTH_2300949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661439.1"
                     /db_xref="GeneID:11510292"
     CDS             complement(join(1852068..1852151,1852202..1852279))
                     /locus_tag="MYCTH_2300949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661487.1"
                     /db_xref="GeneID:11510292"
                     /db_xref="JGIDB:Spoth2_2300949"
                     /translation="MFPQEPDPKGDPERWTTEELRRWLAARNLHPQSSDTRQQLLERV
                     QANMRISRN"
     gene            1852802..1853657
                     /locus_tag="MYCTH_79440"
                     /db_xref="GeneID:11510293"
     mRNA            join(1852802..1852897,1852967..1853000,1853075..1853203,
                     1853273..1853657)
                     /locus_tag="MYCTH_79440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661440.1"
                     /db_xref="GeneID:11510293"
     CDS             join(1852868..1852897,1852967..1853000,1853075..1853203,
                     1853273..1853322)
                     /locus_tag="MYCTH_79440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661488.1"
                     /db_xref="GeneID:11510293"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="JGIDB:Spoth2_79440"
                     /translation="MPQEIGDIKKFIEICRRKDASSARIKKNPKTQQIKFKVRCQRFL
                     YTLVLKDSEKAEKLKQSLPPNLQIKDVPKRNKRSSS"
     gene            complement(<1854021..>1854275)
                     /locus_tag="MYCTH_2032845"
                     /db_xref="GeneID:11510294"
     mRNA            complement(<1854021..>1854275)
                     /locus_tag="MYCTH_2032845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661441.1"
                     /db_xref="GeneID:11510294"
     CDS             complement(<1854021..>1854275)
                     /locus_tag="MYCTH_2032845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661489.1"
                     /db_xref="GeneID:11510294"
                     /db_xref="JGIDB:Spoth2_2032845"
                     /translation="PVTEFALLHLTTPSPHLPDSIRASLAAATRLQDAWHAKAFPALP
                     SSAVDRAALWFPQVEDPSWLMTTAKWDSVAAHWDWIRSEEN"
     gene            1855534..1857732
                     /locus_tag="MYCTH_66022"
                     /db_xref="GeneID:11510295"
     mRNA            join(1855534..1856104,1856172..1857732)
                     /locus_tag="MYCTH_66022"
                     /product="mevalonate kinase like protein"
                     /transcript_id="XM_003661442.1"
                     /db_xref="GeneID:11510295"
     CDS             join(1855814..1856104,1856172..1857455)
                     /locus_tag="MYCTH_66022"
                     /note="orthologue of Saccharomyces cerevisiae Erg12"
                     /codon_start=1
                     /product="mevalonate kinase like protein"
                     /protein_id="XP_003661490.1"
                     /db_xref="GeneID:11510295"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="JGIDB:Spoth2_66022"
                     /translation="MDAMTTQRASNGAPNSHKGHNGVHSDSEPDSISTEASDATLESV
                     DGVNGITNGTINLKINPRRSMKRKQSSPMMPAFMVSAPGKVIVFGEHAVVHGKAAIAA
                     AISLRSYLLVTTLSKSKRTVTLKFPDIDFDHCWNIDELPWATFQQPSKKKYYYSLVTE
                     LDPDLVAAIQPLLADVSPDKPPNIRKVHQNSAGAFLYMFLSLGSQSFPGCQYTLRSTI
                     PIGAGLGSSATIAVCMSAALLLQLRTLSGPHPDQPPEEARIQIERINRWAYVYEMFIH
                     GNPSGVDNTVATQGKAVVFQRTDYGKPPSVRPLWDFPELPLLLVDTKVPKSTAHEVAK
                     VGKLRNTHPKIVGSILDAIDKVTEASAEVLTEAGFDTQSEADLARVGELMTINHGLLV
                     SLGVSHPRLERVRELVDHQGIGWTKLTGAGGGGCCITLLKPGVDRSKLDKLEEQLDEE
                     HFQKFETTLGGDGVGVLWPAVLKNGMDEDEQGGMEIDLEKFLSAEGNEGVERLVGVHG
                     GGGEREGWKFWRVDNN"
     gene            1858014..1860305
                     /locus_tag="MYCTH_2300958"
                     /db_xref="GeneID:11510296"
     mRNA            join(1858014..1858144,1858345..1859142,1859250..1860305)
                     /locus_tag="MYCTH_2300958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661443.1"
                     /db_xref="GeneID:11510296"
     CDS             join(1858099..1858144,1858345..1859142,1859250..1860142)
                     /locus_tag="MYCTH_2300958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661491.1"
                     /db_xref="GeneID:11510296"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="JGIDB:Spoth2_2300958"
                     /translation="MPPNAKVASKPKASETSKPPQSTTTGATPAASTSHTAPPTAINH
                     PALPTQPGNPQTDHDRSQTRFSLSALSRADQVAWLAARIASRLAARPALSSGTTTTTT
                     ATATTAATVARLACGGGPKTLKEVWRVVNERSAPLRAPRPKGRKAVEEEDEEEEEKKK
                     KKKEEKEGLRTGEDEARWERKVVLSCLAVQSCCFRARRERERQGQAEEKTGEAAVVTE
                     QEVFEETRRRREMAALRKELYGGGVGKAGKLAADPEWDDVQPVVLEEPEGALAAIAYP
                     ADYAEAMAYLRAVMQAKEYSPRCLRLTEHIIAMNPAHYTVWLYRASIVFALQLPIPDE
                     ITWLNRVALENLKNYQIWHHRHLLVENYYPTIASDPSAVASFAASERSFLQRILAEDT
                     KNYHVWSYRSYLVNKLDLFNDGDELASIEAMLDDDVRNNSAWSHRFFLVFSNPDYATP
                     GSAATEADPGVPQAVVDREVEYAQDKIRLAPQNQSGWNYLRGVLVKGGRKLGSVEQFA
                     SEFVKGLGEGGEEGKEEVLSTHALDLLAEIYAEKGDKEKADLSLRRLGQKWDRIRVGY
                     WEWRRKCLEATA"
     gene            complement(1860305..1861697)
                     /locus_tag="MYCTH_2300961"
                     /db_xref="GeneID:11510297"
     mRNA            complement(join(1860305..1861114,1861268..1861697))
                     /locus_tag="MYCTH_2300961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661444.1"
                     /db_xref="GeneID:11510297"
     CDS             complement(join(1860597..1861114,1861268..1861313))
                     /locus_tag="MYCTH_2300961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661492.1"
                     /db_xref="GeneID:11510297"
                     /db_xref="JGIDB:Spoth2_2300961"
                     /translation="MSANSHETNVRCSCEAAKNFVDWYYRQINEGKSISQGYVNGHAA
                     YERAGHPPADICINGLVVSTPQEWEKLLEQQRQAPKQPDPNKRRVRYEVEGHNVHVIN
                     ADYRFGAPQKVLDLHSPTDGVRMMMSVTVFGTVYFGTGKNKGDEYWEKRDFYDSFILV
                     PNWDVIEKPGVRHGRKYLIISHNYRAN"
     gene            complement(1861855..1862715)
                     /locus_tag="MYCTH_2142956"
                     /db_xref="GeneID:11510298"
     mRNA            complement(join(1861855..1862297,1862357..1862715))
                     /locus_tag="MYCTH_2142956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661445.1"
                     /db_xref="GeneID:11510298"
     CDS             complement(join(1861975..1862297,1862357..1862477))
                     /locus_tag="MYCTH_2142956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661493.1"
                     /db_xref="GeneID:11510298"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="JGIDB:Spoth2_2142956"
                     /translation="MDNVAGLASTIGNRFVTNLKGSFANMTPEQMIRLVIIVGAYLLL
                     RPYLVKLGARAQMKAHEAEEARAEAAAKAKMSANELRGRVEIPDDTDDEDEASAKASG
                     PEWGKRARRRQREMIKKLLAAEEQRLRESQEELEDKDIEEFLVKE"
     gene            <1863057..>1863611
                     /locus_tag="MYCTH_27758"
                     /db_xref="GeneID:11510299"
     mRNA            join(<1863057..1863089,1863219..1863342,1863454..>1863611)
                     /locus_tag="MYCTH_27758"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661446.1"
                     /db_xref="GeneID:11510299"
     CDS             join(1863057..1863089,1863219..1863342,1863454..>1863611)
                     /locus_tag="MYCTH_27758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661494.1"
                     /db_xref="GeneID:11510299"
                     /db_xref="JGIDB:Spoth2_27758"
                     /translation="MADLQDEEVQERLKAALWYSIGKIVDQESLQRNRNATPQFIGAL
                     TDMVWHQIETVATDLESFAQHAGRTTVTTDDVLLLARRNQDLYSVIKDTIDKERAAKI
                     KAK"
     gene            complement(1863896..1866124)
                     /locus_tag="MYCTH_2300968"
                     /db_xref="GeneID:11510300"
     mRNA            complement(join(1863896..1865229,1865282..1865442,
                     1865500..1865820,1865892..1866124))
                     /locus_tag="MYCTH_2300968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661447.1"
                     /db_xref="GeneID:11510300"
     CDS             complement(join(1864011..1865229,1865282..1865442,
                     1865500..1865820,1865892..1865927))
                     /locus_tag="MYCTH_2300968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661495.1"
                     /db_xref="GeneID:11510300"
                     /db_xref="JGIDB:Spoth2_2300968"
                     /translation="MGRLGPMTSLGLGRSPYDEVVPGEGPEDPRAPRQQYDERGRPIN
                     PETKRINRDVIRSHNEVMMVIGVAEPENSLVDAQAEAAREQQRYEDRVGRTLLLYGGV
                     LNTAAIWGVNGMRQRILLYKPYSQTTFYGMFRMAWSRQSLGPYLFGGLPSFLVSTLLE
                     QLPALGVIKKTPLTRYATAYIRLHLAIYAFFQRTGVVPFRNWLPNWRFFVPGSSLSPI
                     CLPPAPTSFRPRGILQWLGAFALAAAPFAGFYLYTKFYTILTRALRYTIHQRLPRPYN
                     SSKRRRDWAPLSREDPDFDFVEQQTDENPPTTPPTTTTNTTTTTTTTPTTTDPSPSAV
                     LRRQSTISLRGGSGSNNNNNNNNNNNNADQPAPAQDDFASEDEDTDIISATLISFDVE
                     ATDPTSPDAGPHSSGSNAANHHNHTGGDATPGVWSAELRPSLADGSRSGGAAGLPGSR
                     GGGRDPLYRETVLTRLPAILATDVLAITPARLAMLPFAVSVWLGLTRPYMARMGMSLD
                     GVLEGAGRWWGLSSARGLVNMLGLELLLAVMQGEAWAVIMLAADRYRISEEEWRRRVE
                     ARREEREREERI"
     gene            1866276..1869121
                     /locus_tag="MYCTH_2300969"
                     /db_xref="GeneID:11510301"
     mRNA            1866276..1869121
                     /locus_tag="MYCTH_2300969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661448.1"
                     /db_xref="GeneID:11510301"
     CDS             1866349..1869078
                     /locus_tag="MYCTH_2300969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661496.1"
                     /db_xref="GeneID:11510301"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="JGIDB:Spoth2_2300969"
                     /translation="MATKQAVKTTFEVENVIQPIFTGGSVALENGARILASTLGEAAI
                     LTELNTGKRLAEIEGDGEPISTLTITPSASHLIVCSRSLTMRIYSLKVSPDFDSVEAT
                     LVRTTKPHATPVVVLAVDRTSTLLATGAADGAIKIWDIVGGYVTHTVSGQSVLVSALH
                     FFEIAATAEGTSERKSKKGSRKGQNDQSEADVASKFRLAWGTQDGRIRIFDLHKRTTI
                     SVYADPKRKKEAHESNVQSIQYSPEQHALLSGSRDKTMTLWLWRDGAWQGTPMLRHEL
                     VESVGFLHEGRWMYAAGSSGLLRIWDTTTRHEITAKQDAKSEAEAILSAVCLPHQSLI
                     LCAQSDFTLALYRVPSPADVTSSGSLVLELFRRISGTHDEILDFTYVAPDQSLMAIAT
                     NSEDIRLVSVAETETQADGEEGGAYFGHDVALLKGHEDIVMSLDVDWSGHWVASGAKD
                     NTARLWRIDKANNSYTCYATFTGHLESVGAVALPKVVPPENSEAFKNPLDHPPPFLIS
                     GSQDRFVQKRDIPRQSQKAKASSSLKRLAHEKDINALDVSPTGRLFASASQDKTVKIW
                     DVERLEVQGILRGHKRGVWTVKFAPLHTPAIQGEQGSVSGRGVILTGSGDKTIKLWNL
                     SDYTCLRTFEGHSHNVLKVVWLRIPTEETTTKKRVQFASAGADSLVKVWDANLGETEC
                     TLDNHEDRLWTLAVHPKTNTLVSGGSDSKITFWKDTTAETQAAAASAALKLVEQEQEL
                     ENYIHAGAYRDAIVLALQLNHPGRLLNLFTNVVTGTTPEEGSLTGLRAVDDVLASLSD
                     EQIFLLLLRLRDWNTNARTAPVAQRILWALVRSYPADKFSNLSVKGARGQKSLNEVLN
                     ALRVYTERHYKRMEELVDESYLVEYTLQEMDSLAPPALEGGEQDGGDAVMAEA"
     gene            1869384..1871399
                     /locus_tag="MYCTH_2300970"
                     /db_xref="GeneID:11510302"
     mRNA            1869384..1871399
                     /locus_tag="MYCTH_2300970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661449.1"
                     /db_xref="GeneID:11510302"
     CDS             1869594..1871267
                     /locus_tag="MYCTH_2300970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661497.1"
                     /db_xref="GeneID:11510302"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2300970"
                     /translation="MSKRQASEALDDVSADSPASKKSRFDDYTMDVIPASAEDGDDEQ
                     TRPAHENGVVKQDGNGDADEFSEEEEEEEVEEKAPIRQSAPTAGYDDLYLDTIDRNVL
                     DFDFEKLCSVTLSNINVYACLVCGKYYQGRGPKSHAYFHALDEDHHVFINMSTQKVYV
                     LPEGYEVKSKSLDDIKYVSDPRYTRQEVAEFDRKPRTSLTLAGKEYTPGFVGMNNIKE
                     NDYLNVVVQALSHVAPLRNFFLLEDFSSAPELVKRTSILFRKIWNPRAFKAHVSPHEL
                     LQEVSLRSNKRFTLTAQSDPVDFLSWFLNNLHLGLGGSKTKPGSSPIQRIFQGKLKVE
                     SQAITARTDTHDDRLRFEEASEIKTDIARFLLLTLDLPPAPLFQDEEQRNIIPQVPLT
                     TILAKYNGVTSQELNAQRKRYRLVHPLPPFLILHVKRFSRNRFVSERNPTIVTFDPHN
                     LDVSPYVEPDPAYHPPGEPIWYDLVANVVHEAVRAKEDVADSAVGEERKTWKVQLRDK
                     ATDEWVVAQDLFVDKIRSELLYLGETYLQVWERRRGPPPQGPAPGARAL"
     gene            complement(1871435..1873491)
                     /locus_tag="MYCTH_2314567"
                     /db_xref="GeneID:11510303"
     mRNA            complement(join(1871435..1872169,1872228..1873058,
                     1873125..1873491))
                     /locus_tag="MYCTH_2314567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661450.1"
                     /db_xref="GeneID:11510303"
     CDS             complement(join(1871911..1872169,1872228..1873058,
                     1873125..1873153))
                     /locus_tag="MYCTH_2314567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661498.1"
                     /db_xref="GeneID:11510303"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Spoth2_2314567"
                     /translation="MDNLWSRRANSSKLSLSTGSGQDSPSGRNSSFKRFGGDSSSLGK
                     HTFGSVTTPGGSLASPIGGASSAFGLGSGAFASFGSAKTPKTPKSPGNPFDAALGAAA
                     KTPTAEKSAKDGASGGKSISKPAFATSLKEAGKTATPSAGPSTHQLRNCWVFWFRPPI
                     SKANGFIEYEKTLHPIAAVDCVEHFFKIYQHLKRPSTLPLVSDYHLFKKGICPIWEDE
                     ENKNGGKWVVRLRKGVADRYWEDLLLAVIGDQFGEASEEVCGVVLSVRNGEDILSIWA
                     RANGQRVLKIRETMRRILSFPPDTKLEWKSHDSSIQQRTAIEESRREKANQHHHGDKR
                     SSNKQHQQQHSQQQQQQQQQQQQQQQQADDQKNPTNSS"
     gene            1875123..1877893
                     /locus_tag="MYCTH_2300974"
                     /db_xref="GeneID:11510304"
     mRNA            1875123..1877893
                     /locus_tag="MYCTH_2300974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661451.1"
                     /db_xref="GeneID:11510304"
     CDS             1875456..1877561
                     /locus_tag="MYCTH_2300974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661499.1"
                     /db_xref="GeneID:11510304"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="JGIDB:Spoth2_2300974"
                     /translation="MGEFLPSLELPPEAVKNHAMEKITDKIAALPAGQHYFSLEFFPP
                     KTAMGFSNLRGRLDRMARALRPLFVNVTWGAGGSTAVKSLELAEICQRELGLTTCLHL
                     TCTNMSRRLIDKALDDAKALGIRNILALRGDPPRRAEYLDVSEPEPDEEEEFSWAVDL
                     VRYIRKMHGDYFCIGVAAYPEGHADESHPLGQSLEHDLPYLVEKTRAGADFIMTQLFF
                     DIEAYKHFEKTLREHPSGAFKDIPIIPGLMPIQSYQMIKRTTKLSHAKIPEPLMARLD
                     AVRNDDEKVKEVGVDIVSELVEQIKEIKSRTGGPRGFHFYTLNLEKAVSFIVERTGLI
                     APLTPEEAEGAAVDRNPLPDVRFLRINGLTPEQSSHDHPHLRRKPSVGSDPRDRVIVQ
                     ERSASHPDWEATPLEASVPAEPINSRANTLAISEGEGVLGREATWDDFPNGRWGDARS
                     PAYGQIDGYGVSLHVTVAQARQLWGAPATPRDVSDIFIRHLRGELPTIPWSEESFSPE
                     TDKIRDRLVALNSKGWWTLASQPAVNGLRSSDPVFGWGPQNGFVFQKAFVEFFLPSKD
                     WEVLEQKLKRPEMKNAVCFYATNARGDFVSSDTVLPPPPPPTAAAPAEQREASTNAVT
                     WGVFPGKEIVTPTIIEEVSFRAWSEEAFGIWREWAKIYPRGSDSERFLEAVRADTWLV
                     NIIHHDYVDPDALWDFLLG"
     gene            complement(1878609..1880827)
                     /locus_tag="MYCTH_2300975"
                     /db_xref="GeneID:11510305"
     mRNA            complement(join(1878609..1879990,1880173..1880322,
                     1880574..1880827))
                     /locus_tag="MYCTH_2300975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661452.1"
                     /db_xref="GeneID:11510305"
     CDS             complement(join(1878744..1879990,1880173..1880322,
                     1880574..1880679))
                     /locus_tag="MYCTH_2300975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661500.1"
                     /db_xref="GeneID:11510305"
                     /db_xref="JGIDB:Spoth2_2300975"
                     /translation="MPPKERAANFKTYEAQSRLLAALVASLEGHRFDYKKIAQYHGGG
                     VTESAMEHKFRLARAQAELIKVMVANDRDPGDYDIPNLTKAEIQKFFGASTPDGVGFQ
                     FRGIKRGSDVLKAAVENGDDPVDAFARFLRGGSSAAGSAPATPSTTKRARTTKAAAPG
                     SGATPSSKRHKAIKIEPELDDDEDSPEIDYSELDTTPTKTKAKPARSAQIQAKSAPGT
                     RAPTPRHVPIAPAPPRSAAASPAPPSYNLAPIPGVASASLPNGYINMATGLGYNVMAP
                     PTSMDSAAPFTAGSQAMGMAQARRGSAYSTGSYTAASSPATPNMSWQDPTPSPMSNAA
                     SVNNMHNMGDMSLNMGGQYPAVPGTADVTSGMTVSMASLDAATTMSTSSNMPSFNASA
                     VHAAPSPSESSFDMITQPTATSSSATGAATPGMYATAKSTEASQEFLPSQGYGSASRH
                     VAPVNGHSSHSNSGGYSNFDQHEAELAAQVDFGGFEVQDEESDYDDAGEI"
     gene            complement(1882852..1884708)
                     /locus_tag="MYCTH_2300978"
                     /db_xref="GeneID:11510306"
     mRNA            complement(join(1882852..1883423,1883495..1883701,
                     1883806..1884708))
                     /locus_tag="MYCTH_2300978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661453.1"
                     /db_xref="GeneID:11510306"
     CDS             complement(join(1882949..1883423,1883495..1883701,
                     1883806..1883981))
                     /locus_tag="MYCTH_2300978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661501.1"
                     /db_xref="GeneID:11510306"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Spoth2_2300978"
                     /translation="MDSIGGLFTTLSGYLTPAFLVLSPVLSYSDQAYSMYRTRTSAGF
                     SLDIPLIMLVASLLRIFYYPGARYDNALLAQSCVMVAMQVVLLKIGLDYRPPPYSRGG
                     DAAVPFARVNEMRRPFDFWQWRSPKPYWQFLLGLLAALVVCELLLAPVPSVYQTYSSL
                     IGVVGLSVEATLPIPQILANMRSRSCKGFRLSVLASWLIGDSMKMFWFFTSTTSIPIA
                     FKVCGMFQAACDSFLGVQYMMYGDGGPASKEHASPTWQHELQSNGFSTASGHTRTPGR
                     RTSTTEKTI"
     gene            complement(1894415..1895152)
                     /locus_tag="MYCTH_2300982"
                     /db_xref="GeneID:11510307"
     mRNA            complement(1894415..1895152)
                     /locus_tag="MYCTH_2300982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661454.1"
                     /db_xref="GeneID:11510307"
     CDS             complement(1894431..1894937)
                     /locus_tag="MYCTH_2300982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661502.1"
                     /db_xref="GeneID:11510307"
                     /db_xref="JGIDB:Spoth2_2300982"
                     /translation="MTGIRAVSQCRFVRLLLLGIARWASVEPIGDWDPKEEPVSCAQT
                     LLGKTGRQNGVVPNSLNCNGQPRCVSFLLFWKFGHRLFRPIQREQATQGGLLGCNTGF
                     FSPGIPRAPRLGRAGTRRRPLSTSQRSAVRAPRRRSQRRLNSSGGQSGACKAQVRFRD
                     YLAGYLLG"
     gene            1896521..1898833
                     /locus_tag="MYCTH_2300984"
                     /db_xref="GeneID:11510308"
     mRNA            join(1896521..1897907,1897984..1898430,1898512..1898833)
                     /locus_tag="MYCTH_2300984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661455.1"
                     /db_xref="GeneID:11510308"
     CDS             join(1896820..1897907,1897984..1898430,1898512..1898533)
                     /locus_tag="MYCTH_2300984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661503.1"
                     /db_xref="GeneID:11510308"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2300984"
                     /translation="MGFTTVLEPRLRSAIPDTPPEVLTPDSASFPLRQFERAPPSPPM
                     SNYEPTVKATDMSSGKGPEESSTAHRESSADRSGSGAPREQLPSLSSLFGPSSQTPLL
                     HSPFSDRPGHYSASSSPLDYPPRPTVGSSSYFQPPGSSASQTRSLLESKLPDRPQIPP
                     LSSMFPRPLSPVPRQEQQRLEHGSGNQWSSVRHDANREYSLGSRDPHQYYQPPPLDRY
                     SSHLPSGRGDGRRADFREQPAPQTPAPTNPPATPTSSVGSEVPPVKDGLGPRIWTGTH
                     FLPRFVRAAEVPGEGMCYFYDDGSHCKTVIDGEAVNAHWGVTKAGKPRKRLAIACVTC
                     REKKIKCDPDYPRCLQCEKFGRVCKFKNAPRGGHNNNAPSTPPADQEEMRRLGSGTAS
                     RPTTESGSNSSTTTTNNNHNSSSNQQYHYPRPDSHSSGSVSPRTTTAHRPASPDPAGS
                     GPRKLARVGYNHYSPTTGRVSPLTPTPEAAQRSTSTTYSWRQPETLPRIHDDVLRRTW
                     QAESRPDARV"
     gene            1900745..>1902847
                     /locus_tag="MYCTH_115198"
                     /db_xref="GeneID:11510309"
     mRNA            join(1900745..1901305,1901724..>1902847)
                     /locus_tag="MYCTH_115198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661456.1"
                     /db_xref="GeneID:11510309"
     CDS             join(1901245..1901305,1901724..1902847)
                     /locus_tag="MYCTH_115198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661504.1"
