GenomeNet

Database: RefSeq
Entry: NC_016474
LinkDB: NC_016474
Original site: NC_016474 
LOCUS       NC_016474            5062665 bp    DNA     linear   CON 27-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 3, complete
            sequence.
ACCESSION   NC_016474
VERSION     NC_016474.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 5062665)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5062665)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 5062665)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 5062665)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003004.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5062665
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="3"
     gene            complement(2635..4719)
                     /locus_tag="MYCTH_2303065"
                     /db_xref="GeneID:11509871"
     mRNA            complement(2635..4719)
                     /locus_tag="MYCTH_2303065"
                     /product="glycoside hydrolase family 13 protein"
                     /transcript_id="XM_003662401.1"
                     /db_xref="GeneID:11509871"
     CDS             complement(2782..4578)
                     /locus_tag="MYCTH_2303065"
                     /note="CAZy_ID 268030"
                     /codon_start=1
                     /product="glycoside hydrolase family 13 protein"
                     /protein_id="XP_003662449.1"
                     /db_xref="GeneID:11509871"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="JGIDB:Spoth2_2303065"
                     /translation="MTVNTREKQWWKQAVVYQIYPASFCDSNGDGIGDLPGITSKLDY
                     IASLGVDVIWICPMYDSPQVDMGYDISNYEDVYRPYGTVQDMETLIKETHARGMRIML
                     DLVINHTSDQHAWFKESRSSKDSPKRDWYIWRPAKYSPSGERLPPNNWRCNFGGGSAW
                     EWDELTQEYYLHLFATEQPDLNWENPETRKAIYASAMEFWLKRGVDGFRIDTVNMYSK
                     PPTLPDAPIVDPGTPYQPAGMIYCNGPRMHEFLSEMNAILTKYGAITVGELPCTPDTS
                     RVLQYVSAKAKQLNMVFQFDVVDVGMGKTHKFATPPRNFTLPDFKAAVDMTQALIRGT
                     DGWSTVFIENHDQARSVSRFTDDRPEFRVRGAKLLALMQACLSGTQYIYQGQEIGLVN
                     LPKDAYPIENYKDIDSTLFYDMVKERYGADNKVELDKAFDAVQYLARDHARVPIPWNG
                     QAKYGGFSEAAEKAGKKVEEPWMKTHPLASEINVASQLNDPDSVLAFWRKMLRFRQAY
                     AHLLVYGDFKDLRPDDKNLFMYLKEPDHGAGDRVLVVLNFTTEDQTWNVPSPAELGAS
                     ENPELIPIMATHSGMRKLGQLEPFEGQVYLVR"
     gene            <6126..>7793
                     /locus_tag="MYCTH_50903"
                     /db_xref="GeneID:11509870"
     mRNA            <6126..>7793
                     /locus_tag="MYCTH_50903"
                     /product="sugar transporter-like protein"
                     /transcript_id="XM_003662402.1"
                     /db_xref="GeneID:11509870"
     CDS             6126..7793
                     /locus_tag="MYCTH_50903"
                     /note="Sugar transporter-like protein"
                     /codon_start=1
                     /product="sugar transporter-like protein"
                     /protein_id="XP_003662450.1"
                     /db_xref="GeneID:11509870"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_50903"
                     /translation="MSPAKDDDAVERVVVIRPNVDKSTALEAAAATEAEHNMGLFKSL
                     KLYRKACLWSIFLSTCIIMEGFDYAFLASLFAYPPFQRKFGVALPDGTYQLTAAWQTG
                     LTNGVLAGQVVGLFANGIIADRFGYRKTLIGALVACIGFIFIIFFAETLVQLLIGEIL
                     IGIPWGVFQTLTTTYAAEVCPTHLRAYLTTYVNLCWVIGQFIASGVLRAMLSRDDKWG
                     YKIPFALQWVWPVPLIIGIWLAPESPWWLVRHGRLEEAKRSLARLTTRNSGVPFRPDE
                     TVSMMVHTNELEKELLAGTTYADLFKGVNLRRTEIVCMTWMIQTLCGAAFMGYSTYFY
                     QQAGMAIENSFTMSLGQYALGAVGTFTSWFLMQWFGRRTLYLSGQVVMFCLLLTIGCA
                     SFAGKDNVAAQWAIGSLLLIYTFTYDATVGPVCYSLVSELTSTRLRTKSVVLARNMFN
                     IMGLVSNIITPRMLNPTEWNWGAKSGFFWAGTCFLSAVWTYFRLPEPKGRTYGELDVL
                     FENRVSARKFKTTAVDDFAGRSSEGVEEKEKALEVEDVVRRVESRPN"
     gene            complement(8325..10567)
                     /locus_tag="MYCTH_2303067"
                     /db_xref="GeneID:11512558"
     mRNA            complement(8325..10567)
                     /locus_tag="MYCTH_2303067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662403.1"
                     /db_xref="GeneID:11512558"
     CDS             complement(8647..10257)
                     /locus_tag="MYCTH_2303067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662451.1"
                     /db_xref="GeneID:11512558"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2303067"
                     /translation="MSTKVSQACNACRVRKVRCSRTQPCTQCAHLNLACTFAPAPAKR
                     KPGVRGHLVAQLRNKTINHAGSEGTPPAGTTTSTAPAVTSIAGILDWGHAATPSPPRC
                     FEPVPLAAGFSQEFFLRLLPEYEQLVYPVNPVLTPDEMRSAIGNMHVSYEDAALVHAF
                     GAITLNLTQPSWNLHGNVASQMTLLLQHSLWAYRKADMGRDTSADYLLNEMPLTVKRA
                     MVGIWNECSLMAFRRFDRSFASLREAITMIQMLNIHRYSEDNLCGLTRREVSRQQRMY
                     WEAYIHERFLCVMSGYPCTMIPLRTGLPITDPDVPPHVTVGFNRLIRLFQIMDAPLLA
                     HWAAQDIPDAPTITAEWIEHKQAQLDADEAETAEAARDLAASGAGTLSEEQHVDLFVT
                     RLWLRTLVWQLALSHGLLRSAPPRDAHEGFSLHFPAQRLSAQLRGLVSRLRHTSSIIT
                     HGSGILQKLFEITSTVADVLALPRGPGQTQEEARARVEDFLFLVRFIFSFERTQKHHR
                     EYLLDKLTTLREMYTVVDFGTLGRTPEG"
     gene            complement(10965..12755)
                     /locus_tag="MYCTH_2303068"
                     /db_xref="GeneID:11512559"
     mRNA            complement(join(10965..11291,11353..11563,11624..11926,
                     11975..12755))
                     /locus_tag="MYCTH_2303068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662404.1"
                     /db_xref="GeneID:11512559"
     CDS             complement(join(11384..11563,11624..11926,11975..12523))
                     /locus_tag="MYCTH_2303068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662452.1"
                     /db_xref="GeneID:11512559"
                     /db_xref="JGIDB:Spoth2_2303068"
                     /translation="MAANSRSGHAFVAFARRVYHPMGFSKGYNFVLFFIFAGAFTGFT
                     LARLQYLAIDRSCESKSGDRPLGCYYYTRGSIDRIGIILHLGTILPGSLLVILQFVPI
                     IRRSVVLFHRINGYLIIILSLVPTAGAIMLARNSVGGRTEVQTSIGVLSIAFVVCLAL
                     AWYNIKRLQIEQHREWMLRAWFYAGSIVTVRPVLFLMALITSNEDYFVPMPCAEVASL
                     ISKKERILQDYPACESYFTHGDTSTNVLVPATMAGDGSNRMASFSHNFGAALWLALAL
                     HAVGVEIYLRLTPAEANRLRNVSYQRQLEAGMKSPGRAGLTADRLGNSDLWKPNTDQN
                     EQDGGEVSK"
     gene            complement(13665..14331)
                     /locus_tag="MYCTH_2314963"
                     /db_xref="GeneID:11512560"
     mRNA            complement(13665..14331)
                     /locus_tag="MYCTH_2314963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662405.1"
                     /db_xref="GeneID:11512560"
     CDS             complement(13820..14257)
                     /locus_tag="MYCTH_2314963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662453.1"
                     /db_xref="GeneID:11512560"
                     /db_xref="JGIDB:Spoth2_2314963"
                     /translation="MQYSTLLIGLLAAASSAFAAPAPNTRSEAVSAMADVPQWIIRSF
                     TRTCNDDDTSCEISFGVDTQIAPVTECSYNVTGNPASQTSTNGITCGPYTISSGWDPL
                     GFTTWSVVDWSKHLIVWPAYSDAELVNGQPVTPDKSFAPQALP"
     gene            <16105..>17368
                     /locus_tag="MYCTH_2117751"
                     /db_xref="GeneID:11512561"
     mRNA            join(<16105..16196,16300..16981,17024..>17368)
                     /locus_tag="MYCTH_2117751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662406.1"
                     /db_xref="GeneID:11512561"
     CDS             join(16105..16196,16300..16981,17024..17368)
                     /locus_tag="MYCTH_2117751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662454.1"
                     /db_xref="GeneID:11512561"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_2117751"
                     /translation="MTEEASSDEAGKLSPWDRIVLVGLFPLFGNYPGLHWRQRLALTF
                     LQAQRAAFPIRHLRWLTRRVSTGEAVVRYCSKNKIPHKSVVIDSPAAASGIEGVPAAT
                     LHLLTVPIVEEDVPGRTFLYFHGGGFVNPLRDVAHMPFIMQCAEACHARQAVILEYAL
                     APEHPYPAQLVQCVATLQYLLGEMKLRPEDIVLAGDSAGGQLVGALLAHLAQPSPYAA
                     AITVDGQFRAALFVSPFVRMPPDEGSYEANHGKDYLNRPQVWANLCGVEQGADIWKLV
                     FARGRGRGDRGLVLKAMVTVGTSEVFLECCRSFAKEHVGAETVFVGRQTDCRVLGGMD
                     RVLVECEAEVHVQAALDCAVGYNEGAMQRAIASWLAGL"
     gene            complement(17324..19978)
                     /locus_tag="MYCTH_111741"
                     /db_xref="GeneID:11512562"
     mRNA            complement(join(17324..17947,18035..18285,18338..18778,
                     18838..19127,19191..19648,19724..19839,19940..19978))
                     /locus_tag="MYCTH_111741"
                     /product="fungal-specific transcription factor-like
                     protein"
                     /transcript_id="XM_003662407.1"
                     /db_xref="GeneID:11512562"
     CDS             complement(join(17482..17947,18035..18285,18338..18778,
                     18838..19127,19191..19449))
                     /locus_tag="MYCTH_111741"
                     /note="Fungal specific transcription factor-like protein"
                     /codon_start=1
                     /product="fungal-specific transcription factor-like
                     protein"
                     /protein_id="XP_003662455.1"
                     /db_xref="GeneID:11512562"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_111741"
                     /translation="MVEGESSLTAHSVFANNLLQKVASTDSRPEVRERIDALRNMVES
                     MEKQPAAREMAYPHAKPVRPVTLEGCDVPPIEKTLQLLKLTKAQPQIGAAWILDLFQI
                     DHFPETCLALYMAEEYNPVHFIIVNAGLHFLYRGYAYYFPDKTEEYLALARLCGVNIE
                     TALSSLPLHLPANDDVVEALLLGAFYTIELGKPSLAWILSSKASEMCQSLGYHRADTH
                     ANNDSSAGARRKRLLFWVVYTLDKSLSLRLGRSSTIQDYDVTVPEPRDEETQHSASLS
                     FFNLWITESRIQGQIYELLYCPEALRQPEAVRKSRAKLLLGRLDELDTLTQKMLDKWH
                     GLLRSVSPRELAEFFVISDHVLRLSIRTLIHRAVPNPPGSPTTFTAECIQTARETLAR
                     HQECMAVLEKTTAGLFSTYMNWTILFAPFVPFIVVFCQVIETRDRADLARLEAFVSSL
                     QPYTAVSEAVDRLRRLFQVLYSVASQFVESQTGQGRDGQQPSTVDTCLAALGFPSQLG
                     PSSQESEYETGTASFASDPAFQRGVNPMIWMGNGTELEDWFYNNQYMMGFMEGAVTEE
                     AN"
     gene            <20913..25961
                     /locus_tag="MYCTH_81753"
                     /db_xref="GeneID:11512563"
     mRNA            join(<20913..21053,21126..21313,21390..22046,22111..22390,
                     22466..22612,22995..23439,23570..23727,23810..24339,
                     24425..24540,24602..24789,24855..25961)
                     /locus_tag="MYCTH_81753"
                     /product="ABC transporter"
                     /transcript_id="XM_003662408.1"
                     /db_xref="GeneID:11512563"
     CDS             join(20913..21053,21126..21313,21390..22046,22111..22390,
                     22466..22612,22995..23439,23570..23727,23810..24339,
                     24425..24540,24602..24789,24855..25565)
                     /locus_tag="MYCTH_81753"
                     /codon_start=1
                     /product="ABC transporter"
                     /protein_id="XP_003662456.1"
                     /db_xref="GeneID:11512563"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_81753"
                     /translation="MAAGVDFPKEAEQAEKESTSQPTSEDRGNINDTNNKGAEENGWS
                     AYRRIFRYAGPFEYTLQGIAILAAIASGAGIALQNLIFGEFVTVITDYASGDSSRQVF
                     LDDVAELALNFVYLGIGRFVLSYTYNALLTYVSHRIVRNIRHAYLRAALSQEVAYFDL
                     GTSGSIATQATSNGRLIQGGIAEKLGLTFQGLAAFVTAFILAFVTQWKLTLITLCIAP
                     ATIISMGIVAAIEAGYETKILDIHAQANSFAEGVLASVRTVHAFEMRARLVAKFDEFL
                     SEAHRWGNKNSPLFGALFSVEYTIIYLGFGLAFWQGVQMLARGEVDSPGQIFTVLLSV
                     TIGSINITMLAPYSIEFTRAATSAASLFKLIDRQSAINPFDDSGEKPSEVTGLVELEN
                     VTFAYPTRPGVTVLDNFSLRVPAGKVTALVGQSGSGKSTIVGLIERWYNPSSGVIKLD
                     GRPIDSLNLSWLRKNVRLVQQRALDKAAEGRTTIVIAHKLATIRKADNIVVMSKGRIV
                     EQGTHEGLVAQDGTYARLVRIQDLAVKAAGSSSDAEGEDTAADEEGHPAELTKTMTRY
                     ATEDQARMESQKGRYDFENHKKLGLLGVIIRLAKFSPELIWWYLCVLVACVAAAGVFP
                     GQAILLSRMMNVFTLTGDALKERGNFFASMFIVLAAGCLVVYFILGYATLSHKLRRQI
                     LHDILRQDLEFFDRPDNSTGALASRVDSHPQAVFELMGFQVGLILIAVLNVVGCAVLS
                     LAHTWKLGLVIVFGGLPPLLGAGWLKIRLDMRLDHNVSKKTSTSAAIASEAITAIRTV
                     SSLAIEDRVLSRYTAELDHAVAQTVQPIAAVMVCFGLTQAIEYWFLALGFWYGCRLMA
                     SDETTLYNFFVAFMGVFFAGQATAQMFQFSTSITNAKNAANYMFWISGLQPTVRETDE
                     NRDNSPKSGGPISLDSVRFSYPLRPDAMVLRGLNLEITKGQFVAVVGASGCGKSTVIA
                     MLERFYDPSTGNIRIDGDVLSELNPRHYRRIVSLVQQEPTLFQGSIRENIALGIDDPT
                     APVDTAASSATAQGPTVSDSQIEAALRAANAWEFVCSLPDGLSTAAGPNGTQLSGGQR
                     QRIAIARSLIRNPKILLLDEATSALDTESEKIVQSALAEAAKDGDRITVAVAHRLSTI
                     KEADMICVFHDGKIVEKGTHEELIALGGMYRKMCEAQNIE"
     gene            27620..30162
                     /locus_tag="MYCTH_2303088"
                     /db_xref="GeneID:11512564"
     mRNA            27620..30162
                     /locus_tag="MYCTH_2303088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662409.1"
                     /db_xref="GeneID:11512564"
     CDS             27766..30018
                     /locus_tag="MYCTH_2303088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662457.1"
                     /db_xref="GeneID:11512564"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="JGIDB:Spoth2_2303088"
                     /translation="MGECPVRHSANVAGGGTRNTDWWPNQLRLNILRQNQPASNPQKD
                     LDYAAAFKSLDYEGLKKDLRALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVFDGR
                     GGGSQGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGDKISWADLLLLTGNVALESMG
                     FKTFGFAAGRPDVFEADESIYWGGEQTWLGNDVRYSQGREGVAGQGALGGDESKKDHK
                     DIHTRDLETPLAASHMGLIYVNPEGPDGIPDPLAAARDIRITFGRMAMNDEETVALIA
                     GGHTFGKTHGAAHSDNVGPEPEAAPLEQQGLGWSNKHGSGKGPDTITSGLEVIWTKEP
                     TKWNHNFFEYLFKFEWELTKSPAGANQWVAKDTDAFIPDPYDPNKKHKPRMLTTDLAL
                     RFDPVYEKISRRFLEHPDQFADAFARAWFKLLHRDMGPRSRWLGPEIPAEVLPWEDPI
                     PPVNHPLVDDKDIAALKHDILATGVAPHKLISTAWASASTFRGSDKRGGANGARIRLA
                     PQKDWEVNNPPQLAEVLKALEGVQAAFNASAPGGKKVSLADLIVLGGVAALEQAAGVP
                     VPFSPGRTDASQEQTDVESFQHLKPFADGFRNYGRGTSRVTTEQLLVDRAQLLTLTPP
                     ELTVLVGGLRVLGANYDGSSHGVFTTRPGKLTNDFFVNLLDTGVAWKSIDGELFEGTD
                     RKTGEKKWTGTRADLIFGAHAELRAIAEVYASAGGQDKFVKDFVAAWAKVMDLDRFDL
                     AQQGSAGPKL"
     gene            complement(30205..32682)
                     /locus_tag="MYCTH_68580"
                     /db_xref="GeneID:11512565"
     mRNA            complement(join(30205..30740,30829..32682))
                     /locus_tag="MYCTH_68580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662410.1"
                     /db_xref="GeneID:11512565"
     CDS             complement(30875..32530)
                     /locus_tag="MYCTH_68580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662458.1"
                     /db_xref="GeneID:11512565"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_68580"
                     /translation="MYIHADAPPRPGMSKSLVHDAATSAEAASTAPRPKPKRVQVSRA
                     CQRCKRLQKGCSESRPCQRCVRVGLEYECLRDPGRQARRSATAGMATTINTNSSSSSR
                     AWSSYPHLPASLSPETAHASPLTGSLPPLLLPPPPPPPPPSPRRSLPPGIVIRYCFQR
                     FFAKLYPTIPILTPEYADLLVAEAESHRGAEAQCLVTAVCAVVLLQVEEPDRRPFEAA
                     GIPHSNRHFGELLFEDAMASRVHLSSSAFNPSLERTLATFFLYAGHASLFHHSQGFFF
                     LREAATLCLVLRIRDGDLLRRKLADRLFWIILVSERSHGIRYRRPVTLQVVPSGPALE
                     AESESGSGSGSGSGSEPDTALAGLRRLVSLFRPLDTAFFSLLNREETTVFGSRLVSSS
                     LDAIQAAIRGALEPQHTGLLCETQLANLRVTQLWLLVILWQLRLRLGLLMEEPGIPCH
                     LTFHYPVELGEELVGVVRAISVESIRIHGVGINEKIFDVACAMVDVLSRVPATDKRGT
                     GRENIRYFRDLILKLPGGVSTYGALLDKHISNTLPNLLVQSGN"
     gene            complement(32818..35194)
                     /locus_tag="MYCTH_2303089"
                     /db_xref="GeneID:11512566"
     mRNA            complement(32818..35194)
                     /locus_tag="MYCTH_2303089"
                     /product="glycoside hydrolase family 13 protein"
                     /transcript_id="XM_003662411.1"
                     /db_xref="GeneID:11512566"
     CDS             complement(33106..34953)
                     /locus_tag="MYCTH_2303089"
                     /note="CAZy_ID 267907"
                     /codon_start=1
                     /product="glycoside hydrolase family 13 protein"
                     /protein_id="XP_003662459.1"
                     /db_xref="GeneID:11512566"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="JGIDB:Spoth2_2303089"
                     /translation="MGSNLIHHPDGWVGTTPWWKDAVFYQVYPASFKDSNGDGWGDIP
                     GLISKIDYLHRLGVDVVWLSPMFESPQQDMGYDISDYQAVHQRYGTLEDVDRLIEACH
                     SRGMKLILDLVVNHTSDQHPWFKESRSSKTSPKRDWYIWKPPRYDGEGNRIPPTNWRG
                     YFAGPTWTWDEGTQEYYLNLYGPFQPDLNWENPECRAAVYDEAMRFWLDRGVDGFRID
                     TVNKYSKRTDFPDAPVTCPGVAHQPAPEMWCNGPRIHEFIREMRTRVLAPYGAVSVGE
                     LSNTPRPEQVLPYVSAAAGELDMAFEFSTIRLGTGDLFHGKYIYRPFPLSALKRLVET
                     WQTFTEGTDGWHTVFCENHDNGRAVSRFGDDSTPELWEASAKTIALWQATSTGTLFLY
                     QGQEIGMRNMPASWGIEEYKDVESVGFYNEAVATGDQDRVRATLHGLGILARDHSRIP
                     FQWDDSPNAGFTDEGVTPWMRVHDQYRELNAAKQAADPESVLGFYTRILKLRKQYRDL
                     FTHGRFRLLAPDDEALFMYVKEGGADGDGDGDDDKKRRKALVVMNFSSSVQQCPDISG
                     ALGCREGEASLLLSTVRSGKSAASDGLGPGLRGSELSPWEGRVYLNFKP"
     gene            35762..38146
                     /locus_tag="MYCTH_2303090"
                     /db_xref="GeneID:11512567"
     mRNA            join(35762..36684,36749..36989,37073..37345,37418..38146)
                     /locus_tag="MYCTH_2303090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662412.1"
                     /db_xref="GeneID:11512567"
     CDS             join(36168..36684,36749..36989,37073..37345,37418..38048)
                     /locus_tag="MYCTH_2303090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662460.1"
                     /db_xref="GeneID:11512567"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2303090"
                     /translation="MADTKTPPGSDGPLPDKETGAVAAAAAPLDGDIAIVEAKHASEK
                     EHQMSLLKALKLYPKAIGWSVLVSSTIIMEGYDLALLGNLYASPAFNKKFGEYDAASD
                     KYVVSAAWQSGLSNGARAGEIFGLIFAGWASDRFGYKMTTIGSLILMICFIFVLFFAP
                     NVKVLVVGEILCGVPWGAFQSVTAAYASEVAPMVLRPYLTTFINMCWVIGQFFAVAVN
                     KGSVGRNDDYAYKIPFAVQWVWPVPILAGLIFAPESPWWYVRHGRKEEARRSLLRLTS
                     RNQPDFDLDETIAMIEHTNELEKKLKEGVRFRDCFKGVDLRRTEIVVGIWLVQTLGGQ
                     NLMGYFAYFLVQAGMDSSNSFTLSLCQYALGMIGTAGSWFLMSRVGRRKIHFGGLCAQ
                     LTLLIIVGCLSFGTTKASVWAIGAMLIVFTFVYDFAVGPVTYSLVSELSSTRLKAKTI
                     VLARAAYNASNIFVNVMTNYQLSSTAWNWGARTAFFWAGSCLLSAIWVFFRLPEPKGR
                     TYAELDLLFEQRVPARKFAETKIDPFAHTEEKRSLSGEMLEHVEK"
     gene            complement(38228..40402)
                     /locus_tag="MYCTH_2303093"
                     /db_xref="GeneID:11512568"
     mRNA            complement(join(38228..38904,38979..40197,40308..40402))
                     /locus_tag="MYCTH_2303093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662413.1"
                     /db_xref="GeneID:11512568"
     CDS             complement(join(38316..38904,38979..40075))
                     /locus_tag="MYCTH_2303093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662461.1"
                     /db_xref="GeneID:11512568"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="JGIDB:Spoth2_2303093"
                     /translation="MKFSLATACLLGTALAVREDHLVSRRLNKRFIDDAGNYNISFYH
                     INDVHAHLDQFSKSGTDCTRPEAGCYGGYSRVKTVLKETRPSHPDSLLLNVGDEFQGT
                     MFFNFYGGEKIAETINQIGFDAMTLGNHEFDRGDDYLGEFLENLTFPILVANIESDNE
                     VLNRTIKPFHIFPEYDLAVIGVTTDTTPGISNPGKGTKFNNPVAAVQNTVDLIRSTTN
                     ITRLAAITHIGYEEDQRLAKETTGLYLIMGGHSHTPLGDFEGAVGPYPTIVENKDGEE
                     VFIVTAYRWGEYLGYIDVTYDADGKILAYHGAPIHLTNATAQDKDLQEQINEWRGPFE
                     EYAKEEIGYSNVVLDQTTCQEQECLLGDFVSDALLTYRLNASTSETAPAFALVNAGGV
                     RATIDDGPITRGEVLTAFPFSNSVVEVTVTGELLWKVLEGIISGVNVDNGKPVTSFLQ
                     VSRGIRIEYGPASANGTDNVLVSVTIGDKSLDKAAEYKIVTVDFVAGGGDNMFSTPFE
                     NLVTLDAVDEVLVRHIQATSPVDIALDGRLTKVSRCKASRAVRMERARRAKRN"
     gene            <45282..>50701
                     /locus_tag="MYCTH_2117759"
                     /db_xref="GeneID:11512569"
     mRNA            join(<45282..45866,45934..46305,46378..46878,48637..49749,
                     49863..49900,50029..>50701)
                     /locus_tag="MYCTH_2117759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662414.1"
                     /db_xref="GeneID:11512569"
     CDS             join(45282..45866,45934..46305,46378..46878,48637..49749,
                     49863..49900,50029..50701)
                     /locus_tag="MYCTH_2117759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662462.1"
                     /db_xref="GeneID:11512569"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="JGIDB:Spoth2_2117759"
                     /translation="MLVLVAELFLLAALLIICLAYFVFLMPPRYPTNIPAVPFWVALI
                     PFFKDVDQSDIFRKYIERPLRTHGAVKLFFGAQWNILVHKPSYLAAIFRDEDIYQKSG
                     NQKKIPHSVLAHLLGDNIISSHGERWRNYRSVVKPGLQRDFEARAIARNAEHLCGLLR
                     DAQVRAGNGGVPVQELLQRYSVANCSEVVLQIKLDALTSANAPINFLQTEVKREIFKP
                     VFMNFPVLDRFPFPSRTRARRTVDRFKHELRRAIVESHAKDAIFASAASSDGLGRRML
                     DARESGLWDEKQLLDNLTVAFVAGQENPQLCMISTLYLMAKHPESQAKLYAEAQSKGL
                     MERTNPDPDPDPEILQDMPYLTSLIYESLRLFPPIGQLVNRKASKDILLGDDIVIPKG
                     TYLGYNCYSTNRDPAVWGPRADEFDPARWGDSPLAIRKQYRLRKARAEFISFHGGRRA
                     CLGEKFAMLEMRVTLVTLVREFRWRLDPAWVDRKTPLRTMDFSNEGQSFYHRLQGAFV
                     TDGNGRLIHCTGPQRQRAPDNRGLIQSGSQSLGDSGDVRIYQDCDARQHRTVVLVNSA
                     RSDHEDIALDKFFVQLVLHQADFSVRSRPLKTAKNDPRAEQIVDLFDSYLRYQGKDDK
                     WTDGGRTYFTERVRHFTAQERPIEFCLPAFPCKSSNRDKVTGPDPDRGEELALERLHD
                     FVEAVERMYGPGAKLWIISDGHVFSDCIGVDDADVDAYGEKLKQMNHSIGVRRGNTNR
                     VGFKSLVDLFRLSTSAVVGGLPALAQRLSLLPTIDHHVSTKLTEEAELCRRILMAGCG
                     PRRSAVRAKIDSKDPAITALYRGFSRFMLEDLEHHPHTRNLTRSQQKKLSAKVAFEMI
                     LMLFPNHVRLSIHAHDNAGPKFGIQLFDPSRVRAVQTLSADGELMTSLDLLHIPTPWH
                     NSVVQLAGSDVILVTKAKLARAALTSGSMTGGLVGAEEGRAHFMLEKKSVGAAIPAQV
                     APLPPASSVATIPAEGVVETESKMGPAATETATDSTTAAVELPRAANRPTAGKPRKPT
                     TMFAEKADDVIRRSTGSSVGGEKSSPASHTTNSSSWLAKLRWVLSLFGRKSREMVGRH
                     LRLGT"
     gene            51647..52845
                     /locus_tag="MYCTH_88187"
                     /db_xref="GeneID:11512570"
     mRNA            join(51647..51953,52021..52370,52447..52539,52601..52845)
                     /locus_tag="MYCTH_88187"
                     /product="copper transporter-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662415.1"
                     /db_xref="GeneID:11512570"
     CDS             join(51813..51953,52021..52370,52447..52539,52601..52649)
                     /locus_tag="MYCTH_88187"
                     /note="hypothetical copper transporter"
                     /codon_start=1
                     /product="copper transporter-like protein"
                     /protein_id="XP_003662463.1"
                     /db_xref="GeneID:11512570"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="JGIDB:Spoth2_88187"
                     /translation="MDHHDMTGMSSVATMTTTAAAAAATSSGKSGMGGMGGMGSGNGC
                     KISMLWNWNTIDACFIAKSWKITSRGVFAGSCIGVVLLVIVLEMLRRSVKEYDRFLLN
                     KHRKSLAAAKPTPSPKTASDDGTDALHCPAVVSQGYRPNVFEQAIRALLHMLQFAVAY
                     FIMLLAMYYNGYIIICIFIGAYIGSFIFHWETLGGGQQTSASKEATVCCG"
     gene            complement(53495..55070)
                     /locus_tag="MYCTH_2303108"
                     /db_xref="GeneID:11512571"
     mRNA            complement(join(53495..54053,54136..55070))
                     /locus_tag="MYCTH_2303108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662416.1"
                     /db_xref="GeneID:11512571"
     CDS             complement(join(53591..54053,54136..54797))
                     /locus_tag="MYCTH_2303108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662464.1"
                     /db_xref="GeneID:11512571"
                     /db_xref="JGIDB:Spoth2_2303108"
                     /translation="MRLSSTLFAAVAALLVPGSLAADPSKCNTSDKARDGADFVFVEQ
                     ADNPNVASLAKKLKRVNVSDVFEDANHKMTTDSSGRKLWQRTSDFNDFETEKWIPQGI
                     SSTADAVEGGTYEGKDGWIVSWHRNDDKSARVTFVDRANDKYRHALLVYPHAEDNFRE
                     VPIHAGGIMWYGDKLWVVDTTNGIRVFDLANIWQVDTGDAVGKSGSKYTAAGYKYVIP
                     QIRWYKWSSDFSFRFSFLALDRTEKEHTVVVGEYQTSDSLPIRLVKWALDESTGRLKT
                     GADGKTAKATWAYCVGILQMQGAVSANGKFYISTSNGNSKGDLFGWVPGSYAYNNVGF
                     YPPHPEDLSFDKRKNRLYGLTEGKGQRYIIDSDAKKVKFS"
     gene            complement(<56670..>57673)
                     /locus_tag="MYCTH_94504"
                     /db_xref="GeneID:11512572"
     mRNA            complement(join(<56670..57385,57496..>57673))
                     /locus_tag="MYCTH_94504"
                     /product="survival protein
                     sure-likephosphatase/nucleotidase-like protein"
                     /transcript_id="XM_003662417.1"
                     /db_xref="GeneID:11512572"
     CDS             complement(join(56670..57385,57496..57673))
                     /locus_tag="MYCTH_94504"
                     /codon_start=1
                     /product="survival protein
                     sure-likephosphatase/nucleotidase-like protein"
                     /protein_id="XP_003662465.1"
                     /db_xref="GeneID:11512572"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="JGIDB:Spoth2_94504"
                     /translation="MRLNALVVLLPALGAQGIRIIQSNDDGWAEQYARSFHNALIAAG
                     HDAVLSAPAENKSGSGSLDIEPSPRSTPCQYDSCPANSGPIGRNETSPRLNWVNSFPA
                     TSMRYGIDTIGPQLWNGEGPELAVSGPNVGSNLYLAVQFSGTVGAAVHAAKNAKIPAI
                     AFSGASEGTLAWNSPEEPRSRVYAELAATLTNAVIASGKPYLPEDVFLNVNFPKVEGQ
                     CTEASQFKWVLSRINVGLFSAPDTEQCGSTRLPTELSVLDTDGCYISVSVGDANDKTT
                     APAEKQAVVRDKLKSMLTCLP"
     gene            complement(<65137..>65433)
                     /locus_tag="MYCTH_2060854"
                     /db_xref="GeneID:11512527"
     mRNA            complement(<65137..>65433)
                     /locus_tag="MYCTH_2060854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662418.1"
                     /db_xref="GeneID:11512527"
     CDS             complement(65137..>65433)
                     /locus_tag="MYCTH_2060854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662466.1"
                     /db_xref="GeneID:11512527"
                     /db_xref="JGIDB:Spoth2_2060854"
                     /translation="FIRAYIDDIIIFSKTEEEHLKYLYTVYEILNKAYIYIGIAKSFI
                     GYLAVKLLRYIVNGKGIAKTDDHIIAFKKLKFPDTLDSLEHYLRIARWLRKGIL"
     gene            78072..79513
                     /locus_tag="MYCTH_2303110"
                     /db_xref="GeneID:11512528"
     mRNA            join(78072..79053,79117..79513)
                     /locus_tag="MYCTH_2303110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662419.1"
                     /db_xref="GeneID:11512528"
     CDS             join(78330..79053,79117..79400)
                     /locus_tag="MYCTH_2303110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662467.1"
                     /db_xref="GeneID:11512528"
                     /db_xref="JGIDB:Spoth2_2303110"
                     /translation="MRSPSLLLPLLPLALAQLAQAAINWDMFEYGVVPTFRWSRPFPD
                     DGTNPGGFHVHCRHSKTFRAKMYKLRDLSEEPPTGLAPWKVGIEDFLRKRDYVGSWDG
                     VDHKGQDREVVVMEWRDVPGEVRAWIEEQQRDPSEANEKKWLFGVFEKPKAPGEKVYS
                     TVRPRPTAPASSQQQQQQDQQNQEQQEEQQQQQQQQQVEQQKKEAAHDEPEVADQDKI
                     VVFPAGAIYEILPLWVANGSGCERDLNNLTIYRSQAIDHSVLAWPVDHTKPQRDLGKR
                     DITFKIEAMSVTETEDAKRARLMWERMHRTIKRNDRKQQREKRQKAKKELEEQRVRDE
                     L"
     gene            complement(79510..81505)
                     /locus_tag="MYCTH_2303111"
                     /db_xref="GeneID:11512529"
     mRNA            complement(join(79510..81048,81131..81505))
                     /locus_tag="MYCTH_2303111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662420.1"
                     /db_xref="GeneID:11512529"
     CDS             complement(join(79627..81048,81131..81328))
                     /locus_tag="MYCTH_2303111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662468.1"
                     /db_xref="GeneID:11512529"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2303111"
                     /translation="MRPKGEELPSSGPDDNRDHSRTDSDATELDDGLDLDRLGRQRPA
                     VFKNGLHEILFCSSLLVSMFMAEFFISGFNIILPNVSKALEIPKGSQTWPASVFSLVT
                     GSFLLPFGRLADIHGAYVVFNAGIVWFFVWSLVSGFSVNYQMLIVARALGGLGPAAFL
                     PTSIMLLGKTYRPGPRKNLVFSLWSAFAPIGFFLGIITGGATTEYMSWRWYFWLGSVV
                     TFVVCVCSFATIPRDRAQTRAENAHVNMDYWGVATVVPGLILTTFALTDGAHAPDGWR
                     TPYIIITFILGILCLAATVYVEGWVAEQPLLPFDLFKPKYMARLSVALFFAYGVFGIF
                     LFYASFHISDYMGASALQTAVWFAPMAAGGVVLATVGGFTLHLLPGRVLLVFSASGFL
                     ATCLLFAFAPRDGNYWAFIFPAMLGSTIGVDITFIVTNVFITTNVARERQGIAGALIN
                     SLLFVGISFFLGLADLAVSEDENRGGTQGHKVAFWFATACSAVVLLIFATIKLGKAES
                     ELTVEERMRLEAGRQPKPESETRHEATTLDV"
     gene            <82319..>83879
                     /locus_tag="MYCTH_2062045"
                     /db_xref="GeneID:11512530"
     mRNA            join(<82319..82607,82750..>83879)
                     /locus_tag="MYCTH_2062045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662421.1"
                     /db_xref="GeneID:11512530"
     CDS             join(82319..82607,82750..83879)
                     /locus_tag="MYCTH_2062045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662469.1"
                     /db_xref="GeneID:11512530"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2062045"
                     /translation="MPAPGRGPGAAPSPACHNCRRRRLRCDRSLPSCRKCLGSGQKCL
                     GYGPLLRWANAPAVRGRLVGLGERLEVSRISPPLLDPLVNHLDRRARHYVHHFATVVC
                     RVLVSFDQEDFNPFRVIIPLATKFDFLEAIIVATGAMHTALLHGAKDQPGRPEMIDAL
                     VAKDRAIRLLRSAIDNITPDSQAMVLAATVFLINLDLIDSGKGGWQVHIEAASALMSC
                     LQDPAHELDRSLTTSIDTIAADCLTYRVLGSAISGVALTSWAGRDLAEFFSVLRRAEA
                     YSYHCCPPEILHILLSASSLCSDDGPARVPEALALIGRARALDVVAWVHSIRGLSAHD
                     DLDIRVRIALAHRATACLYILLAVPEAAPSPSSVDMLVREVLEHLAAVPIDHMHLKGT
                     IWPTFVVGAQTDDPEQRAWCMERMQAVSTMNRWMCPWGYIRTAVRMMQDLWDARDREP
                     AKGGRRNWLLELKSMREKCLIV"
     gene            <84957..>85547
                     /locus_tag="MYCTH_94500"
                     /db_xref="GeneID:11512531"
     mRNA            <84957..>85547
                     /locus_tag="MYCTH_94500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662422.1"
                     /db_xref="GeneID:11512531"
     CDS             84957..85547
                     /locus_tag="MYCTH_94500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662470.1"
                     /db_xref="GeneID:11512531"
                     /db_xref="JGIDB:Spoth2_94500"
                     /translation="MYLPQLLPKSAAPDNKHSSAAAVSPLPSDGSFRTTSESESASVT
                     IPPPATRGSPPHQTLLALDRNEQHQHHAASSEENLDQTPQPPLPVHPYYHTLGPPRPL
                     PSPPGHDRRGRNVHGRPLLLLQQRLQAREAGTMRAQNVTIGIVVGVLLAVFLAGFFYF
                     VWRYHRSIRIRRRGGHHRRTSKGSRSSASQSTGAAA"
     gene            complement(86102..86183)
                     /locus_tag="MYCTH_t98"
                     /db_xref="GeneID:11512532"
     tRNA            complement(86102..86183)
                     /locus_tag="MYCTH_t98"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:complement(86149..86151),aa:Thr,seq:agt)
                     /db_xref="GeneID:11512532"
     gene            complement(<86482..>87495)
                     /locus_tag="MYCTH_2060890"
                     /db_xref="GeneID:11509869"
     mRNA            complement(<86482..>87495)
                     /locus_tag="MYCTH_2060890"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662423.1"
                     /db_xref="GeneID:11509869"
     CDS             complement(86482..87495)
                     /locus_tag="MYCTH_2060890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662471.1"
                     /db_xref="GeneID:11509869"
                     /db_xref="JGIDB:Spoth2_2060890"
                     /translation="MANSRRSPRASSKLEGSKEPPEILQQVGRAVLSYTLKKLSERQA
                     QSETRSRRAHPRSSRTRTRDPSSESKGSSSRDLPRSESGDVHALISQLVVGAFGFGIR
                     ALVRRRKEAKKKKAAAAAAATQSGSRSAAKGKPQPGQDVGAGAVDPDLSAALDSVTTE
                     LQSASDSIRRLAYSAPPPSHRDCAVRDALLTDADRLSGSLVNLQVSINNMRNLHPSLV
                     HETGQKERPRERPWERPRERTLTRETTKDRERSEGGVRDWVRERQRKPRTEEAREVSK
                     GRARAEGGLERSERVPRSERYRNHREHGRSHEQPEERPRHHRSRRRNESMQRARRPEP
                     MCR"
     gene            complement(87632..88541)
                     /locus_tag="MYCTH_2303112"
                     /db_xref="GeneID:11512533"
     mRNA            complement(87632..88541)
                     /locus_tag="MYCTH_2303112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662424.1"
                     /db_xref="GeneID:11512533"
     CDS             complement(88099..88449)
                     /locus_tag="MYCTH_2303112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662472.1"
                     /db_xref="GeneID:11512533"
                     /db_xref="JGIDB:Spoth2_2303112"
                     /translation="MSERATEGSEMEPGRASEPVVDVATQTEDRGATEQQERSLARAQ
                     SFERDTQLSKSRPYRETRVLRNHDTAVEAQHRSDGGGAPAVRLDMDLDVDVKMQARIN
                     GRLELSILQVFGPR"
     gene            complement(88546..89365)
                     /locus_tag="MYCTH_2314967"
                     /db_xref="GeneID:11512534"
     mRNA            complement(88546..89365)
                     /locus_tag="MYCTH_2314967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662425.1"
                     /db_xref="GeneID:11512534"
     CDS             complement(88873..89262)
                     /locus_tag="MYCTH_2314967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662473.1"
                     /db_xref="GeneID:11512534"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_2314967"
                     /translation="MSESHAINHVASESDFDSLLASTRYVVVDFYADWCGPCKMIAPH
                     FLRMASTFSIPGFLAFAKVDVDKVRPVAQRYSVAAMPTFMFFKEGKQVAVNANERIQG
                     ADLPALAQAVEKVGRLAKEKADAAAAK"
     gene            90851..91767
                     /locus_tag="MYCTH_68564"
                     /db_xref="GeneID:11512535"
     mRNA            join(90851..91128,91198..91767)
                     /locus_tag="MYCTH_68564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662426.1"
                     /db_xref="GeneID:11512535"
     CDS             join(90951..91128,91198..91745)
                     /locus_tag="MYCTH_68564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662474.1"
                     /db_xref="GeneID:11512535"
                     /db_xref="JGIDB:Spoth2_68564"
                     /translation="MTSPADPHSKCFSHINGTSDQLRDRLAVSELCKGWPVYRDASEW
                     KNYRNLFTEDATVWTTWSGPRHVDDFIAISKAGKEKGVFIMHRECGTLVELNSCNRRA
                     IGKMKATITHRFKFDPSTGGPGVSPVTETAEFDVDCDCRFIFFCEKNPATDEWKAKYV
                     KLFYEKDKVVPVDGRTAPVFTKEELDKIPVGYKYLGAAQARIGYQIDLDLPTASGELF
                     GRMYAEMEKWLDGKPVDLFWESK"
     gene            110667..113259
                     /locus_tag="MYCTH_2303121"
                     /db_xref="GeneID:11512536"
     mRNA            110667..113259
                     /locus_tag="MYCTH_2303121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662427.1"
                     /db_xref="GeneID:11512536"
     CDS             111128..113122
                     /locus_tag="MYCTH_2303121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662475.1"
                     /db_xref="GeneID:11512536"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="JGIDB:Spoth2_2303121"
                     /translation="MPQPDRRRSVLNERPVPNEQLFDPVSRCSASLPNPSESSKTATS
                     YRRPVPPTALAATGPSSTTVSEHSQRQSSSQKPKQPTPIPAHSPSQSPASSKMTQHSM
                     SIPERISARGGSISDFMAEIAALFWFESTKLLERLETTKKLVPGVQVQPLAPAAVASQ
                     HFKKWVSSVLTTTQVTQNVVILALLYIHRLKKANPTVKGRPGSEYRLLTVALMLGNKF
                     LDDNTYTNKTWADVSGISVNEIHVMEVEFLSNMRYSLLVSAEEWEQWLDKLARFWSYV
                     ELAQQAQSSAPSPLMIPSPTHRAYASPLHSPTVPLTPGLQSTTHSSSFQSPNLGPAAN
                     ASQNWITSHGGSNANSPLALKPQPSLHRKRSFPEENQAEHPAKRASLLPAVQGNASSQ
                     APLQYSSNGLQAQVGLAGAGSVAPVQSRPVPAPLPDHGRQHVPSLTLNTAQATADVTV
                     TQPQTYTSSAYTLQQPPLSLPPLASGARAMSIVFSATTYPPSQPVPASGGAVTPTTSF
                     PPMSYNTPTKRLSPQNTLAAYPGSSPLVMGNGTTSGLHTPISHSPSIYLQQRNSPYKP
                     VRHVNTLLYPPPSAFLQQYQLPNPVLPNQMHYQPLGKRNEYRTGIVPEFLDSAHRVAG
                     YHQPPVPQMLPNLPAHSQQSRAQYQLTPAARAGPSYPGQY"
     gene            complement(115172..118696)
                     /locus_tag="MYCTH_2303122"
                     /db_xref="GeneID:11512537"
     mRNA            complement(join(115172..116487,116561..118696))
                     /locus_tag="MYCTH_2303122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662428.1"
                     /db_xref="GeneID:11512537"
     CDS             complement(join(115294..116487,116561..118633))
                     /locus_tag="MYCTH_2303122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662476.1"
                     /db_xref="GeneID:11512537"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="JGIDB:Spoth2_2303122"
                     /translation="MPSAGPEHDFQVPREPYCRSAHGTVYYFPRRQADHGRRLDPDHF
                     PAALIQPRQRRPHSIHIVSYPPGFVPPDLRSPKTSRGTAARQEKRKRRKREKEEAKQR
                     KKGEKERERQEKERRRADKENSEKQQKRRSLRSLSSGSGRFGRVVDKIVAAFSITPKP
                     PPAASARPAGNTPRSRPSSFISFARRLSRLEPATSEPILAGEPDPEPASMTAVTVPRP
                     QAAITTAVMPENRNTIMSIRSSKSMMSSSACEVQKPVASGSGVSCSILLAEPNVFLSG
                     FDHDRHTRRSIQSTSALLRGKLQLNVSKNVKIKAITLRLVGKGRTEWPEGIPPSKSEV
                     FEETTLRAQSLIFFHAMHEGMWDTEYGSQCTYILKNASPMGSRHSTVTSGSLPIPGKG
                     RSSTLTAKELKRLSLQSVNSRSFGKADSPHINHVHAKGYKIFPPGTYEYAFELPIDHS
                     QPETARLPFGSVRWDLEMTVERAGAFKPNLHGSREVSIVRLPDQISLETVEPISISRL
                     WEDQLHYDIVISGKSFPIGAKIPIAFKLTPLAKVQVHRLRVFVTENIEYWTNDRRVTR
                     KDAGRKILLLEKAAGMPLDKRFSASDVRVVCGGELSPEQREEARMMAARRRMRDASWN
                     RGSPEPLPEPSDNLLGDLDLGLETFWGSTEIEMNVQLPTCDMMARDKLLRLHPDCSWK
                     NVNVFHWIKVVMRISRSDPDDPTGKRRRHFEISIDSPFTVLNCRATQANTALPRYSGS
                     GAPVIPEQRQQMSCGCPDAQPLDPSAAALARPLTLVEQDFINASGRRLRLDGSASLPS
                     VPLAAHRPSGRQTVSSSDARPETFFTPTEQDRPIHLLRYPSHNPPAFDADEPPPPLPL
                     QTPPPQYDLIVGTPSVDGLADYFARLAAYEGNEGNGAAGACPGGEEQAADRVESGSDA
                     DTVGPDTDNTGGEATRPSTASTAPPPVLPQQPSPAGAVAHWHADTSTGTVGDEVDPFK
                     NLSMDSGDQESGRPPTEAPAPAPAPAPTLAPAPAPCPGSRGGGDDGDDAADAESSGSE
                     DSVDEEHGRARLHRGGRVNVANPRTPGGRMVPSRSLEIERPTVRLDMTNVLRRRADRA
                     "
     gene            124175..125272
                     /locus_tag="MYCTH_2303125"
                     /db_xref="GeneID:11512538"
     mRNA            join(124175..124217,124370..125272)
                     /locus_tag="MYCTH_2303125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662429.1"
                     /db_xref="GeneID:11512538"
     CDS             join(124201..124217,124370..125024)
                     /locus_tag="MYCTH_2303125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662477.1"
                     /db_xref="GeneID:11512538"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_2303125"
                     /translation="MKEFVESGQVRYLGLSECGADTLRRAVRVHPIHAYQIEYSPFTL
                     DIERPGSGGGSGGSGVDDTLARTCRDLGIAIVAYSPLGRGVVTGRHASADEFRAELEE
                     NDFRRLVPRFSADNLPHNMRLAEVFKERAAAAARKGKGNEGCTPAQLVLAWLMKQDGV
                     FPIPGTKRIAFLEENVGANAVFERMTDDDEREIRAAVESAEVRGTRYPEAMMGGLVKD
                     TPPRQ"
     gene            149364..151434
                     /locus_tag="MYCTH_2079066"
                     /db_xref="GeneID:11512539"
     mRNA            join(149364..150077,150156..151434)
                     /locus_tag="MYCTH_2079066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662430.1"
                     /db_xref="GeneID:11512539"
     CDS             join(149840..150077,150156..150916)
                     /locus_tag="MYCTH_2079066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662478.1"
                     /db_xref="GeneID:11512539"
                     /db_xref="JGIDB:Spoth2_2079066"
                     /translation="MGFGDFDSICRMAPLPLCSSIGPITSIASGVGIEPDCYARNIEV
                     ANTMIFQGAASAMHIVALVMTVVMVLHVRGKFTAVGRKEILTFFYLYMLLTFLSLCVD
                     AGVVPPGSGPYPYFVAVQAGLSSALVTCLMINGFVGFQLYEDGTPLSLWMLRFCSAAA
                     FVISFLVALATFKTWAGLGPTKTVGLFVVLYLLNAVQLFVYVVLQILLVTRTLQDRWP
                     LGDIAFGVFFFVAGQVILYAASSPICNAVSHYLDGLFFATTCNLLAVMMVYKYWDSIT
                     KEDLEFSVGTRMNNWEVKDLLPEEDRRATMYHDDPYGQSTAYDTPFSPTSNRYSRY"
     gene            152005..156747
                     /locus_tag="MYCTH_2303128"
                     /db_xref="GeneID:11512540"
     mRNA            join(152005..152453,152574..156510,156621..156747)
                     /locus_tag="MYCTH_2303128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662431.1"
                     /db_xref="GeneID:11512540"
     CDS             join(152792..156510,156621..156687)
                     /locus_tag="MYCTH_2303128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662479.1"
                     /db_xref="GeneID:11512540"
                     /db_xref="JGIDB:Spoth2_2303128"
                     /translation="MAISSPATAAAPAAAPSPPSSSAAPSSEAPSATAAPPAASSAMA
                     NSVAEKETAAEPDPDPWPQIEHNYFTSMRLHREREDAALAEAYHAKTDPLRQRLVDNY
                     NAQAELLRQLRALREQYDTAQAELGALEEEWQVLMDEKRREREREDEERRAWFRKYRR
                     GGLAYRGAGAATATATATATATATATATAADADAAANGSDVNGQGNAERDGERRKVGD
                     SRVDGLDKGGEGEVEAEVSNGQQSQAQANGEEQRREENEPESEGSGEEHDKGAVEQEQ
                     RNGMEVDAQPSALAKSVEVLGFAQGREKGQEHRQPANGDRDAPGVPSSVNDHTEKPRF
                     EPEKIDDDKRVSDGQGDTVSEDRPTNEHSSPPVAGQGEGESRTVEALRADERAKSSLA
                     ERNTAEAVPSVPPGKSIEMDSSETVNGADLPRRIVSPPTTEAGSPVESRMRDQQPESA
                     EPTADAQQGGIELTQNASRVEISGINGTVGRRDGDGDVEMPDAQIRPENDTNGALGND
                     RPQAASAALGAPASPSSSSELSSRNTTPELDTPVYLGRDPSPSETPEQKSLGNIEILG
                     ESGDPIGRVKAEDFGNSVMSRIVQLPVKRPVQIRSGRKFTTDDLDAVERPEPGNARPS
                     RFVSLFVQATGELQARPCLDCTADGGPYLDCVMVDDPEFPRCGNCEWNQRCCQGGTTE
                     RPSDSRQNLTSKPPADSPTKRRASSSGPTAIDPAAENRESREELKPSTSNSDGRDSRE
                     AATKKGPRKSLPGSRNVPLPSTPSTSFQDEGELLPEITKDVLSLKHDGVVFTDPPIMR
                     GVPLAKISPEHPYWEPDWKPLEEIVEPVWQKHQERYDQLERSGTTYRDKHLANRDAKR
                     GRLILKFLEEGELHPYQLVGKQWINHRLTNYDTLYRLAQLLTDELPKMNLDVTPSEWL
                     RHRLHELYLEHGDKLDVANWIRRAYHDRKIEQLRLKNGFPRVGRPPAHASKSTEPGGS
                     SKKATGPRSLKRKDPHQTPESTPSKSKTGSTLRESPSVASDAGSSSAAATAKTGGPGQ
                     QPKPKKIKIITSQPQLQPSSKPPSTKAPKIILNSPYPPSATSDKAPALKGSRAAAKGK
                     EDDQGSALEYDGYTSSDSISGDTLHVNDWRLHQVKTRTFATNPQVTQYWHWVTEQKEH
                     NLIEHQVLESVGPPVKWSIFKRPYNFHLKLPDIQEVSFARASNRVVVTHRKGRDGKDL
                     APRGDIMAEFKRDRTKRRFLTFLRRDKGVKVIELSREAIEAKWNSLSPETLPGPDSD"
     gene            157554..158788
                     /locus_tag="MYCTH_2091689"
                     /db_xref="GeneID:11512541"
     mRNA            join(157554..157689,157779..157810,157989..158788)
                     /locus_tag="MYCTH_2091689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662432.1"
                     /db_xref="GeneID:11512541"
     CDS             join(157666..157689,157779..157810,157989..158280)
                     /locus_tag="MYCTH_2091689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662480.1"
                     /db_xref="GeneID:11512541"
                     /db_xref="JGIDB:Spoth2_2091689"
                     /translation="MLYETIGIVRPGNLKEVKEIVLTAGQLILRQGGVIRDVANWGVF
                     HLPRAISHNQTRYTRGHYFVLRYDAGVATHQDVTKTLRLDPRVIRSGGVKLGDGKLET
                     LSKFGAVQWKNME"
     gene            complement(159050..161025)
                     /locus_tag="MYCTH_2303133"
                     /db_xref="GeneID:11512542"
     mRNA            complement(join(159050..160145,160217..160311,
                     160423..161025))
                     /locus_tag="MYCTH_2303133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662433.1"
                     /db_xref="GeneID:11512542"
     CDS             complement(join(159442..160145,160217..160311,
                     160423..160721))
                     /locus_tag="MYCTH_2303133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662481.1"
                     /db_xref="GeneID:11512542"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="JGIDB:Spoth2_2303133"
                     /translation="MPGLRRFFHSYFHKQPESKSPSHPEASTETDSSDATLVLPPPSS
                     HRSPGLLPIRDRMRGSGKAQAPDANTQTMPKAGKKRATGGSAAAQKPYTKAQEAARYY
                     NDTQNHGANRKADAGTKAQLNKLFDELISEEDKARDDLEPVAEIGAEQCMAYLERLNV
                     NPASYELFVVLEIVRAESIGIITRAGFVDGWADVIAASGGSGRVTPDWAGQRQLVHAR
                     IAQALTDPNYFKTIYDFAFQVGREPGQKAITMAVAVGFWEGLYVPDKNPWRSAHVDWL
                     GAWTRFLKEKFGVVKVNSDGEEEVEYKRTVSKDLWTQTRLFAAKSMQDETLSFWSEEQ
                     AWPGLIDEFVIWCKEKGIVPNANNGESMVVE"
     gene            complement(162687..166007)
                     /locus_tag="MYCTH_2303134"
                     /db_xref="GeneID:11512543"
     mRNA            complement(join(162687..163219,163297..163890,
                     163956..164095,164184..164963,165213..166007))
                     /locus_tag="MYCTH_2303134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662434.1"
                     /db_xref="GeneID:11512543"
     CDS             complement(join(163010..163219,163297..163890,
                     163956..164095,164184..164963,165213..165714))
                     /locus_tag="MYCTH_2303134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662482.1"
                     /db_xref="GeneID:11512543"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2303134"
                     /translation="MSLFGTPSPEGSPDMRSSNFGNGRPSLFEDEPPMTRSTTTALFA
                     DDDAGSDSPWDMPTPRRQQTRADVLRNLLANSTVPDSYIDVFEKMVAEDGSAGRISAG
                     GVAKTLAAAKLGADDQARIMSIVAPGGSAEDVSLDRNQFNVLLALIGLAQEGEPVSLD
                     TVDERRRDLPRLKLHGIVDSTSALAHAEELAAKPPQRPATPPRAPDPVSPARHRSVRK