                     /db_xref="GeneID:11510309"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_115198"
                     /translation="MAQRTPRFPTRPVAQLLGSNGPVHAVTYSASPGTYILTGSSDRS
                     IRLYNPSSTTPTPSNAASNSITSRSSSNSSSSNGINTSGGSPLSPPPAGRLIQTYNSH
                     AHSVLSLAVSASNATFCSAGGDRAVLLWDVATAQTIRRFGSASTAHSHAGRVNAVCFA
                     GADDSLVVSGGLDCTVRLWDVRSGGGGGGGGGGGAAVQVLRDARDAVTSLAVCGAEVL
                     AGSVDGRVRAYDVRMGRCVTDVFPGSVTSLCLAADGRTVLVGTLDSKIRLMDRRDGAC
                     LRTFSDPAWRNDELRVQSVLGGRERFVVAGDEMVDAPEGTGSDGRVWAWDLLTGKLVV
                     TLSVPWGGSGGENRKRVIGRDGKEKERKNVVSCIAWKEGGFGDQFCVGGTSGVVTVFG
                     EA"
     gene            complement(1902967..1904819)
                     /locus_tag="MYCTH_2300989"
                     /db_xref="GeneID:11510310"
     mRNA            complement(join(1902967..1903324,1903388..1904006,
                     1904056..1904316,1904372..1904819))
                     /locus_tag="MYCTH_2300989"
                     /product="glycosyltransferase family 15 protein"
                     /transcript_id="XM_003661457.1"
                     /db_xref="GeneID:11510310"
     CDS             complement(join(1903168..1903324,1903388..1904006,
                     1904056..1904316,1904372..1904522))
                     /locus_tag="MYCTH_2300989"
                     /note="CAZy_ID 267947"
                     /codon_start=1
                     /product="glycosyltransferase family 15 protein"
                     /protein_id="XP_003661505.1"
                     /db_xref="GeneID:11510310"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="JGIDB:Spoth2_2300989"
                     /translation="MAVARPVRALALTGVVLWCFFVWQLFKPTGSPKSPARVPLLSRE
                     RDPNLDPTGEPEGVLTYASGEYAPGPAGTARINATLLALVRNEELDGMLQSMRDLERT
                     WNHKFNYPWTFFNDVPFTEEFKQKTQAETKAECRYELIPKEHWEVPSWINNDLFTESI
                     KILKEKEVQYADKVSYHQMCRWNSGLFYKHPALENTQYYWRVEPNVHFFCDVDYDVFR
                     YMRDNNKTYGFTINLYDSPESIPTLWPETVKFINEHPEYVHEHNAMNWLTDKTRRPSH
                     NEKANGYSTCHFWSNFEIADMSFWRSKAYEDYFNHLDRAGGFFYERWGDAPVHSIALG
                     LFEDKHRIHWFRDIGYQHIPFFNCPNSPKCKGCVTGRFTDGEAWLHDEDCRPLWFKFV
                     GMG"
     gene            1904967..1908278
                     /locus_tag="MYCTH_2300990"
                     /db_xref="GeneID:11510311"
     mRNA            join(1904967..1905420,1905480..1908278)
                     /locus_tag="MYCTH_2300990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661458.1"
                     /db_xref="GeneID:11510311"
     CDS             join(1905352..1905420,1905480..1908170)
                     /locus_tag="MYCTH_2300990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661506.1"
                     /db_xref="GeneID:11510311"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="JGIDB:Spoth2_2300990"
                     /translation="MAHLAQLGALIDDLVAAVAAIPTSQHERRVACREAVLRSLRSHT
                     FTRTNHFEVEDRLNGLEERFSVVGRDGLAEALRARRDALESCRDQFTPEVLHLLLELA
                     DQPAQKSNLNDLDALVEPEEEAPPPLTWRDIAKEDGWKQEKDIWRFVDYSLGSSDEED
                     VDWQSEASAESLTTASSADDQRHRTAHDLAIKPQGTDLLMRVHDAQGWRHASAVDENG
                     RPKKIPVSTTQFFREALFMLAGLETSLFDTRCSPITKYQLRGVSWESYKALATAFSEC
                     GRKLAPLRAYVENREHSPLLQVFQDCLQEALRSLDLELSSIQARVVAAEEDVVVSLIG
                     VLEELGPKLAPLYVLADIVCQVQEERNPHAFRYLELLYDAVGMAQLRDSRATYTLLGT
                     IFLDCFQVYLKPIRLWMEEGKLLQGDRTFFVLESPTKLPLSQVWKGQFNLLRTPEGNL
                     YAPRFLKPAIDRIFTAGKSIVVLKHMKQHEATKKYQATAEPKMDFATVCPDDLEYAPF
                     GELFGLAFQAWVQSKHHTAAATLRELLFSSYGLSESLHALHHLYLMSDGARSDSFASS
                     IFRHLDNFSNSWRDRFTLTEIAQEAFSACVDTYRLSADIDSRGLTHSALACRNSVRIS
                     LPAIRLHYRLSWPVQIVITEEGIRGYQTLFTFQLQARRALSILRHPIAPLQRRDGGSR
                     GTAGMARYYLLRSKLLWFANAIVTYLTTLVFAPNTARLQADLRSSTSAATTPTSTTPT
                     TADVDDMIATHAAFVSRIVEESCQGAKLRPIRDAMLDIFDLAIRLADVQRAEVAKLEE
                     EEMEISRLSVMSSPFKASPARKGRDGGRKRRSVLDEDGDVDDEDEGGLAAQWMVGKKG
                     GSDEGKPHAVVLKELEADFERHLRFVTSGLRGVARASKEEAAAKWDLLAEMLEAGIKE
                     STTIH"
     gene            complement(1909059..1909881)
                     /locus_tag="MYCTH_2077636"
                     /db_xref="GeneID:11510312"
     mRNA            complement(1909059..1909881)
                     /locus_tag="MYCTH_2077636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661459.1"
                     /db_xref="GeneID:11510312"
     CDS             complement(1909144..1909797)
                     /locus_tag="MYCTH_2077636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661507.1"
                     /db_xref="GeneID:11510312"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Spoth2_2077636"
                     /translation="MAIFLRFEPNTLERRLSHRFATPIPEERQFSWIKEIASAASWLE
                     RLDFFHGDLRPENILLDETEHVKVCDFGRAQKRGCKVEAATYPFYRPCKNAAAGPAHE
                     QFAIGSCIYTIRTGEVPYGQWETPEEFKKMYEALLRGEYPPTEDDGVFGHIVSSCWHL
                     NYDSMEDVEAAIQRVVGMLCEEGSAVRLSREEHDFCVRKCQEFLARQRQEYKGSNVV"
     gene            1910574..1911711
                     /locus_tag="MYCTH_2300993"
                     /db_xref="GeneID:11510313"
     mRNA            1910574..1911711
                     /locus_tag="MYCTH_2300993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661460.1"
                     /db_xref="GeneID:11510313"
     CDS             1910638..1911402
                     /locus_tag="MYCTH_2300993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661508.1"
                     /db_xref="GeneID:11510313"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2300993"
                     /translation="MSHNEPWPPLPPDVDTTKLEVEMPELAVSANSTLYRVKGQPSTV
                     YKFRGHPREYQLQKAAGDCAIPVRGRVLGKSTVGTGHVVFFGFLMDLAAPIPKTLSLP
                     QRRDIMHQMIRTIQQLHAKRIVHGDIKLENMLLDSRGKLRLCDFAEGRYLDEDERVWE
                     GNSTWHFESPNRLRRGEGLGHRLPPPIIEGDLYGLGLSIWQLYTGRTPHEDMVIDDLG
                     LKERQRNGQTVNVAEVGDPEARDIIAKLLCRGGARI"
     gene            1912241..1913673
                     /locus_tag="MYCTH_2300994"
                     /db_xref="GeneID:11510314"
     mRNA            1912241..1913673
                     /locus_tag="MYCTH_2300994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661461.1"
                     /db_xref="GeneID:11510314"
     CDS             1912458..1913387
                     /locus_tag="MYCTH_2300994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661509.1"
                     /db_xref="GeneID:11510314"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="JGIDB:Spoth2_2300994"
                     /translation="MSERKVLTKYYPPDFDPSLVGRARKPKTQGPKVQTVRLMAPFSL
                     RCVSCGEYMYRGRKFNARKETPPGEKYLGIQLYRFYIRCTRCSAEIVFRTDPKNQDYV
                     VERGAKRNTDPWKRGLDGGQEEEETVEQRLDRLEREMAEAEGEEERNAMAELEAKTED
                     AKREMAVADALDEIRNRNARLERAQREGGADVLEAVVAGVLRPEEEERRRQEEEDAEA
                     ARRAFAFARRQEVLEEVVEEEEDEGGNAGPGSGSGSGSASAGASTSGSHPASAIATPD
                     VAQPPPPPSFKRQVKKKKDHAALLGIKKKQPLV"
     gene            complement(1913674..1914488)
                     /locus_tag="MYCTH_2300995"
                     /db_xref="GeneID:11510315"
     mRNA            complement(1913674..1914488)
                     /locus_tag="MYCTH_2300995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661462.1"
                     /db_xref="GeneID:11510315"
     CDS             complement(1914030..1914263)
                     /locus_tag="MYCTH_2300995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661510.1"
                     /db_xref="GeneID:11510315"
                     /db_xref="JGIDB:Spoth2_2300995"
                     /translation="MSTSQRTYSTSMPLSPPPPSDLGSYSRFMHQHTKRQMESISQSP
                     PTASQHGQSSPTGLPDGVAGRSRNPNQYTYHQS"
     gene            complement(1917746..1919474)
                     /locus_tag="MYCTH_2300996"
                     /db_xref="GeneID:11510316"
     mRNA            complement(1917746..1919474)
                     /locus_tag="MYCTH_2300996"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003661463.1"
                     /db_xref="GeneID:11510316"
     CDS             complement(1917997..1919073)
                     /locus_tag="MYCTH_2300996"
                     /note="CAZy_ID 267849"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003661511.1"
                     /db_xref="GeneID:11510316"
                     /db_xref="JGIDB:Spoth2_2300996"
                     /translation="MPPLPQPPALPRVITYYQTHHTPSGKPISVLPLLQQPGIGITHV
                     ILAAIHINEDPAGLTLNDHPPSDPRFTTLWAEMRVLQASGVKVLGMLGGAAPGTYARL
                     DLNGNGNGNGNGGDDDGAFEAYYRPLAELIRERGLDGLDLDVEEPMSLGGIVRLIDRL
                     RADFGPDFLITLAPVASALLDPLRNLSGFDYEALEVLRGRDIAWYNAQFYCGWGDCSN
                     PVMYEMLLAKGWPPDKIVVGLLTNPDNGSGWVPWNLLSGVLPLLAGRHPRFGGVMGWE
                     YFNSLPGGKERPWEWAQAMTALLKGRRAVQSLEGLQGSEKPAEEKKTSEVSPEADPDE
                     EQPGEAPPVPAEFEYHSDGGGEEE"
     gene            complement(1920304..1922536)
                     /locus_tag="MYCTH_2300999"
                     /db_xref="GeneID:11510317"
     mRNA            complement(join(1920304..1921024,1921081..1921601,
                     1921672..1921828,1921906..1922208,1922410..1922536))
                     /locus_tag="MYCTH_2300999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661464.1"
                     /db_xref="GeneID:11510317"
     CDS             complement(join(1920396..1921024,1921081..1921601,
                     1921672..1921828,1921906..1922065))
                     /locus_tag="MYCTH_2300999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661512.1"
                     /db_xref="GeneID:11510317"
                     /db_xref="JGIDB:Spoth2_2300999"
                     /translation="MRTDTSLAILASVSGAAAFWRMECRGRVALARLDPLIDPGVPSK
                     HAHAIHGSSGFGASATYEDLRNADCTSCAVVEDMSAYWAPAVYFRHANGSYQEVLQDG
                     GMLAYYFLNPDLKDPSKGIKAFPNNFRMVAGDTNRRNYSVGGLDVKMPDPPKSNWASL
                     GQTSQADLAQRAIGFNCLNYATEPEPSLYRHYLPDKQFLDEKCKDGVRFELSFPSCWN
                     GKDISSPDQKSHVAYPDTVLNGNCPEGFDVKLPGLFFETIWRTQDFVGIPGEFVISNG
                     DVQGFGYHGDFISGWDEDHLQAAVDQCTATSGKISDCPLFTILSEQEQKECRMPTPPM
                     IASEKLSGLIGDTLPGNVAIAYGPEPANHNKPLPDPLPALSSVVDNILPGGVFQEKQT
                     SISTSEEPTSTPTTTPTTTVTPTPSEPPVPEGYEAVRTDYVTNGNVVSKIVVIETVET
                     VMLETATVTVTATRTAEIERREVHLHQHLHHRHHHGLH"
     gene            1924658..1927866
                     /locus_tag="MYCTH_2301004"
                     /db_xref="GeneID:11510318"
     mRNA            join(1924658..1927556,1927649..1927866)
                     /locus_tag="MYCTH_2301004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661465.1"
                     /db_xref="GeneID:11510318"
     CDS             join(1924863..1927556,1927649..1927750)
                     /locus_tag="MYCTH_2301004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661513.1"
                     /db_xref="GeneID:11510318"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="JGIDB:Spoth2_2301004"
                     /translation="MDDLAGLNWSAPNQKPASAATPAQSAPTNPAIPTYPSLRPTPSP
                     FASGRNSPLPAQGSGNAGTKSPAPKIAPDSFGNLLNFGTGKSNANLSLRERQDQLEAE
                     KRKKEEERRRQAQAQYGDGSFLDSLGQTQSSSLRTPSPAISVPSSLQGLDSGTHNGKP
                     ATESDDDLFAAFNASTKVDNSSYFPPPASSNTPSSANAPALDLSNPQAWNTSGAPAGT
                     SVGGGFADEDDDPFGLNQLKSNTSPPPPPAADGDDDDLLGDLAKPVDQVRKKTGPVFA
                     REPEPGKPIEDSSSESEAEPPAPSDDPFDRAVAQLVEYGFTPENARRGLTESGAGLNV
                     QAAVNWLLDDAHRQAKEKQKGGRGAGERSTERGERASSQSRSSTPSWTKEGQSGGGAR
                     GRDNRSPASLDGDFAKAAAAVGSSFLKSANNLWKTGQKKVQKAVAEFQQDGDPSQPKW
                     MRSAQGHGRAEDTGRQIPEVTDEALMLEMGGPPGTRPGKAAPQRQDAGEARLRETPPA
                     LPTRPGKGNQAPRWQQAPQQFMDPRSRLGRQGAEEETFQAYVSPARRKKPAAQPQPEA
                     KPAETDEDLLFGEAAPTSRAAPQTRSAQPSPSPQPSSRPPPPAPRPAAPRPARQIPGV
                     SAIALQNSTRCRLEGTAHFKRGDFAAAHASYTASMTAIPQDHPLTILLLCNRALTALK
                     TGDPRQAVQDADAAIQLIGPGKGEGEYVELQTTDGTPGEKRDMRDLYGKALTRKAEAL
                     EQMEKWADAGAVWQLCIEAGLGGATAAAGRQRCQKAVAPKPASSTPKPASASRAAAPP
                     RPRPSANPQKSFEAVERLRAAHQAAEREGDEKLALADKVDARIAAWRDGKRDNLRALL
                     SSLDTVLWEGSGWKKVGLHELVMANKVKVVYMKAIAKTHPDKIAQDATTEVRMIAATV
                     FSTLNEAWDKFKAENNL"
     gene            complement(1928059..1928996)
                     /locus_tag="MYCTH_2301005"
                     /db_xref="GeneID:11510319"
     mRNA            complement(join(1928059..1928416,1928548..1928996))
                     /locus_tag="MYCTH_2301005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661466.1"
                     /db_xref="GeneID:11510319"
     CDS             complement(join(1928163..1928416,1928548..1928794))
                     /locus_tag="MYCTH_2301005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661514.1"
                     /db_xref="GeneID:11510319"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2301005"
                     /translation="MAQSTAHRRLLQEYRALTNNPPEGITAGPVSEDDLLHWEALIQG
                     PEGTPFEGGVFPAELRFPKDYPLAPPTMKFLGEIWHPNVYPSGLVCISILHPPGDDPN
                     HYEHASERWSPIQSVEKILISVMSMLAEPNDESPANVEAAKMWRENRAEYEKKVREGV
                     RRMLGL"
     gene            <1929278..>1931332
                     /locus_tag="MYCTH_47844"
                     /db_xref="GeneID:11510320"
     mRNA            <1929278..>1931332
                     /locus_tag="MYCTH_47844"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661467.1"
                     /db_xref="GeneID:11510320"
     CDS             1929278..1931332
                     /locus_tag="MYCTH_47844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661515.1"
                     /db_xref="GeneID:11510320"
                     /db_xref="JGIDB:Spoth2_47844"
                     /translation="MPPALALGRALSRGRGLQTRPKPASTCLFCSLARPFPRSAARTT
                     ARTTGPLRLQERTSLAPWIPRLSGRCYQSTESLSSDPRADLRRALLDLQTHAPNHVNL
                     PRLQLALRNLSEPPGRESVRVAVLSVSSDGAGGSSGTNTTTSTAKRLLRLALADPLRP
                     AAAWEARLERRDAAGDGAGSSPLIVRVVGADKAGRDATAGAAGEGEEGREEEEGLRTV
                     VKEHVIPELRVSTPLLRDAELEMLVADAGDALAAAAAASSGAAVDDPVLVPTVDVAAT
                     TAGHVAPIGTPVHLALLVGDGVRGAASILALPVLEGRDVVMGVVNFKGLGSEDAAGCP
                     LVAVNVDAASEGLELFRSDVSNAMKYEALWTEANIGPISEWLRKSALPDGEGVTKAPV
                     RNLVRSLLRSARAAVQGEEARDLAAELRTKVQPESVAHLDRALADWAQSAHQELQQQL
                     DTAFTTGPWSKLGWWKLVWRADDVGMVTSEMVAQRFLPRAEQGLIFLAGRIQEAGVVE
                     GQQGAPLYPGPALPGPSTAEHTGQDSVAPGVVSKWPSHIPFTRHYLQTKTVPALQALA
                     QKLVVQSASLAGLSTALTGLSYLSGFGAYECGAIAALGIVLSCRRLQQKWDAAREYWE
                     GEVREEGRKAIRATEASVAEVLDKAGRTPDPAANRGAQLKELRKAEEIITRAEEALAR
                     MK"
     gene            complement(1931482..1932705)
                     /locus_tag="MYCTH_2301009"
                     /db_xref="GeneID:11510321"
     mRNA            complement(join(1931482..1931910,1932079..1932208,
                     1932332..1932392,1932506..1932705))
                     /locus_tag="MYCTH_2301009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661468.1"
                     /db_xref="GeneID:11510321"
     CDS             complement(join(1931805..1931910,1932079..1932208,
                     1932332..1932392,1932506..1932553))
                     /locus_tag="MYCTH_2301009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661516.1"
                     /db_xref="GeneID:11510321"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Spoth2_2301009"
                     /translation="MTSSIGIPIKLLNEAQGHIVTLEITSGQTYRGKLIEAEDNMNVQ
                     LKDITVTARDGRVSHLEQVYIRGSHVRFFIVPDMLRNAPMFRSRNVRGRGVGLARGRA
                     TVSRARAGGRGR"
     gene            complement(<1932897..>1933705)
                     /locus_tag="MYCTH_2125234"
                     /db_xref="GeneID:11510322"
     mRNA            complement(join(<1932897..1933124,1933338..1933427,
                     1933541..>1933705))
                     /locus_tag="MYCTH_2125234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661469.1"
                     /db_xref="GeneID:11510322"
     CDS             complement(join(1932897..1933124,1933338..1933427,
                     1933541..1933705))
                     /locus_tag="MYCTH_2125234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661517.1"
                     /db_xref="GeneID:11510322"
                     /db_xref="JGIDB:Spoth2_2125234"
                     /translation="MLGLFEGALGIYGQALQPGRIHNTRVTRLSDGEAQPTSDARLMN
                     NMGAQEIDCGKREGELRAAKRTSTYHSCLMSRRCEEACCPTVGSGIHEQAGNGANRPP
                     IGQYSQCRSERASDDEPGTPPFGGTVAPMKSRVCPYCALRLWSIEAHFIGIGSEGGEQ
                     "
     gene            <1933875..>1935063
                     /locus_tag="MYCTH_2057781"
                     /db_xref="GeneID:11510323"
     mRNA            join(<1933875..1934229,1934315..>1935063)
                     /locus_tag="MYCTH_2057781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661470.1"
                     /db_xref="GeneID:11510323"
     CDS             join(1933875..1934229,1934315..1935063)
                     /locus_tag="MYCTH_2057781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661518.1"
                     /db_xref="GeneID:11510323"
                     /db_xref="JGIDB:Spoth2_2057781"
                     /translation="MPPKSREYYLTTSSSRDFAWFLFKAAGARTQSKKLAPPSPNAVP
                     KARRAKMAEPKLALLPPAEAKARKQAPPQSRPEPAKPRKQAKPKRAGLKSVGLWSDWY
                     VSEDRSYFWRARMSHNETWDYQFTPGYQEPAPADKITPNPSSGESSQPQSPIPEKRPG
                     SSNPNVSQGPASPKSSLRTILTTSTGRPTEDLSASTSRTLVTLPKEVEDSSQSGTAPV
                     PLAAETKKNPSGSGTKSNEARRASSTRSPVLRLLQEGRSRKNRARAEAARSGADNTAG
                     MGMPDAADVTGKRKQHPRAAHAGNGGNGSGAATVVAGNRTSSAFAKKLRAKVKSEKEL
                     KVDPKKRVRTWLKGVEVDWAPIPLDAQGFPIYR"
     gene            1936215..1938355
                     /locus_tag="MYCTH_2301014"
                     /db_xref="GeneID:11510324"
     mRNA            join(1936215..1936501,1936577..1936919,1937019..1938355)
                     /locus_tag="MYCTH_2301014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661471.1"
                     /db_xref="GeneID:11510324"
     CDS             join(1936259..1936501,1936577..1936919,1937019..1937974)
                     /locus_tag="MYCTH_2301014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661519.1"
                     /db_xref="GeneID:11510324"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="JGIDB:Spoth2_2301014"
                     /translation="MTRHTPEFLRARSSNLSLRSTALEQSTAMRPDIVIDNTMDAKDL
                     RPEAFTKPYLEFMTENPTVFHAVDYFKQKLLKAGYKELSSRDSWIGKLEPGGKYFTTR
                     NGSSIIAFAVGASYKPGNGVAMIAGHIDALTARLKPTSKKPNTHGYVQLGVAQYAGAL
                     NETWWDRDLGIGGRVIVRDPDTGKTTVKLVKLDWPIARIPTLAPHFGIGMTGHNNRET
                     ELVPIIGLDNGDLDSAAAPEQPLGAPGSFVSTQPPKLVKLIAKQLSISDPSSILNWEL
                     ELFDSQPATVGGLDREFIFAGRIDDKLCSWAAFMALLHAKSDPSEGNIKLVALFDDEE
                     IGSLLRQGARGNFLPITIERAVEALASAAKTPFGPGLLGQTYASSFLVSSDVTHAAHP
                     NFPQTNLAGHSPRLNVGVALCVDASAHMTTDSVSMAILDRVADLAGCVNQRHMIRNDS
                     RSGGTVGPMLSAAMGCKAADVGIPQLSMHSIRATTGSLDPGLGVKFYKGFLDHWDAVD
                     REWRN"
     gene            complement(<1938493..>1943660)
                     /locus_tag="MYCTH_100809"
                     /db_xref="GeneID:11510325"
     mRNA            complement(join(<1938493..1938756,1938787..1939591,
                     1940063..1940097,1940213..1941987,1942167..1942251,
                     1943553..>1943660))
                     /locus_tag="MYCTH_100809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661472.1"
                     /db_xref="GeneID:11510325"
     CDS             complement(join(1938493..1938756,1938787..1939591,
                     1940063..1940097,1940213..1941987,1942167..1942251,
                     1943553..1943660))
                     /locus_tag="MYCTH_100809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661520.1"
                     /db_xref="GeneID:11510325"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="JGIDB:Spoth2_100809"
                     /translation="MAREPGTGVASKKTGVVPLWACNSRFGGIGVVAYSGFFVKHGRP
                     HRGLTQPPRFAKELDQDAVPEWRAKYLNYKAGKKHIKAVTRAINRANATPTLTRKGTE
                     APQAKTPANIFGIDHEFTPNRSSTGDPSLFRCKSAADAPGGNERSGLASSPGSTLQYG
                     SFGPSPSRQSDRNDFELPAPAMRVPSNTGDPVWHRMPLPRSATMADDAARLGRPSPSL
                     RTFRSRGTAPTPRLRVARLFSTASSAPRQTPNRAEIGLQNLDYVRSAERDFFAFLDSE
                     LDKIETFYKEKEDQATERLAALRAQLHEMRNRRTAEIAESRKRREQARSSRRSEEEDA
                     NGRPKDRNRAWIGPLKHRFIKPGPNSEELQKMTRTPVMTGQSQTVDVGRDYVRRPQQA