                     PSMEYPEDPWNTPDLHRNHDHGPEAPRLNGHDRSSSAGPPNGNAFPTGPQATLPRRTT
                     STFTTNVPPSGAGSVVEAPGAWGAMDGRNAPATGGGFNEQLQNPAAPFGGIPTAGGAS
                     QETAGVLPPAPAAANRTIGGGRNGAPVQEHIIVTLMPEKEGMFLFQHHNYEVTSTRRG
                     SKVIRRYSDFVWLLDCLHKRYPFRVLPLLPPKRVAVNGNHLSNDGAFIEKRRRGLARF
                     LNALVRHPVLSQEQLVIMFLTVPTELSVWRKQATISVQDEFTGRPLPPGLEDSLPPSL
                     EDLFARTRAGVKRSAELYITICNLMDRLVKRTEGVAADHARLALSLLSLTEASADTYA
                     TDTNDVPLLNDGLQAMSRHLRTAQSLMEDESRAWESGVLEDLKRQRDALVSLRDLFDR
                     RERLDKDNIPYLEKRIAANESKLASLRAKPEGLVKPGEIEKVVEAIIKDKESIVNQHN
                     RSVFVKECLRDELIYFQHTQYNVSRWNQDWAQERIKYSEMLADNWRRLLDGLEGMPLG
                     D"
     gene            complement(<255781..>258042)
                     /locus_tag="MYCTH_94486"
                     /db_xref="GeneID:11512544"
     mRNA            complement(join(<255781..256989,257860..>258042))
                     /locus_tag="MYCTH_94486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662435.1"
                     /db_xref="GeneID:11512544"
     CDS             complement(join(255781..256989,257860..258042))
                     /locus_tag="MYCTH_94486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662483.1"
                     /db_xref="GeneID:11512544"
                     /db_xref="JGIDB:Spoth2_94486"
                     /translation="MVQNGGDFDLDIDMATNVTAEQLLAQLGQLQQRIQELDQRDKAA
                     QARIKELENREKYSQKLNVTEVAATSYEDKDSDTDSLGHDGNGEDEQAPYSELVTVDP
                     ETGLAEWDMAGEYAPPISILPILRQWGFTVTQRRDGSWTTDTQGIERPGPNALFLQER
                     IEWYRNEVFRLNTELRERDGRLTRLAQQSDEMKDEMRELRRIVETIKGEQPVTYDGPD
                     SYAEHFDDQQLSHDVRNPEYQFMRANRGKDERTWESYWEKHSYLSIGVPTVHVQWEGF
                     GKEFQYLPGDATRLHPRHEAHAQVPWFQCVAHECRYHFRDKFENNHWPTRQENRDGGL
                     CPVEWVYDAGNRAAELLWKIEARDLESITIVPRRAWPRHCGTGRDTWDSCWSNDCLYH
                     ADEKKLRIRELQMKLWHARRKAERTQWWEAASTQWLTEMSTIDEAAISRTTEEVSTDL
                     GNGSGPFEGPGNH"
     gene            complement(281229..282427)
                     /locus_tag="MYCTH_2303153"
                     /db_xref="GeneID:11512545"
     mRNA            complement(join(281229..282003,282068..282427))
                     /locus_tag="MYCTH_2303153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662436.1"
                     /db_xref="GeneID:11512545"
     CDS             complement(join(281421..282003,282068..282387))
                     /locus_tag="MYCTH_2303153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662484.1"
                     /db_xref="GeneID:11512545"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="JGIDB:Spoth2_2303153"
                     /translation="MPPIPFAQAARCCAAAIKAPARQPSLVSLFAALSVQTRSASILA
                     NLSDNKGAYHKRIRRGRGPSSGYGKTAGRGHKGTGQHSRIKPWFQGGQTPLIVSHGRH
                     GFVNHRAPEMMEFNIDQLQTWIDNGRLDPTKPITPRELIKSGIVGSTIKDGIKILARG
                     GDKLKTPVDIFVSRASAAAIKAVEAAGGKIVTRFYTKESLKRLVKGQSINTDKPLPVG
                     PEHVESVLEQVRTSKKHYYRLPDPTSRDDIEYYRDPAHRGYLSHTLKPGESPSLFFKV
                     PGTEAPKARPMSKEKAEELASRLF"
     gene            complement(<283953..>284990)
                     /locus_tag="MYCTH_94484"
                     /db_xref="GeneID:11512546"
     mRNA            complement(<283953..>284990)
                     /locus_tag="MYCTH_94484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662437.1"
                     /db_xref="GeneID:11512546"
     CDS             complement(283953..284990)
                     /locus_tag="MYCTH_94484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662485.1"
                     /db_xref="GeneID:11512546"
                     /db_xref="JGIDB:Spoth2_94484"
                     /translation="MGQMGSSLSRLAGRQKAGRHKARSPSLILQYPADIIVYLCREHL
                     PPESALALSLTCKSLFDLLFSKAKMRLNDPDREAFLLLLEKDVGHNRYYCHTCSVLHR
                     FWSSEHTINCTFCVRVWEKSCRREFAYLSGTSFRVRYRHVRLVMNRHFLGPPNGLPLD
                     KFEVKNTSYSSLRWREKWSAKILKDELFLSGTRTLSWLHGTDQALRDNLDNCLYSICT
                     HVATNKSAKLTVSALHTDSPSACLIVPCRGAIGSCNQCLTDYDTTVERRSTEIKYGER
                     KLVTEYWFITITSYHQLGSGRSPFDPKWRAFEGQGSWVSWRPSRDMTQYPQGAVREAW
                     KESEKASHNPS"
     gene            complement(<285600..>285830)
                     /locus_tag="MYCTH_2019378"
                     /db_xref="GeneID:11512547"
     mRNA            complement(<285600..>285830)
                     /locus_tag="MYCTH_2019378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662438.1"
                     /db_xref="GeneID:11512547"
     CDS             complement(<285600..>285830)
                     /locus_tag="MYCTH_2019378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662486.1"
                     /db_xref="GeneID:11512547"
                     /db_xref="JGIDB:Spoth2_2019378"
                     /translation="QIPIGPWAKDPTLKELGRFEQLHMQMSVASHAPALFTRVFAWPR
                     EQVQLLIEGVKREFRTRDLRLITSYRFVIGRSP"
     gene            285865..286351
                     /locus_tag="MYCTH_2303155"
                     /db_xref="GeneID:11512548"
     mRNA            285865..286351
                     /locus_tag="MYCTH_2303155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662439.1"
                     /db_xref="GeneID:11512548"
     CDS             286127..286315
                     /locus_tag="MYCTH_2303155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662487.1"
                     /db_xref="GeneID:11512548"
                     /db_xref="JGIDB:Spoth2_2303155"
                     /translation="MLLCSLLLCWIPRPLLLLFLFLLLRSCCLRRWRHRTKSLAPRRG
                     KFRERHALILSLPVFSAS"
     gene            <287068..>288208
                     /locus_tag="MYCTH_2126239"
                     /db_xref="GeneID:11512549"
     mRNA            join(<287068..287340,287632..287982,288128..>288208)
                     /locus_tag="MYCTH_2126239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662440.1"
                     /db_xref="GeneID:11512549"
     CDS             join(287068..287340,287632..287982,288128..288208)
                     /locus_tag="MYCTH_2126239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662488.1"
                     /db_xref="GeneID:11512549"
                     /db_xref="JGIDB:Spoth2_2126239"
                     /translation="MVSEEGNTMDNTAAAVAESLDDNGLLASTLSHAAKCSGGKLKDL
                     YHFDAKADVFPDYVAAAHPKLAAKMSCIHTGFFTTSHRILPSAYFSKPVPHLDVNADT
                     GSFVCAVHQMPPGGAYIHGGGRVYLSWPEFAAAWARVTGAAIRYREISVAEMVDHLIP
                     HPDLGLEVALMFAYSSEPGYDGGMRLLRAGDLRKGRERERERERSSKHADIDCLMLTV
                     EESLARQEWAAVLGQQ"
     gene            complement(288321..289959)
                     /locus_tag="MYCTH_2303157"
                     /db_xref="GeneID:11512550"
     mRNA            complement(join(288321..288946,289099..289505,
                     289645..289959))
                     /locus_tag="MYCTH_2303157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662441.1"
                     /db_xref="GeneID:11512550"
     CDS             complement(join(288579..288946,289099..289505,
                     289645..289691))
                     /locus_tag="MYCTH_2303157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662489.1"
                     /db_xref="GeneID:11512550"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="JGIDB:Spoth2_2303157"
                     /translation="MVSQATSAQPKITLYWLNDSRAQRIAWLLEELGLEYNVKVFYRD
                     ADMLAPDELRKVHPLGKSPLVSIALPDDHPADPAKQEKHLVLAESGLIVQYLTEHLGR
                     DTSLAPKRYRDGREGQLGGETDEWMRYQYYLHYPEGSLMPPLVLGLVMRILHGPKVPF
                     FIRPITSSVVDKLFAVYLGPEIANHLAFLESQLETSPGNGQYLCGPSLTAADILMSYP
                     LQAAKQRFAQVTAGKGKGTLGDNFPKVWAYLKRLEEEPGFKRAEARIKQELEKKR"
     gene            complement(290280..291236)
                     /locus_tag="MYCTH_2303158"
                     /db_xref="GeneID:11512551"
     mRNA            complement(join(290280..290601,290665..291236))
                     /locus_tag="MYCTH_2303158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662442.1"
                     /db_xref="GeneID:11512551"
     CDS             complement(290771..290941)
                     /locus_tag="MYCTH_2303158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662490.1"
                     /db_xref="GeneID:11512551"
                     /db_xref="JGIDB:Spoth2_2303158"
                     /translation="MDVERVSRKRAMRATERLAAIAARSALVYFRVSVFAAILNTIVT
                     ADGRVELRVFTE"
     gene            291654..293540
                     /locus_tag="MYCTH_2303159"
                     /db_xref="GeneID:11512552"
     mRNA            291654..293540
                     /locus_tag="MYCTH_2303159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662443.1"
                     /db_xref="GeneID:11512552"
     CDS             291888..293375
                     /locus_tag="MYCTH_2303159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662491.1"
                     /db_xref="GeneID:11512552"
                     /db_xref="JGIDB:Spoth2_2303159"
                     /translation="MFGKKVRRKQQYHLLRIPGEIRNQIYSDLLLSSPHAVPIYRGGG
                     KKAAAPGTATRTTDEVLSALTVLTALLRTCRQIHREAGTLFYSRARFALPPDASRAPH
                     QAQVNLLFRAFLDRIGPRNAALIRHLAIPFPVDPDLFLQHASLFPRRRPPGGQEGRRE
                     PASGHTDEQRRDEDEYGNEYGDEYDGDDDDEDAALLLITALRRRCPALETLTFDLRCN
                     NSWARRLLLLLNVMTEAATRKTTKTTTTMISMTTTAQVTGAAQAAALRLFGPVDSLLR
                     AAFPRLKRVDLLLGAGVYRNPWADPITPAEAAWLQAVLGSEMEGKEKEDKQKMMMKER
                     KKKDKRGFSAKWDVTVEDGNKEERGGSNAEAAGSSSANNWRSGGGWEWWGVGKWYGTP
                     RRPRHAIEVLYGPPAHAVRSEMHDQWTSLDVGLAYLRLAIAWLRSPTRAVLDREEAVE
                     WKRWRRAMLANAAPRGRGTLSLKSLRVGGGSGRRSLRSLICRKQT"
     gene            294120..295683
                     /locus_tag="MYCTH_2143478"
                     /db_xref="GeneID:11512553"
     mRNA            294120..295683
                     /locus_tag="MYCTH_2143478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662444.1"
                     /db_xref="GeneID:11512553"
     CDS             294525..295667
                     /locus_tag="MYCTH_2143478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662492.1"
                     /db_xref="GeneID:11512553"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2143478"
                     /translation="MAARLVSHPAPKPHSIYEYAGLARPPHLGRLERATHKSGVVESL
                     SIGVDDEDDGYVPGFLHLPPDIFTTDAPPPSAAAVSTKSSDQEEEGGGGGGGPGAPTA
                     EQTSQQQEQQQQEQQQQQHYQRPATAQPPHHHRTAAILLSGAGGGVTGPSSMYLSLAC
                     KLATLGRGIPTLRLDYRAAGRRESCAADARAGMAYLRDLYGLDRFVLVGWSLGGAVAL
                     SAAADDPRVVGCAAVASQMPLPVPLPGTEGEGTLALDLALTDADADAVAACLPPRPLL
                     LLHGSDDSTVGVECSRRLFDAYGTRDGAGAGDRALEIFEGDNHALSGNAERAEELLCE
                     FVARCAGVRVGPREREDVVAAELVEGGERHALMERGGDLRQPERED"
     gene            296519..299094
                     /locus_tag="MYCTH_2303163"
                     /db_xref="GeneID:11512554"
     mRNA            join(296519..297205,297390..298301,298421..298586,
                     298673..298789,298890..299094)
                     /locus_tag="MYCTH_2303163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662445.1"
                     /db_xref="GeneID:11512554"
     CDS             join(296678..297205,297390..298301,298421..298586,
                     298673..298789,298890..298972)
                     /locus_tag="MYCTH_2303163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662493.1"
                     /db_xref="GeneID:11512554"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR012941"
                     /db_xref="JGIDB:Spoth2_2303163"
                     /translation="MTTTEAEKVDVLICGSGSAGLCAAVWLARFGVNYRILERRDGPL
                     KTGQADGVQTRTVEIFDSFGIAEELLREAYHVLEVAFWAPDPRDPGEIARTRYAADKE
                     TAISHQPHVILNQARLNALMTGLLGPEPPVEYGCEVREVRVDDGAAAEDPDAYAVTVT
                     AVKDGVERTYRAKYVLGCDGAHSTVRRSLGFKMVGDSSDAVWGVMDVYPRTDFPDIRK
                     KCVINSAAGSILVVPREGDALVRLYTELPAGTRVADVSLEGLQAHARRVFGGRYPLDF
                     AETAWWSAYSIGQRLADRFHRAHRVFLTGDACHTHSPKAGQGMNVSLQDGHNVGWKLG
                     MVLRRLARPDVLLPTYVLERERTAADLIDFDRAFARLFDSRYRRENHVSPRDVADHFV
                     RAGRYTAGQAVRYDPSVITAATPSSSSSSSSVASGLTVGMAFRSAQVVRFCDAKAMQL
                     VKGMPANGQWYLVVFAGDLARPESAARLREVTRSLERIAYRFTPPGADPDSVIDRILV
                     LASDRKTVEQDEIPAFFTPVTGKRGMKCLTKVFADEESYNSGHGHAYEAYGVHPERGA
                     LVVVRPDHYVSKIASLDEADSLEQFFEGFMIPQRT"
     gene            complement(300848..302290)
                     /locus_tag="MYCTH_2303165"
                     /db_xref="GeneID:11512555"
     mRNA            complement(300848..302290)
                     /locus_tag="MYCTH_2303165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662446.1"
                     /db_xref="GeneID:11512555"
     CDS             complement(301012..301968)
                     /locus_tag="MYCTH_2303165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662494.1"
                     /db_xref="GeneID:11512555"
                     /db_xref="JGIDB:Spoth2_2303165"
                     /translation="MSSPPAKTDTKTILFLGATGGVGLSALRRSLAAGHSCIALCRTP
                     SKLTSQLQQPDGGSGTVPPNLDIVQGDAHDAAALARCLARPVDAIVFSLGGRPTLRGL
                     SEPQVCERGMATLLAALRETKAKREAAASATTTERGEEEIRTRQERGRGEGKKPRLVV
                     VSTTGISEAERDVPLVMMPLYWAMLSAPHRDKRAMERLVVQEAGELADWTLVRGSLYT
                     DGPATEGRVRAGMEDPVRRVVEVAAAPGYTISREDVGKWLFEECIEGGNKWVGKAAMI
                     SYCAIVGSVFGYILYLELGGGGVGPGKEALIYRMTLLVIIPT"
     gene            305320..307670
                     /locus_tag="MYCTH_2303166"
                     /db_xref="GeneID:11512556"
     mRNA            305320..307670
                     /locus_tag="MYCTH_2303166"
                     /product="glycosyltransferase family 55 protein"
                     /transcript_id="XM_003662447.1"
                     /db_xref="GeneID:11512556"
     CDS             305641..307557
                     /locus_tag="MYCTH_2303166"
                     /note="CAZy_ID 268031"
                     /codon_start=1
                     /product="glycosyltransferase family 55 protein"
                     /protein_id="XP_003662495.1"
                     /db_xref="GeneID:11512556"
                     /db_xref="JGIDB:Spoth2_2303166"
                     /translation="MSVTVLTSPPPPPVRYPSLAWPEIPPLRQIPGLASAKSSPAAFS
                     APDENRIKPHHTTAAVSAATTTAATTTTATTTRGASMRLTRPSESRSFGLLHIAGEAQ
                     VVDLDAPGPQGGRSQGHGGVSGQTEAGGTATVCCSREALDAVLSDMVIVVPCKDEELA
                     VIRGVISAIPALCLVILVSNCARGEGDEYAQQVAMARAFGRAGRQVLTVHQRDPAAAA
                     ALRAAGMEELCESGADGGGAVIRNGKGEGMVLGIALAAAFCPGRRYIGFVDADNLCAA
                     SVTEYCRVFAAGFAMSPPPERGDCMVRLRWRSKPKVRNGRVEFVSEGRCSRVVNSWLS
                     RLFAAPATKEDNNTDNNSNSNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSTMKN
                     MRAAPGTGPDTHFITTGNAGEHAMTIGLALKLRMAAGYAIEPFHFVDLLERAHLSAPS
                     GGGSKASEETPGGRNDKNNNNNNGSGSDGSSNGNNNSRSHPHPHPRKPLSRPVRVLQI
                     RTLSPHYHRPSDGEHIRRMWAAGLGSVFHGLAAHAGGELLPGPDGAPDGAADGAAMAI
                     SELRRDMHDFAVRQANVDRATGELPCPRTYPALETIDLDKFRDLMLRHSLGRGSLRSF
                     GWPADKDHPAWAQS"
     gene            complement(<308285..>309362)
                     /locus_tag="MYCTH_94476"
                     /db_xref="GeneID:11512557"
     mRNA            complement(join(<308285..308337,308460..308715,
                     308778..308791,308854..308917,309056..309281,
                     309340..>309362))
                     /locus_tag="MYCTH_94476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662448.1"
                     /db_xref="GeneID:11512557"
     CDS             complement(join(308285..308337,308460..308715,
                     308778..308791,308854..308917,309056..309281,
                     309340..309362))
                     /locus_tag="MYCTH_94476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662496.1"
                     /db_xref="GeneID:11512557"
                     /db_xref="JGIDB:Spoth2_94476"
                     /translation="MSVPYTWGRLQEATFQKSTNPPQTNPRRAVASPDRCDRCRKARP
                     NRPSMQCTASTRQMVSVHRLLPDGLDSVLQPQKGIRVSKVGWKNEGPSLQGEGINTVA
                     PAVHAVYLGSQAPTPPTAPFTLQTISGLTAGFSSDTVCSAPGTPKLPATPGPTVRPEY
                     VKYSLSGVSGVMSARKKTWSGVGLGLGRLQSGSDLLITLVLAYLDESSTTN"
     gene            <311037..>312342
                     /locus_tag="MYCTH_2126246"
                     /db_xref="GeneID:11512573"
     mRNA            join(<311037..311097,312068..>312342)
                     /locus_tag="MYCTH_2126246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662449.1"
                     /db_xref="GeneID:11512573"
     CDS             join(311037..311097,312068..312342)
                     /locus_tag="MYCTH_2126246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662497.1"
                     /db_xref="GeneID:11512573"
                     /db_xref="JGIDB:Spoth2_2126246"
                     /translation="MTCKFVGIDRRNSLIVQQSSTLTTPSTRPLADASSGPGSTMCQW
                     EEIIYACDSSQHYGRKVQKMAYSCDIYRRHVYGPCRYDKRYDRPMTLVYSDEYCDECQ
                     RMFEYINYH"
     gene            316315..316400
                     /locus_tag="MYCTH_t78"
                     /db_xref="GeneID:11512574"
     tRNA            316315..316400
                     /locus_tag="MYCTH_t78"
                     /product="tRNA-Trp"
                     /note="Anticodon: CCA"
                     /anticodon=(pos:316347..316349,aa:Trp,seq:cca)
                     /db_xref="GeneID:11512574"
     gene            complement(<317318..>318172)
                     /locus_tag="MYCTH_2109689"
                     /db_xref="GeneID:11509849"
     mRNA            complement(<317318..>318172)
                     /locus_tag="MYCTH_2109689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662450.1"
                     /db_xref="GeneID:11509849"
     CDS             complement(317318..318172)
                     /locus_tag="MYCTH_2109689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662498.1"
                     /db_xref="GeneID:11509849"
                     /db_xref="JGIDB:Spoth2_2109689"
                     /translation="MLLLLASLLAASANGVALVARQNVNQVVRLSSVENVAVRSTGEI
                     LATNMNSANLYSIDPVAKTSATALTVSGARGLSGIGEYAPDVFAVIGGKAVYSVDFTA
                     SPPASSAIATIAEASNLNGLAVLSNSTVLVADAGRGLVYRLDVGTGEYAVALQDATMA
                     PSGGIPFGIDGIKYRDGVVWYTNIFKNSFHRVAVDPHTAEAVGPYETLWTNLMGDDLC
                     FGPDGLIYVATNAGNSLVEVDPAVGTPRTVGSVTGSTSCAFGRTDADANVAYVGAGQG
                     VYAVTVQV"
     gene            complement(319114..322196)
                     /locus_tag="MYCTH_2303167"
                     /db_xref="GeneID:11512575"
     mRNA            complement(join(319114..321603,321696..322196))
                     /locus_tag="MYCTH_2303167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662451.1"
                     /db_xref="GeneID:11512575"
     CDS             complement(join(319437..321603,321696..321880))
                     /locus_tag="MYCTH_2303167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662499.1"
                     /db_xref="GeneID:11512575"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2303167"
                     /translation="MELVASTGGAVSPPAPRRGRREKPWPPGKQKKLLRLYVCTQSER
                     LPLIRILERLKDGSFDPRQRNSHKHLKNLLPDRRIDDWRPRDLATMLVRVRFLRSVRA
                     ERRIRNRRVRRRLEAQSRNPIAHDMLEPVGTRMSVDRQQVEQQAGFFAESPSTDSPST
                     VKQSESAGSTPQAVSTGSSDTNHRDKSPSRASSTTPSTKSAKRRSWASVLSSISSGIS
                     SLARSSSSASSKNVNFNPSGGNTALSKMTREEFLAMLQERPRKPTKPSGAAAVGNLFK
                     SKYSTVNPTTEDLNAALVRMCCAARIGRGPPGCVHERLSKAIDAQKTDGYDFTHFRVT
                     EEEANMVDKYGNSLLHVAARWGARISILLMILKRTDDVQMINHRGETFLHVYDPPENP
                     RMRPVSFLNLIRTLRARGFDFCHRDVDKHTFLHHLVAKKAFPIETLYYVFREVGYGTA
                     RFLVANKSANGERLWHSVRRNLEQAAPKLHRIFGDEVEFIRRYLPEFGSEGKAPSTAD
                     TSTIGSDSLASIHPTEVPTLGLVFDPNESNAQNVRRTPVMKLLRRAAASRAGVTDAEL
                     TAKLEHVLESAAKAADFDMQSFLSKRDTEGNTALHYAAEFGLVPAVQFLCAKGASVNV
                     FNNCGNTPLQLVKYAIQRTDVRSDIHMEARYLRCAVLLLEQGAFDQSKLVSERSVISA
                     YDVFDGSERSISNLVRQGVASQCRGLHLLTSSVRHHSPRYLEDLERDYGSDGQNGGYL
                     GYDGYEQQRRGSESNGGAATARGTGAGMSMTFQTSALTSRVAT"
     gene            324666..325631
                     /locus_tag="MYCTH_2314976"
                     /db_xref="GeneID:11512576"
     mRNA            324666..325631
                     /locus_tag="MYCTH_2314976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662452.1"
                     /db_xref="GeneID:11512576"
     CDS             324741..325379
                     /locus_tag="MYCTH_2314976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662500.1"
                     /db_xref="GeneID:11512576"
                     /db_xref="JGIDB:Spoth2_2314976"
                     /translation="MRAQIATLLALAAPLYAIEITSPSKNDVVDPSKGVTVKWTTVST
                     DPDRAHLVLVNMAAGHTPFTKDLGEVDLSTGSYTVKEKDIPNDGGYQFNFESDEPQNT
                     GILAQSAQFEVKSSSSAQDEDEKSSSSAASASTTVQSVTSADTSTGSETTVTGTATTL
                     TTSTGSASETTGASRTASASSVTSTAAAAPTGMAAHSGSLFALMVGAAAVLA"
     gene            complement(326727..327692)
                     /locus_tag="MYCTH_2303170"
                     /db_xref="GeneID:11512577"
     mRNA            complement(326727..327692)
                     /locus_tag="MYCTH_2303170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662453.1"
                     /db_xref="GeneID:11512577"
     CDS             complement(326920..327579)
                     /locus_tag="MYCTH_2303170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662501.1"
                     /db_xref="GeneID:11512577"
                     /db_xref="JGIDB:Spoth2_2303170"
                     /translation="MKKKDHLALSGLLVDPLTWLTEVSPPGSRGAPGSYCAEDEAAAN
                     ILGAPPCSSLFGCVESDLECGVPLFFDNHDEDPGSDQSSIAWLFLPSKDEEEEEGQRE
                     DGQAQAAANSDGIWDWYADEIRSRGSSEQVPCEGSSECEKTGEGESSPSEGSTPESPP
                     ATAREEPDPDDGKAEEPREYVGVGLAPPLVFPLKRERLSVFKRAYIFASFENRECLRP
                     M"
     gene            complement(<329193..>330501)
                     /locus_tag="MYCTH_102172"
                     /db_xref="GeneID:11512578"
     mRNA            complement(join(<329193..329772,329895..330248,
                     330392..>330501))
                     /locus_tag="MYCTH_102172"
                     /product="Aldo/keto reductase-like protein"
                     /transcript_id="XM_003662454.1"
                     /db_xref="GeneID:11512578"
     CDS             complement(join(329193..329772,329895..330248,
                     330392..330501))
                     /locus_tag="MYCTH_102172"
                     /codon_start=1
                     /product="Aldo/keto reductase-like protein"
                     /protein_id="XP_003662502.1"
                     /db_xref="GeneID:11512578"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_102172"
                     /translation="MAPPAKLPTRKLGKDGPEITALGFGLMGLSTAYGSVGSDEERLR
                     VLDRAWELGCTNWDSADMYGDSEDLVGKWFALHPERRADVFLATKFGLSPGVRADGSR
                     GLVIDSSPEYCRARCEKSLRRLGVDSIDLYYVHRVDGKTPIEKTMAELVKLKEEGKIK
                     YIGISACSAATLRRACAVGPVHAYQVEYSPWALDIEGPESGHVLAACRELGVSVFAYS
                     PLGRGFLTGQIRSPDDFEPGDLRRLLPRFSKENFPKNLELVARFKQLAAQKGCMPGQL
                     AMAWLLAQGPDVIPIPGTKNVKYLEENVGALHVSVSSGEERVIRGWIEDVGIAGLRVP
                     PGLLDEFNDTPPL"
     gene            complement(330869..332437)
                     /locus_tag="MYCTH_2303173"
                     /db_xref="GeneID:11512579"
     mRNA            complement(330869..332437)
                     /locus_tag="MYCTH_2303173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662455.1"
                     /db_xref="GeneID:11512579"
     CDS             complement(331236..331982)
                     /locus_tag="MYCTH_2303173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662503.1"
                     /db_xref="GeneID:11512579"
                     /db_xref="JGIDB:Spoth2_2303173"
                     /translation="MTTTTAASLPPAASLPTLPPAAQAATLDLLFEPSADLHAVALPA
                     LQRARPLGSYDDLVAAVRARLLELADAAETEAEAEEEETEKVGAEARRRLFSVLGSHP
                     RLGEKKKKKEEAKAEVEVEVTETETKAGSRGPGGEGGGEGGGEGGEGQDESALSALSA
                     AEQSHLSAEDEELARLNREYEARFPGLRYVVWVNGRPRAEVLEDMRRRIQRGDMKAEV
                     RTIIEVSKLFFFFFASLPFFFPPCLLICCA"
     gene            complement(341763..343959)
                     /locus_tag="MYCTH_2303174"
                     /db_xref="GeneID:11512580"
     mRNA            complement(341763..343959)
                     /locus_tag="MYCTH_2303174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662456.1"
                     /db_xref="GeneID:11512580"
     CDS             complement(342441..343895)
                     /locus_tag="MYCTH_2303174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662504.1"
                     /db_xref="GeneID:11512580"
                     /db_xref="JGIDB:Spoth2_2303174"
                     /translation="MTDMRVQFEPIGRSLKQYGPWHFADARFEEDHHTGLGPALLQTA
                     DIPGLSDRLLGISKGGRPDPGSPRSEVTLSVSKVRHTPGSSPDPALPKGSSPAHPTEI
                     SQPLLPAIFHPSLAFTDPAPSGKAVVTFPLPEPARVPKPCLKRRRPVTDVDGPGTNAT
                     SRKKRRLLRQLITSRLSQPFSLPATHILNRESVAAGGKRFAKLTAIMSARRLNSAVVS
                     PVSPQQPSPSTWLRRAAVLNSLRNRVHATAAERANIPVPDLAAKATALQQSHGFATTF
                     VGGRYLIATPIHQANKAMLPGPHGSTAGPAAATLSLSSSAAAATAATTQRSPPGAAAA
                     HHHHHHQTLHSNSHHPPPSTTRLRIPSPKLRPLRSPELRVTRPLVPLEDIEPLLVDDP
                     SSFSGDTDCVAFPTADLESRYIYGDDDDEEGGGEGVYADFSVIFGSGGKKSGDGEGGG
                     DGATGGSGDGRDGDGDCFEDYMDDLDGIPWGDTW"
     gene            348534..349937
                     /locus_tag="MYCTH_2303176"
                     /db_xref="GeneID:11512581"
     mRNA            join(348534..348898,348967..349937)
                     /locus_tag="MYCTH_2303176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662457.1"
                     /db_xref="GeneID:11512581"
     CDS             join(348629..348898,348967..349860)
                     /locus_tag="MYCTH_2303176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662505.1"
                     /db_xref="GeneID:11512581"
                     /db_xref="JGIDB:Spoth2_2303176"
                     /translation="MPSDDKTLLPLQEALNLVKLAAEGDSRRYMGTRAAYLPGADLSP
                     DKGMLSTHKAAFGGHVYGQAALAVARTQRELEDETGRKPSERLSLHTIHGYFTRAGIP
                     SRPFLYTVTPLTSSRTFSTLSVTAYQPSEPSTNPQGDHFPLSDAALPLSPPSFTGMCS
                     FKLPEPDSQGVSTQEAPPQERFASILSSRAPEDWPPVPPLDITAFVEIVGADEPGKFP
                     VATMRKVDMTAYNAGRPVHERRELMLYKLLAPLPTTGGDGDGGGGGGGGGTGAEEGEG
                     KGQGQVWDANAHVIAHAYVADRNGLLLAGNHVGFGHALARAATLSYTFVVHVNAELAV
                     MREEDGWWVQEMFFPRTAAGRGIVESKIWSPAGVHVATEYQDGLVQGRGLGKL"
     gene            350565..351931
                     /locus_tag="MYCTH_2303180"
                     /db_xref="GeneID:11512582"
     mRNA            join(350565..350760,350905..350946,351151..351309,
                     351372..351472,351553..351931)
                     /locus_tag="MYCTH_2303180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662458.1"
                     /db_xref="GeneID:11512582"
     CDS             join(350667..350760,350905..350946,351151..351309,
                     351372..351472,351553..351711)
                     /locus_tag="MYCTH_2303180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662506.1"
                     /db_xref="GeneID:11512582"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="JGIDB:Spoth2_2303180"
                     /translation="MFLQRSAVAVARRAAVASPMLRRSIATTAVRHNAVPDQPKIKTF
                     KEVKTEEDLIGPGAAPGTVPTDLEQATGLERLEILGKMEGVDVFDMRPLDASRRGTLE
                     NPILVRSAGEEQYAGCTGFPADSHNVLWLTMTRERPVTRCTECGNVYKMEYVGPEHVD
                     HHYHNPYGLKEPKTISDYIKPEYW"
     gene            complement(352393..353105)
                     /locus_tag="MYCTH_2303183"
                     /db_xref="GeneID:11512583"
     mRNA            complement(352393..353105)
                     /locus_tag="MYCTH_2303183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662459.1"
                     /db_xref="GeneID:11512583"
     CDS             complement(352441..353070)
                     /locus_tag="MYCTH_2303183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662507.1"
                     /db_xref="GeneID:11512583"
                     /db_xref="JGIDB:Spoth2_2303183"
                     /translation="MSQKITAKNLQYNANLPPFLARLRGQHASETDRDGPDPILAARR
                     RPAKPRSKSAEAEDAPLVVDEHGNSIDDVAVGADGSVREKRSETADDQQQQQQQQKQQ
                     EEQQRDQAADADTAASGEKLASVGDQRKKRKFGRVIGAGASEEDEGEEKGGEWRSEMD
                     PRIGKTGRDSGASGTEPDAKQKDGSAATVKAKAKKKAKKIKLSFGDDEG"
     gene            354940..357135
                     /locus_tag="MYCTH_2303184"
                     /db_xref="GeneID:11512584"
     mRNA            join(354940..355007,355617..357135)
                     /locus_tag="MYCTH_2303184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662460.1"
                     /db_xref="GeneID:11512584"
     CDS             355748..357112
                     /locus_tag="MYCTH_2303184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662508.1"
                     /db_xref="GeneID:11512584"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2303184"
                     /translation="MDSHGSPRSSDIAQVAPSLPLPWPEDDPCPEFRSHYAVTDRFVS
                     AAFPDYHTQSTQQMFSRDATSPTFSHSAWIDNAEALHAAPHELPSEPPSHGYHAPMIE
                     APSSLVDQQMPQRVENFVECGLGSAMPGFSGSHTSLLDHGVVEAIPLGGTNPIYGATE
                     AQDMMLCTQGHTPLHYAVIGNDLQKAKTMLHAGASPNAASRNGTTPLHYAAYQRNVEM
                     VKLLLDYGASLDATTDKKRSVLFFAVRSHGQLDSSDLLIYGDSTMTASNPPTDDDTVR
                     IINALYNSPTRWRCLLRSLNKSDKDGVTPLMVAARGGFGKTATLLLERGAQPDQRDHS
                     DHTALKYAAMSNHRDLVRLLLLTDEAVSSERKPSHVLKLASKNIPTSDVPAQHEQETW
                     EDSHFVSSAAFLAEEIVRLCQEMGMLDGLLNLAYRKSKLHLLELFLRATRRLDIETSH
                     GNGS"
     gene            complement(358666..361034)
                     /locus_tag="MYCTH_2079097"
                     /db_xref="GeneID:11512585"
     mRNA            complement(join(358666..359832,359938..360375,
                     360482..361034))
                     /locus_tag="MYCTH_2079097"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003662461.1"
                     /db_xref="GeneID:11512585"
     CDS             complement(join(359051..359832,359938..360375,
                     360482..360602))
                     /locus_tag="MYCTH_2079097"
                     /note="CAZy_ID 267797"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003662509.1"
                     /db_xref="GeneID:11512585"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Spoth2_2079097"
                     /translation="MVRGLLPLGAALLGATAVLADGPPKCTLDKKCPKEAPCCSQYGE
                     CGVGAYCLGGCDPRMSYSLDSCVPAPVCKDKVYKMDNLDRYKDISEYLGDSSKTDWVG
                     QGEPLLYNGNVLLTMPPKSVGTVLSTTTYMWYGKVKARLKTSRGAGVVTAFILFSDVK
                     DEIDYEFVGVDLQTAQTNYYFQGIPDYNNSGNITVSGNTYDEFHDYEIHWTPDEITWL
                     VDGKVGRTKKRSETWNETLNQWDYPQTPSRVQLSIWPGGAETNAKGTIDWAGGPIDWD
                     SDEIKNFGYYFATFSEVSVECYKTDTPPGTSKGKSYYYDDVRGTNDTVVDSNKRTTLK
                     SLLGTGTDMDKGDTTSSGKPSSTSSVNAIPGGGSTPPNQVPGGSNPSSSDGSSSGSGS
                     SGSSTCSSEGFQQHCGEDGSSSTDNKNDGARGVDRTLGASAFAVIVGFAGLLLL"
     gene            complement(362823..365663)
                     /locus_tag="MYCTH_2303193"
                     /db_xref="GeneID:11512586"
     mRNA            complement(join(362823..362990,363049..363166,
                     363225..363305,363407..364361,364888..364964,
                     365379..365663))
                     /locus_tag="MYCTH_2303193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662462.1"
                     /db_xref="GeneID:11512586"
     CDS             complement(join(362959..362990,363049..363166,
                     363225..363305,363407..364361,364888..364961))
                     /locus_tag="MYCTH_2303193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662510.1"
                     /db_xref="GeneID:11512586"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2303193"
                     /translation="MHQWTISPMPEYLYSNSTNHPNELHQSPYQQPQPQPPQPQQQQP
                     PPPPPQQQQQQQQPDVTRRDQPTDYRAYPAQPPPTSQPQHPHQQQQQQQQHGQQHHAV
                     PPVQPHAQQSQAPPPQQQQAPASAPTQSGRRKRPAPGAHPPAHAQPHPQQQHVPHQPQ
                     HAPPPHAPQHVPQHGSQHASQHGAQHAQQHPSQHPQHPSQHAPQHMTAPPAGQPQQQQ
                     QQQAAPTAPMASPQLAQPPSQQQQQQQPQQQQPQRQQSAHLPQHSPHQPHQQHAQQPH
                     QQHVSGSAPAQTQTQPTTGAAQPTSTDDTPAPPPAKKSRTNTPWTPAEELRLKQMRDA
                     GNSWAEIAKTFPQRTEGSVKKHWYKDMHYAEFAEDEKAALFSAIKDYENNKWKFIGQK
                     VGKPAKACEQFAKEHFPELFPPQQKGR"
     gene            <373032..>374395
                     /locus_tag="MYCTH_2061546"
                     /db_xref="GeneID:11512587"
     mRNA            join(<373032..373172,373253..>374395)
                     /locus_tag="MYCTH_2061546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662463.1"
                     /db_xref="GeneID:11512587"
     CDS             join(373032..373172,373253..374395)
                     /locus_tag="MYCTH_2061546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662511.1"
                     /db_xref="GeneID:11512587"
                     /db_xref="JGIDB:Spoth2_2061546"
                     /translation="MSPTMHMTGHHVPYMPRSDAIDRHDYGINKNRKAASTGGGRAWS
                     EDEEAYLLRTRMQKMPYKHIAAHLKKTELACRLHYHQLSHGSNRRKRTTSTSSGSSNS
                     SHSPVLQTSMPSPIREHGGATSRSVSPLDSIYRSNSPGGIQLPSIMSATAPNNHSPRL
                     PTILPKPASMSPAQASSTNSSGSAGTASPQASRGYPTPLHDTHPHTGAPVNSAGYRDG
                     ANPSARGSRGGAPHHGPGRGNLRLDCSALPPPPSANGLPAPPGLVASHPVDMARLTAA
                     YNAHRASFWAAVAADYGPSANPLVLEQAWRGTSAGNGTQPNGSGSGSGNSPCAGGGGA
                     GSIANLGIAAQTPITPVGSPEDQAYSACGGSSGGSVVHHPGNSGGGGGGHHGKPDRTR
                     ISAILGIDANPSSPSEREMVRRMEEERGAVGLGMA"
     gene            <374992..>376045
                     /locus_tag="MYCTH_94462"
                     /db_xref="GeneID:11512588"
     mRNA            join(<374992..375075,375138..375202,375261..375298,
                     375328..375377,375410..375568,375622..375648,
                     375853..375979,376017..>376045)
                     /locus_tag="MYCTH_94462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662464.1"
                     /db_xref="GeneID:11512588"
     CDS             join(374992..375075,375138..375202,375261..375298,
                     375328..375377,375410..375568,375622..375648,
                     375853..375979,376017..376045)
                     /locus_tag="MYCTH_94462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662512.1"
                     /db_xref="GeneID:11512588"
                     /db_xref="JGIDB:Spoth2_94462"
                     /translation="MLNGLNGLNGLNGSEELAQGGRTGQGGVQFLSVAKVHIAMSTGG
                     LVGWCMCQGQDLISLVPSGMSLHCYAASTQTSTSILGCAMLCTYSVPLSTTSFGPGLR
                     RGGRSKPGSHRRELQIVASTDHSGSIKHTRRTGILPLPGGKAAGTMGPASMNDHYFQS
                     LPGANRMPSSGPDAVPRSDTTLQIAVSLLADT"
     gene            377784..>380586
                     /locus_tag="MYCTH_68509"
                     /db_xref="GeneID:11512589"
     mRNA            join(377784..378072,378300..378397,378474..378481,
                     378562..378669,378767..>380586)
                     /locus_tag="MYCTH_68509"
                     /product="dihydroxy-acid and 6-phosphogluconate
                     dehydratase-like protein"
                     /transcript_id="XM_003662465.1"
                     /db_xref="GeneID:11512589"
     CDS             join(377908..378072,378300..378397,378474..378481,
                     378562..378669,378767..380268)
                     /locus_tag="MYCTH_68509"
                     /note="Dihydroxy-acid and 6-phosphogluconate
                     dehydratase-like protein"
                     /codon_start=1
                     /product="dihydroxy-acid and 6-phosphogluconate
                     dehydratase-like protein"
                     /protein_id="XP_003662513.1"
                     /db_xref="GeneID:11512589"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="JGIDB:Spoth2_68509"
                     /translation="MAPHANEAPVGQNDHPDRNLPKPGDYLQFDCLPPGGPLNRWSQV
                     LTRGHDFPGAQAMLYAAGVPNRDMMKNAPQVGIATVWWEGNPCNTHLLELGNIVKKSV
                     EQQKMLAWQYNTIGVSDGITMGGDGMKFSLQTREIIADSIETVTCAQRHDANISIPGC
                     DKNMPGVVMAAARHNRPFLMIYGGTIRKGHSSLLDKEINISTCYEASGAYMYNRLEAK
                     CKMPSGADATPSDVMEDIERHACPGAGACGGMYTANTMATAIEAMGLTLPGSSSFPAT
                     SPEKRRECERAAEAIRTCMEKDIRPRDLMSRAAFENALVVSIVLGGSTNAVLHFLAMA
                     NTADVPLTLDDIDRTSNRTPLLADLAPSGRHYMEDLYAVGGTPAVLKTLIAHGLIDGS
                     VPTVTGKTLAENVRDWPSLPEGQKILRPLSDPIKKTGHIRVLRGNLSPGGAVAKITGK
                     EGLSFTGAVRTFDKEHELSDALARGAIRPDAGNLVLIVRYEGPKGGPGMPEQLKASAA
                     IMGAGLRNVALVTDGRYSGASHGFIVGHVVPEAAVGGPVALVRDGDVVTIDAVANRID
                     VVEIPGVGKGPEAVAAEFDRRRKEWKPPKMKPMRGVLAKYARLVGDASHGAVTDVGES
                     AW"
     gene            complement(381022..383086)
                     /locus_tag="MYCTH_2303205"
                     /db_xref="GeneID:11512590"
     mRNA            complement(join(381022..381424,381515..381899,
                     381958..382044,382106..382504,382589..383086))
                     /locus_tag="MYCTH_2303205"
                     /product="glycosyltransferase family 15 protein"
                     /transcript_id="XM_003662466.1"
                     /db_xref="GeneID:11512590"
     CDS             complement(join(381083..381424,381515..381899,
                     381958..382044,382106..382504,382589..382872))
                     /locus_tag="MYCTH_2303205"
                     /note="CAZy_ID 267887"
                     /codon_start=1
                     /product="glycosyltransferase family 15 protein"
                     /protein_id="XP_003662514.1"
                     /db_xref="GeneID:11512590"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="JGIDB:Spoth2_2303205"
                     /translation="MDLLRRAGRFIPARRSPLPLSDEKGKLRPRRTLASRFAYLRRPL
                     RLKGNSTISVPLGVVILFPCIFVILILVLFVRHPSSAGRALMPTGAPPAIRKISEKHD
                     KVFVTGCLQPDTSKPRANAAFVVLARNKELDGVIQSIKSIERHFNRWYNYPYVFLNDG
                     DFDQNFMDTVRNYTSSSVEFGKVGPDMWGYPDWIDPKVAKEGINKQGDDAIMYGGMES
                     YHFMCRFYSGFFYKHPLLAKYEWYWRLEPEIKYFCDITYDPFLEMIANNKTYGFTIAV
                     KELRETVPNIFRYASAYKRLKGYKSQGLWEMFVEPQPEKKEKEKLPEEVQRTEPARLP
                     DFDPEAMEGEKYNMCHFWSNFEIARLDFFRSKEYEEFFQMMDRSGGFWMERWGDAPIH
                     SLAAGILLSPRDIHYFRDFGYRHTTIQHCPANAPGRQLPREPWLEKTTLNEKERIEED
                     QYWEHWDEPQENGVGCRCRCDTDIVEVEGKEGSCLPEWVDVAGGWASP"
     gene            383604..383685
                     /locus_tag="MYCTH_t79"
                     /db_xref="GeneID:11512591"
     tRNA            383604..383685
                     /locus_tag="MYCTH_t79"
                     /product="tRNA-Ser"
                     /note="Anticodon: AGA"
                     /anticodon=(pos:383638..383640,aa:Ser,seq:aga)
                     /db_xref="GeneID:11512591"
     gene            <384783..>386761
                     /locus_tag="MYCTH_2117807"
                     /db_xref="GeneID:11509850"
     mRNA            join(<384783..384868,384931..385071,385162..385411,
                     385535..385722,385950..386232,386447..>386761)
                     /locus_tag="MYCTH_2117807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662467.1"
                     /db_xref="GeneID:11509850"
     CDS             join(384783..384868,384931..385071,385162..385411,
                     385535..385722,385950..386232,386447..386761)
                     /locus_tag="MYCTH_2117807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662515.1"
                     /db_xref="GeneID:11509850"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Spoth2_2117807"
                     /translation="MRGIQSLVSLSLLAGAWANPMHKRWKPNAPRNPDFPLDEVDKLE
                     ESIMPNVEAWMSKRPAKYSNCTLENAGIRREWSDLSVDERKEYISAVLCLQSKPSKIP
                     EGEVPGALSRFDDFVATHMTMAGQLHSPTNLFAAHRYFIHAYEKALREECGYKGYQPY
                     MNYDRYADDPLNTPLFDGSDSSMSGNGGPYNYSGIPQPFPKPYNLIPPAGGGGCVTEG
                     PFRDMVVSLGPKGGLFHDIPRNPRADGLGSNPRCLRRDVNKYSARGARANYTYSAIMD
                     NPDIDSFYNRYMGMPQLKGDPYPWGLHSSGHYLIGGDPGGDFYCSPGDPLFYFHHGML
                     DRVWWIWQMQDPENRVQAVPGTNTMPMPPLMAANLESEAAATTTHKRAVNVSDLVVDL
                     GWTAPPVKLVDLNEQLGGLGGELCYIYV"
     gene            complement(<386958..>388102)
                     /locus_tag="MYCTH_2109705"
                     /db_xref="GeneID:11512592"
     mRNA            complement(join(<386958..387006,387063..387096,
                     387130..>388102))
                     /locus_tag="MYCTH_2109705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662468.1"
                     /db_xref="GeneID:11512592"
     CDS             complement(join(386958..387006,387063..387096,
                     387130..388102))
                     /locus_tag="MYCTH_2109705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662516.1"
                     /db_xref="GeneID:11512592"
                     /db_xref="JGIDB:Spoth2_2109705"
                     /translation="MVLQSPEAAFIILSALSPSLGDHLALAGKLRARIASSRGAKWAL
                     GIIVFALLFVVMDPWMVLTGRDTAGTPYSLLGVTPVWFDDEITHAYHAVIARIALLGP
                     QVGGIPGLVVDPLRAYHDAYLTLIDPLRRCVYHRDTGIPDWYGVPATCWGSLAVNRLR
                     AAQRLVRARLGGDDPLPHATAALRLLKARFRFAAGGAAAAVEAAPKHPATTAGQTLLA
                     WQQAVLSSAWGECLRWLGITKRAAALTLSLFRLSWKYRNWLRPFLPVLLKASQLEEWA
                     ASHPARVIMTSAVVALALVSGTVICYVSPDRFERYRIRKQRAGGGKRQQNVEHESPQS
                     LRAVLSRVIVILDGRNY"
     gene            388167..389068
                     /locus_tag="MYCTH_2303206"
                     /db_xref="GeneID:11512593"
     mRNA            join(388167..388307,388415..389068)
                     /locus_tag="MYCTH_2303206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662469.1"
                     /db_xref="GeneID:11512593"
     CDS             388507..388812
                     /locus_tag="MYCTH_2303206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662517.1"
                     /db_xref="GeneID:11512593"
                     /db_xref="JGIDB:Spoth2_2303206"
                     /translation="MDTRQGNWTSVVLDGIDGDQSGITTDFGLRVTLEEAVVLQTGGV
                     VNVKFESEAAFKVGDNMAGACGASGVCNWVLKSENAPVFVKQKLVELECVAGTCELV"
     gene            389254..392845
                     /locus_tag="MYCTH_107891"
                     /db_xref="GeneID:11512594"
     mRNA            join(389254..390371,390763..390889,390946..390990,
                     391055..391499,391556..392013,392105..392845)
                     /locus_tag="MYCTH_107891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662470.1"
                     /db_xref="GeneID:11512594"
     CDS             join(389325..390371,390763..390889,390946..390990,
                     391055..391499,391556..392013,392105..392577)
                     /locus_tag="MYCTH_107891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662518.1"
                     /db_xref="GeneID:11512594"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="JGIDB:Spoth2_107891"
                     /translation="MAGHDAPKLDFVTVDVFTDTRFVGNPLAVVFVPAALRDRIDQST
                     KQRIAREFNLSETVFLHTLDNEPNRSVTTREIDIFTTEDELPFAGHPTIGSAYLVLKH
                     LGWSHVDTLQTKAGPIRIESLQDQDQGRGQGRVRAAIPHAVHIHQQTLGGILESPSGP
                     LASAAADAIRQGLSADADIRAAELAAPVVSIVRGMTFVLVRLPSLEHLARVTPARRID
                     FGKVPELLDQGEWHDSFVSRYYYVPRGQEADEGALADDGSRSWKIQTRMVELGFEDPA
                     TGSAACALASYLAVRNEAVRGARFEITQGVEMGRRSDIVVDTVALKDKESGEVKIKEL
                     FLGGTAVVVMSGSIARDRLGSRQLPKSWVTCKSHPGPGQADPISFEEHAQNIKMLCAL
                     SGEVPEEPVVSRKTGTVFEKRLILKYIEENGKEPGTNEELDPEDLLDVKTSRVVRPRP
                     PNFTSLPSLLKAFQDEWDALVLETYNTREQLARTREELATALYQHDAAVRVIARLTKE
                     RDEAREALAKLTVTPASAGAANGDAMAVDSESLPQNLVEHVQELQQQLMKGRKKRPIP
                     QGWASSDEVAALQQVAYADLAVSQASCLGIESDYAAIGGLDGKLDIYSIQANKVERTI
                     DIGEPVTATVWTGSKVIVATSKGSVKVFDNGSETASFQAHAGAVTGLSVHPGGRLLAS
                     VGVDKSFIFYDLDTLQKVARGYTDASLTTCAFHPDGNLFGAGTQTGDVKVFRTDTGEQ
                     AETFPLGTPVQTLVFSENGFWFAAAGKGQSTTTIFDLRKSGAAAQVKELQTGDAQALA
                     WDYTGQYLATAGSTGVTVQMYIKSSKSWSEPLRTSTPATALRWGAEAKTLVTVSKEGV
                     VSVLGAKE"
     gene            393323..395488
                     /locus_tag="MYCTH_2303213"
                     /db_xref="GeneID:11512595"
     mRNA            join(393323..395091,395167..395488)
                     /locus_tag="MYCTH_2303213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662471.1"
                     /db_xref="GeneID:11512595"
     CDS             join(393478..395091,395167..395328)
                     /locus_tag="MYCTH_2303213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662519.1"
                     /db_xref="GeneID:11512595"
                     /db_xref="JGIDB:Spoth2_2303213"
                     /translation="MDRHDPIDLEGLPSDAFDTEDFDDDQPQTASDRSSSPAESSPVD
                     SDDDEVEYSDPELDEIGGVGDEADHDSQEDDDFEVQDEDEDEDDTDDEHSSFDLENDD
                     PYDLVLDGEAVLDELWAESAHDWGFGGDSERETSNERPSASPSAGHRFAGLLAEIHAR
                     RDAEGDSLFVDRGPNILPPLEELISNVRRNHARALGLASELHSHLFGGQERTSRGSLG
                     GATAGPSRESHRQNHRQSSHRTPQGPSRERARMNDNRHSGLRDELVEVEVQPSRASLR
                     RSRSPPRRQPEVIDLTGEPDSPELPRAVVPPRGARASNAPAAGRNPRRHASLNQRTPS
                     LARTDSSILGNQTNVIDLTLDDSPAPPPLPQQLPRRNNPDNSPHHRHHHNHQHRHRHS
                     ARAQASDLDNPGGFGARFAGIIRNLDIIHRFGFGRQPEVEVQFIGGRGLNMDNPLGAN
                     IPNLDYRVNGSHPGSTPKPDHVPPPPAREGFTRDTGNPDDVVICPSCEQELKYDPDAG
                     NESGVRPAKKPRTRKDQEEHHFWALKDCGHVYCKDCYENRRVGSKNSSVRFRRDPENT
                     RKNLCAVEGCTSEANNKSNWVGLFV"
     gene            complement(396408..398247)
                     /locus_tag="MYCTH_2303215"
                     /db_xref="GeneID:11512596"
     mRNA            complement(join(396408..397234,397351..397479,
                     397587..398247))
                     /locus_tag="MYCTH_2303215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662472.1"
                     /db_xref="GeneID:11512596"
     CDS             complement(join(396523..397234,397351..397479,
                     397587..397978))
                     /locus_tag="MYCTH_2303215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662520.1"
                     /db_xref="GeneID:11512596"
                     /db_xref="JGIDB:Spoth2_2303215"
                     /translation="MSITGVSLGEDLTRRRRQTNSRYRGPKPQYNRVHALILTWSFHD
                     LRLEDYTAQPETEYVSLEQETARLRATLEGYGYAVHEYLIPMHRSVESLKTKIKQFCA