                     NDVPYRTAKRKLKLAMQEFYRSLELLKSYALLNRTAFRKLNKKYDKAVNARPPYRYMN
                     EKVNKSWFVNSDILDGHLRTVEDLYARYFEKGNHKIAAGKLRALQKRQGDSSDSAFRS
                     GLMIGLGSVFAVQGLIYGSEILLGHEDEDFVEQTGYLLQLYGSYFLILLLFGLFTLDC
                     RMWSKNKVNYPFIFEFDARNFLDWKQVAEFPSFFFTLFGVFLWLNFSRSGNWEELYLY
                     YPVILICISLVIIFLPAPILHHKARRWFLYSHYRLLLSGLYPVELETSSAIWDLFMDF
                     SLLQANAQQRLLRDITALRPVWIYYVIMVLDPILRFSWIFYAIFTHDMQHSTIVSFMA
                     SFAEIVRRGMWTLLRVENEHCANVAQYKAARDTPLPYHLEQFVQRPSLEQAAAAATAT
                     AGAVGAGAALAPAVDDAGRPTTGAAATPSLRHRPGTAATPAAAAAATPSSLRPVTAAT
                     TTMAPTPRSERAAAPQEVTATALEEGAAAAVARSGTFRRRLSDAVGKRSILQAMAEAH
                     KQDFEKRRPTAAEAGRDDRRAAEEVDDVLGSEDDEMEELKSDYDDDDDDDDGNEHGDN
                     NNDGAGHHHHHQHHRQHSLQHHRHHSLQHHRRVHSVGGGGGGGGRGNGSGE"
     gene            1945113..1947213
                     /locus_tag="MYCTH_2301019"
                     /db_xref="GeneID:11510326"
     mRNA            1945113..1947213
                     /locus_tag="MYCTH_2301019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661473.1"
                     /db_xref="GeneID:11510326"
     CDS             1945542..1946681
                     /locus_tag="MYCTH_2301019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661521.1"
                     /db_xref="GeneID:11510326"
                     /db_xref="JGIDB:Spoth2_2301019"
                     /translation="MSQRWPADPAYDDPYARNRAPPMEPASNASYTHSRTRTTSSNTF
                     PAGMQGPPFQPNPYQPPMHLAQPPVNHQRRSASVNTFSTVSSGGMVPPAAYRTSPTLE
                     VRRSTSSRSGGATGSPQPSYVALLRKQKATVWCDRAQHEDPRLQAQQRAAKMRAYREI
                     AGASSGLGLGLVGTGRTATGLSSAGGKVAAKIRHHGKPTVIGYSPNSDFNGVGGVPLR
                     LSATEVEGEESDEDDAAIQRQNHRRTGSSGRNSTSSARRAMPYRSSGGLGPAGGATKW
                     SPGGTPDRTGSLVGIKSSDQSPPADDAASGTAKSFGSGSSNERLDNVPELNGASSHLA
                     NNSKRNATVAREKSVKSVEELKRRGSVDERTMTLTAGRLYIANPD"
     gene            1948309..1950675
                     /locus_tag="MYCTH_2301021"
                     /db_xref="GeneID:11510327"
     mRNA            join(1948309..1948541,1948603..1949913,1949968..1950675)
                     /locus_tag="MYCTH_2301021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661474.1"
                     /db_xref="GeneID:11510327"
     CDS             join(1948409..1948541,1948603..1949913,1949968..1950407)
                     /locus_tag="MYCTH_2301021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661522.1"
                     /db_xref="GeneID:11510327"
                     /db_xref="JGIDB:Spoth2_2301021"
                     /translation="MATDVQDRDVAGRKRSHDDFLTQDSCGAAFGESEDCKADHSLSD
                     KENNVQCAPYGPLASPKAKSSSSLSEPPSSPLNPNSPSPIPSPAPPAPSTGSAQPSST
                     TGNPTAQKLAGEPPKKKRLTAEEKAAREAEKRKRDEERERKRREKEEADKLKAQQKAA
                     KAEERAAKAADRAEKEQEKRQRAEERERKRREKEEEELRKARSQMKLTSMFRTTTVSK
                     KEPAASNSDQSQAIGATAKGGSKEMSLYDQMFKPFFVKKHVRMASQLPELDEETREAK
                     TRILDEYLLGDRQHPITTFKPLEALQIPYKVRRGRVYPSVRKIMAEFEGLSSNAAGDI
                     SKESQSAQTKHALEALKSVPLKVIQFREDVRPPYVGTISGLPPGVTSLQKLARKPVSR
                     ILPLDYEYDSEAEWQEEEGEDVDDLDDDEEEVDMDEDMDDFLDDSEDVGPSRMVFTGG
                     MEPESIGPSWEDKNRTATEPELCKYRLEFVLQSLEHDHSIDPFSTAYWETSKTKANGN
                     APPTGSTSGTTASNPSSGAQDNARGKPMAPPPAPSDAFQALNSGASAAAPAGNKKSQH
                     PLPPDMQQKLKDLVRSMPTLSKIGVIELFAASNPGCPKGQIKTSFDALFEKDGKIFKV
                     KGE"
     gene            complement(1951018..1952710)
                     /locus_tag="MYCTH_2301022"
                     /db_xref="GeneID:11510328"
     mRNA            complement(join(1951018..1951449,1951530..1951551,
                     1951698..1952059,1952189..1952710))
                     /locus_tag="MYCTH_2301022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661475.1"
                     /db_xref="GeneID:11510328"
     CDS             complement(join(1951237..1951449,1951530..1951551,
                     1951698..1952059,1952189..1952416))
                     /locus_tag="MYCTH_2301022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661523.1"
                     /db_xref="GeneID:11510328"
                     /db_xref="JGIDB:Spoth2_2301022"
                     /translation="MPPPALRPATGPAWRGVAPKIARASAATTSAVLLSHRDLTVNDA
                     QKVTLGIIAAYVVAIALLWNLPYIKWILWPFKMLVIAFHEFGHAFACVLTGGRVESIS
                     LDPHEGGVTHMRGGRSAVTLPAGYLGSSLIGALLTFAGFNINASKVASIVVGVCFLLT
                     LWWGRRDWLTILTVLAAVGLLVACWFIAHAEALRFVILYSAWDICDDLILRKVNSSDA
                     SVFAKRYGGSSQCWGVIWSIISLGFMAAGIVAGIAAFRQSASQQREDSQHFIPTKF"
     gene            <1952853..1953769
                     /locus_tag="MYCTH_2142974"
                     /db_xref="GeneID:11510329"
     mRNA            join(<1952853..1952867,1953120..1953769)
                     /locus_tag="MYCTH_2142974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661476.1"
                     /db_xref="GeneID:11510329"
     CDS             join(1952853..1952867,1953120..1953587)
                     /locus_tag="MYCTH_2142974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661524.1"
                     /db_xref="GeneID:11510329"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Spoth2_2142974"
                     /translation="MRTYCYTAAIESWPPSVACEQIGALALAAAHLRVARPTDDIDRL
                     LPFYRDGLGFEVLGRFADHLGFDGVVLGHKSAAYQIEFTKLRGHDVGRAPTQDNLLVF
                     YLPDDDAYTKAVTRMEENGFQAVASFNPYWDRYGKTFEDPDGYRVVLANRPAPFASSP
                     "
     gene            1954237..1955286
                     /locus_tag="MYCTH_2301025"
                     /db_xref="GeneID:11510330"
     mRNA            1954237..1955286
                     /locus_tag="MYCTH_2301025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661477.1"
                     /db_xref="GeneID:11510330"
     CDS             1954316..1955188
                     /locus_tag="MYCTH_2301025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661525.1"
                     /db_xref="GeneID:11510330"
                     /db_xref="JGIDB:Spoth2_2301025"
                     /translation="MRLIQPSNLISQSLSRLLFRPPPARRAPRAPRAQPSATLRPKQR
                     PYSTASQKPNSGAPLTTSPTSTTTTTTTTTTTTTNTTASSAATAGADSTRAAAAATTR
                     LTRLLSRLPRPLQRYASRLRGAPLTHVAAFLVLHEITAVVPLLALFGLFHYTDRAPVS
                     SAWVVEHCGAYVREGVGRFERWFAKKGWFGFGEEEEEEEEASSPSYSPSSGEKGKQGS
                     ASRELEGLGTAETEAALERWEADPKYRILVEIGLAYALTKVLLPVRIAASVWATPWFA
                     GVLGRLGRLARMRG"
     gene            complement(<1955348..>1955766)
                     /locus_tag="MYCTH_2116909"
                     /db_xref="GeneID:11510331"
     mRNA            complement(join(<1955348..1955524,1955584..>1955766))
                     /locus_tag="MYCTH_2116909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661478.1"
                     /db_xref="GeneID:11510331"
     CDS             complement(join(1955348..1955524,1955584..1955766))
                     /locus_tag="MYCTH_2116909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661526.1"
                     /db_xref="GeneID:11510331"
                     /db_xref="JGIDB:Spoth2_2116909"
                     /translation="MSLFHALIRTHHITSRKKVAHLRKAAGKLGCYALLRSGGCPGIM
                     YCKGSEEDVKEWVGTVQRLRYKDFQLVSKPAPIDATVAKPEDRTGLFEVASVKEFADA
                     MEKRGISEWFKRGMEFA"
     gene            <1961961..>1963270
                     /locus_tag="MYCTH_93007"
                     /db_xref="GeneID:11510332"
     mRNA            join(<1961961..1961981,1962228..1962242,1962374..1962398,
                     1962615..1962733,1962791..1962890,1963026..>1963270)
                     /locus_tag="MYCTH_93007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661479.1"
                     /db_xref="GeneID:11510332"
     CDS             join(1961961..1961981,1962228..1962242,1962374..1962398,
                     1962615..1962733,1962791..1962890,1963026..1963270)
                     /locus_tag="MYCTH_93007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661527.1"
                     /db_xref="GeneID:11510332"
                     /db_xref="JGIDB:Spoth2_93007"
                     /translation="MRPVRVVLSVYLYKNINLSFSIKKIIGYYDTSTALTSPAYHKTA
                     NQGAYYAILTPKFSTLAAFAPTLAASSRRSNNDFALVTTTAAPNTPTRCVDTNATFIA
                     YVLGTLLPASYARTSVSVRPVPMLIDFGCSYTYYSSLPAERVTYLVRNCNDPTLAAIT
                     IILEEEDKEEDITE"
     gene            complement(<1978718..>1979014)
                     /locus_tag="MYCTH_2056182"
                     /db_xref="GeneID:11510333"
     mRNA            complement(<1978718..>1979014)
                     /locus_tag="MYCTH_2056182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661480.1"
                     /db_xref="GeneID:11510333"
     CDS             complement(1978718..>1979014)
                     /locus_tag="MYCTH_2056182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661528.1"
                     /db_xref="GeneID:11510333"
                     /db_xref="JGIDB:Spoth2_2056182"
                     /translation="LFLKYYHFIRVYINDIMIFSKIEEEYLKHLYTVYKILDKAYIYI
                     SIAKSFIGYLAVRLLRYIVNSKGIAKTDDRIATFKKLKFPDTLDSLEHYLGIAR"
     gene            2023436..2027013
                     /locus_tag="MYCTH_2301027"
                     /db_xref="GeneID:11510334"
     mRNA            join(2023436..2023877,2023937..2024532,2024587..2027013)
                     /locus_tag="MYCTH_2301027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661481.1"
                     /db_xref="GeneID:11510334"
     CDS             join(2023533..2023877,2023937..2024532,2024587..2026870)
                     /locus_tag="MYCTH_2301027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661529.1"
                     /db_xref="GeneID:11510334"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="JGIDB:Spoth2_2301027"
                     /translation="MPFPFSYVCDLLQRLDDNRLARSGVKSNTAIIEEWFRGHHGLLY
                     RDDHCSAPLLSALLPEKRTDRVYFIREKKLQAIIGRALGLGRSRIAELSRWTTPEASA
                     DLADCVESILKQTPNTVSPAHRPVTVEEIDEALHSIAAACRFSSPSVRSSAENRPADK
                     ELSLGSLYQRLSARDAKWLTRLILKNYEPVVLDPRVVCASYHPLLPAILKVQDDLAVA
                     GRILDTLKRDRTVTGTSELADYLKPTLGVKIGRQTWLKGRSIKHCLSLVQGRVSCEEK
                     VDGEYCQIHIDLSKGYHCIQIFSKSGKDSTRDRMALHDSIRKSLQLGQPSCPLKHSCI
                     LEGELVVYSDKDQKILDFHKIRKHVTRSGSFLGTDKDSQAHPWEHLMIVYYDLLMVDN
                     ESLLAVKHSERFRRLERLITPVPGRASLVKRELLDCDRPSAASDLRRAFAKCITARRE
                     GLVLKADDPYFDFGTLRRPYSGCPIKLKKEYIGHFGDVGDFAVVGARFDAAKARTYNI
                     PGLKWTHFYVGCLENKDEVQRFGKKPHFVVTNVVELNAAQLTDFVSFVNPEAIRPEDN
                     SAISLRIEPGLDGGKRPSMIFSTPPVFDLRCFSFHKEGNTGFWSPRFPSVSKIHYDRT
                     FHDAISFAELQEMAAKEKEAPPPPEDSQELLGWIAALENAEPRTSTDGPSQSTTFTGS
                     DSATQSPRASRVVEERAFAARISTADQRADPAGQIRVATAGEQSTLPTSAVAQGPAAP
                     ASPRSDSRNGVSLGAKRRFESSTQHDDSDRYKIRKCSSHQGAPGSPSRDNGQADSSAS
                     QRETPGASPEIPSRGDAGAVLPVLGPSRSSGSPPPTMRSLAAHSVQQADSGSRRDPDR
                     SPLQVSPSFHEAQPQFVSPSLPASSLKSGAPKSGGVGCRSSEQAFEGPTHKRSNETSL
                     AKCHFLGDMCKFRTYSILLSPCIANFPWVTDDLLSGHGVSEFLRDPKDWLRSQDASAT
                     PVGTSASAPTKISTPNTRRKTKIVLVDRRRREATLAFLQSIEAAQLKRRNGEREYVPV
                     YDWRVLEAIRDEERKLYNNKWKPERQFELNHHTSIWRRFWVGLA"
     gene            <2027688..>2029549
                     /locus_tag="MYCTH_2059249"
                     /db_xref="GeneID:11510335"
     mRNA            join(<2027688..2027935,2028061..2028225,2028339..2028740,
                     2028856..>2029549)
                     /locus_tag="MYCTH_2059249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661482.1"
                     /db_xref="GeneID:11510335"
     CDS             join(2027688..2027935,2028061..2028225,2028339..2028740,
                     2028856..2029549)
                     /locus_tag="MYCTH_2059249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661530.1"
                     /db_xref="GeneID:11510335"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="JGIDB:Spoth2_2059249"
                     /translation="MTTDSKLEERGPGSDPEPGADHGAGPDVRAGRWAGLKNILHKAV
                     KFGRVEVRGITPIPVKERTVEKTVNVFTLWWSMNTNILGITFGMLAPAYGLNLRNSAL
                     VILFFTLLTTLLPAYLSTLGPKIGMRQMLQARYSFGRYLVSVPVLLNLATLTGFCVIM
                     AVVGGQCLSSVADGNLSVTVGIVITAILTLGISFCGFTVLHNYERYAWIPAIISIVVA
                     VGTGGKELRNQVTYDAPPSAASVLSFGMIVASYMVPWACLSSDFTTYLKPDTSSTKIF
                     TYSYLGLAVPTILLMTLGSAIGNAIPNVPRWQAAYDQTLVGGVLAAMLAPAGGFGKFL
                     VVLLSFSLLGNLAATSYSVTLNLQLLLPALVRVPRYVFSVVFAAVVIPVAIRAAGDFF
                     VNLENFVALIGYWSSAFLAIVLVEHFAFRGGDCAAYDADAWNDARRLPWGAAALAAGA
                     LSFGLVVPSMAQVWWTGPIAETTGDIGFELAFFVSALLYLPLRWLEKRWTGR"
     gene            complement(2030708..2031370)
                     /locus_tag="MYCTH_2301032"
                     /db_xref="GeneID:11510336"
     mRNA            complement(join(2030708..2030763,2030845..2031370))
                     /locus_tag="MYCTH_2301032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661483.1"
                     /db_xref="GeneID:11510336"
     CDS             complement(join(2030732..2030763,2030845..2031271))
                     /locus_tag="MYCTH_2301032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661531.1"
                     /db_xref="GeneID:11510336"
                     /db_xref="JGIDB:Spoth2_2301032"
                     /translation="MDTTASGQANNVRASYPANERKDVPIPPGITEAARQARDRQFRE
                     DKKLGDQAAENPELNKDTATSDQANQDQASRLPSGRQGVRIPPGMTVETWLAIRRANL
                     KQYWEEKKLADETAKNTELNKNITISDQTYRNTRFNKNVKWADVFHPAQP"
     gene            complement(<2031504..>2032212)
                     /locus_tag="MYCTH_2125251"
                     /db_xref="GeneID:11510337"
     mRNA            complement(join(<2031504..2031514,2031573..2032095,
                     2032153..>2032212))
                     /locus_tag="MYCTH_2125251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661484.1"
                     /db_xref="GeneID:11510337"
     CDS             complement(join(2031504..2031514,2031573..2032095,
                     2032153..2032212))
                     /locus_tag="MYCTH_2125251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661532.1"
                     /db_xref="GeneID:11510337"
                     /db_xref="JGIDB:Spoth2_2125251"
                     /translation="MAAAALCPMITTADQITVTSSNNDRELADAEPSVQPSVKLSASQ
                     DQAKLQHNIGRCQRRGTHDGEDRSPIDDGVTDQGRDDFTQLPRKRRKISISTSTTATH
                     KNSAQAADTSAVHQFSVTTGSKNNNPTPQRDVEVSVTLLASNLQGGPRWERRQLKLLS
                     NFEEWPLDDAVLKRVTVDRVATSPEKEALKEPKAASL"
     gene            2033885..2037322
                     /locus_tag="MYCTH_2301035"
                     /db_xref="GeneID:11510338"
     mRNA            join(2033885..2035539,2035589..2035745,2035801..2037322)
                     /locus_tag="MYCTH_2301035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661485.1"
                     /db_xref="GeneID:11510338"
     CDS             join(2034024..2035539,2035589..2035745,2035801..2037181)
                     /locus_tag="MYCTH_2301035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661533.1"
                     /db_xref="GeneID:11510338"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="JGIDB:Spoth2_2301035"
                     /translation="MALSLSPAKLVLLAVHYAVHGDVDSLTALAARHGAVLKKDLLLR
                     ILLTYLPETLPSSRYTDFVRQLDERGLFPDTVPVEVDCSPVEHLAEDDAVKKVRRLRL
                     LPLALPDAPESAPEDALTLFLLRRSYKVDEEAGLLDELPALLLPFMDHSPCVRTLLVS
                     TILPLLRRNCEYYPQEPIPFTLQGFQHLPDRVAVSSLLSRSGSHDADISLVGRDLRGL
                     VGPWLSGEKRWKQGTQGTHGADSSRSAAEADDDLCPGWDEVLRWLMTKASKSWRVAVS
                     AIQQWDGPGDADLGGWGSVEFSDSQREYLEESYARAALASAYLIPEASLEALDGAYTI
                     AARVANLRALDPVSPLASALAVLPPLTEQISDDILSLKNTAQMRNDLLSPSNPLTSPT
                     DSSLAFLQALALSAHILTKAGCPCTIRRAGELALLRDEREQKAEAGKLIYAISSTGPK
                     TDDRFWIKARNEILWLRDWGAEDGWSPEEAACGVFGQVKKDFLEVEILKALLSNTRYT
                     LARSIYEDAPDQPLDRGLLQDTIYATAMTAYDNASNPNRTRGGLKKCDEIIKAFPKTI
                     QQSDPRAKRIEALLQATHSLSGYRLVLKQGEPFTPVVLRVHDDPVSIISKILEQNPRS
                     YTQLHDLLTLGTHMVDAGLTTKTPLTSEKDVARHRLSTERRITAMCINAALAEDDFET
                     AYSYVVNRIAPATTPNSSSSSSSNNATWGDDYSWKAALQAGKYRRGHSSSSSTTTTTT
                     THHQRTLPSGVGSGGGLFSSANADVRHLEQRIECLATALRVAPPHTLQEIVNAFRRAE
                     EELDVLVREEQEREDEWDARGDQLGSGATTTTTTTLPGLFGRPSPASAAGAGAGRAGH
                     HLEAKRSRPSRTAAAAAAAAGDEDAAPMSLFDLSRASVLSAQRNLSALSALHRSTGLG
                     ARLASVGSGLGGGRRGGGGGGGGGGAGRKASEGRGDGASDAGDGRSSMDMPPLSATGS
                     TTSAGSADEEKRVRKRDQLREAAMGTLVSGVGWLVGAPPPSQLRD"
     gene            complement(2037412..2040116)
                     /locus_tag="MYCTH_79373"
                     /db_xref="GeneID:11510339"
     mRNA            complement(join(2037412..2037870,2037943..2039358,
                     2039412..2040116))
                     /locus_tag="MYCTH_79373"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661486.1"
                     /db_xref="GeneID:11510339"
     CDS             complement(join(2037662..2037870,2037943..2039358,
                     2039412..2039907))
                     /locus_tag="MYCTH_79373"
                     /note="Also has a glycine-glutamic acid rich string
                     (25/30)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661534.1"
                     /db_xref="GeneID:11510339"
                     /db_xref="JGIDB:Spoth2_79373"
                     /translation="MATPSSAALMSDMEPPSSPAPVEKSFMTAVTEDDDTRMMATPEP
                     SERQPRGKKRGRDDGGGPNSNPIGKIRHLKKEDGEPLWRKDIQYDFLKAVFDNEQKVF
                     TNSYEKDKIGLQCFADLYIDTMSRSSKTSKVLRDKLLSDRDAAKGMAMVCLLVNIGRM
                     NTTLNSDADRRPVFPEMRAQLRTYHAIPSLQARQDPHAYKQLQDAPRLKSILKGGSDD
                     RPEPGSLDEIKAMNVPRTNPVNLLFLICQSAAKIAELHFPPGQEFHDLIMKTNYSSES
                     RARAFLWLMWFYLESDFTEEGCEENPFGPGVDYGVGVANQGVPRLKALTEEEEAQENV
                     DTPEEIEFGYAKQKMRAKIIEADQQFMAETQSKRGGRGGRGFPAGDEVGPTTGILPRI
                     RPSKNESDLDSVRSTPPPRGFGRQSGIFGSIGRRGPHSLKYQVFDGSSPAADKAAEGV
                     VARKPRPPTAHQLAVERNRAQRVEYILDRGVRRSYHESRKRRRTEGAILRALPRLSQM
                     QDPFEDSEDDEIYTSGKHGSSVTNGDSNKHMRERGYGGLAQLKDERDDFGEQVSSYAA
                     ALRRAVRRLDRWETHVGPKLGVIPPIKRPKVNGARHADDDEMEEGEGDGGNSPSKEMV
                     DPAETEDENEVAAHTPTDDADELDEMEKELLGLGEGDADEGEGENEGEAEGEGEGEGE
                     GEEELDDVDKTPLGADGDSDDSDS"
     gene            2040697..2042863
                     /locus_tag="MYCTH_2301039"
                     /db_xref="GeneID:11510340"
     mRNA            join(2040697..2041215,2041286..2041354,2041425..2041469,
                     2041537..2041553,2041625..2042338,2042455..2042863)
                     /locus_tag="MYCTH_2301039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661487.1"
                     /db_xref="GeneID:11510340"
     CDS             join(2041054..2041215,2041286..2041354,2041425..2041469,
                     2041537..2041553,2041625..2042338,2042455..2042500)
                     /locus_tag="MYCTH_2301039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661535.1"
                     /db_xref="GeneID:11510340"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Spoth2_2301039"
                     /translation="MATAAKIPVIDLSGDDQTQVAKDLVEAAIEHGFVYIRNTGKDIP
                     VEAIDGAFAVSKKLFDAPLSEKQACTIQKNNRGWSAMNYETLDPANQRIGDFKEAFNF
                     GEFVDGKAQQPIPPTIAPDEAQISAFRDLCNALSLKLNTLLGIGLGVSPPDFFTSAHL
                     RSRGPSGSILRFLRYPPRSAITELAPGADDVRAGAHSDYGSLTLLFRLRGQPGLEILL
                     RDGKTWSPVPVVPPGTEDDPAPPILMNIGDLLSYWTNGLLRSTVHRVVFPSGDSPAGL
                     EGEADHGPRYSIAYFCHPFGGTELGPVPSERVKEYKGGLAEGNPYAERKVMTADEHLR
                     MRLEASYTQLYKEGKA"
     gene            complement(2042885..2045071)
                     /locus_tag="MYCTH_2301045"
                     /db_xref="GeneID:11510341"
     mRNA            complement(2042885..2045071)
                     /locus_tag="MYCTH_2301045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661488.1"
                     /db_xref="GeneID:11510341"
     CDS             complement(2043201..2044898)
                     /locus_tag="MYCTH_2301045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661536.1"
                     /db_xref="GeneID:11510341"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="JGIDB:Spoth2_2301045"
                     /translation="MASTTSNVSPFLDPGPRTKANSLAILQLSRDNLLPVYLQPPTGE
                     HDGYAEGAVVNTRYGSFPHSTMLDVPWGSQIRASKVDTGSRGRKRKRDAADDDDDAGR
                     ETTGTGQREKEESPAVAAVATNENGTAAAAVKKAVADTSGFIHILPPTPELWTSSLPH
                     RTQVVYTPDYSYILHRIRARPGSVLIEAGAGSGSFTHAAVRAVYNGYPTAEGQRKGKV
                     YSFEFHEQRYHKMKKELSDHGLDRLVHLTHRDVYNGGFLVDGKSPEADAVFLDLPAPW
                     EALPHLSRRKPHRPSCSSSSSSSSSSSSSSSSSSSSPPPDADGAAAGDDQAAGWVSPL
                     NPRKSVHICTFSPCIEQVTRTVSAMRRLGWVDIDMVEIANRRLHTSRERVGLNLNFDR
                     GVNNSARDVEEALARLTEIEARTREHAAKPRAASADADEDMDSADDGDGDGNGGSGPV
                     NNNNGGQAPSAAEATSPTGTTPPWMEGRLITRGEPEIKTHTSYLVFAVLPMEWTAEDE
                     AAAAAKYPVGKEQKVIGAVDKLARKQERREQLQKVQGTGGRKARRKERDEKLGEMAA"
     gene            complement(2045480..2046262)
                     /locus_tag="MYCTH_2314576"
                     /db_xref="GeneID:11510342"
     mRNA            complement(2045480..2046262)
                     /locus_tag="MYCTH_2314576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661489.1"
                     /db_xref="GeneID:11510342"
     CDS             complement(2045626..2046207)
                     /locus_tag="MYCTH_2314576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661537.1"
                     /db_xref="GeneID:11510342"
                     /db_xref="JGIDB:Spoth2_2314576"
                     /translation="MFPPQLQPIQPTPAPQFAPQAAHVPPHFLVMQPGQQAQQVPIMQ
                     PQQQQQQQQQQQQQQQQPLMWKANTGRDPNPRFPAPHRNPNQSFMPPPDVMQSIRKQD
                     LRLQQPSHVQSPSPGQGQGQALPRLDAATHGGSSQGASEEVKAANNKTAVASAAVKSE
                     HEEKASGWGKTNGGVSSSEYDGSGWGDEEDGQY"
     gene            2052246..2055224
                     /locus_tag="MYCTH_2301048"
                     /db_xref="GeneID:11510343"
     mRNA            join(2052246..2054121,2054177..2055224)
                     /locus_tag="MYCTH_2301048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661490.1"
                     /db_xref="GeneID:11510343"
     CDS             join(2052523..2054121,2054177..2055079)
                     /locus_tag="MYCTH_2301048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661538.1"
                     /db_xref="GeneID:11510343"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="JGIDB:Spoth2_2301048"
                     /translation="MASSADSPPPPSRPALHVQMPSYSDPSAEADDLTKSKIDPDHLA
                     PDVVPLSPSDSREAANRLHDDLELLRAERVVSTEDRRDRGSVRPRSNTRSHNEGIEDA
                     FNTTNAPTPAVAAGPAKTTWLTKLWRWLKKFPRIFRYVLYAIPPGLIIMIPVLLDLFA
                     YNRKGHPVGGRGGVQLLWFGIWLEVVWLTLWAARIISSILPPIVAFVADTVGSTNHKK
                     WRDIGRQLEFPTALFLWLLAVLVSYHPILDHRVIGPGEDNKTPYVAWIDVVYKIIIAL
                     FVLATLNLVEKILIKWIATSFHLRTYSHRIRENHTHIEYLVSLYAYAKTRLEEQDPAW
                     ASPSSRRGSGQHSSPLKDIRNNARQVLSKVGNAANRVAGDLTGRKFPKGNHPRKVVLE
                     LLRNSESSYTLARVFYRTFVQPGKSTITVEDLFPAFPTQEDAEGCFSVFDKDLNGDIS
                     MEELEMVCNEIHLEKKAIAASLKDLDSVIKKLDEVFMFIIVVIVIIVFISIISNSAAA
                     ALTSAGTFILGLSWLLQATAQEFLQSIIFVFVKHPFDVGDRVTIYGNTGSTMMGDDYY
                     VLEVSLLYTEFKKMEGHVVQAPNSVLNTLFILNQRRSQGLADPINLKLRFGTTEAQIE
                     ELKSRMLQFCLQNKRDYAPRIISEVQTIDEVSSISMNIIFFHKSNYQNELLRLNRHNK
                     FAVELMHQMRDMGLETPRLAQPGGMRDMPLYWTQVQPPPSYQSTTHDAGAPAPATVRK
                     RGNSRAAVVEAGVDFQDVFHNRRRDNSISRLPSIRQSPREEEEEEAEEQRRLRSSGED
                     SNEKRQSMDSASSTQRRSWRPRSRSTNRGSMSNVV"
     gene            complement(2055452..2057449)
                     /locus_tag="MYCTH_2301051"
                     /db_xref="GeneID:11510344"
     mRNA            complement(join(2055452..2056191,2056256..2056321,
                     2056377..2056421,2056480..2056538,2056595..2056638,
                     2056701..2056731,2056869..2057449))
                     /locus_tag="MYCTH_2301051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661491.1"
                     /db_xref="GeneID:11510344"
     CDS             complement(join(2055998..2056191,2056256..2056321,
                     2056377..2056421,2056480..2056538,2056595..2056638,
                     2056701..2056731,2056869..2056888))
                     /locus_tag="MYCTH_2301051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661539.1"
                     /db_xref="GeneID:11510344"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="JGIDB:Spoth2_2301051"
                     /translation="MSTTERTFIAIKPDGVQRGLVGNIISRFEARGFKLVALKLVKPG
                     KEHLEKHYADLSSKPFFAGLVEYMNSGPIVAMVWEGLDAVKTGRAMLGATNPLASAPG
                     TIRGDFSLQTGRNVCHGSDSVENAEKEIALWFNKEDLISWESAQKAWIYE"
     gene            2057838..2061174
                     /locus_tag="MYCTH_2301053"
                     /db_xref="GeneID:11510345"
     mRNA            join(2057838..2058133,2058186..2061174)
                     /locus_tag="MYCTH_2301053"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003661492.1"
                     /db_xref="GeneID:11510345"
     CDS             join(2058049..2058133,2058186..2061049)
                     /locus_tag="MYCTH_2301053"
                     /note="CAZy_ID 268021"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003661540.1"
                     /db_xref="GeneID:11510345"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Spoth2_2301053"
                     /translation="MHVPGPLSSRWTAYLGLLSAFSAAFAPAVAVKEHDFKKCHQSGF
                     CKRNREFADHALATSSWASPYNVAPDSGSFKDGQYQAVILKTTNSGETVWLPITVSFL
                     ESGTARVTVDEEKRQKGEIELRHGSKARKERYNEAEKWAIVGGMTLDKEAKVDYEDKT
                     QITVKYGPTSKFEATIKFSPFSIDFKRDGISHVKLNDQGLLNIEHWRPKVDKPEPEKK
                     DGDSTEENKAEEAKEEPKGEDESTWWEETFGGNTDTKPRGPESVGLDISFVGYEHVYG
                     IPSHASSLSLKQTRGGEGNYQEPYRMYNADVFEYILDSPMTLYGSIPFMQAHRKDSSV
                     GVFWLNAAETWVDITKAKDSKNPLSLGGKARTNTHTHWFSESGLLDVFVFLGPTPKDL
                     TARYGELTGTTAMPQEFALGYHQCRWNYVSDEDVRDVDRKMDKFKMPYDVIWLDIEYT
                     DEKKYFTWDKHSFTDPIGMGKQLDSHGRKLVTIIDPHIKNTDNYPVVAELKSKELGVK
                     NKDGNLFEGWCWPGSSHWIDAFSPAAREWWSSLFKYDKFKGTMENTWIWNDMNEPSVF
                     NGPETTMPKDNLHDGNWEHRDVHNLNGLTFHNATYHALLTRKPGELRRPFVLTRSFFA
                     GSQRVGAMWTGDNQAAWDHLKASIPMVLSQGISGFPFSGADVGGFFGNPEKELLTRWY
                     QAGAFYPFFRGHAHIDARRREPYLAGEPYTTIIAAALRLRYSLLPSWYTAFRHAHLDG
                     TPIIKPMFYTHPSEEAGLAIEDQFFVGNTGLLAKPVTEKEKTTVDVWIPDGEVYYDYF
                     TYQVIPTVKGKTVTLDAPMEKIPLLMRGGHVFARRDVPRRSSALMRWDDYTLVVTVPR
                     ENKVAEGDLYVDDGDSFEYQNGQYIHRRFVYDGAAKSLSSVDAEGRDAASIREGAWMK
                     QMRSVGVGKIVVVGAPASWAGKKSVKVESEGKVWEARMEFTPAGQGRAAFAVIKKVGV
                     RIGADWKVEF"
     gene            2062022..2063129
                     /locus_tag="MYCTH_2301054"
                     /db_xref="GeneID:11510346"
     mRNA            2062022..2063129
                     /locus_tag="MYCTH_2301054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661493.1"
                     /db_xref="GeneID:11510346"
     CDS             2062166..2063089
                     /locus_tag="MYCTH_2301054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661541.1"
                     /db_xref="GeneID:11510346"
                     /db_xref="JGIDB:Spoth2_2301054"
                     /translation="MKPTVLFTLLASGAYAAATPAIPGYSPRTRGMNPHHHAPLRLLH
                     TFTPISTSGKSFRLLASSTESTKGGAILGLPDNDLSTVRTTIRIPAAKMPTAGPTANN
                     TVGEYAASFWVGIDSATDACGAGGSLRAGVDIFWDGTLGGQQTPFAWYQGPGQADVVG
                     FGGGFPVGEGDLVRLTLEAGPAGGEEIAVVAENFGRNVTRADEGAVPVRKVRKVLPAE
                     AGGQKLCRGEAAWMVEDFPLQGRPEFPTALANFTSVTFNTGITLDDGTEKDLTGAEVL
                     DIQLEAQGGRLTSCEVVDDRNVKCARVVGDN"
     gene            2063675..2064510
                     /locus_tag="MYCTH_2301055"
                     /db_xref="GeneID:11510347"
     mRNA            join(2063675..2063839,2063914..2064053,2064133..2064510)
                     /locus_tag="MYCTH_2301055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661494.1"
                     /db_xref="GeneID:11510347"
     CDS             join(2063812..2063839,2063914..2064053,2064133..2064279)
                     /locus_tag="MYCTH_2301055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661542.1"
                     /db_xref="GeneID:11510347"
                     /db_xref="JGIDB:Spoth2_2301055"
                     /translation="MASGYGLNGGPSRCFPFWQELLSCYVINGAEEDGAGKRKCVPAM
                     EDYYECLHHRKEAARVKMLQAAYRQSEAKKLQENPPTAGQIRNLGLLDKEEDTKKVLG
                     SS"
     gene            <2064780..>2066608
                     /locus_tag="MYCTH_2057586"
                     /db_xref="GeneID:11510348"
     mRNA            join(<2064780..2064955,2065057..2065377,2065684..>2066608)
                     /locus_tag="MYCTH_2057586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661495.1"
                     /db_xref="GeneID:11510348"
     CDS             join(2064780..2064955,2065057..2065377,2065684..2066608)
                     /locus_tag="MYCTH_2057586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661543.1"
                     /db_xref="GeneID:11510348"
                     /db_xref="JGIDB:Spoth2_2057586"
                     /translation="MPCLRGVELSLTTIPSNEPIPEYPHPEGTSARLLGTLLSGQNGQ
                     ASQRKTGPTVAVYIPINTAPSTPCKYVFFRLYMNGRPIAAWGIDPVVRLKGKVTKSLW
                     VPSELYHGQVGFEGRNFVFLPGQEHKSVAEDGGLIEIQVFRARERRARAPRLEEFRHR
                     ESYGIARSFRSDNTDEAVFHERSRGVTVLGNLESAGYHLKSPPELFPVISSNAKVPQP
                     SKALRDAYLESYLQRPLPQLPSEEPNRRSRRSSAASATSATSATPSITPSLLRDLEED
                     SLDLEEVDIGIARVVQLAPSESATDLVGDENSGSVNYSVSDYETSPKSQGDSFPVEER
                     MSPGRYLPTTGSGLDRGIALFTPPKRTVISSEPKNEESLPGCFASHHHLPCFETAALG
                     ELERRGARRSPNRAGHVDVAARPESSPQAGKGHGKSLFAGLRRKKSIGSPSKLGLSRP
                     GNGGSIVQRATGSRIWPCPGPDD"
     gene            complement(2066749..2068229)
                     /locus_tag="MYCTH_2301059"
                     /db_xref="GeneID:11510349"
     mRNA            complement(join(2066749..2067810,2067900..2067992,
                     2068094..2068229))
                     /locus_tag="MYCTH_2301059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661496.1"
                     /db_xref="GeneID:11510349"
     CDS             complement(join(2066890..2067810,2067900..2067992,
                     2068094..2068144))
                     /locus_tag="MYCTH_2301059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661544.1"
                     /db_xref="GeneID:11510349"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Spoth2_2301059"
                     /translation="MGNQSHIERTAHEPRDTSLHTLTISRITQFSPTVRIFRLAIPPD
                     DNITFLPGQWVDLYPPPEAGVTKPGGFTITSSPSAASPRRRRRHTPDPSHDPNHPLQP
                     PVGNVEEDAKEGDEGEGKGEASAYIELAIQHSPQNPAAAYLFLPRTRLLHSPVRVRVG
                     GSFVFPPALPPPLLSSLRKAVFVAGGMGINPLVSMLVWIGEQAAAAGGGSRWADLEVE
                     VLYSVRDPRGGEEEQDSGAVSGSGILFLERVARLFRSGRVKGRLKLFLTGGVFAGSGA
                     QEAERQGVVSCNGGADLVPFSRKRMTVRDVQEAVGKNKGATVIYICGVPRMTDDFVEA
                     LVSPEGFGMDQKRVLFEKWW"
     gene            2069195..2072584
                     /locus_tag="MYCTH_2301060"
                     /db_xref="GeneID:11510350"
     mRNA            join(2069195..2070345,2070401..2072584)
                     /locus_tag="MYCTH_2301060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661497.1"
                     /db_xref="GeneID:11510350"
     CDS             join(2069795..2070345,2070401..2072402)
                     /locus_tag="MYCTH_2301060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661545.1"
                     /db_xref="GeneID:11510350"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="JGIDB:Spoth2_2301060"
                     /translation="MKRPRKRLLDETADGPDELTDGTRGKQAFSSNAGQPSGVPPMVD
                     APSLSKRGDMKRTNWSQKAGTDTAPAGVSIQAAVCEPNLRCIAKEDQPCFFLRPSGME
                     LRVFTRDGDEAEPCDWLKITNKAKLLAYHPESSLIKISQAMDPSALIGGLMMLKFRSK
                     SDVSWVVNWARDNLGLRLVQESESHRLHMTWDNLNSRISQAGSQASTRRLPNGNSHPQ
                     PRAIEKSPKANAVLPEGASPSTSTSARTPLRRQMQVSVQQSSTPRFQIDISGEHASHE
                     PRSLRSGRTIRQLEKLDSPPLPTFRRWSDENSDWAKDWETPLIVRRTTVDKEDIPRLD
                     EGQCLNDNLIGYGLRYLFDEHKNTAEGLRDRVYLHNSFFYEKLKAPRGAINYDGVKNW
                     TAKVDLLSYDYIIVPVNEHYHWWVAIICNPGKLDPDSRRLPAKRHSLSDEQDSKAEGE
                     VPEVEMTDVTQKRPSPSPEGSSASGVDLIKSDIVDLVSEDKHVGTGQSPSSKGKRARK
                     AKPGPKLLNPDDPRIITLDSLGSTHTQAIGHLKKYLLAEFEHKRHKVITETPPNFGMR
                     AKRIPEQNNLCDCGIYLLGYIQQFVENPDRFIQKLLREEPLEWDFDPSHLRQLWRETI
                     LSEKRSQRKKQPASQGSRCSSTAVSTPKKSTTPSRHTSPETSENRPNGASEANREAKD
                     GSSELPASAKAAESPAKPITLEPEDRNEPQHPPRASSNEQPQPSAPSSSIAAQTDCAN
                     DGDVLESIESSEPAEPEDPTFIRQLSSSTSTKSADDGAGLLEVDSKESKSPARQKRAT
                     YESTTKGQDSVPKSCFPHTSSRFVIDSSMDLDPVVEKAEMVREPDSIDLTSE"
     gene            complement(2073042..2075100)
                     /locus_tag="MYCTH_2301062"
                     /db_xref="GeneID:11510351"
     mRNA            complement(2073042..2075100)
                     /locus_tag="MYCTH_2301062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661498.1"
                     /db_xref="GeneID:11510351"
     CDS             complement(2073110..2074990)
                     /locus_tag="MYCTH_2301062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661546.1"
                     /db_xref="GeneID:11510351"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2301062"
                     /translation="MSSFFTAPGGQKKRKRTAAAETTPKKRLATTKTSSSKPSSKGPA
                     NAAAAVPKKKKKKAVERDESISGSDLESDESEDEVRDRSDSEADSDESDAGGETAAEK
                     RLRLAQRYLEKTRKEVELEDEYAFDAEQIDRDLLAERLQEDVAESKGKVYRRLAAELN
                     FGEASHTQFRWNSGSVTSVAVCPPYAYTTTKDGYLTKWKLQDLPKDQWPQTTKRKPKK
                     PPAPPKRRPERICFAKSNPSKAKDKTYQGHTGIPLTVRASQDGKYVVTGGADRRLVVY
                     NAADLKPIRAFTQHRDAVTGLAFRRGTNQLFSCSKDRTVKVWSLDELAYVETLFGHQD
                     EILDVDALAQERCVSVGARDRTARYWKVPEESQLVFRGGGGPGEGRKNRLPPGVDPAS
                     AAHEGSMDRVAMIDDDIFVTGSDNGDLALWSIQRKKPLHVIPRAHGIEPPLKPSKASA
                     DEVPDPSVVPAPQPRGITALRTIPYSDVILSGSWDGYVRVWKLSEDKRKIETVGVLGG
                     ASATSPAAAATTTTAATTAAAATTPTSNETRDKEKEELNRGFLVRGIVNDIAMFERGD
                     RGRDGLCVVVVTGKEMRLGRWKTMREGRCGAVIFEVPKVVSKKQNGDEQNGRLTGSEG
                     DD"
     gene            2075261..2076494
                     /locus_tag="MYCTH_2301064"
                     /db_xref="GeneID:11510352"
     mRNA            join(2075261..2075414,2075470..2075627,2075688..2075937,
                     2076003..2076494)
                     /locus_tag="MYCTH_2301064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661499.1"
                     /db_xref="GeneID:11510352"
     CDS             join(2075413..2075414,2075470..2075627,2075688..2075937,
                     2076003..2076204)
                     /locus_tag="MYCTH_2301064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661547.1"
                     /db_xref="GeneID:11510352"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Spoth2_2301064"
                     /translation="MEVLLGITGKDFTLIAASKAAMRGATILKASDDKTRQLNKHTLM
                     AFSGEAGDTVQFAEYIQANAQLYSMRNDTDLSPSALAHFVRGELASSLRSRKPYSVNL
                     LLGGVDPITHKPSLYWLDYLASLAPVPYAAHGYAQYYCLSLLDKHHHPDISLDRGLEL
                     LRLCADELKRRLPIDFKGLIVKVVTKDGIEEKPFDVDEVVKGT"
     gene            2077863..2080157
                     /locus_tag="MYCTH_2301066"
                     /db_xref="GeneID:11510353"
     mRNA            join(2077863..2078179,2078239..2080157)
                     /locus_tag="MYCTH_2301066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661500.1"
                     /db_xref="GeneID:11510353"
     CDS             join(2077965..2078179,2078239..2079997)
                     /locus_tag="MYCTH_2301066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661548.1"
                     /db_xref="GeneID:11510353"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2301066"
                     /translation="MADQLSSGMGNLSLDSAPQATQLGGQQQQPATRSYIPPHMRNKM
                     AQSGNNPSMNGPGPQGSVGGLNNSAWAGNNNYDARGGNWGGYDSQPQSWGSRGGGGGF
                     NRHSYRGPGGGGIGGVGRGEGRWVDGKHVIGPADPRLERELFGTADDPSKQHTGINFE
                     KYDEIPVTPSGRDVPEPVLTFSNPPLDPHLLSNIELARYKIPTPVQKYSIPIVINGRD
                     LMACAQTGSGKTGGFLFPIMHQSFTQGPSPIPPQAGGGYRQRKAYPTTLILAPTRELV
                     SQIYEEARKFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRIS
                     LVNIKYLVLDEADRMLDMGFEPQIRRIVQGEDMPPTGQRQTLMFSATFPRDIQMLAQD
                     FLNDYVFLSVGRVGSTSENITQKIEYVEDVDKRSVLLDILHTHAGGLTLIFVETKRMA
                     DSLSDFLINQNFPATSIHGDRTQRERERALELFRNGKCPILVATAVAARGLDIPNVTH
                     VINYDLPTDVDDYVHRIGRTGRAGNTGIATAFFNRGNRGIVRELIDLLKEANQEVPAF
                     LETIARESSFGGGGRGRSGGGRGRGRGGNTDFRKYGGGGGGFGGGFGSQHGSGGGFGG
                     GGYGGPPNGGYGGYGGYGGGYGNPGGAGGQLWW"
     gene            complement(2081111..2083303)
                     /locus_tag="MYCTH_2301067"
                     /db_xref="GeneID:11510354"
     mRNA            complement(join(2081111..2081487,2081607..2083303))
                     /locus_tag="MYCTH_2301067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661501.1"
                     /db_xref="GeneID:11510354"
     CDS             complement(join(2081373..2081487,2081607..2083207))
                     /locus_tag="MYCTH_2301067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661549.1"
                     /db_xref="GeneID:11510354"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="JGIDB:Spoth2_2301067"
                     /translation="MARRKASAEAPAPRASQKRDLPDDPYEIPDEAETPRRRRRPGAA
                     STVSANLGEDSLEEEGVRSPLNSTPAKRRGRPPKSAATGTPKAHATTPTARRQKQPTE
                     TPVRLNGTDTPSRRSIADRSARRKSARALIDRVIGGTVSDDEVEEGDIAREIYESSED
                     EEAEADGQAGEGEEEEEEQEVQEPTTPSRTPGRKRRTAGRKRSPTPPRDLPPHEQYFY
                     QNKPGLSKTSNNTLSSLNLLTHEEYFSILRQLKDPHAADVDFLRSLHAESFPQWAFEL
                     SQGFSTCLYGYGSKRRLLHDFASYLSSLDPSRTIVVINGYVRTLTARDILTTLTSALP
                     PSLAPANTSNPAAALQALLANMTAASSAPATTTASSLTVLVNSIDAPPLRRPALQAML
                     AQLAAHPRVRLACTADTPDFPLLWDAALRASLNLLFHDCTTFAPFAPCELEVVDEVHE
                     LLGRRARRVGGKEGVAFVLRSLPENARALFRLLVGEVLVAAEEHGDGCGGGAEEVAVE
                     YRMVYNKAVEEFICSSEMAFRTLLKEFHDHQIITSHKDSIGTELLSLPFRKEELESIL
                     EELTS"
     gene            <2083552..>2084377
                     /locus_tag="MYCTH_2116929"
                     /db_xref="GeneID:11510355"
     mRNA            join(<2083552..2083773,2083896..2084237,2084294..>2084377)
                     /locus_tag="MYCTH_2116929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661502.1"
                     /db_xref="GeneID:11510355"
     CDS             join(2083552..2083773,2083896..2084237,2084294..2084377)
                     /locus_tag="MYCTH_2116929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661550.1"
                     /db_xref="GeneID:11510355"
                     /db_xref="JGIDB:Spoth2_2116929"
                     /translation="MNLNLSGSLNVFRLLAKPSLCLPHATVATFDDLPIPLNKAFSKN
                     VKQPDIRAVVLDKDDCFAIPDHNEVHEPYKKHRFEALRAAYPGRRLLIVSNTAGATSY
                     DVTGRLASEVEKSTGVSVLSHAVKKPGCGEEIMSYFRQHPETGVTSPHQIAIVGDRLA
                     TDMMLANMMGSWGIWVKDGVVPLHQKSIFSKIERKLGPYLLSRGYSAPDPSSPFE"
     gene            <2085050..>2085881
                     /locus_tag="MYCTH_2108831"
                     /db_xref="GeneID:11510356"
     mRNA            join(<2085050..2085236,2085329..2085409,2085469..2085633,
                     2085796..>2085881)
                     /locus_tag="MYCTH_2108831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661503.1"
                     /db_xref="GeneID:11510356"
     CDS             join(2085050..2085236,2085329..2085409,2085469..2085633,
                     2085796..2085881)
                     /locus_tag="MYCTH_2108831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661551.1"
                     /db_xref="GeneID:11510356"
                     /db_xref="JGIDB:Spoth2_2108831"
                     /translation="MGGKVWSREEEEYFWLRLIPHSPKRLGDDMFFNEEKDWGWVGEM
                     MTQYMGNRARRKYTQLCVFEHYFLNASLSRFSPNVGNLCARYWRYEQHQLRLRARALR
                     IQQEAAQSDSEANASGESSTSQAESPIEVNSVVDQDTPIVINYEGLFVTQQHKFRMDM
                     AVPLWGYGYRHC"
     gene            2086321..2088048
                     /locus_tag="MYCTH_2301073"
                     /db_xref="GeneID:11510357"
     mRNA            join(2086321..2086437,2086490..2086714,2086781..2088048)
                     /locus_tag="MYCTH_2301073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661504.1"
                     /db_xref="GeneID:11510357"
     CDS             join(2086371..2086437,2086490..2086714,2086781..2087952)
                     /locus_tag="MYCTH_2301073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661552.1"
                     /db_xref="GeneID:11510357"
                     /db_xref="JGIDB:Spoth2_2301073"