                     RYAADDTLLIIYYHGHGAMDDDNELVFSSHDHPENAEWLKAAAADLYAALLTGGAYAT
                     KGRLDSRQNLLKKYERLRPIASVPWSAIRDPILSAACDVLLVLDCCAAGGASLRHLHW
                     QPPPGAEAYTKHLFAACGFESSTSDDMTAAMCEVLEEWVPPPQSSSSSRIQSRAASVD
                     SRVDDDEDDDVGVGGGGGGGAGGGGGAGGGAGGKNSGNGGRGRGGGGGGEGVVGGGAG
                     RPVGAGQFLTTKRLHQLMEDKLQKRSVGSQPIFKQLLPQDPEQYITLPKLRRREASTE
                     DVKLAERRSRGRRGYIIP"
     gene            complement(<399865..>402540)
                     /locus_tag="MYCTH_94453"
                     /db_xref="GeneID:11512597"
     mRNA            complement(<399865..>402540)
                     /locus_tag="MYCTH_94453"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662473.1"
                     /db_xref="GeneID:11512597"
     CDS             complement(399865..402540)
                     /locus_tag="MYCTH_94453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662521.1"
                     /db_xref="GeneID:11512597"
                     /db_xref="JGIDB:Spoth2_94453"
                     /translation="MAPRHQHTFTLVPNPLGMQGLMSRPTNGPQSKPPMTSKQAQKLY
                     REATRGPRLSKAEQRRIEREEQERIRRELEREKQLNRARVLRERKKAKEQQALEEKRR
                     KGLPLVDVRPSQDTIARFVRGNGAGKKRNAAGESVDISAVQAEATGAGSVVGYRSNEE
                     EPFREATDTSESKRRRLEQDPKGEEGEDHGPQRAPDAKGVESPSAVTAIERAEKSSFT
                     AESKVSVPGYPVINLAEAVKVPAPVAKACTGEGESRSASAQAELRTESQLEQRRAGNP
                     TSAATSSENASPTVVCRPISAGNAVLTKPSEVVVDEGLDKGVMTKRPVVPSVRQQTPS
                     RNRNITMHERAMATTPKPQPKQLAMSPMPEKPPINKRPQTPNPLPRASPPQQQQQQQQ
                     QQQRPSSRPPQAQPVPTRKALQEITNSSNRMRPVSVTDGASKFASPYKHTIATPQRQS
                     PNNGPAFRQTKPSNSSAGTVQKPQFLPARLRNAATHNQPVSQTSAAKAQSRSPQGNFL
                     SEPPTSTQLFITSHLDELLPSPTQEAREIQGDSPPAVSKPARPDTERPPIAAFVTDRS
                     RRLARRVTHVQEPMAPPPRPTTVVQQAQMKAVAGKPALVPEPSDAFELSFLSTQDLSF
                     SSQDLRELDEPTSSTGTVNPRSNNGPPPFKQRTTVPQQPSLLSHSPSGITAQRSTPQH
                     RPKPPDSTARRHPSPICATRQLPGSAVGNGCCSTPTCVVERKPALECNKYVPPSDKTR
                     QPPEGQPRGPSPEKPRFFGSSGEGIVALALDRSIKTYQEEEERRRREREAQQDAAKAG
                     SVGIGRGLDKQKGSPPPNMENQMREDATRREYEHATLPQQKPPTTSNNSAPSNVHKED
                     AASLPTIMHTASQETEYGDVELDSMDLELLFATTG"
     gene            407683..411632
                     /locus_tag="MYCTH_2314986"
                     /db_xref="GeneID:11512598"
     mRNA            join(407683..408196,408288..408576,408660..408977,
                     409056..410274,410410..410709,410811..411070,
                     411148..411632)
                     /locus_tag="MYCTH_2314986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662474.1"
                     /db_xref="GeneID:11512598"
     CDS             join(407804..408196,408288..408576,408660..408977,
                     409056..409399)
                     /locus_tag="MYCTH_2314986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662522.1"
                     /db_xref="GeneID:11512598"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2314986"
                     /translation="MASPDQKPIIIIGAGISGLLLAQYLRKSGTRVPFRIFERDADLT
                     TRGIGWGLTLHWSLPALRSLLPEDIVRRLPEAYVDRAAVAEGRPSTFPFFNLSTGELK
                     AKTPTADESQRIRVTRDRLRRLLSTGLDIQWNKAANGVRTTEDGTVTVTFDDGTSCEG
                     SLVVACDGGSSRIRGLLFPEHPKYRIPVRLLGVKIDCTPEEIEPLRKLDPYFLQGAAS
                     ENDSFVYCSVLDAPGNAPEGNGGKYTYQMVFSWPVRDGFFNQPAPIEFPETNEGRVEL
                     IKKFAKTWADPFRSLALSIPSDTEVKSLELYDWPPPKGLRTTGNVALVGDALHPMVMY
                     RGEGANHAIVDVHDLVELVMPHFVADERDEHSTPAQRAVDLRAALDRYEDRVVSRTRP
                     AVLASRQACIDAHQWSRINEKSPLLSRRAMNLVFDDADLDLGVHKISTPGSVPVE"
     gene            413299..415905
                     /locus_tag="MYCTH_2303233"
                     /db_xref="GeneID:11512599"
     mRNA            join(413299..413768,413862..413970,414062..414609,
                     414686..414879,414955..415066,415127..415905)
                     /locus_tag="MYCTH_2303233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662475.1"
                     /db_xref="GeneID:11512599"
     CDS             join(413523..413768,413862..413970,414062..414609,
                     414686..414879,414955..415066,415127..415444)
                     /locus_tag="MYCTH_2303233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662523.1"
                     /db_xref="GeneID:11512599"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2303233"
                     /translation="MSTTSEKNSAKERVDVNETTPNGASGGLDSAWKYLDAHRDQDAL
                     DASASIDLKALRRKIDWRIVPLMFLCYTLQFLDKVILNYAAVMGLHADLKLEGNDFSN
                     IATFLFVGLLCFEVPNTYFLQVVPAAKWLGANVVLWGVATASGAAAHNYQTLLVSRVF
                     LGIFEATIAPSLMLISSQWYTKSEQAPRFCFWYTGLGIGQIVGGLVSFGFQHMGPGAQ
                     LTGWRTMFVVLGVVTVLVGLSVILFLPDTPMKARWLSDKEKVALLKHVSVNQTGVQNR
                     KFRAKEIVEALLDPQIWLLLLSVVLLSVSSGVVTSYSATLIKNLGYDPKRAALMNTPS
                     GAVSIFFTLFVGFGIRLQSHRWAFIIACVIPAILGGGLMSFLPVSNRSGCLAGIYLVN
                     AVVAPLAIFYNWIMANVGGATKRAFAAAVISGSFSLGNIIGPQTFQQRDAPEYRPAKI
                     AVMATQAACAFTTFLLFLYYVWQNKRRTSEGETEEAYLSPEHWINMTDRENKKFRYVY
                     "
     gene            complement(417453..420183)
                     /locus_tag="MYCTH_2303238"
                     /db_xref="GeneID:11512600"
     mRNA            complement(join(417453..418631,418784..419119,
                     419257..419517,419626..420183))
                     /locus_tag="MYCTH_2303238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662476.1"
                     /db_xref="GeneID:11512600"
     CDS             complement(join(417735..418631,418784..419119,
                     419257..419517,419626..419853))
                     /locus_tag="MYCTH_2303238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662524.1"
                     /db_xref="GeneID:11512600"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2303238"
                     /translation="MALNHPRSTPDSSAMKSEESSQTGPVDEPTNAPMNGSTSKGGDS
                     PENMNMATKALLILSVFLSMFLVALDRTIISTAIPAITDDFNSLNDVGWYGSAYLLSS
                     CAFQLLFGKIYTLFSVKPVFVVSTLLFEIGSVLCGAAPSSIVFIVGRAVCGVGAAGLF
                     AGTVVCIIYIVPLHQRPKVQGMFGAIFGIASIVGPLLGGAFTSNVTWRWCFYINLPIG
                     GVSMAVVALFFRVPQRESDQLSLAEKILRLDIAGTAVLVPGVVCLLLALQWGGPTYPW
                     NDGRIIALLVLAGILSAAYVAVQAIFTATSTIPGRIIRQRSIASGLWATVCINSASFI
                     FVYFLPVWFQAVRGVSPVDSGIRLLPIMLATVVGSILGGFLNARVGYYAPLAIVGTCV
                     MAVGAGLLTTLQVDTGPGGWIGYQVLFGLGMGGCFQAPNLAVQAALPQADVPVGLALM
                     TFGSSVASAIFVSVGQNVLTNQLVRRLSGLPGFDVGLVTSGGATALLDALPARSRGPA
                     LVAYNEALREVFRVGLILACLTIFGTATMEWLSVKKPQPEKPVAGLGGSKTGQEKEEM
                     KTGNMKK"
     gene            420392..423463
                     /locus_tag="MYCTH_2303243"
                     /db_xref="GeneID:11512601"
     mRNA            join(420392..420937,420998..421025,421122..421649,
                     421768..423463)
                     /locus_tag="MYCTH_2303243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662477.1"
                     /db_xref="GeneID:11512601"
     CDS             join(420669..420937,420998..421025,421122..421649,
                     421768..423264)
                     /locus_tag="MYCTH_2303243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662525.1"
                     /db_xref="GeneID:11512601"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2303243"
                     /translation="MGAQCVPAALVPRQRRRRFPERELLERIRQYETLLRQHHVPFRP
                     LHPPHTPVDVPSERPPSSRDGRTPEPPRIDDSAPSGQGKRVKPRTTNLWHALRRTDAD
                     TEDDSDTGSEADEPGGGFIYDNEDMEKVIKAAFDRAYRSGMESSSPLLLGSPASTTPL
                     TSLHPDQATIFRLWQVYLDNVNPLLKVTHTPSLQPRIIDAMGDLANISAPLEALLFAI
                     YCTSIMSLSEDQCRTLFGSARRNLLTGYQFACRQALSSANLLQSCDHDCLVALFLYLV
                     SIKSDTDPRSVSSMLAVAIHIAQRMNYDKESSNEKYPILEAEMRRRLWWSLVILNSRV
                     CETFNYRAATMAPTWDCRTPSNFNDFELLSGSRTAPPVHDKPTEALFVCVRSQISDFI
                     RHCPFHLEPTDPFLATLAGGGTSHYDLRELQETVEKTLSLCDPAHPLHYMTMWTARGI
                     LAKNMLLEHCFRRRRRQHQQQQQQQQQQLGSDLPDKPDPDEPDPAIGYAVTMLRCDTA
                     LLASPLTRGFLWYVHAHFPFLAYVYLAQYLPSLAATTAAAEAGESGVKERNNNNNNNN
                     NNNDNAADVVSAAWAAMSDNYDARRAADFFSFPSEEKDQNKRERERNEGGRDGATPGS
                     GEDSHPLFVLFARVVLGAWDAVAAAFAAAGHSRDVEEAVPRIVVSLRERLGKEGAGIE
                     ERGGGSGLPSGGGSNGNNNSIGGDGGNAAGGSCNNTDTGIVNTTGDSAAGYGFTGAYM
                     DVLLGDGGIGLVDVECQQVWPTMDWAPLVQHGF"
     gene            424178..426350
                     /locus_tag="MYCTH_2303246"
                     /db_xref="GeneID:11512602"
     mRNA            join(424178..424923,425064..426350)
                     /locus_tag="MYCTH_2303246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662478.1"
                     /db_xref="GeneID:11512602"
     CDS             join(424319..424923,425064..425964)
                     /locus_tag="MYCTH_2303246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662526.1"
                     /db_xref="GeneID:11512602"
                     /db_xref="JGIDB:Spoth2_2303246"
                     /translation="MDRAGTTTRNDGTADENPTPRLFNDVYSSRWGCPTPFHATWAPF
                     PRLPTELRLQIWLSYLQQHRMIEVEIGLPADEDETSYPGEAPHSRYYKGRNHLDRIVS
                     GRGYTLSIKGRGSYAASLSPLLWVSQEARRAALSFYHIRLPLQCLHGERILYLNSDYD
                     VLYVRPQQPERVRFVRGGFPRLATILADVLHDIKAHDSKDQGVAHLTLSVEYWVDLLL
                     QQHVPVTPGILHPVAAKSFADILRTRLRSVLCVVGFRHPTRGLGEFPVKDWHFHFAQT
                     FPLYRRGHPTGAFHWLRADPRPGVEIDLRQVPLDLFVDTHHLLRSWEELERAFGITRA
                     QQRAAPETGGDDDNAGLRFYICPTLDWSRLTTSMMHEFPTWEEEEEEEEEEEEEEEEG
                     EEEEEEEEEGEEEEGEGWREELAKYLQYEADMWLRELGYFLHFDNGIRPEQLSHGFMM
                     DPETFDMMEKVPCTAVGMWLFPVDAFQKCTIPRRNCFDLSAVRPGLFLFDV"
     gene            complement(426658..428192)
                     /locus_tag="MYCTH_2303248"
                     /db_xref="GeneID:11512603"
     mRNA            complement(join(426658..427399,427486..428192))
                     /locus_tag="MYCTH_2303248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662479.1"
                     /db_xref="GeneID:11512603"
     CDS             complement(join(426731..427399,427486..427716))
                     /locus_tag="MYCTH_2303248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662527.1"
                     /db_xref="GeneID:11512603"
                     /db_xref="InterPro:IPR007065"
                     /db_xref="JGIDB:Spoth2_2303248"
                     /translation="MDKYLNPLLPPSCLPYLPAPVAHFLGYRTRPPRPLGNLAMIFWA
                     VVGVFASLAIIGAVDQAIPAFQARGAPIIIGSYGAAAVLDFYAIESPLAQPRNAVLGQ
                     MVSALTGVAVCKLFALSPHFEAVRWLGGSLACACATALMALTGTVHPPAGATALMAVL
                     DPNVAGLGWFLFVPLMLGCALMLVVALLVNNIQRRFPYYWWTPGETGTFWHRREEPGA
                     EKEKEAEEEREASPERQRQRGEESSGSSSSGDLTQTVSRIVTVLSGKEGEIVIKRGRV
                     MIPDGLDLRQEEILSLETLSERL"
     gene            complement(<441313..>441633)
                     /locus_tag="MYCTH_50019"
                     /db_xref="GeneID:11512604"
     mRNA            complement(<441313..>441633)
                     /locus_tag="MYCTH_50019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662480.1"
                     /db_xref="GeneID:11512604"
     CDS             complement(441313..>441633)
                     /locus_tag="MYCTH_50019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662528.1"
                     /db_xref="GeneID:11512604"
                     /db_xref="JGIDB:Spoth2_50019"
                     /translation="SKLTADHRDNRELSPYIRVTICSLISAEYSKRSLVTLFSVSRPA
                     IYHTIELWNSYNTFKSLPRSGRPKVLSPSEKRYILLIIKKERYIARKALVNTIRKKVL
                     PLTI"
     gene            complement(442053..444077)
                     /locus_tag="MYCTH_2303249"
                     /db_xref="GeneID:11512605"
     mRNA            complement(join(442053..443536,443640..444077))
                     /locus_tag="MYCTH_2303249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662481.1"
                     /db_xref="GeneID:11512605"
     CDS             complement(join(442286..443536,443640..443975))
                     /locus_tag="MYCTH_2303249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662529.1"
                     /db_xref="GeneID:11512605"
                     /db_xref="InterPro:IPR000898"
                     /db_xref="JGIDB:Spoth2_2303249"
                     /translation="MSPSETLTFNNSRGGSTEVLPMPLNEYAVTSNGFLPEEPPLRKL
                     PNPYYGPWELLVESLPNALASRTLRDQVHQLPILSTDRLTAEPEWRRACVILGFLAHA
                     YIWGGDTAAETLPPQITLPFLAVTTHLGTPPVATFASLSLWNFEIASTSTNTASTPSN
                     TTPSTSVPDRDLDLTDPDALRALHTFTGTADESWFYMVSVAMEAEGARLLPVLLRAMH
                     ALFAARDQDVPPATTTAAAAAAVASRALGETTACIGRLGRLLDRMDERCRPDVFYHQI
                     RPFLAGSKNMEAAGLPRGVFYAESAEGEGEAEGKANGKGEWRQLRGGSNGQSSLVQFL
                     DIALGVEHIAMGSSNSSSGGGGSSSNSINSDPKEGGGGQGGKPAVGFHEEVRGYMPEP
                     HRRFLEDVAARYPGGLRKGVEELLAAGGEGKGGLGPELTEVREAFQTATRALAEFRNK
                     HLQMVTRYIIIPSRQQNTRREVNLATASSKLRASSSAEAKETVPAGGGELTGTGGTAL
                     MPFLKQTRDETFQAGRLEYR"
     gene            444709..446643
                     /locus_tag="MYCTH_2303251"
                     /db_xref="GeneID:11512606"
     mRNA            join(444709..444944,445010..445431,445547..446643)
                     /locus_tag="MYCTH_2303251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662482.1"
                     /db_xref="GeneID:11512606"
     CDS             join(444749..444944,445010..445431,445547..446581)
                     /locus_tag="MYCTH_2303251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662530.1"
                     /db_xref="GeneID:11512606"
                     /db_xref="JGIDB:Spoth2_2303251"
                     /translation="MDAEYQSLIDAFRAGQKKPEFPSNFDSREYARRLDAQDKLSFLR
                     DSFIIPTKGSLRKKALTGTLPGEHKRVGTLDGEGKRTEQNGSKNSSGNAEDEEPAIYF
                     VGNSLGAQPKSIRTHLDAQLETWASIGVNGHFTSLDNSPLTAWQDMAADCARKSVDLV
                     GAASPSEVIYMNTLTVNLHLMMASFYQPTEKRHKIIVEWKPFPSDYYAITSQLEWHGL
                     NPSTSLVEIHPDDPETQYMSTAHILSVIDEHADGTALLLLPGIQYYTGQLLDVARITA
                     HARARGIPAVGWDLAHAVGNVELALHDWGVDFAVWCTYKYLNAGPGAIAGAFVHQRHH
                     RLRREEDDGEGGANDHDTAGSNNSANNDNNGDRPSGPRYVPRLSGWYGADKATRFDMA
                     KEFRPAEGAHGWQVSNPSAADLACVGAALGLFERAGMRALRDKAVVLTGYLERLLLDL
                     LDRSGVTGRRNEAGEPAFRILTPADPRERGSQLSLLLRPGLLDRVSGRLAEAGVVVDV
                     RKPDVMRVAPVPMYCRFEDVWIFVRELEKALERAIIEHTQTK"
     gene            <446722..>447201
                     /locus_tag="MYCTH_2126285"
                     /db_xref="GeneID:11512607"
     mRNA            <446722..>447201
                     /locus_tag="MYCTH_2126285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662483.1"
                     /db_xref="GeneID:11512607"
     CDS             446722..447201
                     /locus_tag="MYCTH_2126285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662531.1"
                     /db_xref="GeneID:11512607"
                     /db_xref="JGIDB:Spoth2_2126285"
                     /translation="MFAALLSMTVMVHQIVIKLHLRCIISARSIPAWSIRPSRAASEA
                     FDRAFWIINRHLGGEVRFESRAAIYIILNVSKEAAPEMGIDGSLTVEAPRSSCRRIGA
                     IVCRQANMGQGKRIQADAELRVCQEGLAGKQGNLRDDTILHNREVAITGSAATADQE"
     gene            complement(<447654..>448532)
                     /locus_tag="MYCTH_2062247"
                     /db_xref="GeneID:11512608"
     mRNA            complement(join(<447654..447868,447995..448176,
                     448240..>448532))
                     /locus_tag="MYCTH_2062247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662484.1"
                     /db_xref="GeneID:11512608"
     CDS             complement(join(447654..447868,447995..448176,
                     448240..448532))
                     /locus_tag="MYCTH_2062247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662532.1"
                     /db_xref="GeneID:11512608"
                     /db_xref="InterPro:IPR002935"
                     /db_xref="JGIDB:Spoth2_2062247"
                     /translation="MAPTAATLALSAKPHVHALLKRLHSASEAQEKSLSQSWFWFKRL
                     LTSRLFTWKWDASADDHMRDKFVALEEDKCHFMYLLVRGSGALNVVEAGTSFGVDVSG
                     RVIATEKEPTKAARAREHWAEAGDEVAGVIELREGDLLETLKRDDMPEQVDFLLLDIW
                     TPLALPTLKIVQPRLKKGAIVLADNTTMARTWYKEYLDYIHDPVNGFKTTEIPYSGGL
                     QMSVYLPGEVN"
     gene            <449016..>449701
                     /locus_tag="MYCTH_2126287"
                     /db_xref="GeneID:11512609"
     mRNA            join(<449016..449042,449486..>449701)
                     /locus_tag="MYCTH_2126287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662485.1"
                     /db_xref="GeneID:11512609"
     CDS             join(449016..449042,449486..449701)
                     /locus_tag="MYCTH_2126287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662533.1"
                     /db_xref="GeneID:11512609"
                     /db_xref="JGIDB:Spoth2_2126287"
                     /translation="MWQSLKRKATTAARSPQRHYPDARRHQLRVTLPNSDSGARGESN
                     LDLYYSMALTRFGRPRCGVNNAAKVILVSYISNENA"
     gene            complement(451192..454117)
                     /locus_tag="MYCTH_2303253"
                     /db_xref="GeneID:11512610"
     mRNA            complement(join(451192..451745,451850..451982,
                     452046..452110,452166..453468,453540..454117))
                     /locus_tag="MYCTH_2303253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662486.1"
                     /db_xref="GeneID:11512610"
     CDS             complement(join(451215..451745,451850..451982,
                     452046..452110,452166..453468,453540..453928))
                     /locus_tag="MYCTH_2303253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662534.1"
                     /db_xref="GeneID:11512610"
                     /db_xref="JGIDB:Spoth2_2303253"
                     /translation="MTTHDTSSAGFHMADFSSFLSYLSDAVTAAWPDRFATRYRKVKV
                     LLMSWDRDDLGVEPEARKLEAVFRGLYHYDTEYWKIPSRRSAVELSRKVADLVDEHGQ
                     EGNLLILYYAGHARPSEQPGGSPVWAANRGRDSPTVQSSILHSFLGEVDCDVLLLHDC
                     FHQVQENKGAFVGQGVVETLAAAGGAEPAPTEANDHHSFTASLVQELAHAAHTADWLS
                     VVELHRRILNRMHAWTATLSFRDDAYSVVQVDRRTGQPMFEQPRRRTPVHSFLSRKPK
                     TIVLTPLPHQVQEQSDNESLLLLNPPTPQSQTTPTMGPAILVTCRLRDQRVDTEKWRQ
                     WLLGAPEEAKGIQISALFPGFGAVLILELPLAVWDLLPPSPAISFIAYTTGSNHISEF
                     RRALLGSDADDSSSDTAEYESDGDDGFGPGKHHKKTGRRRMRSGREADETTTQYRSSL
                     WPDFFENNRASDDSAEHTPYCLTLAEMQGDEKMSKAARVIRAFVQEADEPSSRYISDE
                     IQEFCAPASFEALSCDPEGDPDLVAILDEPRSNGTHPGAHGMKFLTRGQLYEALVSRA
                     VPQLIDTESKDGNSSERRLIYTTNLDPATTLALAAAAPERHALPLRDFVYKHLSFQSD
                     MDVRLHSSGVQGFSLSFHLPFFAWRQDSHPFTDRRRGGGHNGPLRGSRNISFLNKSGE
                     RIQTCIHEAQVSCLIVGVDNRHWTAYGVFDTYHDGGESRHDVRSYQTTQGGAAMDPLT
                     CGRHMADSSVADAREYFLRAMESCVREVKEEWENTGRQVMRALKHQVSLGTGFSLTMH
                     DRTNRAQK"
     gene            <455749..>457996
                     /locus_tag="MYCTH_2061855"
                     /db_xref="GeneID:11512611"
     mRNA            join(<455749..456662,456760..457237,457346..>457996)
                     /locus_tag="MYCTH_2061855"
                     /product="protease"
                     /transcript_id="XM_003662487.1"
                     /db_xref="GeneID:11512611"
     CDS             join(455749..456662,456760..457237,457346..457996)
                     /locus_tag="MYCTH_2061855"
                     /note="cysteine-type peptidase"
                     /codon_start=1
                     /product="protease"
                     /protein_id="XP_003662535.1"
                     /db_xref="GeneID:11512611"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="JGIDB:Spoth2_2061855"
                     /translation="MCWLWERSVAILLAAGVIANPLRPRRIPWPEPVPASSIGPIDWS
                     SIPPSPYKHALRQTNTTTTSSSSSSSSSKYDNQVYSVQVSGSSSSPPASVDWRNRDGQ
                     NYITTPQDQGACNSCWAFAVAALIESMMRIEHGVWGKRSEADVHDGVGAACESVGNAE
                     DTLAWVAGQGPEFVADPTRPAPGIADWACDPYEATAHAYEHCDDRSGRTTHIPYYQAL
                     GLVEDQKRWLDEYGPIIATFVLYDDFGSWKPTAAGGSGGDVYRWDGVSGSDGNHLAIV
                     IGYDDEKQAWLMKNSWGSGWGDEGFVYFAYGEANIDNWTKYGLVNVNPDPWTRRKHQS
                     GSMMQSGNGETHRNFELLVSEAGGSGFTHVSRDGNSTQWSKVLEVSGSGSGSGLVGQP
                     AILGTSFNRDFHAVSLDENQVVQQWAYRQSEMRWSRVSAIEGTKIDGFPGLAQSDGST
                     LVMVVKHADGTLNEWQQAPNSTTWTLANSPIASGIAQSGPALVQSNAGLNLYDRQQGA
                     SRGNIYTVAVREDGKLQLFWRPGADAAGWSAGEVFGGSGVVDPGSPPVMIQDYSGTAN
                     ETSVGRFQLAVAVGGSVQHWERANDDLEAGQAPPAGAEGGSPAGRWELVETAGTGVKR
                     VWALLQGSFGGRLHMITEGTDGRLSYWERDEKWVEVEKLPALSDAAWTRSGPVSGG"
     gene            complement(458574..459584)
                     /locus_tag="MYCTH_2303256"
                     /db_xref="GeneID:11512612"
     mRNA            complement(458574..459584)
                     /locus_tag="MYCTH_2303256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662488.1"
                     /db_xref="GeneID:11512612"
     CDS             complement(458675..459406)
                     /locus_tag="MYCTH_2303256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662536.1"
                     /db_xref="GeneID:11512612"
                     /db_xref="InterPro:IPR000250"
                     /db_xref="JGIDB:Spoth2_2303256"
                     /translation="MKLAVLIATTAGLAAALPQGVARRGVGRPLHHSGPNIRNTTYPQ
                     YSSNWAGAVQIGTGFTSVYGTITVPSVHDRNPNAAASAWVGIDGDTCQQAILQTGVSF
                     YGDGSFDAWYEWIPDYAYSFSNFRLSAGDQIRMSVEASSKRAGVATLENLSTGQKVSH
                     TFTSTPSTLCETNAEWIVEDFQEGSSLVPFADFGTVTFTDAYATGSSGTVTPSGATII
                     DIKQGNEVLTNCATSGSDLTCSYTG"
     gene            463005..463621
                     /locus_tag="MYCTH_2303257"
                     /db_xref="GeneID:11512613"
     mRNA            join(463005..463232,463316..463372,463447..463621)
                     /locus_tag="MYCTH_2303257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662489.1"
                     /db_xref="GeneID:11512613"
     CDS             join(463134..463232,463316..463372,463447..463512)
                     /locus_tag="MYCTH_2303257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662537.1"
                     /db_xref="GeneID:11512613"
                     /db_xref="JGIDB:Spoth2_2303257"
                     /translation="MVRGSVSTYRLRSDHLEEYLKSQFPGYEKFGVQLSADGKEFYTF
                     NTPAALTEEQLKYIDEHVRLKHDDDADFL"
     gene            464298..471972
                     /locus_tag="MYCTH_2138765"
                     /db_xref="GeneID:11512614"
     mRNA            join(464298..464684,464758..466069,466210..466404,
                     466562..466830,468523..469102,469234..469577,
                     469655..469824,469883..469887,469957..471296,
                     471441..471972)
                     /locus_tag="MYCTH_2138765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662490.1"
                     /db_xref="GeneID:11512614"
     CDS             join(464401..464684,464758..466069,466210..466404,
                     466562..466830,468523..469102,469234..469577,
                     469655..469824,469883..469887,469957..471296,
                     471441..471534)
                     /locus_tag="MYCTH_2138765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662538.1"
                     /db_xref="GeneID:11512614"