                     /translation="MARTRGQAAAQKGFASPAPKAQEPQGIQLRKGASQRAESNRRIR
                     PSAIRETPSQQDPPALQSKGRKRKQRIEPGAARERRGPKRQPISPTRPAGDTIGNWPS
                     QTVSTMNRLLARKKSTLSRKRSNSDISKTPSDQKPREEKSAQYRDQRYETLLQFNGSY
                     MTKAPGGLASASQDLCRSLLENPQPVPGDTLFQDDIFETTCEKIRNKNEARVIQDISR
                     LIVPSAESLATFGAKHLDILIESVNEGWSNSMPLTGTRPQPDYSVGFRREAFTKDQLA
                     KLSPCIGDLIAGDASPVMATYYMYFPFLTCEVKCGTAALDIADRQNAHSMTLAVRAIV
                     DLFRAVKREDEVNRKILAFSISHDNTSVRIYGHYPVIAGNDTKYYRHPIHKFDFTALD
                     GKDKWTAYRFTKNVYDIWMPEHFKNICSAIDQLPLELDVDAPPLSDTTTGLSQDLGGL
                     MQSDAGSVSQDSQSSNARQQGRTPDTSFTVPGKRRKG"
     gene            <2089174..>2090472
                     /locus_tag="MYCTH_48078"
                     /db_xref="GeneID:11510358"
     mRNA            join(<2089174..2089291,2089538..2089962,2090008..>2090472)
                     /locus_tag="MYCTH_48078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661505.1"
                     /db_xref="GeneID:11510358"
     CDS             join(2089174..2089291,2089538..2089962,2090008..2090472)
                     /locus_tag="MYCTH_48078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661553.1"
                     /db_xref="GeneID:11510358"
                     /db_xref="InterPro:IPR005627"
                     /db_xref="JGIDB:Spoth2_48078"
                     /translation="MALDKAYPRLEVPIFGPDDGLLAVSLGARRLELNRAGSYALGGT
                     TPTLSELAALLSSLGASDRRPRPAIRIMIRPRGPPKSATSTIIPNNTAIITTDDTGGD
                     QASDRAPEPTTTPRQRPDQDFLYTPSELAAMAASIRAFAASGLLSPRHGDGFVFGALR
                     LGDDGRRLELDVERNRELVSLGEGEGERPPSPRLACVLHRAVDDLLSSSSCLGGDDDN
                     IEGVMRSVRECGFDGVLTSGGRGPALGNLEGLKGVIGSGAAAAAEAKGLEVIVGGGVR
                     RGNLDALVHGLKRGTGNDALGEMVWFHSSCLGPDGRLDEQEARALAEQLWRSGVVLTD
                     Y"
     gene            <2091850..>2094217
                     /locus_tag="MYCTH_79335"
                     /db_xref="GeneID:11510359"
     mRNA            join(<2091850..2092372,2092437..2092555,2092638..2092726,
                     2092796..2092874,2092961..2093633,2093694..>2094217)
                     /locus_tag="MYCTH_79335"
                     /product="alkaline phosphatase"
                     /transcript_id="XM_003661506.1"
                     /db_xref="GeneID:11510359"
     CDS             join(2091850..2092372,2092437..2092555,2092638..2092726,
                     2092796..2092874,2092961..2093633,2093694..2094217)
                     /locus_tag="MYCTH_79335"
                     /codon_start=1
                     /product="alkaline phosphatase"
                     /protein_id="XP_003661554.1"
                     /db_xref="GeneID:11510359"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="JGIDB:Spoth2_79335"
                     /translation="MLLKANAAALCLAASLSAVTAQTFQRLGTCPDLGCVLPPDQQDF
                     LPGQEFDIRFEVHAPKNGSEAFNNGVPDEKFTATIAKDGHRPKSIADFFDRSEPKLEK
                     WTFSWYEDLFAKDANTPSVVNVASKVYRRVALYEPGEYTVTLKYYNGKTTTAKWTVRA
                     LATEKKAKNVIFFIGDGMTTNMITAARLLGHKTVNGRYQSLLAVDEFPVLGHQMSHSI
                     DTFITDSANSASALYSGHKSSVNAMGVYADSSPDTEDDPKVETIVELLHRIWGSAWGA
                     VSTAFIADATPIALTGHTRRRSNYGILIDQALHGVSNYSWTKTDGPDAYFGGGAEQFI
                     PGPGSFKGKDYYAEFAKKGYSVSWNKTALLAAPNNKKALGIFCKSNFPVWLDRNIFPD
                     NLDSLDNNPSGAAGPAKDLPGLKDMTLKAIDILHERGGKNGFFLMSEAASIDKQMHAL
                     DYERALGDLLELDDTVRATIAKLKELRILDDTLIVVSADHGHGFDVFGSSDTKYADAQ
                     KDDRAKRNAVGVYENSGLSQYTQPKEGVSYGTGPNFPLNWDPRYVIAAGMGANPDHRE
                     RFGVGREPRTPASVGAGGEVYVNPADRPDGFVVNGTLPTDQTQGVHSLTDVPVYAMGP
                     CQETFGGTYNNIDVFFKMASCLGLGQPRNRTRADAGHGGTKPKS"
     gene            2094731..2097188
                     /locus_tag="MYCTH_2301076"
                     /db_xref="GeneID:11510360"
     mRNA            join(2094731..2095033,2095147..2097188)
                     /locus_tag="MYCTH_2301076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661507.1"
                     /db_xref="GeneID:11510360"
     CDS             join(2094937..2095033,2095147..2097107)
                     /locus_tag="MYCTH_2301076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661555.1"
                     /db_xref="GeneID:11510360"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Spoth2_2301076"
                     /translation="MERFLRDWRQDALNKAQYESAIFIGDKLLAMTKDENDAFWLAQV
                     HFAAGNYTRAHDLLNKHGLIGTNPSCRYLAAHCLIRQNNFADALALLGEHTPTHLFTS
                     NAKRKTHRTAGRGTRAGSKNLDRQPDELSEEEWSVRRYEAGMCYLRGLCYAKENAFDR
                     AKEAYKDALRIDVQCHEAFTQLVRNSLMSADEEAEFMQSLDFGAVRAPRGGDDPELRS
                     EPGDYVHMLYQTQLSKYGNPRAFNVAVESLSTHYGLEDNADLLLARADLLYTQCRFKD
                     ALAITAAVLREDKTNFPAYPVHLACLYELKRTNELFLVAHELADHHPEHACTWLAVGT
                     YYLATGKIADARRYFSKSSMMDATFGPAWIGFAHTFAAEGEHDQAVTAYSTAARLFTG
                     THLPQVFLGMQNHAMNNLTAAEEYLKSAYQLCRADPLLLNEMGVVLYHQDRLRDAAKF
                     FRQALLVADETGADPHAWLGARTNLAHAYRRLRLLDEALDEFDAVLRDGGKNAPVLCA
                     KALILLDKGLPDEAARVLHEALAVNPQDPVATELLNKALEESAAAGDLAVLMGGLRTG
                     EAGAEGEPDDDDDEGGRGGGGLGGGGADDDEELARFELELEEKKAAAMRRLERRGRWS
                     STAGLGGGGGGRGKGKAVMRGNARGGRAAGAAEYEVVDDDDDDDDDDKGGEDVMMDMS
                     DDY"
     gene            complement(2097319..2100511)
                     /locus_tag="MYCTH_2301077"
                     /db_xref="GeneID:11510361"
     mRNA            complement(join(2097319..2097688,2097783..2099120,
                     2099234..2099770,2099917..2099995,2100109..2100511))
                     /locus_tag="MYCTH_2301077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661508.1"
                     /db_xref="GeneID:11510361"
     CDS             complement(join(2097530..2097688,2097783..2099120,
                     2099234..2099770,2099917..2099995,2100109..2100155))
                     /locus_tag="MYCTH_2301077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661556.1"
                     /db_xref="GeneID:11510361"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2301077"
                     /translation="MASVEQEAASVPRKLWEHPDPKSTPMYRFMQEINSKENRQLKTF
                     RELYAYSLAHRTSFWSHVFRSANLIYEGSNSVVVDESAPIDAVPRWFEGVRLNFAENA
                     LFSSASPAPPDDGGGDQAARRSLRHKEDDKVAITEVREGGSEVRSVTYGELRRRAGEM
                     ARAMRAHGVGRGDRVVIVGANSVETLVVFLATAWLGAVFSSSSTDMGVKGILQRTVQV
                     NPKLLFMDDAALYNGKVVDLRDKMAEVVKGLSECSNFEGVVSIRRFEQARDISRVPKA
                     RTWASFLAAANRNAPLPEFVRIPFHEPFLICYSSGTTGIPKAIVHSVGGILINTYKEG
                     VLHEGLGPDSVTLQYTTTGWIMYLASCNVIIYGGRTILYDGSPFQPDATILIRIAAEQ
                     KATKLGISPRWMLEVAKSGLRPRELADLSSLRTVTSTGMVLSDELFRWFYDVGFPPHV
                     HLANISGGTDIAGCFGIMNPLEPVYVGGTQGPSLGVHVAIYDSLLPDGAEGKEVPPGT
                     PGELVAVAPFPNVPCFLWGDKQVPGGGGPAAPGTKYHSSYFARFPHVWAHGDFCVMHP
                     VTGNITFLGRADGVLNPSGVRFGSAEIYSVIERRFSDRVQDSLCVGQRRPQDSDESVM
                     LFLLMKPGAKFDRALANEIRQAIAADLSKRHVPKYIFPTPEIPTTVNLKKVELPVKQI
                     VSGRIIKPSGTLANPKSLDYYYQFAKVEELVGPKEKL"
     gene            complement(2100802..>2112949)
                     /locus_tag="MYCTH_79327"
                     /db_xref="GeneID:11510362"
     mRNA            complement(join(2100802..2101881,2101951..2108370,
                     2108521..2112803,2112895..>2112949))
                     /locus_tag="MYCTH_79327"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661509.1"
                     /db_xref="GeneID:11510362"
     CDS             complement(join(2101195..2101881,2101951..2108370,
                     2108521..2112803,2112895..2112949))
                     /locus_tag="MYCTH_79327"
                     /note="Contains conserved domains: COG5032, TEL1,
                     Phosphatidylinositol kinase and protein kinases of the
                     PI-3 kinase family; cd05163, TRRAP,
                     TRansformation/tRanscription domain-Associated Protein
                     (TRRAP), pseudokinase domain; and pfam02259, FAT, FAT
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661557.1"
                     /db_xref="GeneID:11510362"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="JGIDB:Spoth2_79327"
                     /translation="MASSLIEDVVRKLSAPETEPRVKVEAASALRDSLDHYTTGPGYP
                     IFLKRVMPTFISILRQPCVLQTSTPDQANAQKLRNCVLEIFHRLPTAPSPPEPFEPYA
                     EEVVDLLMQLVRNDNEDNAVLSVKVISDIMRHQHKIMGNKVQAFLSLIQELFEQLDKV
                     VREQLDNTAAPTAPGPPSTPGSTQTTFMPHQQSPRAASPVATGAPDFSADASQQSNRT
                     LLKGMQSFKVLAECPIIVVSIFQVYRSSVAQNVKAFVPLIKQALLCQARAQDQAHKDA
                     AARGTIHTGVSPNIKNRAAFGEFITAQVKTMSFLAYLLRQYSGQLTDFLPSLPEIIVR
                     LLKDCPREKSGARKELLVAIRHIINFNFRKIFIPKIDDLLDERTLIGDGLTVHETMRP
                     LAYSMLADLIHHVRDHLSPEQIRKTVEVYTRNLQDNFPGTSFQTMSAKLLLNMAEFIA
                     RMPNKVDARHYLIMILNAIADKFAAMNRQYPNAVKLSKQYAQQAAEGAPETYLPDKEH
                     PPEWDEIDIFNAMPIKASRDRAGDPVVDNKFLFRNLMTGLKNTFYQLKSCNQEGVVDL
                     THAPAHWKDVAYGFTAEEVKVIIKLFREGAYVFRYYEIEKPAAESPYSSPVEYMANFY
                     MISSSKEEKELLETFATVFHCIDPATFHEVFQQEIPRLYDMIHEHTALLHIPQFFLAS
                     EATSPSFCGMLLRFLMERIEDVGSADIKKSSILLRLFKLAFMAVTLFASQNEQVLLPH
                     VVDIVTKSIELSTKAEEPMNYFLLLRSLFRSIGGGKFEHLYKQILPLLEMLLDVLNNL
                     LLAARKPAERDLYVELCLTVPARLSNLLPHLSFLMRPLVVALRAGTDLVGQGLRTLEL
                     CVDNLTADYLDPIMAPVIDELMTALFDHLKPHPYSHFHAHTTLRILGKLGGRNRKFMT
                     DALPVTFQQYVDDRSSFDVRLIGSKRDRAFPAHLGIELAIQKLMEVPKPVKGQLPSPA
                     KQYDPYYKRQALNLIIAQVKLRVGYENLPDDLPRLVRLQAQDLINRNKDVDISVFETS
                     ERERSMAKKHDEENLLKRLLKALLYAQSIPDFKAEVDALLLNLARHFTIIEVGRALVE
                     MKKAYSPFDTKLGEGPLFVDNRVLSDAILESLASENPDIRDAAERLIKEMYNSAVIIF
                     GSPSHVARLSFFNSLAATFCHGCYEEEWFTKTGGTLGIKALLTEVELGDLWVAAKQIE
                     FVRALMYVIKDMPQDLPEKTRRSAQVTLEILLTRLTKNVKKADCIFAPPAAGTQPPQP
                     SPKPSRIAQIVMMLNGELSHMNRHVRDTARRSLELIAKAAGAEVWELLEPHRKHLLQP
                     IYAKPLRALPFAIQIGFIDAVTYYMSLKRGFVAFDENLNRLLMESLALADASDESLAG
                     KMLEFRTHNFIVNLRVACIKILSSAMSFDEFGSGPNNPTRLKVVSVFFKCLYSDSQST
                     IEAANDALRTVEIGARLLEHVKLIAEPNFLQQVSFTFFEQHNSLKVIAAVFNIFHLLP
                     DAAKQFKERVIDNVLDLEEKLRRTHHSPFRLPLYKYLNKYPSDVWAFTLGKLEELRYG
                     RFLSQVLRHPDSQVLRDYGAANVEFIIRTCNNIVTQGKETKFIAIVNTINMLDALCQF
                     PGTLSWLDNKEHIDWLKQVGKELERNLKANSLPPVLRLPAHQASEQLMTILTKALGRN
                     PGDLDSLFALIEGITADDFRETPAVLSHIYKHIICSDSIDFWKTTVLRCLDIYAGKSA
                     SQRTKWYLLHNIVNPIVAMDVMRHWNRGEPGRGPRFLDKAIIDSINTKIWKVNLPDPQ
                     EDLLQPRIDHTRMEVLQLSAMIVKYHHTVLHDARKDFIKFGWTYIRLDDVINKHAAYV
                     VIGYFIAHHETPAKIVTQIYFSLLKTNQNEGRALVTQALELMAPVMPKRCNTALTDRN
                     PVWAVAPRRILAEESQNVQQMTCIFHFLVRHPDLFYHTRDKFAMLIIQCLRKVASPPN
                     PSNESRKLALNMMWLIWQWEERRVEGKMSEPLRAASESPNTKKRKLEDQQASSPSAVR
                     QPEKAEFQIPAVGRQKMIKYLVEFIAQLNERYPLPSAKPRDPALPVLPSQAPDLCKKA
                     MTLLYNLLQPQYWGDLDVDLFPNVTDVVLASEKSASLLAADPSDTDKVDDKFITNIIN
                     TLQVVRIILNFKSNEWILKNMPQIQKILEKCLRSENPEIQDCLHVADREYDGDRDIKP
                     IVKRILDAVPEDVPMEDADADGESETQTSEIITFFSSIATESMAASNYVSGINLLWSL
                     GSRKPSAIDQHIPSIMKSLQSKLARDHVSHYAALAHQASGMRAQQDPNAPTEMNPYDL
                     EIQTNLILKAIEVTAMRMDILGDNRRPFLSVLATIVEKSLHVRLCERILEMVEGWVFR
                     SEGTWPTLKEKTAVLHKMISFEHRQDPHMLMKFLRLVLRIYEDPKITRTELTVRMEHA
                     FLIGTRALDVEMRNKFMTIFDKCLSKTASARLAYVILGQNWDTLADSYWLAQASQLLL
                     GGVDMSPVIQLHHEDFRTLQLSQLFGPYTKDNREPTLISDDKYESFMANHRRFMAELG
                     DVRVRDILEPITQLQHIDPNFANELWVTLFPMFWSATAKEDRPDLERGLVALLTKDYH
                     SRQMDKRPNVVQSLLTGAVRTWPHCKIPPHVLKFEAKTYDAWYTALYQLENSAIKPEI
                     DSATVRESNLDALVDLYASLGEDDLFYGTWRRRCQFVETNAALSYEQHGMWEKAQRMY
                     ETAQIKARTGVIPFSESEYMLWEDHWVLCAQKLQQWEILQDFAKHENFQDLLLECAWR
                     NPEYWQNQENRDQLDTLIKGVMDAPTPRRSFFQAFMSLLKLHNKQESMQDFNRVVDEA
                     IQLSIRKWHQLPKRLTAAHIPVLQNFQQLVELHDASVISQSLNSTNANNLDVKSGELK
                     LLLGSWRDRLPNMWDDIVAWQDLVTWRQHIFGLINATYLQLVPAQPQNPGGVSFAYRG
                     YHETAWIINRFAHVARKHALPDVCISQLSRIYTLPNIEIQEAFLKLREQAKCHYQNPD
                     ELTSGLDVINNTNLNYFSAPQKAEFYTLKGMFLEKLNQKNEADSAFGTALYFDITAAK
                     AWAEWGYFNDRKFKENPTDLAAAKQALTSYLQAASSYKNHKSRKLIARILWLLSLDDA
                     NGTIASGFDDFKGEILVWWWITFIPQLLVGLGHKESPRVQHVLLKIAKTYPQALYFQL
                     RTNREDMLAIKKNQDAKERARRAQAQAAANRPNASPQLTKKDPAAAGNSDSRPATANG
                     DASGQVKTEAKPEGEAANTPKAPPPATNGTAQGEQTGGGGGSGGPQKRPPWELTEEIM
                     SVLKTAFPLLALSMETMVDQIQKHFKCPPDEDAYRLIVALLNDGLAYVSRMPTSYARD
                     VKLPSATENNITRFAETILPSHIRGTFEADFVKVKPTMYEYIHNLRKWRDKFEEKLDR
                     RASPVPLESFAHYSPHLSEFRYQKFDDVEVPGQYLQHKDKNQDFVRIDRFLPNVELVR
                     TIGASHRRLQIRGHDGSVHTFAVQHPAARHCRREERILQLFRQLNQTLASKKESRRRD
                     LQFTLPLMVPLAPHIRIVQEDTTYITLQGVYEDHCRRHGIQKDEPMLYTMEKLRGLAD
                     TKGPKPAEHAATARLEVMRAIQEKFVDNTVALEYFQGTFPDFSEFWLFRRRFSYQLAA
                     LTFMTYVLHIDKRYPHKMHIARGSGNIWGSELISFMAANRPYFHNQEPVPFRLTPNLQ
                     TLMGPLATEGIFACSVMAIARCLTEPEFQLEHALTLFVRDEMMYWFTSSHRSVALTEN
                     QLRETVQANSDMIVKKAVSLAQAPAGNLPAHQTVIDLIAKAVNPMNLAMCDALWMPYL
                     "
     gene            complement(2113932..2115186)
                     /locus_tag="MYCTH_2301079"
                     /db_xref="GeneID:11510363"
     mRNA            complement(2113932..2115186)
                     /locus_tag="MYCTH_2301079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661510.1"
                     /db_xref="GeneID:11510363"
     CDS             complement(2114128..2114964)
                     /locus_tag="MYCTH_2301079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661558.1"
                     /db_xref="GeneID:11510363"
                     /db_xref="JGIDB:Spoth2_2301079"
                     /translation="MFSLKFFILAGGLAVLTEAHIRLVSPAPFTNPDQGPSPLLEAGS
                     DYPCHNGNGGGYQGTPTQMAKGSKQQLAFQGSAVHGGGSCQVSITYDENPTAQSSFKV
                     IHSIQGGCPARAETIPDCSAQNINACNIKPDNAQMDTPDKYEFTIPEDLPSGKATLAW
                     TWINTIGNREFYMACAPVEITGDGGSESALAALPDMVIANIPSIGGTCATEEGKYYEY
                     PNPGKSVETIPGWTDLVPLQGECGAASGVSGSGGNASSATPAAGAAPTPAVRGRRPTW
                     NA"
     gene            2117469..2118820
                     /locus_tag="MYCTH_2301080"
                     /db_xref="GeneID:11510364"
     mRNA            2117469..2118820
                     /locus_tag="MYCTH_2301080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661511.1"
                     /db_xref="GeneID:11510364"
     CDS             2117699..2118523
                     /locus_tag="MYCTH_2301080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661559.1"
                     /db_xref="GeneID:11510364"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="JGIDB:Spoth2_2301080"
                     /translation="MKRTYLAFQRNGHLSTLQVVVTAVRTVASLEESNRSLFKGARDD
                     DHVVVTDSTIFHPQGGGQPSDVGAMTAEGEGEGGARFDVHMVRMSAVAQGEVLHCGRF
                     ANPSAGLFRPGDRVTQRIDVEKRLLYSRYHTAGHVLGAAVRHLLEKEVEGFDETKASH
                     FPDSAACEFQGLIEARWKDAIQSKVDEYIDKDMAVEIEWWDEDDFRANGMGRQIPDRA
                     AMGLADDEKFRVVRIVGAETYPCGGTHVQSTKLCGRTMVKKISRSKGTSRVGYTLP"
     gene            complement(<2118949..>2119900)
                     /locus_tag="MYCTH_2125279"
                     /db_xref="GeneID:11510365"
     mRNA            complement(join(<2118949..2118992,2119067..2119131,
                     2119287..2119657,2119736..2119743,2119843..>2119900))
                     /locus_tag="MYCTH_2125279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661512.1"
                     /db_xref="GeneID:11510365"
     CDS             complement(join(2118949..2118992,2119067..2119131,
                     2119287..2119657,2119736..2119743,2119843..2119900))
                     /locus_tag="MYCTH_2125279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661560.1"
                     /db_xref="GeneID:11510365"
                     /db_xref="InterPro:IPR009288"
                     /db_xref="JGIDB:Spoth2_2125279"
                     /translation="MTVEGSAKSDDGTHCAFFYGTLMLPEVFYSVCYGSKNVPEAIAK
                     QHTFQPAILHGYCRRRVRYADYPGIVEDKDHDVFGTFATGLTGANMAKLDYFEGSQYV
                     RKTVTVRLLDKVGNLKGEGNVEGAEREAQVYVFQDKQDLEEKEWDLEEFRREKLRFWT
                     RAGYVFEDCDPNDTAKVEGTS"
     gene            <2120918..>2121832
                     /locus_tag="MYCTH_100777"
                     /db_xref="GeneID:11510366"
     mRNA            join(<2120918..2121220,2121437..>2121832)
                     /locus_tag="MYCTH_100777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661513.1"
                     /db_xref="GeneID:11510366"
     CDS             join(2120918..2121220,2121437..2121832)
                     /locus_tag="MYCTH_100777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661561.1"
                     /db_xref="GeneID:11510366"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="JGIDB:Spoth2_100777"
                     /translation="MSEALVDEIEAINSIFGDGTLAREQDDDLSVFVLTLPGDTASLR
                     LQFPPEYPDVPPAVLGTHSAGSAGKRGAAARHLALFRDAVGEVYEPGQVCLFDAIEKS
                     KSTFVARCAPVTSPSQAADFLAHLLATDKRVRTATHNITAWRIRGPNGTSFQDCDDDG
                     ETAAGGRLLHLMQLMDLWDTMVVVTRWYGGQKLGPRRFALINQTARDAFVRAGLVKEE
                     GAAGGAGGKKKGGK"
     gene            complement(<2122117..>2123727)
                     /locus_tag="MYCTH_2116960"
                     /db_xref="GeneID:11510367"
     mRNA            complement(join(<2122117..2122406,2122446..2123030,
                     2123165..2123555,2123704..>2123727))
                     /locus_tag="MYCTH_2116960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661514.1"
                     /db_xref="GeneID:11510367"
     CDS             complement(join(2122117..2122406,2122446..2123030,
                     2123165..2123555,2123704..2123727))
                     /locus_tag="MYCTH_2116960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661562.1"
                     /db_xref="GeneID:11510367"
                     /db_xref="JGIDB:Spoth2_2116960"
                     /translation="MTAQVSFLDGTLSLIHIPLDLYSSLLQPILKILLPPSQNPSQRA
                     TGGWTIEDHSHGFLNISVTPIECSIVCNSSWASSVFEPAIHRLPKDQAKTVAISRDTY
                     VALSVYGTDMDAGSRVAELTSPLALANIPIFFITTYYSDFILVPTKDREAVVKTLLAR
                     NFVFSDDDQSRLVSANPSPTSTAHHLGLGTARGRAPSNPESQADTVSDLQQRTFDLLK
                     RRHVTPRIEPGLTLVQCSGIRGAVTPSSHPGRSRRGSGAPNGGCGGGGGNGSSGCGGG
                     GPGWVDTVDTRLYTGIVAALAAQPRFLSVTLAQDDPPSLLVDKALLKIFGSALVGPME
                     GALVPIFLDLADLPFEATGIVSGVAGRLVRELNAAAGSGGNGSAGVGVGIGLGAELSY
                     LSTARAGAVILGREQAAVALGVLKPLLAGEEGSEGPS"
     gene            complement(2125493..2127572)
                     /locus_tag="MYCTH_2301086"
                     /db_xref="GeneID:11510368"
     mRNA            complement(2125493..2127572)
                     /locus_tag="MYCTH_2301086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661515.1"
                     /db_xref="GeneID:11510368"
     CDS             complement(2125715..2127499)
                     /locus_tag="MYCTH_2301086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661563.1"
                     /db_xref="GeneID:11510368"
                     /db_xref="JGIDB:Spoth2_2301086"
                     /translation="MSQFATRPDRPLPYSDEFSSADEYVEGLLHFAAHSDLFRFLCGG
                     VHILDFFTTEPGLFAAAVPKDWQDYLLQTKPIDLLDFLMRDDLSSIAPVPGSLTPPES
                     LVRYVKDVRRFSLQRSFRPSRPKLPVLPRHVALGMKTKKIHEVTHFAGYIDRLAEDVA
                     RVTGAEFTHFVDFGSGQNYLGRTLASPPYNKHIVAVESKEANMAGAKDLDILSGLAER
                     EKRVRNKKLYHRVRETVDPSLLKDEEALKRAAKELGAPDEDINTIDLRSRKELQATYT
                     TEEGKGTIQYVVGRLEHADLTDVLSQLRGRENGVRQEDLRMMAISIHSCGNLSHYGIR
                     SMIMNPCIRAVAIVGCCYNLLTEKLGPPTFKPPFSRPTLQPLNARVVRESERRDPQGY
                     PMSERVSTYGGDGIRLNITARMMACQAPQNWTDQESDAFFTRHFYRAVLQKIFLDRGV
                     ISRVFHGEETDTESPFNSSTNPVVIGSLRKQCYTSFTAYVRGAIAKLTTNPDFSQYSQ
                     TIEEKMGNITDEEIAQYEEAFRDRKRELSAVWSLMAFSACVVESLIVIDRWLFLREHS
                     DIVRDCWVETVFDYRESPRNLVVVGIKK"
     gene            <2127876..>2128308
                     /locus_tag="MYCTH_2058620"
                     /db_xref="GeneID:11510369"
     mRNA            join(<2127876..2127920,2127997..>2128308)
                     /locus_tag="MYCTH_2058620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661516.1"
                     /db_xref="GeneID:11510369"
     CDS             join(<2127876..2127920,2127997..2128308)