                     /db_xref="JGIDB:Spoth2_2138765"
                     /translation="MADVEDITAQFATAWQRAKEYPLTVLRTEVFGHTLKSLQERLGQ
                     DGLFRPSSKMLAVRDIQVTATEFDRGRFLKSVDDFEALLDPEEKDPWWRFIFLRAHSS
                     RDSLGCSREQLAMLLTYHQVMPSFLDLVFTFRARSRPLNYALFRQENYLDKNAPSLPL
                     PHLGRSGIQVQHAFNLLTVEKSDQAQERNQWPLRHAALYHSLDLQTGRAVYILLKGDS
                     GLASRIKHATETNRHLRPDSPRTAEQSFIASLQVHLIMLEWSVENWSEYVDSMEDTLR
                     SRSVEAKVAPVATVTSPVNLAQSLQRRGSSFPPRGPSRTFSRQGTVHVLTSQPATMSR
                     DNSNPQDMLREQPSEPKMPSSPTSPTSPASPAPSRFPLPPIRTMSRRTSSSGFPTRAV
                     RRTLSGIVRRVSGGLENGAASIQQQEAAEGEEESDEVISQLAELENRFSFNELQRLSL
                     TADEINRSILALEQSRDVIVQVQDQYRAVMSSHAFRKLLDGNKCKTEAAVFFRRVNRI
                     LHDMEVHRRRLLDLARTAEHDKYMFESLNQHTSIQTSKAFQLVAHTSSEQMMQWTLKM
                     HEIAVKTKKETLSMHVITIFTLIFLPGTFIATLFSSGVLRWDEDGTLGSDWVVRRDGI
                     RLFLSICLPLTAVTVSIWAAMYGAARRWARRHGRDVGLPGYADERGIVVAAGPQQQAT
                     PRGENRPRRTSAMAAVTNPDPFFRFSEFVNEAKSKYVGHDIAGNAKPYVPLSALSKYW
                     TPHRISSVLRAIPGRLNVDPGLIRSSYLRIFSTLVYTGPDTVGSLTNLSISRNLDDDC
                     FPRHTRPNEWPDEAFFCKFFDSIAPHQWQFFPLPFHPHKLHDRHLHKEYILPIDPVTE
                     IDHSSAASIQRFDIHAEYNDLSPKDEHGRPTRSTFVLKIYHGRKHEASYENEYRVLDQ
                     HRRNRSPNVVELYGSFRQLESYCLILEYANAGNLGEYFENCQPPRTVEDVAAFWKSLF
                     QVFQGLERIHQLMLYDGEEYIKGIHEDIRPENILLIKGLFPYHFVPKVADFALYSRVR
                     TVKSRSSGSGFGLDRYGNQRFSQRHKGINMITTLADIFSAGAVLSHAAAWVVGGKGEQ
                     QRYFKQRKAYHDKNHSLFKHSGYEGCFHDSIEPIPVVAQHHQSFLRRLMPGDDVTPKV
                     IELIDRFMLRQSNDRLPARDLHERFEQFLAIRSLASPSSLTPSTTAVTTDATPQSSCW
                     SVQVAASPSTTNGRIISLPADPPSTAAANPDPTTRPALRVLVTSHDDGTTASTVPTAE
                     PTARASAPPSPVSPATTPGSQIGVSEIHQYRSDVRQGRPADPRTAQLIEYLEHSLSGR
                     DQFFFVDDSRSMGQLGRKTIADGFQALACLAKRLDPNRVELAFASQPRRVYRARHTSD
                     LHQRVADCAYKGDGRLMEAHLGDLIDYKIIPRLSYRLLGININLWARHKVSIYVLTDG
                     NWGPADCGGDACGVERPVRRLIEELRKRRLDRTQVSLHFIRFGNKENGRKHLERLDDF
                     GRQDGWDIVDVKHIESDVASMIIGPLSRANDDIQAT"
     gene            472393..474484
                     /locus_tag="MYCTH_2303271"
                     /db_xref="GeneID:11512615"
     mRNA            join(472393..473018,473131..473286,473361..474484)
                     /locus_tag="MYCTH_2303271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662491.1"
                     /db_xref="GeneID:11512615"
     CDS             join(472514..473018,473131..473286,473361..474430)
                     /locus_tag="MYCTH_2303271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662539.1"
                     /db_xref="GeneID:11512615"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2303271"
                     /translation="MKLLRYLSIALPCLGAANARPRVFDSKHHVSYHGLDRNGIEVFL
                     GIPYGQDTSGANRFKPPRRHVPLPGTEIEATSYGPSCPQQFGQWAVPISLGNITDVSE
                     DCLRLNVARPRGTHPWDRLPVMVYIHGGSFWAGNNHDPTILPDGLVLESVWNGLPVIH
                     VAMNYRLGFFGFAQSGALESEGSENAGLRDQRLAIEWVRDNIELFGGDPGRITIFGQS
                     SGGLSVGLHIMAYGGTKPVPFQQGICQSQALEPGITGNFTINAMQALVDYVGCNATDL
                     HSLETIACLRALDTKTLLDASLSTYRDDLNIGDIWLPVVDNDFLPAAPSTLIREGRFA
                     NVTTMIGWCNNDLTFFTDPEIQTPEDTRDFISGYAPGLTSENVDKLLSLYPVSDFASA
                     ATDTLSAEFFRASRIFRDILMTCEPLFYAEHIARAGNAVYLYDWNQTILEPFLEQKTG
                     RAGWGPIHTAEFAYVFGNLSHYDIDGFPFNPSWADYQLAVRGSRSWSTFAATGRPGSL
                     GGRDTFTGFGPAFHRGDNTTTYIFVAGGPSEGLSAIDGPHSAPAVRAQKLRERCAFIN
                     SPEIIEQLGY"
     gene            complement(<474685..>476880)
                     /locus_tag="MYCTH_2126295"
                     /db_xref="GeneID:11512616"
     mRNA            complement(join(<474685..474948,475068..475190,
                     475258..475283,475348..475687,475768..475899,
                     475963..475996,476184..476293,476392..476663,
                     476739..>476880))
                     /locus_tag="MYCTH_2126295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662492.1"
                     /db_xref="GeneID:11512616"
     CDS             complement(join(474685..474948,475068..475190,
                     475258..475283,475348..475687,475768..475899,
                     475963..475996,476184..476293,476392..476663,
                     476739..476880))
                     /locus_tag="MYCTH_2126295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662540.1"
                     /db_xref="GeneID:11512616"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_2126295"
                     /translation="MARFPLLSALICILASALHVSAAISNYTAICNEIKDRVSQQSDV
                     TYPIQGVTFSDRIHHWFDSSTEIPACVAEVGSVEDVSLVLQIVGASRTPFAVYSGGHA
                     SNVGFSSTKGVHITLRRFNQTQLSEDKTTVTIGFGQTWVDVFEALADSGVNVVGGRVP
                     GPGIGGFTLGGGYSCDTVKTFNVVLPNGTITTASREHNSDLFFALKGGMNRFGIVTSA
                     EFYTHPQPPEVWGGLRIYHASQVPALLNATERFASENRDPRASVLTSVDGTTAVGPTA
                     LGLFFYDGPEKPEIFNLFDGLSTISDSTGRKPFLDLIRGFPAEIVYNSPGHFCHVLDD
                     WDHRTLPGDIAALPDLLHNMGKIAALHGATTINYDAQPFLQYGRHATPSAFPHSDSLF
                     PFNLYFAWRNSSEDEFWYGKIHQTLDTLKRVATEEGIYREDFPDYPNYALSGTSAEKL
                     YGETNAGRLRQIRDQIDPDRIMDLAGGFAL"
     gene            480574..480968
                     /locus_tag="MYCTH_2303274"
                     /db_xref="GeneID:11512617"
     mRNA            480574..480968
                     /locus_tag="MYCTH_2303274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662493.1"
                     /db_xref="GeneID:11512617"
     CDS             480668..480904
                     /locus_tag="MYCTH_2303274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662541.1"
                     /db_xref="GeneID:11512617"
                     /db_xref="JGIDB:Spoth2_2303274"
                     /translation="MSASSGVEGWCKVCLHANNEHNYYTCEVRGCRKRFKICQTGSHE
                     EWNVVAGYVLCAWCRDHPYSCSRVDIYNIKRLIG"
     gene            complement(480969..483113)
                     /locus_tag="MYCTH_2303275"
                     /db_xref="GeneID:11512618"
     mRNA            complement(480969..483113)
                     /locus_tag="MYCTH_2303275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662494.1"
                     /db_xref="GeneID:11512618"
     CDS             complement(481087..482976)
                     /locus_tag="MYCTH_2303275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662542.1"
                     /db_xref="GeneID:11512618"
                     /db_xref="JGIDB:Spoth2_2303275"
                     /translation="MADAVRLSAEDFRGVYEQSFREWSAVYHAAIKQPGLPLSYLAIQ
                     SAFRQHPSFPRNLRLEHAKYAKHSQIYATGRSSWASTQPNCEYGLPHFHQQVQINVAS
                     RNPIPLSIGTTPEREMRVASWFERGDQNYLAVLMLAWAYILSARWAEIMPGGTSLVYT
                     SCKADDYAQDVPVTVPPDNLSVAVDIRDAGPDEARWWAAVLAPDQGWQATMLLDQDTF
                     FAPWSVRLQPGCRFVLLTLSTIRSHSAAVAPSSSEALRFLENFCVRRNITDQSQAALA
                     AVLLFPSMGNGQGLQLPAFATDRLDGPTGVSSSVPHRQGLDLDCELRHTFEHKDNRLD
                     KLITLSCHVKGIRPMLLSSFYNPSVECNAVTPWLQGALAAINLLAQDDPLVLGRMLMD
                     RQPKVAPLWLGITVLGLQKRLLQDVGYGLIPVDLHAAVWSGTIQSFIQQPVSDPLVVD
                     GQVSRADQCRLLFLSRSGSHDRVPVCQWRPFGGTPLEHTDIEVRVHAKCKGHGLRYQG
                     FIWDCVDGNTTYQALDDNDVYACPSPPLTQQTTNSRQNPVIDYKNLDREKDFVSENAT
                     RSIFGWLRVNGYALDEQDIWKHEWLDMHESDEEVEERTEESSGNMPKSSSYVETWISE
                     LSHKS"
     gene            complement(<484380..>485025)
                     /locus_tag="MYCTH_48909"
                     /db_xref="GeneID:11512619"
     mRNA            complement(join(<484380..484595,484717..>485025))
                     /locus_tag="MYCTH_48909"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662495.1"
                     /db_xref="GeneID:11512619"
     CDS             complement(join(484380..484595,484717..485025))
                     /locus_tag="MYCTH_48909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662543.1"
                     /db_xref="GeneID:11512619"
                     /db_xref="JGIDB:Spoth2_48909"
                     /translation="MRSLAAFLLALTALLPTPTAASGSPGFTGHGQLRALHNTGDHED
                     LGCLTSEGKWTVEEPLCGVFAADRIDDYQFRLRSIEAGECGIDVATFKCGGGVKAAGF
                     GTWGTPGPVPGYDVLRYSQYGVLATNAPDSPPAPGEEPLAIHFYSGSEKGKWIWLGWK
                     ALSDDEAADDAGEN"
     gene            <487497..>488508
                     /locus_tag="MYCTH_2060992"
                     /db_xref="GeneID:11512620"
     mRNA            join(<487497..488358,488426..>488508)
                     /locus_tag="MYCTH_2060992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662496.1"
                     /db_xref="GeneID:11512620"
     CDS             join(487497..488358,488426..488508)
                     /locus_tag="MYCTH_2060992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662544.1"
                     /db_xref="GeneID:11512620"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2060992"
                     /translation="MAIFHAETDGASLFYRYYTPSRSSPHRLATTVERQPLTLVFLHG
                     WPMSSRMFDQLIVPLVESHRFPVIAPDRRGFGNSEWANPATGEVTFDTFVSDAVGLLE
                     HVMQKNPGPFVFVAASMGCSESVLTCIASPFLHTHCKGFVWIGPNMPNSVSSDECPSA
                     PGKEVWDGLVQSFRGAGGKDFIRDAIPGVFRVDLGNDVSKDTLQFFERLVQQADPVAV
                     ERTAIILQKPMARELREWAESAAADEREKVPVLILHGDSDSGMPLETSAALVHKMLPW
                     SRLRVYQKAGHGLYLTHAQQVLHDMLAFLEPIVSQQRL"
     gene            489301..490015
                     /locus_tag="MYCTH_2303278"
                     /db_xref="GeneID:11512621"
     mRNA            489301..490015
                     /locus_tag="MYCTH_2303278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662497.1"
                     /db_xref="GeneID:11512621"
     CDS             489411..489914
                     /locus_tag="MYCTH_2303278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662545.1"
                     /db_xref="GeneID:11512621"
                     /db_xref="JGIDB:Spoth2_2303278"
                     /translation="MKYTIILPPLVAILTAASVPSTNSDASGVVARHEGHHDDTTKLD
                     LVDVVARRENQEDQDSDPETNNVTARHSQGDDDHDTSEGDEDDVQGLEKRRRRGGSRG
                     RVGTYHGGHNNTHISGASALLSLDFLDSSLLGWWGLVSVPSMCESESVDDLLIIGSFY
                     GNHRPRI"
     gene            complement(490221..491863)
                     /locus_tag="MYCTH_2303280"
                     /db_xref="GeneID:11512622"
     mRNA            complement(490221..491863)
                     /locus_tag="MYCTH_2303280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662498.1"
                     /db_xref="GeneID:11512622"
     CDS             complement(490378..491742)
                     /locus_tag="MYCTH_2303280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662546.1"
                     /db_xref="GeneID:11512622"
                     /db_xref="JGIDB:Spoth2_2303280"
                     /translation="MGGRYVSTSSAVNARPRGVLLTVCVISLVTIWLCRLPKMCLYGE
                     GAVVDVSTGPTARQSIDLSKADAPFISWPLERVCNESTMWTPGIVFVCDNNSGGIGNI
                     RNYILTCFRYAIEAGATGVVLPQIRTRSEKDLSDIMLPHRGFDYFFDEDHFRRSLSAA
                     CPQFTLYNSTDDIPNAPVPFKAEKITPRNFGKRGGCDKRELNKHTGRFDKQFWEFIKN
                     TTEEFHLPIPSIETPRIFRFNWGVQWDWPVFRDGPEFVATYGGLLRFRQDILDLGFKT
                     AQYMREFSHQHGGSGAFAGMHLRTESDALSRWPKFDEQSGAYLERATALNFKVAYLAT
                     GNQTEARKLTTAAAEWHNMAVVTKHELLRDHPDDLEALAALTWDQQALIDYIVLLECD
                     YFLGVSPSSFSMTVAGKRHLKAEGLYTRPWRIGGDGDGRSWLVGRYENYWEDWLFMYE
                     SLWP"
     gene            511124..513037
                     /locus_tag="MYCTH_2303296"
                     /db_xref="GeneID:11512623"
     mRNA            511124..513037
                     /locus_tag="MYCTH_2303296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662499.1"
                     /db_xref="GeneID:11512623"
     CDS             511307..512800
                     /locus_tag="MYCTH_2303296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662547.1"
                     /db_xref="GeneID:11512623"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2303296"
                     /translation="MSKRMADEDNTGPLKAGGRPDAMDVDETPADMGEFEDEFEDEFE
                     SEDEIIEAGVDGRPDAEREAEEAMDVDNATPGTFIVGRTKLEPGQTLSPDPTTYRMLH
                     NLSTPWPCLSFDIIRDGLGDNRTVYPATMYTVAGTQADSAKASDNSIMVMKFSGLSKM
                     QGSDEDESSDDESDDEDADPILEHKSIPLNTTTNRIRVHQTPSQDPSKPPTTLTAAMT
                     ESTNVFIHDITPHITSFDTPGTIVTPQQNKPICTIRAHKSEGYAVDWSPLHAAGKLLT
                     GDNDGLIYVTTRTDGGGFVTDTRPFQGHTSSVEEIQWSPSEASVFASASSDGTIRVWD
                     VRSKGRKPALSMQVSDVDVNVMSWSRQTTHLLASGDDAGVWAVWDLRQWKPSAGAAAA
                     SSLQRPSPIASFNFHKEQITSVEWHPTDDSIVAVSAGDNTVTLWDLAVELDDEESKDT
                     AGIQDVPPQLLFVHYQNLAKEVHWHPQIPGTLVATGEEFSIFRTISV"
     gene            complement(514704..516772)
                     /locus_tag="MYCTH_2303298"
                     /db_xref="GeneID:11512624"
     mRNA            complement(514704..516772)
                     /locus_tag="MYCTH_2303298"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003662500.1"
                     /db_xref="GeneID:11512624"
     CDS             complement(514861..516537)
                     /locus_tag="MYCTH_2303298"
                     /note="CAZy_ID 268032"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003662548.1"
                     /db_xref="GeneID:11512624"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_2303298"
                     /translation="MMGRLNDLIALLALLSGSATSAAVRNTASQARAAEFNNPVLWED
                     YPDLDVFRVGSTFYYSSSTFAYSPGAPVLKSYDLVNWTPVTHSVPTLNFGDRYNLTGG
                     TPAGYVKGIWASTLRYRPSNDKFYWYGCVEFGKTYIWTSSGTRAGDRDGEVDPADWVW
                     EPHPPIDRCYYDSGLLIDDDDKMYIAYGNPKIEVAELSDDGLTEVSSRVVYTPPAGTT
                     IEGSRMYKVGDAYYILVTRPADAEWVLRSTSGPFGPYEQRELVSRINGPLSNAGFAHQ
                     GGMVDTPDGRSWYYVAFMDAYPGGRIPVVAPLRWTDDGWPEVVTDAQGGWGASYPVPV
                     ETGKTVPDDGWELDEFRGGRLSHHWEWNHNPDPARFALAGGDEGGLVLQAATVTEDLF
                     AARNTLTRRIRGPKSSGTFRLDVSRMRDGDRAGAVLFRDTAAYIGVWKQGDEATIVVV
                     DGLELALSSWTTVSTGRVAETGPTLSSTQDVWLRIEADITPAFGTNTARTTTFSYSVD
                     GGKTFVRLGPAFSMSNTWQYFTGYRFGVFNFATKELGGEVKVKSFQMQPL"
     gene            complement(<518911..>519781)
                     /locus_tag="MYCTH_102138"
                     /db_xref="GeneID:11512625"
     mRNA            complement(join(<518911..519073,519223..519311,
                     519409..519565,519642..>519781))
                     /locus_tag="MYCTH_102138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662501.1"
                     /db_xref="GeneID:11512625"
     CDS             complement(join(518911..519073,519223..519311,
                     519409..519565,519642..519781))
                     /locus_tag="MYCTH_102138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662549.1"
                     /db_xref="GeneID:11512625"
                     /db_xref="JGIDB:Spoth2_102138"
                     /translation="MQPGIPSASTAKSQLAALTVKAAYDDGNYSRDLFPHWETVSGAC
                     NTREYVLKRDGTNVVTDSSCAAQSGTWVSPYDGATWTAASDVDIDHMVPLKNAWISGA
                     NTWSTAKRTQFANDIDLPQLWAVTDNVNQAKGDKSPDAWKPPSTSFYCTYAKSWVTVK
                     YSYGLSVTSAEKSALTSMLNTC"
     gene            complement(<520755..522893)
                     /locus_tag="MYCTH_2303301"
                     /db_xref="GeneID:11512626"
     mRNA            complement(<520755..522893)
                     /locus_tag="MYCTH_2303301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662502.1"
                     /db_xref="GeneID:11512626"
     CDS             complement(<521126..522522)
                     /locus_tag="MYCTH_2303301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662550.1"
                     /db_xref="GeneID:11512626"
                     /db_xref="JGIDB:Spoth2_2303301"
                     /translation="MFVYGAFSHYQKVSNVFNVMTALSAATPAALSRLASRRALSGAT
                     TTTTTTASPAWKAWQLVAVRTGAVGIIAAGGVAAFVHRREIAEGAHAVRNLNRRDVVR
                     GYRQSVDALGQGLAYVNRGNVGRSFSWLADHFAFVGALLKPNELGRRLHRLAALRGVG
                     VRDVYASLGENGYWSGGYFVPERTFCAVPSDGDAAEAALFARHVVEGAKDEIDAHIGL
                     FRKEKNKNYDRMTNDAAELVIDWFNDETDIYDDPRFQEAPPAELAETEAVAKAVDNEG
                     VEKAEERMAAAAGQDSVEDAGMDVDDEVPDESPIDIAAAASLVPLPDDIDKGLPQDAG
                     EDGGDGGEGKDESDQKRAYLRYLFGVAQQTGTTLRAYLPSKLPTVEMPRVSMPAVNFP
                     SMPPAIPNIVPSLPTMASMAVPTSINPFSRKPAAESPSAEGQKEGGDGVPGSEQVGVA
                     AKKSGSEEHGVPQSS"
     gene            complement(523615..524762)
                     /locus_tag="MYCTH_2303304"
                     /db_xref="GeneID:11512627"
     mRNA            complement(join(523615..524328,524431..524762))
                     /locus_tag="MYCTH_2303304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662503.1"
                     /db_xref="GeneID:11512627"
     CDS             complement(523878..524243)
                     /locus_tag="MYCTH_2303304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662551.1"
                     /db_xref="GeneID:11512627"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="JGIDB:Spoth2_2303304"
                     /translation="MMHVSMPRYDNDRQGIIFRASPRQADVMIVAGTVTNKMAPAVRL
                     CYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRIIPVDIYVPGCPPTPDALLYGI
                     FQLQRKMRRTKITRMWYRK"
     gene            525030..527676
                     /locus_tag="MYCTH_2303305"
                     /db_xref="GeneID:11512628"
     mRNA            join(525030..525144,525286..525340,525433..526689,
                     526843..527135,527204..527676)
                     /locus_tag="MYCTH_2303305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662504.1"
                     /db_xref="GeneID:11512628"
     CDS             join(525803..526689,526843..527135,527204..527505)
                     /locus_tag="MYCTH_2303305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662552.1"
                     /db_xref="GeneID:11512628"
                     /db_xref="JGIDB:Spoth2_2303305"
                     /translation="MIEAFLEEPSRDDIPSIELQPDTSIPTDPDQETASADMFFLPWA
                     LDQNPPGPFPELVPWQSPSLREEEEGVDSVLQPTVAALTSLHAALAATTTTTNGSSRG
                     DAFDPALAGRVFTRSNRDIFLPIYFRFTHRHVPLIHRPTFDPAASAPALVLAVFLCGA
                     LYAPPRDCVLAVRGCFPLAEEYVFRRLEGLLRLHEHEHEHSERDAEPRAGKESERYDP
                     ERERETYETLQAALLVHGAQFMMNDPAARSTAWAARWPALVGAVRRLGLTSARQTQSP
                     DAEAGEIDWGRWVRDEVRIRISNAVFLTDWQQCGVFHLPVLSTFHEMTADMPSLPDLW
                     EAKDAAEFRAAIEANGRGCWRRSASLRDCTDALVAESWSGVKGFPLKNLTCLDHLILS
                     TAIHVMIGSARFVSLLRPCIPVLRRAIDRWQELWHATVSKIDDEELRTSGFFRHCGEY
                     GWLARALLKESLEGKDRDSPYYRRIGHATPKELHDLLRKLREG"
     gene            complement(528007..530148)
                     /locus_tag="MYCTH_81645"
                     /db_xref="GeneID:11512629"
     mRNA            complement(join(528007..528714,528814..529622,
                     529831..530148))
                     /locus_tag="MYCTH_81645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662505.1"
                     /db_xref="GeneID:11512629"
     CDS             complement(join(528218..528714,528814..529622,
                     529831..530072))
                     /locus_tag="MYCTH_81645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662553.1"
                     /db_xref="GeneID:11512629"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_81645"
                     /translation="MTVGTDDTQPLLRSVTNEGHQVYTNPVVPRQDARQQDGAANNAD
                     TIIVDFDPRGDAENPLEWPAPFKWVVVSMLASMAFTVTMTCISTVPLASDIVRDLSRS
                     PNPSKSASVLLVTIWELGEAAGPLLIAPLSEMFGRYPVMNAANLIFIGAGLLAATAGS
                     VPQFVFARMLNGLAVAVNVLNPAIVGDMFASDERGAAMSMLFLAPLAGGAFGPMIGSA
                     VADRYGWRTVVWMTVSVASACELLFLSCFRETYKVAILRRRAKRLARHAAGSGKTFKT
                     VFDQGDGVSGWRKLRDSMLRPAIVLCSSGVLMAVSLFSSVVFTFFYVYSTTFSDILTE
                     FYDLSPVAVGSCFTVFSIGSAISVVICNRTLDRIYVYLRSTHKGVGRPEFRLPLAIVG
                     GIALPLSVAAYGWTAQLRLPLLLLLFSVCAMGTSLMLGMIPIMNYVVDAFGIFSASAV
                     TGIIVTRCLMSTFLPLTTAPLVDALGFGWGFTALAGFSLLLAPIPALLLRYGVYWRKF
                     SSYTRDE"
     gene            complement(531677..533246)
                     /locus_tag="MYCTH_2303310"
                     /db_xref="GeneID:11512630"
     mRNA            complement(join(531677..531991,532149..532374,
                     532510..533246))
                     /locus_tag="MYCTH_2303310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662506.1"
                     /db_xref="GeneID:11512630"
     CDS             complement(join(531822..531991,532149..532374,
                     532510..533013))
                     /locus_tag="MYCTH_2303310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662554.1"
                     /db_xref="GeneID:11512630"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2303310"
                     /translation="MAPTTITLAPPYVKTFRKKPYPAVSPSRPELSQSGRTVLVAGAS
                     SGIGFAIARAFVHASASHVILTGRREAVLADAVSRLKTEAKDGTTISGFVSDVSDPRD
                     SEKLWSGIGAQGIVVDVLVLNAMNMGQGGPLLQAELGATWKAFETNVRGFLDYAQRFS
                     KQGEGRPKFLINVSTSCIHNCTTEGSGIPTYALSKNAGTLLMQLIADDTDPEHMQVVS
                     FHPGSILSDTVRSAGFDETSKDWDDVNLSGQFAVFCASEEARFLHGRFVPIWWDVDEL
                     KAGEARARMESDYHFLRLGLVGV"
     gene            complement(<534228..>535422)
                     /locus_tag="MYCTH_102133"
                     /db_xref="GeneID:11512631"
     mRNA            complement(join(<534228..535117,535200..>535422))
                     /locus_tag="MYCTH_102133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662507.1"
                     /db_xref="GeneID:11512631"
     CDS             complement(join(534228..535117,535200..535422))
                     /locus_tag="MYCTH_102133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662555.1"
                     /db_xref="GeneID:11512631"
                     /db_xref="JGIDB:Spoth2_102133"
                     /translation="MNLANHHTFCFGIEIELLLESPSKKHRTWEALAQDLSKRLKAAG
                     IRNHVHDNHGYAEWSIVREVTVQDPDGRNPYQYGVELVSPIHVATSLPILAAQLCKIF
                     AVVNTISTPIKSRRCSSHVHVSRRPILSPQELAALAKAALYFEAALDALMPPERSGPH
                     SHWAQSNRHANNPCLAGLTLAECLAKVDAAAAAHLAAPSLPLDAKGEREGKEIGERVE
                     EDRPADARRPLVETMNLVSRESRYGVVRRKKAHFVRGKTYKWDFTGLLAPPRGAGEEA
                     DHRGIDGTVEFRQPPGSRTAAEAVTWATLAVAFVAGAVELGTAGVGLGSEAGGVVGEE
                     GGSREELWKLLEKGREALGWVDLRALDGLFWGLREE"
     gene            537383..538641
                     /locus_tag="MYCTH_2303313"
                     /db_xref="GeneID:11512632"
     mRNA            join(537383..538067,538185..538641)
                     /locus_tag="MYCTH_2303313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662508.1"
                     /db_xref="GeneID:11512632"
     CDS             join(537636..538067,538185..538193)
                     /locus_tag="MYCTH_2303313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662556.1"
                     /db_xref="GeneID:11512632"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_2303313"
                     /translation="MGDHIKDILTLAALDELTSTHKYVIIDFTAQWCPPCKAIAPLFH
                     KLAAEYARPGALAFARVDVDEASEVAAKFGISAMPTFLFLVDGVADGFDDGGALTGAA
                     VQRTDDRALSIRGADPKNLVSAAIKLSELAAKELVAEEVTAESA"
     gene            complement(538695..541776)
                     /locus_tag="MYCTH_2303316"
                     /db_xref="GeneID:11512633"
     mRNA            complement(join(538695..541403,541476..541612,
                     541686..541776))
                     /locus_tag="MYCTH_2303316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662509.1"
                     /db_xref="GeneID:11512633"
     CDS             complement(join(538733..541403,541476..541558))
                     /locus_tag="MYCTH_2303316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662557.1"
                     /db_xref="GeneID:11512633"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2303316"
                     /translation="MAEGLTRVSSEVSRNNAAPVGEVARDRSKKGGGSFLSRLGMRPG
                     KKKDLVDLDSDSELGGETRMDGVNARVFSQTLGSPLVGGGYVPHHKEPPRYIRTRSSN
                     KRTREFNRVFLAQELVGTRPPENDEDAAAEAGKAPMVSVSVAGTGDRRAVRSGGAIWA
                     SEFSKDGRFLATGGRDYVVRVWAVLSTAEERRAHEEDEVVGGDVGERLSAPVFREQPV
                     MEFKGHTGEVLDLSWSKNNFLLSSSMDKTVRLWHMSRSECLCTFKHKDFVTRLAFHPR
                     DDRFFLAGSLDTMLLLWSIPDKAVAFSAQLPDLVTAVAFSPDGKVAIAGLLNGYCMFY
                     ETEGLKLSSQIHVRSSRGKNAKGSKITGIQTMTIPPPNPLDTGTSQAPDSVASASAAA
                     PADGTGVREEVRVLITSNDSRVRVYNLHDKSLLLKLKGHENACSQIAATFSDDGKHII
                     CGSEDRKTFIWSMTGGSALVQDKDKSPCEYFEAHGDIVTTALFAPTKTRMLLGQSGDP
                     IYDLCNPPPVVLQSLEEAASAAASQVALTNDSQQSRPHEPVGKRPEPSPAYIARSTHY
                     DGHIIVTTGDTGIIKVFRQDCAYAKRRHESWETGSTFSRKLGAGGRLGRSGSVLTRTS
                     AGSTAHSRRGSLSQPVPPSVLGSPQFHAVGAHPDRILSWRQGIEHGGDRRSALLADGS
                     STPARSERSLSPAKASRTSLNSAYNLASEGRKQPYGGASPARNRASSAVTSPTASVFS
                     SPPERHPSRSLTESVLTKQRRTSKPQEEPSAPPTPGFTLYSASAEEADQSPQSESAAG
                     AGSTSFWNLGRWRAITAFKAGSSSQGAAGTRTKSIGSRPSLSISRQHADSSCDEREGS
                     GGQAEGGGGIAASRRQSAGGDGKSRGRKSLPGGSSVQEGSDSDAPSVPVNGGETENRG
                     SRD"
     gene            complement(<543304..>544512)
                     /locus_tag="MYCTH_2117839"
                     /db_xref="GeneID:11512634"
     mRNA            complement(<543304..>544512)
                     /locus_tag="MYCTH_2117839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662510.1"
                     /db_xref="GeneID:11512634"
     CDS             complement(543304..544512)
                     /locus_tag="MYCTH_2117839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662558.1"
                     /db_xref="GeneID:11512634"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="JGIDB:Spoth2_2117839"
                     /translation="MRFASKKQTIDAIDEDAGVSLLIVEPEDMWHANNLIAEGDIVHA
                     PAVRKVTMTTATGSTVGKSVRTNLSIRVKSTFFDPLASELKVSGTVVNENDWVSVGQH
                     HTITLKYEKADLKFTIWKSSGWDSVAIQSLKEALSEDRPEAIAAVVMQEGLANICLIT
                     EFRTIVKQRIESPIPKKRSTAKESTGAMSSFFEKTLSSLRNNVDFSIPRTLLLASPGF
                     AADDFRAYMASEASRTGDKGLQRIAKEAVVVQSTSGHVHSLNEVLKSTKVKKILENAK
                     VTTETNLMDQFYDRLRKDDGRAWYGTKPVEKAVAEGAVGRGGGVLFVNNGFFRSMDVA
                     TRKKYVALVDKVKEDGGEVRLLSSDHESGKRLESLGGIAAILTYPILDLDEDDEEEAV
                     GDSGEGSMVI"
     gene            545503..547949
                     /locus_tag="MYCTH_2303320"
                     /db_xref="GeneID:11512635"
     mRNA            545503..547949
                     /locus_tag="MYCTH_2303320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662511.1"
                     /db_xref="GeneID:11512635"
     CDS             545676..547655
                     /locus_tag="MYCTH_2303320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662559.1"
                     /db_xref="GeneID:11512635"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="JGIDB:Spoth2_2303320"
                     /translation="MNNILALASTSLLSDSTSAEDLERRIPGFSVLQDFFKKWLKLDL
                     TTILTAAALLGAASSGAQTVQHTGSRIYWWVVRFLTASVSIAGNDRLNHEVLNWLGAN
                     VLMKKGTRILTVKSESTRNNTWSYRRGSQERNDYQHEKRVPVQYLPTFGTTWFIHDRN
                     IFMVRRILTSNSQYNIAWDWTPDEYAGAPEGDEPLMVMCLGRSVEPIKRFLNTCREFS
                     DKQRETCITVRSSKHSYDGLWDTTILRPLRPLETVHFDEEIKEALVADIEKYLDVNTR
                     RFYNRRGIPYRRGFLLYGPPGTGKTSLSLALAGRFGLELYLLHMPSVHDDTSLERLFT
                     ALPPRCIVLLEDIDAVGIKHRPRIRDHHDSSDSGDDSDKSSSDRNIGLERSRCTLSGL
                     LNVLDGVASQEGRIVLMTSNYADKLDKALIRPGRVDKMLYLGHISPRSSELMFLRMFS
                     PDEDGAAPTNRAVQLSQDQLKQLAVDFSKCIPDGVFTPAQVQGYLLDHKDSPVNAAAK
                     AKEWVQEEIRLMEAAKEKEKKAAEARKKKRKERKRRRAERLAEALRNYDSGEDLEELR
                     QRVKVARRRKKTITQDATEPEEADVDRKAGDKEETASENRNVGSIPNGETPNGILQES
                     EEDLGAKADENNAAHPKVDITGTEAPQDNKLSGGH"
     gene            548236..549972
                     /locus_tag="MYCTH_2303321"
                     /db_xref="GeneID:11512636"
     mRNA            548236..549972
                     /locus_tag="MYCTH_2303321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662512.1"
                     /db_xref="GeneID:11512636"
     CDS             548482..549642
                     /locus_tag="MYCTH_2303321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662560.1"
                     /db_xref="GeneID:11512636"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2303321"
                     /translation="MKHLSQDQDKNSTAAGNPGTGQAEGSNPASLIRDLNIIGSIKES
                     ADYPTDNPTATAEPAPAENQTPTRVGSADRPRTPSPNPAPSLDTVTQPDRTSTELPAN
                     LKECIKESYDAIAPVYNQWTLLHQARRMHYTTRLLDFLRADRRHKDGVDYRRGEEKEE
                     NKEEEAMKRLPDSAGEGLDLINLNLNGMRALEVGCGTGVPVLEILLAKEMDTIGVDIS
                     ATQIALAQAHFPTQTATGQAVWEQKDMMDLGYPPGEFDVIIGLYSLIHLPREEQTIFL
                     NRAHRWLKAGGMLMINFPREELQGDVMEHWLGQDKGWMFWSSWGEEKMMQIIEDLEGM
                     EVLLREVTETDAADPAFVWVVARKNRVEGAEGPADGTARREGAAESPGSKIE"
     gene            <551266..>556262
                     /locus_tag="MYCTH_50335"
                     /db_xref="GeneID:11512637"
     mRNA            join(<551266..551973,552128..553446,553545..554335,
                     554461..555395,555498..>556262)
                     /locus_tag="MYCTH_50335"
                     /product="ABC transporter-like protein"
                     /transcript_id="XM_003662513.1"
                     /db_xref="GeneID:11512637"
     CDS             join(551266..551973,552128..553446,553545..554335,
                     554461..555395,555498..556262)
                     /locus_tag="MYCTH_50335"
                     /codon_start=1
                     /product="ABC transporter-like protein"
                     /protein_id="XP_003662561.1"
                     /db_xref="GeneID:11512637"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="JGIDB:Spoth2_50335"
                     /translation="MSAAQKQESAGEQHPALGSGTSDSSLTARDDTSETVGGDGGDDR
                     VQNHEASPLRDVLEEGTSNELHRIATALSRHRSRATAGPETPESDPALDPESPHFDVA
                     KWVRNFVFQLKQQGHKSSQLGVLFRDLDVFGSGSALQLQETVDSVLLAPLRVGELLSR
                     NKQHKHILHGFNGLLRSGELLAVLGRPGSGCSTFLKTLCGELHGLTLGKNSTIHYNGA
                     SQERMKKEFKGEVIYNQEVDKHFPHLTVGQTLEFAASMRTPSRRIDDMSRAEYCQYIA
                     RVVMAIFGLSHTYHTKVGNDYVRGVSGGERKRVSIAEMMVAGSPICAWDNSTRGLDSS
                     SALKFVQALRLSSDLGKHAHAVAMYQASQAIYDVFDKATVLYEGRQIYFGPASAAKAY
                     FERQGWYCPPRQTTGDFLTSVTNPGERIPRPGMEHKVPRTPEDFERYWLASPEFRALQ
                     DDMARYDAEFEGDDRQAESIAALRETKHYRQAKHVRPGSPYLVSVSMQIKHNTKRAYQ
                     RVWNNLAATATNIGSNLILALIIGSIFYGNPDATAGFDGKGSVLFMAILLNALTAISE
                     IESLYGQRPIVEKHASYAFYHPWTEAAAGIVADIPVKFAAAVVFNLIVYFLAGLRRAP
                     AQFFLYFLISYVSTFVMSAVFRTMAAITKTVSQAMALAGVLVLALVMYTGYIIPVPQM
                     HPWFSWIRWLNPIYYAFEILIANEFHGRDFTCSSIVPPYSPLAGDSWICATMGAVPGR
                     PTVSGDAYIDAMYGYTYSHVWRNFGILLAFLVGFTAIYLAAVELNSSVTSTAEALVFP
                     RWDIPAHLDPRRKGGDKEVADEEAAGAAAAAAGDERKKVEQGPQDLNGTSIEPQRDIF
                     TWKDVVYDIDVKEGKRRLLDHVSGWVKPGTLTALMGASGAGKTTLLDVLAQRTSVGVV
                     TGDMLVNGRPFGADFQRQTGYVQQQDLHLDTATVRESLRFSAMLRRPKSVSKEEKFAF
                     VEEVIKMLGMEEYANAVVGVPGEGLNVEQRKLLTIGVELVAKPKLLLFLDEPTSGLDS
                     QSAWAICVFLRKLANAGQAVLCTIHQPNALLFQQFDRLLFLAKGGKTVYFGDIGENSR
                     LLLDYFERNGSRRCGDDENPAEFMLEIVAEGVNRDGEDWHSVWKKSKECSEVLAEIDR
                     IHEQGRAAAATEKQTSGGCGGGDEGDSGGEFAMPFWSQVWAVTERIFQQYWRMPGYVL
                     AKLLLGIMAGLFIGFTFWKADSTQAGMRNVVFSVFMVTTIFTTLVQQIQPLFITQRSL
                     YEVRERPSKAYSWKAFLIANIIVEIPYQILTGVLAFACFYYPVVGIQASVRQGLVLLF
                     TIQLFIYASAFAHMTIAALPDAQAAAGIVILLTMMSTIFSGVLQTRIALPGFWTFMYY
                     VSPFTYWIAGIVSTVLHDRPVVCSRAESLVFDPPPNTTCGEYLAPLAGRAAGTLQNPS
                     AREACRYCAFSVADQYLEGVDIYWEDRWRNFGIMWAYIVFDIVVAIAVYYLFRVKGKG
                     FQGLFKRFKKD"
     gene            558592..559854
                     /locus_tag="MYCTH_2303328"
                     /db_xref="GeneID:11512638"
     mRNA            join(558592..559152,559279..559854)
                     /locus_tag="MYCTH_2303328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662514.1"
                     /db_xref="GeneID:11512638"
     CDS             join(558953..559152,559279..559741)
                     /locus_tag="MYCTH_2303328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662562.1"
                     /db_xref="GeneID:11512638"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_2303328"
                     /translation="MQHILALVALVPAVLAQTYYGCYTEIPARALTGSSLIDYENMTI
                     AVCEAHCTGLDFDIWGVEYGGECYCGNALAQGSFPAFVTDCAMPCPGDAATVCGGPNR
                     LSLYGASEEAPVVTPQPHDPVSETQYAGCWSEVEGGARALAGTSAFSLSAMTVPACGD
                     YCLNSGFLWFGLEYGAECYCGEELSVNSTSVAEADCDMPCSGDAATTCGGSNRLSVYQ
                     WV"
     gene            complement(<560051..560909)
                     /locus_tag="MYCTH_2133830"
                     /db_xref="GeneID:11512639"
     mRNA            complement(join(<560051..560238,560271..560461,
                     560574..560909))
                     /locus_tag="MYCTH_2133830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662515.1"
                     /db_xref="GeneID:11512639"
     CDS             complement(join(560051..560238,560271..560461,
                     560574..560860))
                     /locus_tag="MYCTH_2133830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662563.1"
                     /db_xref="GeneID:11512639"
                     /db_xref="JGIDB:Spoth2_2133830"
                     /translation="MLTAAQIEGQMNECIVATALYYLDSEHLTPRRLSFRMMTDSTQA
                     EMEDQVGQDMYKVYERIYGTRLGGDQEGRETVQTCGSVETPEGRLLAFPNIFLKNRNK
                     PGHRRFIALWLVDPLRRIVSTANVPPQQFDWWIKAVFGTEAKTLGNMPPGVFQLLLEQ
                     ELLLQSGMKSRLPSEVMDMVRSQVAPDGLMTVERARRHRLTVMEERSAFATTAREEEW
                     ANR"
     gene            584292..585715
                     /locus_tag="MYCTH_2303335"
                     /db_xref="GeneID:11512640"
     mRNA            join(584292..584671,584790..585715)
                     /locus_tag="MYCTH_2303335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662516.1"
                     /db_xref="GeneID:11512640"
     CDS             join(584472..584671,584790..585336)
                     /locus_tag="MYCTH_2303335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662564.1"
                     /db_xref="GeneID:11512640"
                     /db_xref="JGIDB:Spoth2_2303335"
                     /translation="MLPSTTTTLLLSCLVGAVCGLSVDAKWWWPHPKATCLAPDAVQT
                     ASFYTGLEEGTPGIRPGLSESSTDKANFINFCAGRTLTNGKQNAAGSCNGIPMGRIPA
                     TTNMISSIITYPQPGDRLKPNTTFNVTIQTRHLRAGYLVNPSVSYYTAPQDLDENGDI
                     IGHCHISIQNIGSLRTLDVPDPTAFAFFKGVDDEGDGKGRLSTEVTGGLPDGVYRVCT
                     MIAARNHQPVAMPVAQRGAQDDCTKFEVGL"
     gene            <585849..>586343
                     /locus_tag="MYCTH_2126322"
                     /db_xref="GeneID:11512641"
     mRNA            <585849..>586343
                     /locus_tag="MYCTH_2126322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662517.1"
                     /db_xref="GeneID:11512641"
     CDS             585849..586343
                     /locus_tag="MYCTH_2126322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662565.1"
                     /db_xref="GeneID:11512641"
                     /db_xref="JGIDB:Spoth2_2126322"
                     /translation="MRSTLGLLTTLLRLESIETTAFVIRCFGYYASEFLQHHPDVLDP
                     DLGQVKARVHLTMAHRPVRWLWTQEPAEAKRLWQQEEHAAAFALRILDHFFARGDCVD
                     DCDIGIAVGQIHQRLCILQSLFLGNSAWVEDPTLQEELRGALEDAMNRTKRSQVAPFV
                     GTVY"
     gene            587728..590256
                     /locus_tag="MYCTH_2303340"
                     /db_xref="GeneID:11512642"
     mRNA            join(587728..588254,588381..589382,589480..589579,
                     589679..590256)
                     /locus_tag="MYCTH_2303340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662518.1"
                     /db_xref="GeneID:11512642"
     CDS             join(587981..588254,588381..589382,589480..589579,
                     589679..589937)
                     /locus_tag="MYCTH_2303340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662566.1"
                     /db_xref="GeneID:11512642"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_2303340"
                     /translation="MNRPSRTEDDLEHPTWNQNPPFLAPDLTTRQDLNGIANTREHRH
                     GCSGAHDGAGALHDEKRAGNRGCGCCDRDCDCRHGIRSPFAMSGQHGCPLIAPETALG
                     GEGQTCLASRPIQPPSGWIGWIASVVLASTLIHVAGNSRRLSSSFSPFSGTTAVEAPI
                     VIETTASRPLAARRVACVSSNAGDDYNTPLHVGALLIILAVSSSACATPLLAAKFPAL
                     RIPESFLFIVRHFGTGVLLATAFVHLLPTAFTSLGNPCLSSFWTTDYPAMPGAIALVG
                     IFFVSVIEMIFSPARTLAPRAASSAAEAAASGAPTSGSPGGATHAPLPAGGHCSSAAV
                     MAVMRRPSISHRRASIEPAPAVSQINLSKEALEAESQGGGGLTPEQLHKKSILQCMLL
                     EVGILFHSVFIGMALSVAVGTNFVVLLIAIAFHQTFEGLALGARIASIAWPKKTLQPW
                     LMALAYGCTTPIGQALGLATHSLYSPDSEFGLILVGTMNAVSSGLLVFAALIELLAED
                     FLSDHSWFVLRGRKRVTACFLVLFGAICMSLVGAWA"
     gene            590737..590821
                     /locus_tag="MYCTH_t80"
                     /db_xref="GeneID:11512643"
     tRNA            590737..590821
                     /locus_tag="MYCTH_t80"
                     /product="tRNA-Asp"
                     /note="Anticodon: GTC"
                     /anticodon=(pos:590770..590772,aa:Asp,seq:gtc)
                     /db_xref="GeneID:11512643"
     gene            complement(591131..592351)
                     /locus_tag="MYCTH_107866"
                     /db_xref="GeneID:11509851"
     mRNA            complement(join(591131..591988,592167..592351))
                     /locus_tag="MYCTH_107866"
                     /product="glycoside hydrolase family 25 protein"
                     /transcript_id="XM_003662519.1"
                     /db_xref="GeneID:11509851"
     CDS             complement(join(591455..591988,592167..592310))
                     /locus_tag="MYCTH_107866"
                     /note="CAZy_ID 267765"
                     /codon_start=1
                     /product="glycoside hydrolase family 25 protein"
                     /protein_id="XP_003662567.1"
                     /db_xref="GeneID:11509851"
                     /db_xref="InterPro:IPR002053"
                     /db_xref="JGIDB:Spoth2_107866"
                     /translation="MKSALVATIAAFAAGVQAAVQGFDISHYQPSVDFAAAYKSGARF
                     VIIKATEGTSYIDPKFSSHYTGATKAGFIRGAYHFAHPGQSSGEAQADYFLAHGGGWT
                     SDGITLPGMLDLEAYNAGQCWGLSTSAMVAWIKAFSDRYHSRTGVYPLLYTNPSWWKA
                     CTGNSNAFVNTNPLVLARYASSPGEIPGGWPYQTIWQNSDSYAYGGDSDIFNGDLDGL
                     KRLAKGP"
     gene            596414..598455
                     /locus_tag="MYCTH_2303344"
                     /db_xref="GeneID:11512644"
     mRNA            596414..598455
                     /locus_tag="MYCTH_2303344"
                     /product="phospholipase C-like protein"
                     /transcript_id="XM_003662520.1"
                     /db_xref="GeneID:11512644"
     CDS             596516..598363
                     /locus_tag="MYCTH_2303344"
                     /codon_start=1
                     /product="phospholipase C-like protein"
                     /protein_id="XP_003662568.1"
                     /db_xref="GeneID:11512644"
                     /db_xref="JGIDB:Spoth2_2303344"
                     /translation="MRFLGLLAVLASSAWLPASGQTDDVCRAEDRTYSTKNVPAGSHQ
                     PFEQLNPLLGSLSTKFYITVVNLTPHRIRLQNTHSYQMDTFEFGDVPQGRARQNRIKY
                     RGTWSTGDDAGEAYYALDGTDKTFVLRVKTYASEPDPRRVVLDLSGMGLGQREYVFPG
                     GETAVSLVITGSSRFGFQASLRHGPGNWMRNLYDVIGDRPVRHLVMPGTHDAAMSKIT
                     DKLTSIGSEPNTQNQGVNIYDQLRAGSRWFDLRIGSVHDNNDAAVNKGFWAMHLSDEM
                     ATVAIGNTGESLDEIVDEINRFTDENPGEVVFLAIRYLVGRYERPDRGPILWTAAVVN
                     DFFAKLRGIKNRCPDLDDGGTGGLQNREASYFMDRNQGRGCVIPLLNGHLDRDGVPRE
                     SPGDGIYDMGRVMAVSDHWSNKMQASDMAPDQIANWRSATRGGGGDYGSLMIAQWLVT
                     PDALASTAYSLQSFAIQPANPSLYWAGVNGMDPEHWPNVLLVDYIGVQQQDRWAWDQL
                     SAELYTLAVGLNLYMISENCNVSPHRSPLLRSAQEEEGVVAAAAAAAAAAATLGGSLR
                     APWNGIVFANGTTLDNPPPDLHPGRMDVLPKGTRLGNGTVLEQSIPNPW"
     gene            complement(599000..600661)
                     /locus_tag="MYCTH_2315007"
                     /db_xref="GeneID:11512645"
     mRNA            complement(599000..600661)
                     /locus_tag="MYCTH_2315007"
                     /product="glycoside hydrolase family 17 protein"
                     /transcript_id="XM_003662521.1"
                     /db_xref="GeneID:11512645"
     CDS             complement(599234..600451)
                     /locus_tag="MYCTH_2315007"
                     /note="CAZy_ID 267911"
                     /codon_start=1
                     /product="glycoside hydrolase family 17 protein"
                     /protein_id="XP_003662569.1"
                     /db_xref="GeneID:11512645"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="JGIDB:Spoth2_2315007"
                     /translation="MRPTSALVAAGVLVSGTSAENYLGFNSGATLADRSAKFKADWLA
                     EFKTAQNLENAPGKFNAVRLYTNIQAYSEDTPIEAFEAAIETNTKILLGIWTSGTNSI
                     EKELSALKKAIDKYGSKFTDLVIGMSIGSEDLYRDSETGVKNEAGIGAGPDTLIKFIN
                     DYKKAVAGTALKGVPIGHVDTWDAWTNGTNKAVIDAVDWIGVDEYPYYENGKGNNIKN
                     SGTLFDRAFNAVKGVAGDKPIWVTETGWPSSGPNWDQAVSSVENAKYYWDEVGCRKLF
                     NKVPTFWYNLRDSNPDNKMKFAITNNLSTKPLFDLTCPTKFDTPTSTSTSAAPSSTGV
                     SAPSSSATSASGSTNTTGGSGTSAGADNSAAESGDGTEEADAIPTGSGASIGRSLFTV
                     VSLALVAGVFTLF"
     gene            complement(603248..605287)
                     /locus_tag="MYCTH_2303348"
                     /db_xref="GeneID:11512646"
     mRNA            complement(join(603248..604691,604982..605287))
                     /locus_tag="MYCTH_2303348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662522.1"
                     /db_xref="GeneID:11512646"
     CDS             complement(603350..604516)
                     /locus_tag="MYCTH_2303348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662570.1"
                     /db_xref="GeneID:11512646"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_2303348"
                     /translation="MRQRLYRQILVGREDGDAVAAVPECEVSPASTDHWGLRIASIFI
                     ILVGSALGALLPVILARTSKLRVPRLCFFVAKYFGTGVILATAWMHLLSPASDNLRDE
                     CLANILPDYDWAMGIALMTVMVMFLMEIIVSRFDFGFGSVHGHGHEHDGKAKGSDEAG
                     LEAAGSEKSTGTAMPAQSTAGAAGTGFFNRTGTSGLAINDVSYPPGGEDHLGHQRDHF
                     EGDEHANYAAQITAIFVLEFGVIFHSIFIGLTLAVTDNFIVLFIVLVFHQTFEGLGLG
                     ARLGTATWPSGVRRYTPHLLAMLYAISTPFAIGMGLVASKSLALEAATSRVVNGVFDA
                     ISGGILMYTALVELVAHEFMFNPEMRKAGLGMQLSAYTCVALGAGLMALLANWA"
     gene            complement(605288..607281)
                     /locus_tag="MYCTH_2303349"
                     /db_xref="GeneID:11512647"
     mRNA            complement(join(605288..607048,607112..607281))
                     /locus_tag="MYCTH_2303349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662523.1"
                     /db_xref="GeneID:11512647"
     CDS             complement(join(605769..607048,607112..607208))
                     /locus_tag="MYCTH_2303349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662571.1"
                     /db_xref="GeneID:11512647"
                     /db_xref="JGIDB:Spoth2_2303349"
                     /translation="MREFMHYITNAFYSATGWNEDNTYKELNATARELIDFPLPRGLR
                     LTLSSLATPHFVTSYQLNTIGVVDGSISYLHSTVPLTGIAAQSDQIPLPALLRSYRRL
                     HDLSSKDKQWYSGADATGEEPVPATTAAAAVDDSSGKNGSSLLYGRLYLPQSLLEGLV
                     VRRFTPALQVQLSAVSERSLRNGGTLLGLIQYDKGKYGIEGLALTDGGLLGIRGLYNF
                     GGDASSSAITPLTSISTLDSNGNGQSPERERIYGRFSAGGEVYYGTLNKSGGMSLGAR
                     FATLPAHRGTPLTATLTINPLMGNINATYAVLARDYCSLATRMEFNVYSYESDWAVGM
                     ELWSHRRPAGFLLGADPSGQAEPDPEPPRRKERSFQAKLEWRLDDPNPEQPEPHGPKT
                     EGKAAGTGSSEEYRGVLKARLDQNLRIGLLWEGRVKSLIFSLGTGIDLRKLGEPFRSL
                     GLEIQYSS"
     gene            complement(<607692..>608332)
                     /locus_tag="MYCTH_102118"
                     /db_xref="GeneID:11512648"
     mRNA            complement(join(<607692..608075,608145..608242,
                     608296..>608332))
                     /locus_tag="MYCTH_102118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662524.1"
                     /db_xref="GeneID:11512648"
     CDS             complement(join(607692..608075,608145..608242,
                     608296..608332))
                     /locus_tag="MYCTH_102118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662572.1"
                     /db_xref="GeneID:11512648"
                     /db_xref="InterPro:IPR004235"
                     /db_xref="JGIDB:Spoth2_102118"
                     /translation="MTSKKEKQITFEEYLGVTEAAFEWADSYDTKDWDRLRKCITPTL
                     RVDYRSFLGKVWEAMPAEEFIAMISDKSVLGNPLLRTQHFIGGASKWERVSDTEIIGH
                     HQLRVPHQVYTDASLQNVEVKGHAHSHNTHYYRKVNGVWKFAGLEPEIQWFEYNFDKV
                     FASGRDSYGEHK"
     gene            complement(608758..610273)
                     /locus_tag="MYCTH_2303353"
                     /db_xref="GeneID:11512649"
     mRNA            complement(608758..610273)
                     /locus_tag="MYCTH_2303353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662525.1"
                     /db_xref="GeneID:11512649"
     CDS             complement(609144..610097)
                     /locus_tag="MYCTH_2303353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662573.1"
                     /db_xref="GeneID:11512649"
                     /db_xref="JGIDB:Spoth2_2303353"
                     /translation="MSQGEPEVREHEPMPKGYRFVPKGNVYITKNCRKKTHEAGKTLY
                     VVVDKRGKPMGLRCPAYIHNLVMSENKATASQRAKLVQKRDAAIRESFEKVLLDLFPR
                     IPKEDLSQILDHSLKKHSRRVGRTGKVALQDRVKLAVRAHIRHAHTEYDQLLRQGVRR
                     QAAREQIWGKLNEVARRWGGRSVKPVATTPVGDRRTKRGKKAAHHRETLGPKFVAKTA
                     AVRSGRVSTRFTGQEAPYPTVPLSGPRTRAKTTRLRSPNLARERPTPEDSDTCTIDGF
                     DADVDGYFEDVDAQDAVFTVDEETSDDESDDSGWSWSDVDL"
     gene            complement(<610668..>612251)
                     /locus_tag="MYCTH_2060008"
                     /db_xref="GeneID:11512650"
     mRNA            complement(join(<610668..610763,610818..>612251))
                     /locus_tag="MYCTH_2060008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662526.1"
                     /db_xref="GeneID:11512650"
     CDS             complement(join(610668..610763,610818..612251))
                     /locus_tag="MYCTH_2060008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662574.1"