                     /locus_tag="MYCTH_2058620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661564.1"
                     /db_xref="GeneID:11510369"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="JGIDB:Spoth2_2058620"
                     /translation="VFIFGVNFNENKLVKKALESFYALGPQTSARILAKYCIHPRAKV
                     GTLPPKTVTALTAELSTMTIENEARKIVQDNIKRLRDIGTYRGRRHAMGLPVRGQRTR
                     NQINTARKLNKVERKG"
     gene            complement(2128397..2130427)
                     /locus_tag="MYCTH_2301088"
                     /db_xref="GeneID:11510370"
     mRNA            complement(join(2128397..2129615,2129730..2129942,
                     2130025..2130427))
                     /locus_tag="MYCTH_2301088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661517.1"
                     /db_xref="GeneID:11510370"
     CDS             complement(join(2128567..2129615,2129730..2129942,
                     2130025..2130292))
                     /locus_tag="MYCTH_2301088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661565.1"
                     /db_xref="GeneID:11510370"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="JGIDB:Spoth2_2301088"
                     /translation="MTSVTELPGPLARMGQKADHSSGQELRARRRSWVARAALYVVLP
                     LFLFAWFVRSAGYSTCFGHGLPFSSTKHRSIEARVKRILRHNPLIDGHNDLAIWIRAY
                     YNNHIYNETFSKPFAEGGLGGHIDIPRLRAGLNGGAFWSAFWPCPANGSDYTDENYHR
                     TVQQTLNQIDLLTRLQQAHSDLFLPPTLTSRQALHRFRHSHGRRLISPLAIEGLHQIG
                     NSAGVLRQLHALGVRYATLTHNCGNRFADAALWEHPAPRKAPPVWGGVSPAGRALVRE
                     MNRLGVIVDLSHTSADTMRDVLGGGRDGWEGSLAPPIFSHSSAYALCPHPRNVPDDVL
                     DLVGRRNGVVMVNFNPGFISCVEAPHRDDGLPDFYPQNSTLQQVVRHILHIGRRIGFD
                     HVGLGSDFDGITEVPEGLEDVSKFPALVAELLRQGVSDKDAANIVGGNVLRVWRDVEA
                     VAEKLQRAGEPPLEDDLPRRIAAFDGVDGENFEDATAFAAQQREGEGGRGKKSTESSF
                     F"
     gene            2131741..2135474
                     /locus_tag="MYCTH_2301089"
                     /db_xref="GeneID:11510371"
     mRNA            join(2131741..2132261,2132397..2134007,2134075..2135474)
                     /locus_tag="MYCTH_2301089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661518.1"
                     /db_xref="GeneID:11510371"
     CDS             join(2132216..2132261,2132397..2134007,2134075..2135195)
                     /locus_tag="MYCTH_2301089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661566.1"
                     /db_xref="GeneID:11510371"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="JGIDB:Spoth2_2301089"
                     /translation="MPGFAESFWSNDYAAGLGVLFGKLQQGIVENRQVLTIARMRAEA
                     EEIYGQRLSEIAPAVDKIQGGFDRDDGASVRKAYEGVRAEMEDASRNHKKIAQNIRDL
                     VVNPFSRWCEAHEARIQDSQEELQARIKAHDKQAETVKKLRSNYFNKCRLVEDLEEEN
                     KLAFQDPESSPKQNIPAIKVNQDPAEEEEPLEIGDVLYTPEQVKKMLSHMLATIKMGE
                     TKVPILGTYQNTSAGADIVEYIQQHMGATSVSHAERIGQDLVTHGFLRLVGNVGNTFA
                     NSSKMFYQWRPKAFETAGVPEKKALGRTFSIPVGGSESGDSPVVGTVTEYLAKWDVLN
                     TSRPNETPAERMRREAREADERYKVAVQKLDEMRCELEEAIYMHLKFLERCELDRLKA
                     IKTVILDFSGTISNVIPSLQATVDNMMLFQETVQPLGDLRYLLENYRTGSFIPKVVVY
                     ENYYNKVDDQTFGVDLEARARADRKRVPIIITTILTYLDHHYPDLEGDEARRGVWLVD
                     VPLSQTHKLRAKVNNGQPPALEMFAEFDIPTVASLLKLYLLELPDSLVSSHVYEIIRT
                     IYNSPATEGGDAARIPVLQQTLSQLRLTNIATLDACMNHFTRLIDLTSADEEYVQKLA
                     TTLAPCILRPRTETSLTMEEKHAYRLIRDLFAHKDAIFNELKRLSTMNASGSGKGNQG
                     RPRAISTDESNRKAHMEERNRAILEKASGSRSRATSPAPSPRAHRRDRSVGGPETRFP
                     ISTSNISSPTSEHRKRTSLGPNLPKRTSLEVPGESDASIGLSHPSDGNFIMNGVSATV
                     AASSSSSAAAAAASAASATPATPPSTSAATATDPQLAKVAAAAGGQEGTVEKRNSLGR
                     SGARFGSGRRVTPAASAAARTAAPPPHHQHTGSGSQSSSQAQDHQQQQQGGARHAHQH
                     SVTLVDAPMDD"
     gene            2136121..2139002
                     /locus_tag="MYCTH_2301094"
                     /db_xref="GeneID:11510372"
     mRNA            2136121..2139002
                     /locus_tag="MYCTH_2301094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661519.1"
                     /db_xref="GeneID:11510372"
     CDS             2136278..2138917
                     /locus_tag="MYCTH_2301094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661567.1"
                     /db_xref="GeneID:11510372"
                     /db_xref="JGIDB:Spoth2_2301094"
                     /translation="MASTDILSQTLSSITTIKLEQLQKQKEAYKTKKRALHEDVAAER
                     DTAKRTRKLLKGYEELRSLGLQNSPTLSSLDEFLDQAEYDPSVSEPLLKEYEAEVRHY
                     MDALTNRYEFASLYGKLVEEWIASGSSDADAADGSDVVVVGREEMHQQRATWEAYVFE
                     AKETDGTAIKAYLDDVFSSKEAKRALDDVRKSFESWQKEWKNRVHFDESTLEAAIAGM
                     LRSDILTEEKRTTLRDFKTNKVVLAEIADVLNMRMSAIATWTWGAPLVVEQRRNLNGR
                     YRFYTDEDLLHSIFVYYVGLQWAVQLRGALMGFIEREGVWKPDTKLISKADARRRHFF
                     LDTTTLLHPKSVQAARDSHFRRILLDQLPTSVDEVRGSYGSLGDEEGDNKPSHVAVVQ
                     DLLHRLQTEIIMRTKLGSDVTVIRSDFKWFGPSLPHSTIFAVVEYFGVQAEWIDFFRR
                     VLETDLKFKQDPPDTAARTRKRGTLISTPLADFFSESILFCLDYAVNQQASGTRLYRL
                     HDDMWLWGSSDACGKAWSIVTRFADIMGLELNADKTGSALIVAKKNTAASTASSGSLP
                     QGDVKWGFLKLDPATGRFLIDQEEVDKHVNELRRQLSACRSVLDYIQAWNIYGHRFFS
                     NNFGRPAHCYGRAHIDSMLATFKRIQTALFPDHPGGVVEYLKRTISSRFGIPISDIPD
                     GYLYWPSSMGGLGLQNPFVFLLVNRREVTEDPEKLMDEYLEAEELAYARAKARFEGDL
                     SFSSSDEDDAAPRNYTTLDADTWRNKPEFADLQSEPFMSLAEYTRYRERTVGRLGDVY
                     RKLIGEPEETLLEPSGEIAAVFVAQKRLVKWDELSPYEKWVVQLYHKDMIGRFGGIDV
                     VDQGLLPAGLIGMLRQSRFRWQE"
     gene            2139827..2141290
                     /locus_tag="MYCTH_2301095"
                     /db_xref="GeneID:11510373"
     mRNA            2139827..2141290
                     /locus_tag="MYCTH_2301095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661520.1"
                     /db_xref="GeneID:11510373"
     CDS             2139969..2140778
                     /locus_tag="MYCTH_2301095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661568.1"
                     /db_xref="GeneID:11510373"
                     /db_xref="JGIDB:Spoth2_2301095"
                     /translation="MGLKKRRRTSNAKSKSLPKATKEPERKGTKTPSSTRTRARGPTI
                     RAPFTPYPPSKVYRLIEPGPVLLVSTGPAPSPAGSPSGDDSSTPSSSSSSSAAAVAAA
                     YDINLMTMGFHMMLQHGSPPLVAACIGPWDATYARLRATRECVLAVPSVEMAQTAVDI
                     GNCSAAEDGMTNKFERFGLAALPAERVGAPLVGGEHVIANVECVVEDDAMVDKYGLWV
                     LRVVKAWANPALMPGQGGRMFHHRGDGTFSVDGEEVLDLRERMVKWKMFQD"
     gene            2142208..2143870
                     /locus_tag="MYCTH_2301096"
                     /db_xref="GeneID:11510374"
     mRNA            join(2142208..2142660,2142732..2142952,2143053..2143870)
                     /locus_tag="MYCTH_2301096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661521.1"
                     /db_xref="GeneID:11510374"
     CDS             join(2142496..2142660,2142732..2142952,2143053..2143554)
                     /locus_tag="MYCTH_2301096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661569.1"
                     /db_xref="GeneID:11510374"
                     /db_xref="JGIDB:Spoth2_2301096"
                     /translation="MWEDFEFDPERIPTFKLVFHSLQIVFGFVSWCLEIAVFRADKSR
                     IVGDNGWTFGVFFLSIPAWIYLIMAPRFPRTRKIAEPHAMLVVDTLYTIIWLSAFSTQ
                     AAYNSKNLCGTACSVSKAVVAMAVFVFLFFCVTTFLSVWTLKYYQWNHRLPGYDRAQL
                     SSQNIDPDKAAFSLAPHDEEAYAPVNMDDHDHDDHVDGSHYGGAGSVVGGRSDYSDPY
                     GPGTAGHVGGASTVSSYHDNPFRRQEANPFDGQDTEYHSGSLSAASGRYAAAPAAPAA
                     DGFEDARFPQADYDRIGRP"
     gene            complement(2143884..2145215)
                     /locus_tag="MYCTH_2301098"
                     /db_xref="GeneID:11510375"
     mRNA            complement(join(2143884..2144742,2144840..2145215))
                     /locus_tag="MYCTH_2301098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661522.1"
                     /db_xref="GeneID:11510375"
     CDS             complement(join(2144148..2144742,2144840..2144955))
                     /locus_tag="MYCTH_2301098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661570.1"
                     /db_xref="GeneID:11510375"
                     /db_xref="JGIDB:Spoth2_2301098"
                     /translation="MGRELQKRKRRSSRPKIKMPNRRKKALNPLGNDIIAKNWNKKET
                     LSQNYSRFGLVAKLGKTTGGTAPNNKALLRPAADPLAVRSGDHGLLQVREVKVERDSS
                     GRITRVLRGDNPLNDPLNDLDSDPEEEEKEKEKAGDGQQQKRHEEWAGFGDDNNDDGG
                     KPEVLRALEREASRPVEKAVRHQSERELEWLRRLVARHGQDTAAMARDMKLNPMQQTA
                     ADIRKRLRKAGLLGEEAP"
     gene            complement(2147702..2150777)
                     /locus_tag="MYCTH_2301100"
                     /db_xref="GeneID:11510376"
     mRNA            complement(join(2147702..2149599,2149677..2150777))
                     /locus_tag="MYCTH_2301100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661523.1"
                     /db_xref="GeneID:11510376"
     CDS             complement(join(2147741..2149599,2149677..2150634))
                     /locus_tag="MYCTH_2301100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661571.1"
                     /db_xref="GeneID:11510376"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2301100"
                     /translation="MTAPINTPAPPAAKDAASARKRRRRAPAGGAADDCFTCAKRNVK
                     CDRRRPYCSQCLEIGNDCSGYKTQLTWGVGVASRGKLRGLSLPIAKAPPVSSAKTVKS
                     PTTTTTTAPRARTGSVASTGQWPQEQDDRSAREEVEVKMEMDHRRNPSASLTTPQFPP
                     PPYDMSHLSPTETAPPGWTHIPFSSSIPTNDASRFPPRQIHIPVSSPGDMMQRELIQT
                     PIDSMSDVDYMSPLGHSFPREEVPTFIHSPIVYESFPSHASPGPQSPVAAMMIEHSRA
                     PAPCPSLVYAPSEPASSLHSQLSHVDSMEAQLSRKMPQDCDVLVPGTPDLESYSSSAQ
                     SHGPYWTSSSVDEESVSHSVPDRTPAPWPGSFPSQSPSPVLQVSPDLITKMPFFMDYY
                     EKTMCPSMVFIDGPHNPFREQILRLGTSSRSLQHAICALAACNLRMKRRLSRGHHGRD
                     VGERQLDRTSPIDGSSDGQPMDQSLAEEYQHRNLAVRLLNEQLNDAEKSIHDSVLATI
                     LLLCHYRMAESGVAKFHTQFAGVKKILSLRRMSPYPASRDSAWMEALFTYFDAISASV
                     NDREPQLTTTFYGVPPDTQLLPPGAENLVGCDRELFKTISKLGRLNLLSQHRPVQPLY
                     SPSSLPRVAGSRSASPLGAPFKPPPPPQLNGSDHHHHHNHLQPHGMLGGLPHPINSSV
                     RFDGPPHGFGGAPNHLEDDDLLSPGHLQAATTPYDDPRSMFWREWKEARQALQSWEFD
                     AARVRASLAAAMSPASDPSSGGPVSVSATTLQQQAPTNGQVRDLGSLSEAFRYAALLY
                     TERLASPNVPSDHNNFRNLVSQVVYYATSLEAGSAAEKFLLWPLFVAGSECVNELQQG
                     IVRAKCREIMARSGYMNNMAALEVLERLWAGEGDAVRNPHHHNQHPYSQHQGGGLCGK
                     GKGGPFNWAKCIGGPGVEVEWIMF"
     gene            complement(2159722..2161022)
                     /locus_tag="MYCTH_2301102"
                     /db_xref="GeneID:11510377"
     mRNA            complement(join(2159722..2160495,2160600..2161022))
                     /locus_tag="MYCTH_2301102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661524.1"
                     /db_xref="GeneID:11510377"
     CDS             complement(join(2160035..2160495,2160600..2160642))
                     /locus_tag="MYCTH_2301102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661572.1"
                     /db_xref="GeneID:11510377"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="JGIDB:Spoth2_2301102"
                     /translation="MASATTFYDFKVADKKGAEVSLADYKGKVVLIVNTASKCGFTPQ
                     YAGLEKLWKTVREKYPDDFVILGFPCNQFGGQEPGTNEEIQEFCQLNYGVTFPIMAKI
                     DVNGDNASPLFEWLKNEKPGLLGLKRVKWNFEKFLVGKDGRVKGRWASTTKPESLEAT
                     ILEELAK"
     gene            2161583..2163491
                     /locus_tag="MYCTH_2301103"
                     /db_xref="GeneID:11510378"
     mRNA            join(2161583..2161892,2161973..2162920,2163034..2163491)
                     /locus_tag="MYCTH_2301103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661525.1"
                     /db_xref="GeneID:11510378"
     CDS             join(2161853..2161892,2161973..2162920,2163034..2163383)
                     /locus_tag="MYCTH_2301103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661573.1"
                     /db_xref="GeneID:11510378"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2301103"
                     /translation="MDAQHEKKNIVIVGGGIIGCTTAYYLTRHPKFNPALHTITLLEA
                     SSIAAGASGKAGGLLALWAYPTCLVPLSYRLHKELAAEHNGAQRWGYRRLGCGSLAAV
                     VRTSDLEARAPKPPSPPAENGVDGGLPIQSTASDEKSKDWEKLPKQDGAATGLLRDSP
                     LPPDLNWIDGKLVQYYEEMGSPGATETAQVHPFHFTNAMADLAKEKGVDIRLRAKVTR
                     ISETKTAGVLHSVAYEDRDTGEIRNIDDVTDVIVAAGPWTGKLVPRTRVEGLRAHSVV
                     FEADVSPYAVFTDIQLPADYVPEHRASQGQRRRHRGNVDPEIYARPFGEVYACGEPDK
                     TIPLPATADEVSVDQSQCDDLVAYIGTISPTLAAAPVKARQACYLPQHIRFGEQRGPL
                     IGPTSVPGLWVAAGHTCWGIQNGPGTGYLMAGMIFGDEVDEEVEKLDPRKFKV"
     gene            complement(2164244..2165722)
                     /locus_tag="MYCTH_87557"
                     /db_xref="GeneID:11510379"
     mRNA            complement(join(2164244..2164427,2164474..2165722))
                     /locus_tag="MYCTH_87557"
                     /product="L-threo-3-deoxy-hexulosonate aldolase"
                     /transcript_id="XM_003661526.1"
                     /db_xref="GeneID:11510379"
     CDS             complement(2164569..2165567)
                     /locus_tag="MYCTH_87557"
                     /codon_start=1
                     /product="L-threo-3-deoxy-hexulosonate aldolase"
                     /protein_id="XP_003661574.1"
                     /db_xref="GeneID:11510379"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="JGIDB:Spoth2_87557"
                     /translation="MTVANGTANGAASGSSQATRRPLPCGIYAPTMTFFDPETEDLDI
                     PTIKKHAERLVRDGLVGLVTMGSNGEAVHCTREEKLAVTRATREALDAAGFTQTPIII
                     GATEGSVRGTVELCKLARDAGADYALLLPPSYFRFLMDEEAVHDYFVAVADESPLPLI
                     LYNYPGAVAGIDMDSDLLIRLAQHPNIVGTKFTCGNTGKLTRVALATDAKTPSSEGSG
                     YMAFGGMCDFTVQTLASGGSGIIAGGANVMPKVCVRVWDLYAAGKTDDAIALQRVLSR
                     GDWVLTKSAIAGTKSAIQSYFGYGGYPRRPLKRLDKARVAAIEEGLREVMEIEKSL"
     gene            2168044..2169785
                     /locus_tag="MYCTH_79295"
                     /db_xref="GeneID:11510380"
     mRNA            join(2168044..2168156,2168207..2168369,2168474..2169785)
                     /locus_tag="MYCTH_79295"
                     /product="D-galacturonic acid reductase"
                     /transcript_id="XM_003661527.1"
                     /db_xref="GeneID:11510380"
     CDS             join(2168133..2168156,2168207..2168369,2168474..2169537)
                     /locus_tag="MYCTH_79295"
                     /codon_start=1
                     /product="D-galacturonic acid reductase"
                     /protein_id="XP_003661575.1"
                     /db_xref="GeneID:11510380"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="JGIDB:Spoth2_79295"
                     /translation="MQPLNVLMVGTGEYTTGFVGGGASGSDKKVGVVGLTLFDLRRRG
                     KVGKLSMAGVNGKKFPAIREHLYKNISLVYNNLDTSFESYPADDVVDPEAYKKAIDAL
                     SPGDAITIFTPDTTHYPIALYAIERGIHVLITKPAVKLLEHHLALLEAAEKHGVYVYI
                     EHHKRYDPAYWDARARARKLGDFNYFYSYMSQPKFQLETFKAWAGIDSDISYYLNSHH
                     VDICDSMVSQLGYVPVKVSASASKGVAVSMGCHESTEDTISLLVQWEKKDDRSKKATG
                     VYTASWTAPQKAGVHSNQYFHYLARDGEITVNQAKRGYDVAEDAAGQLVWYNPFYMRY
                     APDEDGNFNGQSGYGYVSFEKFVDGCRAINAGKLKPADLDAKGLPTLRNTIATTAILE
                     AGRRSIDENREVRIESKDGVWKLV"
     gene            2170655..2173002
                     /locus_tag="MYCTH_2301109"
                     /db_xref="GeneID:11510381"
     mRNA            join(2170655..2171362,2171543..2171953,2172125..2173002)
                     /locus_tag="MYCTH_2301109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661528.1"
                     /db_xref="GeneID:11510381"
     CDS             join(2170725..2171362,2171543..2171953,2172125..2172806)
                     /locus_tag="MYCTH_2301109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661576.1"
                     /db_xref="GeneID:11510381"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2301109"
                     /translation="MGSIGATDPRTGLPDNSLSAHVHVDERTPLLHQPGHDATQPSPS
                     PGAGPEQGGRGGGGVEEEEERTVIPTAPLSRARLWLTLGATYVGVFLGAVDSSIMATL
                     SAPIASEFRSLSLLSWLATAYLIANATCQPLSGRLTDIFGRGPGLVFSNAAFALGNLI
                     CGLARGGPAMILGRVVAGVGGGGLMSISTFLASDLVPLKKRGVVQGVGNIAYGSGAML
                     GGVLGGFINDTSSWGWRLAFLLQVPVIVVSGLLVWYLVDVPPKISNKSLLARIDYGGS
                     FLTVGFLVLVLLGLNAGGNLVPWTDPLVLVTLPLGAIMLLALVWWESRAKQPIVPVRL
                     LLERTVLMSCVSCFSCTMVMMMILYYVPLYLQVLGHSATQAGLRILASSFGVSVSSIG
                     CGYIMKKTGKYVGLGISVLVVYTVAVSLVVTLDAAAPAWVPFVAMALLGAAYGGMLTV
                     TLLACIAAVDHSHQAVITSATYLFRSVGATLGITVASAVYQNILRRRLWDRFGDLPGA
                     ADEIERIRDDLGELDRLPDGWYQGVIDSFMEAFRGVWVMALALTVAGLISISFVKQHK
                     LHANLARQDD"
     gene            complement(2173000..2177172)
                     /locus_tag="MYCTH_2301111"
                     /db_xref="GeneID:11510382"
     mRNA            complement(join(2173000..2176821,2176895..2177172))
                     /locus_tag="MYCTH_2301111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661529.1"
                     /db_xref="GeneID:11510382"
     CDS             complement(join(2173198..2176821,2176895..2176966))
                     /locus_tag="MYCTH_2301111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661577.1"
                     /db_xref="GeneID:11510382"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="InterPro:IPR007725"
                     /db_xref="JGIDB:Spoth2_2301111"
                     /translation="MEDELNNDTVHPQVRAHITSLVSALGGYSLDDDDGYKLGDDALE
                     VLRDLKKWIRFYDEKTNRMDVARCLAEANLVGSDLLHILALWSPNDSSKYKARIALAC
                     LEVMVPLTWPIEKDRETMTVNHHRHLPVLQLAQLGYKRAIINFDAAPILGTAVRVALP
                     SMAIPIGDRSARDQGIIKLMLYFLRNIAMIAPPPGVKYEGDETQISRSALIDAFSFQD
                     IFLTILTIASNMGEDFRTEDVIVMEIIFHLVKRVDSSKLFVSEKRLHKMKEDELTAAM
                     KKEAAMLRSYSKNAPTRHSRFGTMIWVKRESGKLATVSGQDALLDAATRERKMDNSKS
                     FRPPRRARREDMEPKDLGPPVSLDERARQQLQSFVSDFLDSGFNPLFSHVRRSIDREA
                     PHVLPSHSSQFFYLVAWFLEAERMRRKAKNDSKKPSAEDDVGSFNLVAEVLNQEMFIT
                     LNRALNRAYGDKDWRLLTTVMRCFTQILLTVQEMFASGNEEDEEIADNILSRLFYEET
                     THDAIANIVRTYKDQGFEYLDACTELTHTFVRILEAYSKQNVDLQVRSRKRRRRRKKA
                     ANKAAGDDGGDEDQDDAEDDSADDERQAEKTSQERKFDFKRFSLRFVPQGVVDTFVTF
                     TKYYRDLDDSQLKRAHRYFFRLAFKQDMSVMLFRLDIIHLFYHMIKGPEPLDKNSSMY
                     GEWEELVKQILRKCIKKLAERPALFTELLFSKINSTAHYLEYGHEKQTVSSNPRPAAE
                     LEFKREVDRERQIAIVVGVLIDRNQTDHLDWLKKQLTEAESERRAWEEAEKARAADGL
                     DGEAAGGTVETGAAKVAPHATIRPDNDARRAAMFKNPHLRLLMKLVGLERLAPTLDET
                     PDSVWVVPGSIPADSLKETISLINQAEFNPPTFEDGELAEDQLRRKSAARRRAAHDDD
                     GGDNGINDFINDGSEEDDDDGAGILFPRGGPTTRKRTAEDEPPPPPKRKRRRRRGSDE
                     AETDEQREARARARRKKERERARRIKSAMYVDLREDDSDWEGNKEADREFFARERERQ
                     AAKDASFGLVSGSRPSGVGVELWEELLGLGAAASDGEDGEDGGARRGRKRKSVGDDGD
                     SDGDALSDDDQDDDGATAESESGSSSSSSSSSSARRPNKRRRTTQKKKNKAAEISSDE
                     DEDEDMTGADDAMDSTQSSKDGAVTNDTPLSSSPGRQTADAAAEKAGERADGMGDEDD
                     DVPVAKAATRGRPRARAGFIVESSDEE"
     gene            2177456..2178907
                     /locus_tag="MYCTH_2301113"
                     /db_xref="GeneID:11510383"
     mRNA            join(2177456..2177647,2177830..2177929,2178003..2178907)
                     /locus_tag="MYCTH_2301113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661530.1"
                     /db_xref="GeneID:11510383"
     CDS             join(2177519..2177647,2177830..2177929,2178003..2178736)
                     /locus_tag="MYCTH_2301113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661578.1"
                     /db_xref="GeneID:11510383"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /db_xref="JGIDB:Spoth2_2301113"
                     /translation="MAAPMMLARQALRLSSRVRYFSSTAARPAAEVKRLGVVGAGQMG
                     LGIALVAAQKAQVPVTLVDSSQASLDKGLAFAEKLLAKDVSKQRITQEQADATRALLQ
                     PTTSIDDLSPVDFVIEAVPEIPELKFDIFAKLAEICPKHAILATNTSSIPITRIAAAT
                     ARGNPNDTSNSSRVVSTHFMNPVPVQKGVEIISGLQTSPETLDTAIEFCKRMGKIPSV
                     SADSPGFLANRILMPYINEAIICLETGVGDRDSIDAIMKNGTNVPMGPLQLADFIGLD
                     TCLAIMKVLHTETGDSKYRPSVLLRNMVDAGWLGKKSGRGFYEY"
     gene            2189539..2192211
                     /locus_tag="MYCTH_2301118"
                     /db_xref="GeneID:11510384"
     mRNA            join(2189539..2190481,2190548..2190685,2190778..2191469,
                     2191549..2192211)
                     /locus_tag="MYCTH_2301118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661531.1"
                     /db_xref="GeneID:11510384"
     CDS             join(2189892..2190481,2190548..2190685,2190778..2191469,
                     2191549..2192171)
                     /locus_tag="MYCTH_2301118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661579.1"
                     /db_xref="GeneID:11510384"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="JGIDB:Spoth2_2301118"
                     /translation="MSNNFDTVTQSDWQGQYSFLPPGDNTIFSQPYEHVASSTENAES
                     PAQPRTVVAPSEAPKAEGSPLGQRLDPLGLRQTKQPSPIPEQPENQEEQCPSKAPELT
                     HEESTTSTETRDVSLGSNPLSSVSSAPGQGSEAGAPSQSGNEGQPAAVKEEEEEEEVV
                     EDEEMAEGGEGGTEAQPQQPQTAAERTAQRRKMKRFRLTHQQTRFLMSEFAKQPHPDA
                     AHRERLSREIPGLSPRQVQVWFQNRRAKIKRLTADDRERMMKMRAVPEDFDSLSALHS
                     PYGAVHALGTPITSPVDLGGSSYAPLMVDVRRHDGDEHLSPTGLSPAFGNIGFGHSAG
                     LGTPDILSPISPTSTDRYGYPSHLSTTPLSAGPRTSNPFARQASLDSGMQMHNAHSRQ
                     QIRPLQPLQLRDTMTRSRSDSLQSPLRSSMSWKGDAIDYTTYQGGNPSSHLGSRQHSI
                     YHQDQVGGSSAGGLGAYESGNYSASAVQSPAHYSGFQSSSLQASQQRNSRLRAASASS
                     LPLGLDLRTQFRSAIGSGGGLPNSTQSPGPRTASTPQLGGVSSGFTGSFPSTPLTAPV
                     DFSLPRSSAAYRTSTTDYSMPQMSAPIAPPNDFSQAFQASMSSPSARTPMRDSFGGGG
                     GGGGGGAGPLGLGPQRQGPGDRSDDYSDPLGMKRKRSFTGPLPATTAGAGAYGSTA"
     gene            complement(2199070..2202346)
                     /locus_tag="MYCTH_2301123"
                     /db_xref="GeneID:11510385"
     mRNA            complement(join(2199070..2200260,2200411..2200901,
                     2201008..2201073,2201197..2201367,2201502..2201954,
                     2202284..2202346))
                     /locus_tag="MYCTH_2301123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661532.1"
                     /db_xref="GeneID:11510385"
     CDS             complement(join(2199212..2200260,2200411..2200901,
                     2201008..2201073,2201197..2201367,2201502..2201884))
                     /locus_tag="MYCTH_2301123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661580.1"
                     /db_xref="GeneID:11510385"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="JGIDB:Spoth2_2301123"
                     /translation="MASTSEKHTGPGAGPTLPTTNDPGRRQDRPGAGLRIRDWVRSPG
                     AGVSRRLGHDSGSSSADAAAVGGSEPAAEQRRRSPPKHDPWWNIHLFRGMVNDVRKRA
                     PYYLSDWTDAWNYRVVPATVYMFFANILPALAFSLDMFNKTSMQYGVNEVLLASVLGA
                     VVFSVLACQPLVIVGVTGPITVFNYTVYDIMMPTGTNYLAFMCWIGLWSLVFHWILAV
                     TNSCNWLRYVTRFPCDIFGFYVAFIYLQKGIQILETLGDDEPFYLSVVVALCVFGVAY
                     ICGELGRSSLFKHPVRVFLKDYGTPLTLVFFTGFVHMGKMKHVSLETLPTGIAYMPTV
                     SDRGWFIHFWDIPVRDIFIAIPFALLLTILFWFDHNVSSLIAQGTEFPLKKPAGFHWD
                     LFLLGLTTGVAGLLGLPFPNGLIPQAPFHTESLCVTEVVPSGSSSVSPDSSDTDNNPS
                     SSSGATKGFRLRAAYVVEQRVSNLAQGLLTLVAMTGPLLTVLHLIPQAVLAGLFFIMG
                     FQALEANGITAKLLFLFRDAALTPPGHPLRRRQKGVRRAAVWAFVAVELLAFAATFAI
                     TQTVAAVGFPVFIFALIPLRALVLPRWLTREELDVLDEPTASPFTMESVGGTFGGRGG
                     GGGGGGGDEDGRGGGGSHGYDSVFLDDVPGGEPGSGDETEKRGKEREESDRDRGRGHG
                     RGDDGDVRSDEDLAELGESRSAGMRRRLSTLHRDESV"
     gene            complement(2203261..2206305)
                     /locus_tag="MYCTH_2301126"
                     /db_xref="GeneID:11510386"
     mRNA            complement(join(2203261..2204182,2204251..2206305))
                     /locus_tag="MYCTH_2301126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661533.1"
                     /db_xref="GeneID:11510386"
     CDS             complement(join(2203383..2204182,2204251..2206159))
                     /locus_tag="MYCTH_2301126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661581.1"
                     /db_xref="GeneID:11510386"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="JGIDB:Spoth2_2301126"
                     /translation="MFRTSTRQLARCSRLPLRPLARPAVRAARFPQTAPAATLLSTRY
                     NSTNSPRPDGENEPPNQPPKKQDDAGKSNQPTPPPRREPPPGFVRLTQEEYAELTSIL
                     ALLPSKQQRAELEDIFKDATEVGVPVELRDILRSKMNGQLTMRDALRIPRIAYQIASK
                     IDAYERSQKGNVPDFTSNKPGEDKEAGQDRQQGTEGEQHQQQHQQQQQRQQQQQQSGN
                     QQGQKKQGGGKQQPPRRFDGSDALTWAISAALLYPFYSMFFSSETSREITWQELRKNF
                     LDRGLVQKLVVADKRVRVELNRDAVRAMYPDSQAANPNFVYYFSIGSVDAFERRLDEA
                     QNELGIPPNERIPVSYAQEGMAANLIMAFGPTIMIVGLLAWLSRRAGTMGGGSSGMFG
                     FGKSRAKMFNHDAAVKVKFSDVAGMDEAKTEIMEFVSFLRTPERFQRLGAKIPRGAIL
                     SGPPGTGKTLLAKATAGESQVPFYTVSGSEFVEMFVGVGASRVRDLFATARKNAPCII
                     FIDEIDAIGKSRSEGGGFRGGGNDEREATLNQILTEMDGFNTTEQVVVLAGTNRPDIL
                     DKALMRPGRFDRHIHIDRPTMKGRKDIFKVHLQKVLTKEDMDYLTGRLAALTPGFAGA
                     DIANAVNEAALIAARANASSVEMIHFEQAIERVVGGLERKSLVLSPEEKRTVAYHEAG
                     HAICGWYFRWADPLLKVSIIPRGQGALGYAQYLPSSDAYLMNTNQLMDRMAMTLGGRV
                     SEELHFPTVTTGASDDFKKVTRMATTMVTQWGMSEKLGPLHYENDQNQLHKPFAEATA
                     QAIDAEVRRIVDQAYKQCKDLLVAKKKEIGIVAEELLRKEMLTRDDLVRLLGPREWPE
                     KEEFSKFFDNRHGEKSAPPPFPTENTDESSTLLDEDKKTPPTEGER"
     gene            complement(2207538..2210600)
                     /locus_tag="MYCTH_2301131"
                     /db_xref="GeneID:11510387"
     mRNA            complement(join(2207538..2208792,2208854..2210090,
                     2210155..2210600))
                     /locus_tag="MYCTH_2301131"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003661534.1"
                     /db_xref="GeneID:11510387"
     CDS             complement(join(2207727..2208792,2208854..2210090,
                     2210155..2210506))
                     /locus_tag="MYCTH_2301131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661582.1"
                     /db_xref="GeneID:11510387"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2301131"
                     /translation="MHVVPNLVGVGLLGEDDNGATDLGTLEKKLVEKHQQSRQASQAI
                     SDTASPQPTSGQDGSGSTPHSSLTSPGPAKDGDKRRSATPENDSQDDDREDVAELSEM
                     MCSLVTNTNGETRYIGSSSGFSIFSPKGVQWVNEKMGDTSFQQMISDVSMDDHKWNAW
                     KPDVFGDLFRRTIFRDLPPKPEALSLLRDYFENFNCIFPLFHQPTFMHLVERQYSNDP
                     YTGSGWWASLNVALAIAHRLRVMSNLVPQEEDEKAWGYMKNAMAVFSELAMRNTDLLS
                     VQALLGMSLFMQGTPNPQPSFLLIATAIRLSHTIGLHKRGTNFNLNPIEIEQRKRVFW
                     IAYMLDKDLCLRSGRPPAQDDNDMNVELPDADPADGIGNIPLADGKGKMNLFRVMCEL
                     AIVESKVYTRLYSTKATKQSDGELLNTIGELDKELEEWKDRIPIDFRPEHEIKASHTP
                     LILHIVMLHFNYYNCLTTIHRMSIHHGYWTSRLSNFAIRGLNARPLNPRIFSSAALCT
                     SAARASISLLKYIPQGDFSCVWMVLYFPVSALVTLFGHILQNPLDPKARSDTKLMNVV
                     VNFLSTLGHEAETGGVHRMLGICSEFERIAKVVIEKAEKEHASRRKRKNQDQSLNKSA
                     VDSGNANTSAADSPSFNPNPAPPTSRPTAANAATPQASGNHTVTSNQRSIPPQGNDSR
                     SSANESNNNNNNNSSSNSSSSNANSNGNGNGNGSKNNGYGSMTGAMSQSPSPSLAATG
                     WGQVGEFTPDSSDYNKSAYAADMASFDTLDTAMTAGGMESPPLVGPDGELVFQQPMLP
                     QDLFSLPMTLDWNWAEMSGGAYPSVENGNFGGGGMDGMDGMGGMAVGVAGGGTTVGHH
                     QQHHSGSGGGGGGGEGRDFRAQGMMQGR"
     gene            complement(2210601..2211282)
                     /locus_tag="MYCTH_2301134"
                     /db_xref="GeneID:11510388"
     mRNA            complement(join(2210601..2210827,2210908..2211282))
                     /locus_tag="MYCTH_2301134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661535.1"
                     /db_xref="GeneID:11510388"
     CDS             complement(join(2210696..2210827,2210908..2211123))
                     /locus_tag="MYCTH_2301134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661583.1"
                     /db_xref="GeneID:11510388"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2301134"
                     /translation="MMDRNMHSGFQMPIQPPPLMNPPPQIFGGGAGYGELGMPMPQFS
                     PDLITAQMFGDHGLLEDTTEAKRRRIARACDMCRKKKIKCDGKLPACTHCTNYKTECV
                     FTQVEKKRSPPKG"
     gene            2213674..2213746
                     /locus_tag="MYCTH_t59"
                     /db_xref="GeneID:11510389"
     tRNA            2213674..2213746
                     /locus_tag="MYCTH_t59"
                     /product="tRNA-Trp"
                     /note="Anticodon: CCA"
                     /anticodon=(pos:2213707..2213709,aa:Trp,seq:cca)
                     /db_xref="GeneID:11510389"
     gene            complement(2214019..2216611)
                     /locus_tag="MYCTH_2314597"
                     /db_xref="GeneID:11512508"
     mRNA            complement(join(2214019..2215881,2215944..2216611))
                     /locus_tag="MYCTH_2314597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661536.1"
                     /db_xref="GeneID:11512508"
     CDS             complement(join(2214956..2215881,2215944..2216478))
                     /locus_tag="MYCTH_2314597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661584.1"
                     /db_xref="GeneID:11512508"
                     /db_xref="JGIDB:Spoth2_2314597"
                     /translation="MTNQGDPSGPSLFQARGTRHDHDHHHHHHHNHNHNHNHQHLHLH
                     QHRRLQSAEVDPTSTYIRSPPSEKLHGRHVVVVQTVSVVQFIDATGAVTSVETLTPDP
                     VESSNPVFPAAVTSFSSEVGDALPSVSLTDLLPDLTDGAPSKTSSSLLASSETLTSTP
                     LTTSSAFPTLSVTSNSSSTHVSSLFGNHTTNLYSNSSRTSSALRSVFASTTTRSSSSL
                     WTSTTSVTAATIEVGEAGADSNTGGESSVAAPAPTDPTSESHSSGLAPETRNAVVGGV
                     VGSVAGIALIVIALLFLLKWRKRRGQGIMLLGDGDNNARGRGFSSPEPASPSGGKSMV
                     QRAGAFSIPSALARLSGKRAIEEPSAGPSPQEKGFYRVSGRKLISVLESGGDGYSDPH
                     DSNGSGSSHYRDSQGGLLDSSNPFQLGSPMRPVSGVPIFRDGAQRTPVHEQGPLRPGH
                     RPSVFPRTSSTSDSPGRGFAFRDGSRGSGFRFTEDA"
     gene            2217988..2220631
                     /locus_tag="MYCTH_2301141"
                     /db_xref="GeneID:11510390"
     mRNA            join(2217988..2218761,2218836..2220631)
                     /locus_tag="MYCTH_2301141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661537.1"
                     /db_xref="GeneID:11510390"
     CDS             join(2218261..2218761,2218836..2220347)
                     /locus_tag="MYCTH_2301141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661585.1"
                     /db_xref="GeneID:11510390"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="JGIDB:Spoth2_2301141"
                     /translation="MRRAPTPARESSSLDIPHPPYLFPTSLSSLRLSNQPEGGVSNLY
                     GSSQWDRRDPRTSSAQSLVPSAEETEGHIRKRKLLVVYIHGFMGNDSSFRSFPAHVHN
                     FLKTLLGETHVIHTKIYPRYKTYKSIDVACENFSKWLAPHESPTTDVVLVGHSMGGLL
                     AADVVLLPSQSPWDASTPFRHRILGTVSLDAPLLGLHPGVVVSGIASLFRPAQSPPLI
                     CEDSQSEHAEASQSQTPSTRPSSCSEMLPSDEASSPHFGSSPAPQDPYFNPPFPNDVA
                     FVDRGWFKNIIHFAAKHKEENLAYAAANHIMSHLEFAACLADFAGLKSRYNRLRALED
                     VDNWNQPGAVRVRFANYYTVSTGMIKKSRTPSPCGSPRRPDGCEVRRPSLRDAGSLAS
                     DQQILSEDVDVKPPRISIEEYSDGSGSDSLRVLDPMPEPESGPVHEPGSKSLASSEIS
                     RPPSRHEKETQEGGKASDAKDDNLLSVEDEPIGGDTTFSPIPAVPSPPEVPSLDALPD
                     KESRKRAEKAYKAALKAYAQAVKKRDRALEVRQKALDKRQRKALKEAKKMEKEQAKLL
                     CKSPSTKDEEQGEGTKVEERTGKEKPPRRRKFCMLPPKSSDGTVDPTWVEVYMEGVDE
                     VGAHCGLFLPGRHYEPLVGDVGERIAAWVREEESRRVVVGQAGSEV"
     gene            complement(2221461..2222469)
                     /locus_tag="MYCTH_2301145"
                     /db_xref="GeneID:11510391"
     mRNA            complement(2221461..2222469)
                     /locus_tag="MYCTH_2301145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661538.1"
                     /db_xref="GeneID:11510391"
     CDS             complement(2221653..2222297)
                     /locus_tag="MYCTH_2301145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661586.1"
                     /db_xref="GeneID:11510391"
                     /db_xref="InterPro:IPR013942"
                     /db_xref="JGIDB:Spoth2_2301145"
                     /translation="MYGLTGLAAEVARVLPNGEKNALRKTYKGHIKRLGVQGHFDEVK
                     QDPNREYSLTYLMKLPQDVWDYQHVRGQDIKDGFSSEVQQKLLRAMTMGKGVVPKSQW
                     DSSVLGDLAPGKADRQSLSARPTAPNTPVPSAGLQGVPRPKVGTPLAQPQDAGRSMRN
                     IKKRSYGDSSFEGYGEGYGDDETAAETGYSTGEGDMASGQKRRKKVLINDYDPV"
     gene            complement(<2225079..>2226195)
                     /locus_tag="MYCTH_2059227"
                     /db_xref="GeneID:11510392"
     mRNA            complement(join(<2225079..2225857,2225942..2226041,
                     2226115..>2226195))
                     /locus_tag="MYCTH_2059227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661539.1"
                     /db_xref="GeneID:11510392"
     CDS             complement(join(2225079..2225857,2225942..2226041,
                     2226115..2226195))
                     /locus_tag="MYCTH_2059227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661587.1"
                     /db_xref="GeneID:11510392"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="JGIDB:Spoth2_2059227"
                     /translation="MAGRGMKSLSEAMRGLSLAAQPCRRLPVRQASVPCGRTMATAVE
                     SQPANITRSVSEAWNSSTTVPLTIYSFPSLEPRSLESWSAKHLHLPLRRDILHLAVVY
                     EGDKTRQGTASSKTRYEVHGSHRKMRPQKGSGRARLGTKQSPLMKGGGKTFGPKPRDF
                     STKLNRKVYDLAWRTALSYRYRRGELIVTEDGLELPLPEDFLQLADAGVMGRELEDGF
                     VRRYVGELMASLQWDKAHGRTTFITGDRRPNLFTGMEIAGENGRALELEDVDVKDLLE
                     TGRIVIERTALREMIKEHSSDLVSRVVVKGLNTKPTLGQVLVP"
     gene            2226561..2228244
                     /locus_tag="MYCTH_2090388"
                     /db_xref="GeneID:11510393"
     mRNA            join(2226561..2227239,2227321..2228244)
                     /locus_tag="MYCTH_2090388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661540.1"
                     /db_xref="GeneID:11510393"
     CDS             join(2226630..2227239,2227321..2228144)
                     /locus_tag="MYCTH_2090388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661588.1"
                     /db_xref="GeneID:11510393"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="JGIDB:Spoth2_2090388"
                     /translation="MSRPQQVVRPIVRSLQQATGRPATCSSRPIIALRQFSSTPSRKD
                     EVTTTTTTTTSTSAESVQDAQKLAADAALLGQKKPSRIPSTIKQGTEEELAQLMSPQL
                     GSRRRRAALATTSNIPFEQLPYQCFQEARKILAQDREEKVAKIIAETAKIKRLEATDA
                     SVFRGGEAYKQRRLESLRKYVEELKILADINDPMVKRRFEDGQGDMNKPIYRYLAHRK
                     WCSMARKIIIQRIEQFHIVPDLLPKFEPVMDVRMTFRGYKAPPGAIMDSRITENPPTL
                     HMQVFDKGERLFSVVVMDADVPDPETDSFKKRLHYMATNITWSPTKETLPLGQIGSEA
                     SSGSAPGTGALAVPWLPPTAQKGAPYHRLAVFVLQHKDNAPLDTAKLRELYDGQGRDG
                     FSLKSFRDKFNLNPVGFTMFRTVWDDNMADVMARHGIPGADIEFKHKRVYSLKPPRKA
                     RGWEAKRQGPKYRHLWKYTKRIKGIKF"
     gene            complement(<2230941..>2231948)
                     /locus_tag="MYCTH_2019888"
                     /db_xref="GeneID:11510394"
     mRNA            complement(join(<2230941..2231680,2231732..>2231948))
                     /locus_tag="MYCTH_2019888"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661541.1"
                     /db_xref="GeneID:11510394"
     CDS             complement(join(<2230941..2231680,2231732..>2231948))
                     /locus_tag="MYCTH_2019888"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661589.1"
                     /db_xref="GeneID:11510394"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="JGIDB:Spoth2_2019888"
                     /translation="KSDQRTKTKRSVGDLALQFMKGAKRDSLKNEDLQSLVRLCGSSK
                     LYLPSEYSPASLLLPTCFRATVQYLVEHGAKTRGVFRIPGSARTVKALYDYYCAEGDA
                     GEISSTTCWPNLPSHIKAGVHDVASTFKRLLSGLPGGILGSLSLLDALVAIQGQLKAE
                     PDLGDTRQRKIRAKLIALAIGAVEPRLRRDLICAVFGLLCLIGSAAEKAPREDDDERP
                     LSSSDLMGCEALGIVFGPLLVGDLLDSYSLVATGSTSDPKLLSVTVYEGKKECRRLEA
                     SEGVHQTPPPVDLIYMANNVTKMLITDWREVVRHMRSLWVSRS"
     gene            complement(2233087..2234795)
                     /locus_tag="MYCTH_2301155"
                     /db_xref="GeneID:11510395"
     mRNA            complement(join(2233087..2233837,2233900..2234049,
                     2234135..2234258,2234397..2234795))
                     /locus_tag="MYCTH_2301155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661542.1"
                     /db_xref="GeneID:11510395"
     CDS             complement(join(2233173..2233837,2233900..2234049,
                     2234135..2234258,2234397..2234624))
                     /locus_tag="MYCTH_2301155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661590.1"
                     /db_xref="GeneID:11510395"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="JGIDB:Spoth2_2301155"
                     /translation="MDDPRAPAEEAHPGSRSARAPTPAGGENGSGQQLPLRQGHELPF
                     VAPSSYLRPKPPSRTMSEKTPSALDRDQMQGLRGIREFLKVRTSYDVLPLSFRLIVLD
                     TELLIRKSLNILIQNGIVSAPLWDSTNSTFAGLLTSTDYINVIQYYCQFPDEIDQVDK
                     FRLSSLRDIERAIGVLPLETVSVHPMRPLYEACRRMLKTRARRIPLVDVDDETGREMV
                     VSVITQYRILKFIAVNNEKHTILLRKPVREIGLGTYTNLATADMNNSVLDVIHLMVKH
                     NISAVPIIDSENKVLNVFEAVDVIPCIKGGAYDELTSSVGEALSKRADDFPGIYTCSE
                     DDRLDAIFETIRKSRVHRLIVVDDDNRLKGIISLSDILKHVLLFGAEDDNIRAG"
     gene            2236200..2238688
                     /locus_tag="MYCTH_2301159"
                     /db_xref="GeneID:11510396"
     mRNA            join(2236200..2236575,2236630..2236715,2236770..2236890,
                     2236960..2237073,2237130..2237375,2237424..2238173,
                     2238223..2238688)
                     /locus_tag="MYCTH_2301159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661543.1"
                     /db_xref="GeneID:11510396"
     CDS             join(2236545..2236575,2236630..2236715,2236770..2236890,
                     2236960..2237073,2237130..2237375,2237424..2238173,
                     2238223..2238554)
                     /locus_tag="MYCTH_2301159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661591.1"
                     /db_xref="GeneID:11510396"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="JGIDB:Spoth2_2301159"
                     /translation="MGICSSTCCGGKSRDALYENVLAENEREAVADLLQYLENRAETD
                     FFTGEPLRALSTLVYSDNIDLQRSASLTFAEITERDVRAVDRDTLGPILFLLENPDIE
                     VQRAASAALGNLAVNTENKVLIVQLGGLQPLIKQMMSPNVEVQCNAVGCITNLATHED
                     NKAKIARSGALGPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVNAGAIPVLVQL
                     LSSSDVDVQYYCTTALSNIAVDAVNRRKLAETEPRLVQYLVNLTESSSPKVQCQAALA
                     LRNLASDEKYQLEIVHAHGLKPLLRLLRSSYLPLILSAVACIRNISIHPQNESPIIEA
                     GFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKSLVLEAGAVQKCKQLVLEVPV
                     TVQSEMTAAIAVLALSDELKTHLLGLGVFEVLIPLTKSPSVEVQGNSAAALGNLSSKV
                     GDYSIFVQNWTEPSDGIHGYLSRFLASGDATFQHIAIWTLLQLLESEDKKLIGLIGKS
                     DDIVDMIKQIANRQMESDNEAEDDDEGEVVNLAQRCLELLGQGASKSHIEG"
     gene            complement(2239053..2240033)
                     /locus_tag="MYCTH_2301160"
                     /db_xref="GeneID:11510397"
     mRNA            complement(join(2239053..2239282,2239343..2240033))
                     /locus_tag="MYCTH_2301160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661544.1"
                     /db_xref="GeneID:11510397"
     CDS             complement(join(2239100..2239282,2239343..2239897))
                     /locus_tag="MYCTH_2301160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661592.1"
                     /db_xref="GeneID:11510397"
                     /db_xref="InterPro:IPR011056"
                     /db_xref="JGIDB:Spoth2_2301160"
                     /translation="MPFLNPRFRRLPRPTALRINPKSTISSPRPSSTPLSSSSLPSPA
                     PSSSSTNATSNPNPHSHGGSSKGKPGGQPSWLGHPFRVILATLKFVAFAHLLWEYVIS
                     MAPASGPSMLPTFEVLGEWLLVSKLHRFGRGVAVGDVVAYNIPINDEVGVKRVLGLPG
                     DYVLMDTPDGGGVAGGGGGGPSMIQVPKGHCWIVGDNLVASRDSRYFGPVPLALIRGK
                     VIATVRPFSEFKWITNPLRKASSPSDD"
     gene            2240041..2241255
                     /locus_tag="MYCTH_2301162"
                     /db_xref="GeneID:11510398"
     mRNA            2240041..2241255
                     /locus_tag="MYCTH_2301162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661545.1"
                     /db_xref="GeneID:11510398"
     CDS             2240204..2241109
                     /locus_tag="MYCTH_2301162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661593.1"
                     /db_xref="GeneID:11510398"
                     /db_xref="JGIDB:Spoth2_2301162"
                     /translation="MKTSQCLFNSATAIRKVFISNAASLEARGQLQRLLLPSMAVPIQ
                     RTSFSSSSQRPFSSNQIARARYNKNRPGNEGAPANNDRTMRDYDIVFPWIQIRQENGS
                     LTEPQRTSAILKRLDMGRQSLVLLATPRTDASSKGPEYPICRIVDRQAELAAQAERDA
                     LKKKMPKVVSKELEINWATAPHDLRTKMTQLKKFLSKGYQVRVTMMHPKKRDKRRASL
                     DEAGALLKTVESTIGEVPGAKETKPREGSVGETLVLLVQAPTGGGSGAPTETGSPEAV
                     STDASSTKPWPEPVLLAKKPESTKA"
     gene            2241575..2243398
                     /locus_tag="MYCTH_2301163"
                     /db_xref="GeneID:11510399"
     mRNA            join(2241575..2242411,2242513..2243398)
                     /locus_tag="MYCTH_2301163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661546.1"
                     /db_xref="GeneID:11510399"
     CDS             join(2241851..2242411,2242513..2243352)
                     /locus_tag="MYCTH_2301163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661594.1"
                     /db_xref="GeneID:11510399"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="JGIDB:Spoth2_2301163"
                     /translation="MPAENNGPPSNGAPSGSAAPAARDGTENAPASAKSTAPPADTEK
                     LTPAQLKAKAKAEKAARRAQVKEARAAAQSASPAGDRGAAADAKGGKSKGKQDGQQPQ
                     GKGGHLQVHRPSVSGRRPSSPMTEKDVRSAIPDCFSHVPMAKRISTSQAHKDVHPAVL
                     AVGQQMATFALNDSISRLKATLLAFRKVIESYETPKGNSLSRHFVPHVLNPQIEYLTE
                     CRPMCFAMGNAIRLLKGKVNKFDIDTAEDEAKEGLLEWIDFLIKERITLAEYAIARNA
                     AQSINEGDTILTYGRHRLVEKTLLEAKRDGKSFDVTVIDDPFQRGGLELAKTLRQAGI
                     PVLYSPNLGGLRPKVAAASNVFLGGEAIFANGSLHAPSGTADVAMAATNAGVKVIVLC
                     ETINFDRDRVSVDSLTYNEIDPERNTADSFRLLFDNTHDKYITGVITEFESGGGNSPA
                     QAILALLRKQEDPLID"
     gene            complement(2243449..2244377)
                     /locus_tag="MYCTH_2314601"
                     /db_xref="GeneID:11510400"
     mRNA            complement(join(2243449..2244043,2244135..2244377))
                     /locus_tag="MYCTH_2314601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661547.1"
                     /db_xref="GeneID:11510400"
     CDS             complement(join(2243799..2244043,2244135..2244168))
                     /locus_tag="MYCTH_2314601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661595.1"
                     /db_xref="GeneID:11510400"
                     /db_xref="JGIDB:Spoth2_2314601"
                     /translation="MVSRVLFWAGFGIVVRFWQLGIEMRPFFNKGSLWAYPVFGGVGA
                     SFGYWLQGVDERQTKMLEERKQAILEKRARRAERAAKAAAAAPSEAAA"
     gene            <2245160..>2248172
                     /locus_tag="MYCTH_100744"
                     /db_xref="GeneID:11510401"
     mRNA            join(<2245160..2245366,2245421..2246072,2246223..2247953,
                     2248102..>2248172)
                     /locus_tag="MYCTH_100744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661548.1"
                     /db_xref="GeneID:11510401"
     CDS             join(2245160..2245366,2245421..2246072,2246223..2247953,
                     2248102..2248172)
                     /locus_tag="MYCTH_100744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661596.1"
                     /db_xref="GeneID:11510401"
                     /db_xref="JGIDB:Spoth2_100744"
                     /translation="MPAALEPSATAASGEQQIVAPPAPRKFKASDLPLPSATRTAIEG
                     LAHAFKKKGGYDAIRKQVWEKFEASDYEAQVTQAILEVAEQEVERNPTQLLTLERGKA
                     AALIDGALDRGGVYQKAEELISALIDSRAIEEHIRQLRRAEIGDEAAEQERIRGAKTD
                     EEYAAETAARRAERERVRAELKAVEEKKRQLEREIKAREDAKRREAERIAREERRKKE
                     REEDERREKERRERREKERELEREREKEREREREREHESRRERERSRDWDRDRDRDRD
                     RDRDRDHDRDHRSRDRDRGRERDRERDRERDQTRDRRDSRESRAKPSIDGRTDEVEKK
                     LSKEDHERLEQEALADLLRESKRVATKQPELEVDETLVPPPKKAKPASAITPIQRPAT
                     KLSEPKAVEAKTSALDSKKPTDSKDTKESSNTKLSTASKDSEAKPERGRTRSPSRDSR
                     AHRGRDRSRSKSVDRRRRDARSRSRSRTPRPRDRSRSRRRSRSRFRDRRAERKDDYRD
                     DRRDEYRHSRRDDSRSTRRDDRKEDRRYDYRDRSRSRDRADRRERSRSRLRSARIDDR
                     RDRSRSRRRDPRDRSRSPRPRTERRDRSRSRLRFGRRDRSRSRSRDRDYRDRRERSRS
                     RARSDRDRSRDRNREKDRIKEEDRERRRRSRSRSARPPSRMSHTDMEAWKQAEVKKRE
                     QEAKAYLAAQKEAREKGLPVPGIDDCRPGDRSPDLKRRRDPEEHDRYLPGDRDRHRDR
                     DQERDRMDYRGGDRYDGDRDRPRDRNRDRDRDRDRDRRDRSRDRDGDRARDDRRGTRR
                     HSRSRSRERDRDRSRDRSRDRDRDRDRDRDSHYRRSRRERSVSSRRDRDWDRDRDRDR
                     DRDRDRDRLSHSPNLPQAEKAARLTTPMRN"
     gene            complement(2248562..2250661)
                     /locus_tag="MYCTH_2090403"
                     /db_xref="GeneID:11510402"
     mRNA            complement(join(2248562..2249221,2249322..2249555,
                     2249622..2249929,2249988..2249993,2250063..2250130,
                     2250230..2250661))
                     /locus_tag="MYCTH_2090403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661549.1"
                     /db_xref="GeneID:11510402"
     CDS             complement(join(2248859..2249221,2249322..2249555,
                     2249622..2249929,2249988..2249993,2250063..2250130,
                     2250230..2250309))
                     /locus_tag="MYCTH_2090403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661597.1"
                     /db_xref="GeneID:11510402"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="JGIDB:Spoth2_2090403"
                     /translation="MAEDDVERQVEKPTPAERSVHVVFYIGSWIFFSNLTILFNKWII
                     DSRGFKYPVILTCWHLIFASVATQVLARTTTLLDGRKKVKMTGRTYLRAIVPIGLLYS
                     ASLVCSNMVYLYLSVAFIQMLKAAAPVAVLLTSWAWGVEEPSLKRFLNVLLILGGIVF
                     EAMRLVMIQVLLSGDTQKMDPLVSLYYYAPVCAVMNIIIAIGSEANTFDPADLARAGC
                     GLLLLNAMVAFMLNIGKTSGLVMTLTGILKNILLVILSVMIWRTTISWLQFFGYTIAL
                     AGLLYYSLGGEQIASLCQAAWAFAKGGADDQQGGGLPPAVRRALILAFGALVVMFLVG
                     AFFDGGDVMRRLGGLGTS"
     gene            complement(2251686..2254241)
                     /locus_tag="MYCTH_2301169"
                     /db_xref="GeneID:11510403"
     mRNA            complement(2251686..2254241)
                     /locus_tag="MYCTH_2301169"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661550.1"
                     /db_xref="GeneID:11510403"
     CDS             complement(2251829..2254162)
                     /locus_tag="MYCTH_2301169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661598.1"
                     /db_xref="GeneID:11510403"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2301169"
                     /translation="MNTDTRRMLSKFDSRGHPDFYQHYSDGQLRIRLTNPSVVVTAAL
                     LVVSIVYQAVRQQRRLPSLPQLLWDAAVTVIPARILFAVDRFIIPPLVPTHMLKTQPP
                     TRAAKSEALRRILGIDNGGGIIGSVSQAGRRSLSSLSGAALGPKTASDRPPGLGNYDN
                     SCFQNSILQGLAALKPLPAYLSAVSLGRRIESSPTSTVDTLRELIAELTDPSSNGKTL
                     WTPRVLKNMNTWQQQDAQEYYSKLLDQIDNEIARATRALKHHPGLETGRTSYDASASQ
                     HSDDSGYDSLHGHSKPGPEPRITRNPLEGLMAQRVACVNCGYCEGLNLIPFNCLTLTL
                     GNLPEHDLYERLDHYTKVESIEGVECLKCSLLMCRDLIKALAERAGAVPEFQRRLESV
                     EEALEEEAFDEETLTKKCGLTPKMRASSTKTKQIVLARPPQSLVFHINRSGFDEQTGY
                     MFKNSAAVRFPMVLDLGPWCLGSTDARVHLEEGTVAARDVEQWTLDPKASMVAGDREP
                     SRITGPIYELRAVVTHYGRHENGHYVCYRKHPVFSHAVTNKQETAETFDDGVWQEKEE
                     VDEGMILDEATRQGDDGNGASEADESASARDSPPSQWWRLSDEDVYPVDEQTVLSQGG
                     VFMLFYDCVDPNPVLVSDIDKPTTEEEQTADDCNITDAAAASRVATQSPSLVQEDGTL
                     LEDPDSSVVLGDPHTPCETVGSTNTASEDPGLVETAGQPQPALPTSDGSAATPTPGVP
                     TLDEVGGQNVGPPSADLVTQPTDDVAIPQPLSRVTEV"
     gene            2254590..2255928
                     /locus_tag="MYCTH_2301170"
                     /db_xref="GeneID:11510404"
     mRNA            join(2254590..2254727,2254828..2255928)
                     /locus_tag="MYCTH_2301170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661551.1"
                     /db_xref="GeneID:11510404"
     CDS             join(2254694..2254727,2254828..2255387)
                     /locus_tag="MYCTH_2301170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661599.1"
                     /db_xref="GeneID:11510404"
                     /db_xref="JGIDB:Spoth2_2301170"
                     /translation="MAKGTISKGKRGPSIHSRAARRAISPSIDTDKSLKNVRPPQESV
                     DRRPAVLAARQAGGAIKKAKSGRKAVLSSKARRRREQSMSRAEAIMDRTAVKVQKSKG
                     HAKVIHSRKKTWDEINKEAFELTEEQRKLLSKKARAKMEEDAMVEAFYADDGDAEMEG
                     ADDLGQTPGTSEASAAPAVSAPVATAEGGEEEEEEIL"
     gene            2256035..2256126
                     /locus_tag="MYCTH_t60"
                     /db_xref="GeneID:11510405"
     tRNA            2256035..2256126
                     /locus_tag="MYCTH_t60"
                     /product="tRNA-Phe"
                     /note="Anticodon: GAA"
                     /anticodon=(pos:2256068..2256070,aa:Phe,seq:gaa)
                     /db_xref="GeneID:11510405"
     gene            complement(2256772..2258463)
                     /locus_tag="MYCTH_2301171"
                     /db_xref="GeneID:11512509"
     mRNA            complement(2256772..2258463)
                     /locus_tag="MYCTH_2301171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661552.1"
                     /db_xref="GeneID:11512509"
     CDS             complement(2257087..2258229)
                     /locus_tag="MYCTH_2301171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661600.1"
                     /db_xref="GeneID:11512509"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Spoth2_2301171"
                     /translation="MEPPPSHFFDYLDLDDPNSHQSPGQEDNNSAICLNPFNPYGKDV
                     HGALTPPDSRDMIPRTDIWDCFPDQAESLTTEDQKQLFVDPELYSPGSSNDDMKPQIQ
                     VDTTGLPKPPTRQGLSAKSPSNQAFVVGNTPAPVTPPEHEPPKKRKVRKTRKESNAAE
                     ETQKRNKFLERNRVAASKCREKKKQYVSELEATKMDLELRNAHLKVEVDGLIGEIGAL
                     KHRLMAHAKCNDPNIDRWLNNEARKFVQTESGPFGQPFMPFGQPPQPELPMGSPRSRN
                     ASIASITSMASSYPSLQGLQFDGLASGERHGSIAYSQGESWPGAPPPGTEPKALMPGS
                     GSLYPSPTEETFPGFSPALKTEPDVNYTPMPDPMFSPGQSNFGGGP"
     gene            <2259031..>2259702
                     /locus_tag="MYCTH_2125321"
                     /db_xref="GeneID:11510406"
     mRNA            join(<2259031..2259310,2259401..>2259702)
                     /locus_tag="MYCTH_2125321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661553.1"
                     /db_xref="GeneID:11510406"
     CDS             join(2259031..2259310,2259401..2259702)
                     /locus_tag="MYCTH_2125321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661601.1"
                     /db_xref="GeneID:11510406"
                     /db_xref="JGIDB:Spoth2_2125321"
                     /translation="MPYKEESRLLRQRPASFVSPRTLAYIDTGAAFEANGWVPVRYHP
                     KPTALFELLQSASCLLPLPALAVGWKAVGSPVGSNLGKAHRSRLRINRPAQRNSHTGL
                     DPPRQGTSYWSHGGVYCVKERGQEQPPLAELGKRRFTGAYERRLMDLQPVRPGGDWAR
                     GPSTLDKLRYVTEVLRAMGDQRQTMACKPIPAW"
     gene            2261189..2262133
                     /locus_tag="MYCTH_2301172"
                     /db_xref="GeneID:11510407"
     mRNA            join(2261189..2261562,2261774..2261876,2262032..2262133)
                     /locus_tag="MYCTH_2301172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661554.1"
                     /db_xref="GeneID:11510407"
     CDS             join(2261413..2261562,2261774..2261876,2262032..2262099)
                     /locus_tag="MYCTH_2301172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661602.1"
                     /db_xref="GeneID:11510407"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="JGIDB:Spoth2_2301172"
                     /translation="MEAVATPRITCAYLNSYVGRNVIIVGKVIQLRGEEAIIDADGNI
                     TAHLNRDAHLLAGNGAQIIGKVNPDLSIKVLSSLDLGTGVDYNLANTVVEISHQHRDI
                     FAYD"
     gene            complement(2263043..2267284)
                     /locus_tag="MYCTH_2301174"
                     /db_xref="GeneID:11510408"
     mRNA            complement(2263043..2267284)
                     /locus_tag="MYCTH_2301174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661555.1"
                     /db_xref="GeneID:11510408"
     CDS             complement(2263275..2267132)
                     /locus_tag="MYCTH_2301174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661603.1"
                     /db_xref="GeneID:11510408"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="JGIDB:Spoth2_2301174"
                     /translation="MAALGSLIRGLLSVKVHYSFDRENQVHCLARWHQILQIQTIPLD
                     ENTTIGVVDLRTCLQAVSQSSPEILNQQDHDYSVYAYDYSEPDVPLVGQGLLSWNMDP
                     QRGSQQQLVTGRVTRNLLALLNNGSRDTLEVKLKFATVAKSTQRTEYPSEQAGKRAKS
                     TSISAETVSEWNSFIQSNTMLGHASNNGAVSSPALAPAQLSQYNPHVNESRPMDTQGD
                     SQPPQPIRPATMTSAQTLQPVAIQPASRPSSAAAPIPPRPQGSLDSAPSPAASQPTEP
                     ALKPRPSRSRSKQPTGRPRGRPRKRPLETGNTSAVEEGTDGDDGPQKRRVKVTQAEYS
                     VIAPFGVAPDSLRVAASTSGSLRAMRPVGAGGETSAPSHLQDVPRVPTPIPDGQMLQQ
                     QQRRRALENQAKTEHTSQFDQPGPGRSIAQSGIQDARSPADSNAQSPDHGYMPEDSAG
                     DLNSSPPVPRTTPYIQSSPPASSPILPTMPMPPIDSGFMSGGLEDIFDEDILQRLPQE
                     QTQDQMLPLPSLPDATKAVVPRKKGRSQRQQQEQKQQLSDFPFQEVNPGPPELLPTKS
                     IFNPAGKAKTLNRQASSGTQPAPKPSTNRPFKRSNTAPTPAVSGQDTPHEQVTYQQNG
                     NTLPQEPARQDSHEEQLSLADGDGMGDAIQPATNDAEKGGSANSPLEPAPAASVSMPV
                     PDRPEPERISPAQPPSRPTSRSASASRDAPALKTQGPATSASETAPEPTLTLPRPPAS
                     EPPCPPSDFDPPRYSKNLVKKQSIKEKLESAIDKGETPPFCSNCGAIETPTWRKIWTQ
                     DHEGVPEFHEFSDKPGCVTMIEVLERDENEQPSRYRMVKKNLGPRDEKRNWVETLLCN
                     PCGIWLGKFKVHRPPDRWDKDAARLNQPRRKREPKGKSKKSRTKSDNAPANPTSEAYF
                     ATDPIGPLDHDFLTDRYENGAQSQQPSAPTADEQHLNLRSSPRQRFLGSTHSRGSGTA
                     DSPIAVEDQLGSTRRLLFPSPRRDGEPKTLGELPLNTTQTTSTHAPEAKSAPAGKENK
                     ANQERPGTPVVAEDELEQELFGTPPRRPSTPPPKATAGPFKTPTRPTPNHRPITRSIS
                     RSIRSSRGGILKSPAQLFALQHLEQTPTRTPRSASASKRRTPRSSSKIKNDNNSSHNA
                     DFALDASEHNQLSMGMAMQTPMQFDSPFTATLHQLLSEANEFIGGNNGSGGDGDGSPS
                     RRGTASRGEPGHLDLHDDEAGMDFGSFLGTDLVMPSSPPLVRRARTGGGHGNGEGEGD
                     GSGGDQFGGVLQEGVGDDVWGQK"
     gene            complement(2268708..2270119)
                     /locus_tag="MYCTH_2301177"
                     /db_xref="GeneID:11510409"
     mRNA            complement(join(2268708..2269603,2269672..2270119))
                     /locus_tag="MYCTH_2301177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661556.1"
                     /db_xref="GeneID:11510409"
     CDS             complement(join(2268724..2269603,2269672..2270009))
                     /locus_tag="MYCTH_2301177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661604.1"
                     /db_xref="GeneID:11510409"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2301177"
                     /translation="MVRTVVILGASYAGIPIAHYLLKHTATKTKDLKVIIVAPNTHLY
                     WVFASIRGIVPNRIGENKIFLPIAPTFAKYPSDQYELVHGVAKEVVPDANVVEVRGND
                     GSARTIQYDELVIATGSSFKNGMPFKNLSSTEETKTALREWAKRIESAKSIVVAGAGA
                     TGVEIAGELGQEYAVPGKKQITLVCDDDLPLSAHLRRDVRETTKDELERLKVKVITNA
                     RLATAPSAAPKTSTLTLTLTKTSASSADEAPTTLQADLLIPTYGITPNTAFLPPSLLD
                     SRGHVRQTARLRAEGYDNIFVAGDAGNLESHQAVHADSQAVHIARLLEARILGGVPGS
                     PSLKPDEEEEDYKPIDKVMFAVTLGRNRGTGQVGSWKLWSLLVWFMKGRYLGTNYAPE
                     YARGERTLRLKSW"
     gene            complement(2270970..2272023)
                     /locus_tag="MYCTH_2301178"
                     /db_xref="GeneID:11510410"
     mRNA            complement(2270970..2272023)
                     /locus_tag="MYCTH_2301178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661557.1"
                     /db_xref="GeneID:11510410"
     CDS             complement(2271078..2271929)
                     /locus_tag="MYCTH_2301178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661605.1"
                     /db_xref="GeneID:11510410"
                     /db_xref="JGIDB:Spoth2_2301178"
                     /translation="MASDRAQQQQQQPASPIGRAADQARRHTVTASRPRIGTLSRLNG
                     TSYAVMMVDLDVPTDTPPATDTLLHWMQAGLVPSATPTRMNTTAGTLQVFLLGDPSAS
                     SNTGTSAGRGRVANATAGIAVPYVGPNPPARTPLSHRYVQLLVDTSGVTGQGAEALRR
                     AAASATKTTRRGFDPSAALAAAGLEGRVVAGNSFNVTNAGPPANSTGASGPKSGSESG
                     SGSGSGSGSGSASESDASGSDGSSSRAGAGDGARQTVLPGEGVGSRPGSVLVGGLVAV
                     GVVALGL"
     gene            complement(<2273290..>2274308)
                     /locus_tag="MYCTH_2116990"
                     /db_xref="GeneID:11510411"
     mRNA            complement(join(<2273290..2273450,2274089..>2274308))
                     /locus_tag="MYCTH_2116990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661558.1"
                     /db_xref="GeneID:11510411"
     CDS             complement(join(2273290..2273450,2274089..2274308))
                     /locus_tag="MYCTH_2116990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661606.1"
                     /db_xref="GeneID:11510411"
                     /db_xref="JGIDB:Spoth2_2116990"
                     /translation="MSFGDSVRALLDTYANCILLLKSFGRKQKDDGAVEVRQQPSRLR
                     EALKTDRLFVEQAYSSKLSESGSRFKEGDDPPQRKWRSVTQNTKIDPNGYEYNVHPVF
                     PLRPYTVEVKKRRLFGLFGRKREA"
     gene            2274801..2276795
                     /locus_tag="MYCTH_2301180"
                     /db_xref="GeneID:11510412"
     mRNA            join(2274801..2275560,2275619..2276423,2276476..2276795)
                     /locus_tag="MYCTH_2301180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661559.1"
                     /db_xref="GeneID:11510412"
     CDS             join(2274976..2275560,2275619..2276423,2276476..2276693)
                     /locus_tag="MYCTH_2301180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661607.1"
                     /db_xref="GeneID:11510412"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="JGIDB:Spoth2_2301180"
                     /translation="MRLLVRSLAALPIALSLVFPLPTAGAGLQPSPYQRLDRSESTSH
                     VFPFLKWLRDSAVEAVFGRPPTKTKDQRPGPQLQSRYRNDVVVRFNVTNPEEEGAIAQ
                     AVSQMFLDVWAFAPDFVDVRLAKDDLSALLTLLPGSLEPSILIPDVAAAVWATYPSSS
                     AGASRLQWSTADAAKMRTSLDGVGNIFFQDYQPLAVITNWMRLLEAMFPSVASMSSIG
                     KSYEGRDLYALRVGAPSDDSEASGPRKTILITGGLHGREWISTSSVNYLLWSAVTSYG
                     TDSMMTKLLKHFDIVFIPVLNPDGYEYTWKVDRLWRKSRQPTKMRFCRGLDLDHAFGH
                     SWDAGRHTSDPCSESYGGEQPFQAVEAAALAQWALNETENGLNFVAFLDLHSYSQQVL
                     FPYAYTCSLEPPNLENLEELAVGLAKAIRISSGEPYTVSSACEGAVAGAYSASDSLRR
                     IEARGGAAIDWFYHELHARYSYQIKLRDTGSYGFLVPSDNIVPTGEEMLNALKYLGDY
                     LLGNNGIEKLLAQQPLDHWKDLKRRRR"
     gene            2277660..2282403
                     /locus_tag="MYCTH_2301182"
                     /db_xref="GeneID:11510413"
     mRNA            join(2277660..2278168,2278261..2282403)
                     /locus_tag="MYCTH_2301182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003661560.1"
                     /db_xref="GeneID:11510413"
     CDS             join(2277793..2278168,2278261..2282243)
                     /locus_tag="MYCTH_2301182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003661608.1"
                     /db_xref="GeneID:11510413"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Spoth2_2301182"
                     /translation="MASESDMRRHSLFDALAAPAPKQPPFSSGSTTELPALASVAENS
                     SPSGISPPLGDLPRDSISVDSTHGNPSIVEPSDGPASLTGSDYSQKHRRFSMLRFRNA
                     SDSQLAAKAKLHAATEKPPPVPRPPTIITTAPTFSNPAPPRKKSSRMNFGRLGRSAEI
                     PRTEEGNEPSNSNPGRGRVHMVPEHGVSFDESNRPSSSSHAPGSPPYGDDHPAASAPG
                     PNRLSESSRSDASLGDRAHGSTAATTHTAHATTTFFRLPRRKPKQPTPLFPIAHLQKT
                     KPPPAENSNVSNSSSAASIPASADRPSSDASRDSQSTPIPSRTPSRNGVTTPPPEKQG
                     TTTLGRPASPATALFRPSSRQSGQSSPSRSHINRRGRSSTMSSMGRNSPRDSVDDHLA
                     PPTTRTSISTGRKSFTDLLGLSRLRHNTDMMPSRQGTITPVTPGSSTSKNNSLQIPRG
                     SVSLPERRDDDTPAKYLERLVGVVNRSVVAAALSKSADPFFQSVLRSYMRSFRFFGDP
                     MDMALRKLLMEAELPKETQQIDRFLQAFANRYHECNPGIYSSPDQAYFIAFSLLILHT
                     DVFNKNNKHKMQKSDYLKNTRGEGIFEEILEVFYDNITYTPFIHVEDDPDVNGDRNVA
                     QKVRKKSKFPHGAPDPAKRVAKEPVDPYTLIIDNKLDLLRPNLKDVMQLDDPYGYLGT
                     AKSLNMKELQRTFFKTGVLQIVSARSRPDAFMTEKTATNPDAAHPGIVDIKITKVGLL
                     WRKDAKKKKTRSPWQEWGAILTGAQLYFFRNTNWVKQLMHQQKDHLKKGHDGDPCIFK
                     PPLEQFKPDALMSTDGAVALQDSSYNKHKHAFVYVRHGGFEEVFLAEDEDEMNDWLAK
                     LNYAAAFRTSGVRMRGVIGGNYDGQSRRAIRGSSSGNVQVIQTPSGVVTVTRSRIDHQ
                     LAQDILAARRDFMRRKIQDANEKLKEAEATLESQLRNARHLQILAPISPKTRENMLLS
                     AARMAAQLKWTRMEIWKLKCHRDVLQLDMEEERQLLGLPPDTGTDTVARPLTREECKT
                     CQMSPCQCQRRPRSPERASLTRSSTVATTSDAESSQEAELFQTPPTSATVSQEDSWSS
                     SGAADHHGPRKASVSTAVGPETSVSGTPTTGDDAGPSAASPEKR