                     /db_xref="GeneID:11512650"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2060008"
                     /translation="MSSPASEDKREVFGLGRKVAVVGAGISGVCAAAHLIKQGLQVTV
                     FERSGIAGGVWHYDRRVAEDPPYPNNAPSRGDYLLSKPGEFAFATPPPEHDTAAGDTA
                     DLRSRSLLPADLEAHFSPPGPCYAGLKNNVPTHLMASSLDPWPEGTEPFVSQDKVEQY
                     IQGLASDHGVTAVTSFHTRVDEIRKTPDGTKWEIRSVALEAWDTGPRLNERTSYFDLV
                     VVATGHYNMPRIPDTEGLKEWKERYPSRIIHSKQYRSPEPFRGRNILVIGAGVSALDI
                     CRETDGVTAKTYQSVRGGRFDLPQSLLPESTVRVPEVARYELRADSGGRLDDEAPIPG
                     SVVLKDGQVLEGIHHVVVATGYITSYPFLPHLHSDDTPNVQAGEDIVVAAEGDMAHNL
                     HRDIFYINDPTLAFVGVPYHVATFSLFDFQAQAVARAFAGKARLPSREEMRREYQKRM
                     EEKGLGRGFHSLHVRGHELEYVQGLVDWEWRRAYNEMKDKTMSLFKWSENAGEEGPKE
                     Q"
     gene            <613107..>614402
                     /locus_tag="MYCTH_2060338"
                     /db_xref="GeneID:11512651"
     mRNA            join(<613107..613550,613614..614155,614249..>614402)
                     /locus_tag="MYCTH_2060338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662527.1"
                     /db_xref="GeneID:11512651"
     CDS             join(613107..613550,613614..614155,614249..614402)
                     /locus_tag="MYCTH_2060338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662575.1"
                     /db_xref="GeneID:11512651"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Spoth2_2060338"
                     /translation="MAPSAIIESIVDTAEPRKDNIELPEPARQRLTRAGIDLSNGYPY
                     RPALPLYLQDVYKIRNEERPYEDAGARADKSKKHLFAAATKVTDLTTHIGTEIEGVQL
                     KDLTPEQRDELALLIAERSVVFLRNQDLTPQQQKELGEYYGQVEVHPQTPQVPGVPGV
                     TVIWPALFAQERPANFRNPGGASSWHTDLVHERQPAGITHLHNDTVPPVGGDTLWASG
                     YAAYEKLSPEFRKFIDGKKAVYRSAHQYLDRENPTAGPKYIERIHPLVRVHPATGWKA
                     LWVNRSMTVRIVGLDKAESDLILNYLYDVYEKNVDIQVRFKWTPGTSALWDNSWDYGG
                     KHPRHGTRVTSLAEVPYFDPNAPTRREALGLLDESEKEALESSKY"
     gene            complement(<616733..>620386)
                     /locus_tag="MYCTH_2117854"
                     /db_xref="GeneID:11512652"
     mRNA            complement(join(<616733..617305,617384..617535,
                     617591..617622,617720..618189,618265..618320,
                     618387..618624,618855..618937,619040..619117,
                     619170..619363,619443..>620386))
                     /locus_tag="MYCTH_2117854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662528.1"
                     /db_xref="GeneID:11512652"
     CDS             complement(join(616733..617305,617384..617535,
                     617591..617622,617720..618189,618265..618320,
                     618387..618624,618855..618937,619040..619117,
                     619170..619363,619443..620386))
                     /locus_tag="MYCTH_2117854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662576.1"
                     /db_xref="GeneID:11512652"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2117854"
                     /translation="MEYPPGDPRNGTPAKSIEANEDNPAKDASEAPAYPSPILSAIPS
                     LHSPPASPRTTTQPDDWKITGEGIKNAKKYWKLVYANQRQRRSRAKKRKDYGGANDQG
                     RTKRRQGAGSSAPLQFQSQSSDPPATADPDDEYEPATAGVEHDVLAPVTILARLDKAE
                     QMQPVKANVDLNDPLVLRDLQELHEAVVSFGHGNCRFVDGKWELHGFGTSLYHHQVIG
                     VSWMLSRELHPAAPNGGILADEMGLGKTVQILACMSQNIPGKNAKASKTLIIVPKRLI
                     AQWFDGIVKHCSNDRMKRVLIHGAGQRILGSQWEGATIILTNYSQLHRQLPPERTLLQ
                     IEEMRQKGDPGWKTLLREEGGRLFQTDWHRVVLDEGHAINNRSSETSRACRLLSKKHG
                     WVLTGTPITNKPEEFFTYLDFITSKFSKFGDYQDLMGDGVDIPKSRPTELITVEFSPL
                     EASMHQPTKDRLQQLREHSETRKGADRSLAVPSGELRRLFNYLRYFPSHPALVEPTYL
                     SRQPLQYFCRACRNALVSPLIAECGHAFCRECLRKVSKEKGFAPRCPGCGENLGSARE
                     AGAECYRHNPDQFRELTKRYASTAMPQDDKRMKRVRKPGDDEFGLQPRLVRGKKTNKG
                     GKRRNKSKSGTKRSSQRAKSKRNNEIEQIRTNAGAFLKECDTRPWDPIPHSAKTRATM
                     DLIAKWQEEAPDDKIIVFVQWIPMLSFLGRMLFQNGFRFVYLWGEMEPDDQERCIRAF
                     EQIADIKVMLISVSCGAHGLNLTVANRAIVFDHWWHEGWERQAFARIHRIGQTKEVHT
                     AKLVVKGSMDETVMTIQASKREAIRTAVGERTNHAGDQDTYDDLFGDGSYDEGVLNLD
                     RMESISDEKGSKSDGETETETEVESCSDDGDSDDEEDEREFDTDNTTSSGSDEEYVAS
                     STGTHRGEDEDDLNTDGDGAASKEL"
     gene            <622949..>624416
                     /locus_tag="MYCTH_2117863"
                     /db_xref="GeneID:11512653"
     mRNA            join(<622949..623202,623265..623792,623864..>624416)
                     /locus_tag="MYCTH_2117863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662529.1"
                     /db_xref="GeneID:11512653"
     CDS             join(622949..623202,623265..623792,623864..624416)
                     /locus_tag="MYCTH_2117863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662577.1"
                     /db_xref="GeneID:11512653"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="JGIDB:Spoth2_2117863"
                     /translation="MPTLSAPCAITVVDFSQESLSLQRLDNETLPTFLSRPHPDWAKC
                     RWINVNGLSWDVIKALGRHKNLHRLAIEDIMNTRNRTKAEWFPTHAFIVLTLQKLVHL
                     YEPESDDSDPESEEESRSQKSVSSKRGTKSPRRLFRRLRRALRGRPADEAERRPRKEK
                     MPSLRDAGGYPWSPPTGFSDLPDISQLRTLQRYHTSPNDPRTQYMEKHSALSTRNLAV
                     ACEQVSIFLTNDNCIISFFEQSAQDIEGPIIRRLQTNDTIIRQSCDASMVGQAIMDGI
                     IDLAIPVAACYGDVISDLELDVLTRPNIGHTKSLYILISEINKILSFINPITTLINAL
                     RDHEAKLAPDVVMSHLLDPSHGVIITPMTNTYLGDVLDHCLLITETLNQLKGSADGMI
                     GLIFNTISANQNESMKQLTIATIIFLPLTFLTGYFGQNFEPFNVLKEDIGYL"
     gene            625872..626939
                     /locus_tag="MYCTH_2303359"
                     /db_xref="GeneID:11512654"
     mRNA            join(625872..626093,626171..626939)
                     /locus_tag="MYCTH_2303359"
                     /product="carbohydrate-binding module family 52 protein"
                     /transcript_id="XM_003662530.1"
                     /db_xref="GeneID:11512654"
     CDS             join(625992..626093,626171..626812)
                     /locus_tag="MYCTH_2303359"
                     /note="CAZy_ID 267828"
                     /codon_start=1
                     /product="carbohydrate-binding module family 52 protein"
                     /protein_id="XP_003662578.1"
                     /db_xref="GeneID:11512654"
                     /db_xref="JGIDB:Spoth2_2303359"
                     /translation="MHRFSLVATALLGLTKGVLGDTETCGQVPYDPSKYVCWDNEFLC
                     PITAGEPLSYCAGACYSKFMYTCTNNVLTLLPPVETPFTLTADNPNLPIHGKPVTAAN
                     QHWVVNGETASYCPDQVGDACPPGNETVIVSGGGTVSMSVMVPGGQQAYLDPYWNMGY
                     TQAHSAYIPPGSITTGFGAYQGGGFVNLNGNGWGWAACPPRASGGGGPAWNLVARNDT
                     NAERYKDCSPINLKIHSLPSGTVGAWQYT"
     gene            complement(627367..628800)
                     /locus_tag="MYCTH_2303360"
                     /db_xref="GeneID:11512655"
     mRNA            complement(join(627367..627667,627753..628233,
                     628330..628800))
                     /locus_tag="MYCTH_2303360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662531.1"
                     /db_xref="GeneID:11512655"
     CDS             complement(join(627491..627667,627753..628233,
                     628330..628571))
                     /locus_tag="MYCTH_2303360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662579.1"
                     /db_xref="GeneID:11512655"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="JGIDB:Spoth2_2303360"
                     /translation="MTANSAFQHQDVARVNGVTKTDSLPDPRGVMPRALPDICFELQA
                     KIDAFLAEQTDDRVLRNVQSQVRVSMGVIQEALRRYGPAHLSLSYNGGKDCLVLLVLI
                     MACLPAYASTSGPAADDPDTTETIADPLPGHAATSPVAPPSRLQAIYIVAPDPFAEVE
                     DFVEASEKRYHLDLKRYTLPMRPALEAYLKDRPAIRAIFLGTRRTDPHGEFLTHFDPT
                     DEGWPQFMRVHPVIDWHYVEIWAFIRHLHIPFCELYNRGFTSLGGVTNTRPNPALAVS
                     GSPSVFRPAYELRDDDEERLGRD"
     gene            <681541..>681837
                     /locus_tag="MYCTH_2061788"
                     /db_xref="GeneID:11512656"
     mRNA            <681541..>681837
                     /locus_tag="MYCTH_2061788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662532.1"
                     /db_xref="GeneID:11512656"
     CDS             <681541..681837
                     /locus_tag="MYCTH_2061788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662580.1"
                     /db_xref="GeneID:11512656"
                     /db_xref="JGIDB:Spoth2_2061788"
                     /translation="LFLKYYHFIRVYINDIIIFSKIEEEYLEYLYTIYKILNKAYIHI
                     SITKSFIGYLAIRLLRYIVNGKGITKTDDRITAFKKLKFLDILNSLEHYLRIAR"
     gene            complement(691488..694938)
                     /locus_tag="MYCTH_2303362"
                     /db_xref="GeneID:11512657"
     mRNA            complement(691488..694938)
                     /locus_tag="MYCTH_2303362"
                     /product="RAD5-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662533.1"
                     /db_xref="GeneID:11512657"
     CDS             complement(691510..694884)
                     /locus_tag="MYCTH_2303362"
                     /note="2|RAD5_NEUCR RecName: Full=DNA repair protein rad-5
                     Contains conserved domain HepA[COG0553], Superfamily II
                     DNA/RNA helicases, SNF2 family. HIRAN[pfam08797], HIRAN
                     domain (HIP116, Rad5p N-terminal) and RING[cd00162],
                     RING-finger"
                     /codon_start=1
                     /product="RAD5-like protein"
                     /protein_id="XP_003662581.1"
                     /db_xref="GeneID:11512657"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="JGIDB:Spoth2_2303362"
                     /translation="MDGPGSDEPPTKRRRFFADATDETTQACNSAVGKPSAEAEVDHR
                     GASGTPFPDDRCFVLRPNVDESTSSDLSGSCCAKPPIDVTHPAVFDQGTFESFVGKKV
                     DSDLVAQIRESCGNDLERAINMYLDGTWRNLKRKSTVSTPVRPTSGRLPPKPDNSIQR
                     PRPASALQSMPESRYIGAFGVEGWATRSGNNLLRHGDTVRIERQRIQAPKSLQQKAPS
                     KLRAAQHSAAAARRVDVIVRFTDVAGREIGRLAKDTANWVSTLIDQKICSFEGTCVYA
                     PERLRTNDTVFLQLRCSLMRSAFFGRELRVADNRTTGRFEESETSEERELRLRQIALV
                     KLFQEINLLPTRGNPTAAKNKRQELLEAAEMAETRDKNQPRSPQDQDGAAPSSSSEDN
                     EDGEELEQDQLDALYKKAQSFDFNTPETEPAESFALTLRPYQKQSLHWMIQKEKNVRN
                     EERETSIHPLWEEYAWPTKDHDDKDLPIVAGQPFFYVNPYSGELSLEFPRQSQHCLGG
                     ILADEMGLGKTIQMLSLIHTHKSEIAAQVRQSSRPVSSVNQLPRLPSSLGRDTVTNAP
                     CTTLVVAPMSLLAQWQSEAENASKEGTLKSMLYYGNEKNVDLLALCCEANAANAPDLV
                     ITSYGVVLSEFTQIASRHGDRASSHGLFSLNFFRVILDEAHSIKNRQSKTAKACYEIA
                     ATHRWVLTGTPIVNRLEDLFSLVRFLRVEPWNNFSFWRTFITVPFESKDYMRALDVVQ
                     TILEPLVMRRTKDMRTPGGEPLVALPPKQVEILDVELSKAERDVYDYIYTRAKRTFFA
                     NVEAGTVMKAFTSIFAQILRLRQSCCHPLLVRNQEIVADEEEANAAADAASGLADDMD
                     LQSLIERFAATTDDPANSNAFGAHVLNQIREEAVNECPICAEEPMVEQTVTGCWHSAC
                     KNCLLDYIKHQTDRHEVPRCFQCRGVINYHDLFEVVRNDDDPDVAEAGQGPRITLQRL
                     GVGNASAKIVALIDQLRALRREDPIIKSVVFSQFTSFLDLIEPALARSNMRFLRLDGS
                     MPQKIRAAVLQEFRESRKFTVLLLSLKAGGVGLNLTSAKRVYLMDPWWSFAVEAQAID
                     RVHRMGQEDEVKVYRFIVKDSVEQRMLKIQERKKFM"
     gene            695083..696505
                     /locus_tag="MYCTH_2303364"
                     /db_xref="GeneID:11512658"
     mRNA            join(695083..695292,695349..696505)
                     /locus_tag="MYCTH_2303364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662534.1"
                     /db_xref="GeneID:11512658"
     CDS             join(695156..695292,695349..696324)
                     /locus_tag="MYCTH_2303364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662582.1"
                     /db_xref="GeneID:11512658"
                     /db_xref="JGIDB:Spoth2_2303364"
                     /translation="MTLVTAAGSGFKLLLRRSPQVGRGLATSVDASDVDKARKYCLNQ
                     LRQGDYEAYLIRHFIPSSARDAYDALRTLNLELARLPEAVSNPTIGRFRMQFWRDTIS
                     SIFAGNPPREPISILLHSAITNLAARAGASSTSSIKFWLLRFISTREKHIENRPFASL
                     AALEDYAENTYATLMYMTLAVMPMRSMHMDHLASHIGKAYGIAATLRGIPILAVPSQP
                     IQGPSGSNVGNTRSPTLLLPLDVMAEVGLKEEDVFRRGPNAEGLQDAVFQVATRANDH
                     LITAREMLKKLQAGQEPGHEYEHVGEREHAYHGLLQGDEDTTSNVKRGFGVLLEAIAA
                     RDYLQRLESANFDPFTVKNSWKLPWGLWRSLKRHEI"
     gene            <699057..>700454
                     /locus_tag="MYCTH_2062265"
                     /db_xref="GeneID:11512659"
     mRNA            join(<699057..699450,699532..>700454)
                     /locus_tag="MYCTH_2062265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662535.1"
                     /db_xref="GeneID:11512659"
     CDS             join(699057..699450,699532..700454)
                     /locus_tag="MYCTH_2062265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662583.1"
                     /db_xref="GeneID:11512659"
                     /db_xref="JGIDB:Spoth2_2062265"
                     /translation="MADSRTSSSSLDFHREHGSHHTHHWISFPGMHFGRSSKETNTSA
                     PATLDWQLESPPLVMYGDPQTSSGALLSGQLFLDIKEEGLEIETLVATLNIRVTQKRP
                     FANHCADCANQRTELKRWELIQHPLVMAKGEHSFPFSVLLEGHLPSSMDSPLVSISYE
                     FKAEAIPRVNSCSLPPILLEKTLDVRRSLPTSETPHHSVRVFPPTNIKASAHYPHVIH
                     PIGSYTLSLRLDGIAKLNAKVNTVEYWKLKKLTWKLEETTKTIAPACERHSPKLGEAA
                     EQQSKKGVVRSETRIIGEKTLFSGWKSNYTSATDSVVELELDYSLAKNAKYACDSKSR
                     DGTEVTHQLIVEMVVSQEWAPVNKPSLVTHTGVGRILRMHFGTILTERAGIGISWDNE
                     APPIYQDVPPSPPAYSEEANLSAENSIADLIEPLDGAQAQGDISRI"
     gene            701319..703467
                     /locus_tag="MYCTH_2303368"
                     /db_xref="GeneID:11512660"
     mRNA            join(701319..702984,703045..703467)
                     /locus_tag="MYCTH_2303368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662536.1"
                     /db_xref="GeneID:11512660"
     CDS             join(701412..702984,703045..703412)
                     /locus_tag="MYCTH_2303368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662584.1"
                     /db_xref="GeneID:11512660"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Spoth2_2303368"
                     /translation="MTSKSAKQSSHERRKGEAALSDFAEYVEKQQALRYPSSKQVAAT
                     AAAGSTQGDLEHHEELDDILDSLDLSDPTPRVRLRELLLSSSGDADALQKLVDIISER
                     LSEGHGETVFDVGFENNGESMRLSRDEWEVAMGRLAEAAKKLRADTQLLLTKNVGGDL
                     DGAPTKDGDCSGKVMIRKAPATVEEVIETRIAVVGNVDAGKSSMLGVLVKGDLDDGRG
                     KARVNLFRHKHEIETGRTSSVGMEIMGFDTTGQVVVSDTPGRKLSWEEIGKRSAKVIT
                     FTDLAGHERYLRTTVFGLLSSSPNYCLLMVAANNGLIGMSKEHLGIALALNVPVMVVI
                     TKIDICPPQILEQTITQITRVLKSPGARKIPIFIKNREECINTATQFVSQRICPIFQV
                     SNVTGENLDLVRSFLNILPHHGRYDADAPFEFHVNDTFSVPHVGTVVSGIVKSGVIHA
                     GDDVQIGPDSLGRFIQTSIRSIERKRIGVPAASAGQSASFALRRVRRKDVRKGMVVLP
                     KSDGAPPKVYREFVAEVLILSHATTIKTKYQAMLHVGPVSQTCAIIDVDRPFIRTGDR
                     ATVAFRFVQRPEYLAPGDRLLFREGRTKGLGIVKSVGYDPSKPLMSKQSESGVGDEQQ
                     PSGHAAREKSDDKVARDMKIEA"
     gene            complement(703740..704610)
                     /locus_tag="MYCTH_2303370"
                     /db_xref="GeneID:11512661"
     mRNA            complement(join(703740..704008,704068..704104,
                     704187..704273,704360..704610))
                     /locus_tag="MYCTH_2303370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662537.1"
                     /db_xref="GeneID:11512661"
     CDS             complement(join(703965..704008,704068..704104,
                     704187..704273,704360..704482))
                     /locus_tag="MYCTH_2303370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662585.1"
                     /db_xref="GeneID:11512661"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Spoth2_2303370"
                     /translation="MAEARDEGNAVSEPLDLVRLLLDEVVCVKLRGDRELKGRLHAYD
                     SHCNLVLGDVEETIYVVDDEDDEDVKTVSKKSEMLFVRGDSVVLISPHAASF"
     gene            complement(704990..706464)
                     /locus_tag="MYCTH_2315009"
                     /db_xref="GeneID:11512662"
     mRNA            complement(join(704990..705781,705850..706464))
                     /locus_tag="MYCTH_2315009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662538.1"
                     /db_xref="GeneID:11512662"
     CDS             complement(join(705138..705781,705850..706072))
                     /locus_tag="MYCTH_2315009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662586.1"
                     /db_xref="GeneID:11512662"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="JGIDB:Spoth2_2315009"
                     /translation="MNWLLNLGVLAVVLPSLYIYTVSVVSARFPVLRNKRICLLIAHP
                     DDEAMFFAPAVMALANPETGNHVKILCLSSGNANGLGETRKRELAKSGLILGLRKADD
                     VFVVDKPEFPDSMTTTWDSSSISSLLCTAFAPDLSRSRSRDAAPTAAIDVLITFDAGG
                     VSGHPNHISLYHGAKAFIAALVAGKPGWQSPVDLYTLTTVPLWRKYVGFLDVLATLIS
                     WAIGADKKDKQHPGGLVFLNGLAGHGSVTTAWKAMVSAHKSQMVWFRYGWISLSRYMY
                     INDLRLERVKGR"
     gene            706889..708256
                     /locus_tag="MYCTH_2303374"
                     /db_xref="GeneID:11512663"
     mRNA            join(706889..707505,707570..708105,708166..708256)
                     /locus_tag="MYCTH_2303374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662539.1"
                     /db_xref="GeneID:11512663"
     CDS             join(707130..707505,707570..707871)
                     /locus_tag="MYCTH_2303374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662587.1"
                     /db_xref="GeneID:11512663"
                     /db_xref="JGIDB:Spoth2_2303374"
                     /translation="MTRRRRERSPSSLPLKQPDRSGPTEKTLLQLAEERGLFDQAKKR
                     EEEIGRKSGAASNLRPSSDEGSHAEDEAGLPPSVERVLEAGLWSVSLSMLHLTFDVLV
                     QHQYSIDRVVWSTVLSRFGQALPVFGLLVYVFHAHPANPGLIPGLSPRYQSVFQQAIF
                     LITSVVAGCYLIHITNSYGYMAVMKQAPPLGCLWVWSVIELDLPWAVISLAGAGLFLW
                     MKGYSIK"
     gene            708226..709375
                     /locus_tag="MYCTH_2303375"
                     /db_xref="GeneID:11512664"
     mRNA            708226..709375
                     /locus_tag="MYCTH_2303375"
                     /product="carbohydrate esterase family 4 protein"
                     /transcript_id="XM_003662540.1"
                     /db_xref="GeneID:11512664"
     CDS             708581..709360
                     /locus_tag="MYCTH_2303375"
                     /note="CAZy_ID 267825"
                     /codon_start=1
                     /product="carbohydrate esterase family 4 protein"
                     /protein_id="XP_003662588.1"
                     /db_xref="GeneID:11512664"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="JGIDB:Spoth2_2303375"
                     /translation="MIVPRVSALITIGLFLSQGRSAPTSSANLTARAETAVPLGVIIE
                     HCTVPGVVALTFDDGPFIYTSHVLDLLDEYGAKATFFINGENWSRGIDDFSTPWPEIL
                     RRIDSSGHQIGSHTWSHADLSSVDSATRELQIVKLEKALFHVLGKAPTYLRPPYASCS
                     QDCLSETERLGLHVVNFDVDPKDYLHNQEGDTGAAENFSRALDEHWWGDSFLVLSHDS
                     LQYTAEYLVPYMLGEIQRRGYRAVTVGECLGDPAENWYWTA"
     gene            complement(709693..711009)
                     /locus_tag="MYCTH_2303376"
                     /db_xref="GeneID:11512665"
     mRNA            complement(join(709693..709985,710047..711009))
                     /locus_tag="MYCTH_2303376"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662541.1"
                     /db_xref="GeneID:11512665"
     CDS             complement(join(709791..709985,710047..710805))
                     /locus_tag="MYCTH_2303376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662589.1"
                     /db_xref="GeneID:11512665"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2303376"
                     /translation="MEDKCVTLNSKPGASLHVSFSHPKPRQSPLSNTLVVFLNGLMMP
                     SAAWVESVNHLLNLRKDSGQPTPALLLYDRYGQGKSDSDPSDAWDSPYGHDARTVISD
                     LHQLLTQVSHEELGRRLEDLRLVLVCNSIGCALARLYAAEHPGRVAAYLFLDSMMANT
                     DFGSIFPDPDDPGFDEGRLPEDITTDDLRHARAKFQELFHPTVPNPERLDRRNLRELL
                     PHADRPGLPNVTKDKPPLLTVVGHDWDEFAAQCEQGSLSVPRAVINTYLNPAWAVYNE
                     GLTRLVPAETKVKIARGCGHFIQKDDPAFVAAELSGILNEL"
     gene            711479..712878
                     /locus_tag="MYCTH_2303378"
                     /db_xref="GeneID:11512666"
     mRNA            join(711479..711608,711686..712878)
                     /locus_tag="MYCTH_2303378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662542.1"
                     /db_xref="GeneID:11512666"
     CDS             join(711594..711608,711686..712735)
                     /locus_tag="MYCTH_2303378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662590.1"
                     /db_xref="GeneID:11512666"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR005303"
                     /db_xref="JGIDB:Spoth2_2303378"
                     /translation="MKITALYVYPIKGLRGIGLKSAQIGPQGIEHDRRFMLYEVHSTT
                     GELKKIQVDSHPRCALFEQQFARESEDGVPGRIIVRFHGSSPHGSETAEENKTIEVPL
                     TPDWSSLEKVDVVLHGSPASAYRMGDPYDSWFGRHFGVRTILVYLGDGRRAVLGKTLP
                     PTPVQEPQRQGWISSLTSYITGSQGAGTGSGSGPWITFADVAPLLVTSEMSLRDVRDR
                     LLGGLPLEMFKFRPNIVVDGEGESAWAEDFWAELSIGAVGHGDRRRVLQLTGNCVRCI
                     SLNVDYNTGKPAEGELGNVLKRLMKERRVDKGAKWSPVFGRYAFLDSRHARDITVSVG
                     DDVEVTRRNTERSVWDWPDL"
     gene            720970..725009
                     /locus_tag="MYCTH_2303382"
                     /db_xref="GeneID:11512667"
     mRNA            join(720970..721181,721340..724771,724833..725009)
                     /locus_tag="MYCTH_2303382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662543.1"
                     /db_xref="GeneID:11512667"
     CDS             join(721073..721181,721340..724771,724833..724918)
                     /locus_tag="MYCTH_2303382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662591.1"
                     /db_xref="GeneID:11512667"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2303382"
                     /translation="MTVSSDAGSKLEPVATMSNSSTPSAASGSAPAGDEAASTIMVNT
                     KTPAAFPPPKTDKPRPHVCGTCQRSFARLEHLKRHERSHTKEKPFQCPECARCFARRD
                     LLLRHQQKLHQTTTPSSRPRNRRESASGATPGAGRVRKNSVAGPSAASGDTAASMRPR
                     ANTISHIDNTAIQMMAAATSPISRMPPTHSRHPSLIGLPTHHGLEAYGMASALAHRGA
                     PLGLPKLETHGINGMDFSGSLRTAPAMPFGSEFDMDGSLFFGGSPGSTINPNALHYND
                     SPPSMAMDPLSPFSHGLPDTSTASQSLDDFDWVTGFDHTMSFNNGPLENAVDGSSPSA
                     LSTTSQSGISDVMVDGSNHHTATTATSSMWQTSIMGPPQMPNPFSLDVSGSVFPDLLN
                     GAPVSPQPSSAKPMGEGYFSTPSPSLLSNLNTQNMNQALNFGAGPETPSSMNGSNHHG
                     TLPVSTITDSTRNAILGALSASQASQFGTRRYSFATSTNPLATARTSSKTASTTGTTG
                     TGAAIASSTDQTTSLPTTQELQRYVGAYLRYFHPHLPFLHVPTLTFEIPAQLLANGRN
                     SDIGGSGCLLLSMAAIGALFELEHQASMELFGMAKKMIQLYLDERRKANVRKAESLRR
                     TPMSDHSSQQQDPPIETPVWLVQAMLLNVVYGHNCGDKRSGEIASTHAAALVSLAQGA
                     ELLRPVRVEPVAKDVEMSDANGAGSWSGSGRDPSEEHAEWLRWKAAEERKRTLYAVFT
                     LSSLLVLAYNHTPALTNSEILLDLPCDEEFFAADSAAAFQAKGGIEAANYNRMTFHEA
                     LGQLLRSNEKQNMRPFTDPHQPFGSAFNASDLPESSLKPSSFGCLVLISALHNYIWET
                     RQRHHNKVWTNEETEKMHRHIEPALRAWHAAWASNPRHSAERPNPHGAGPLSADCIPL
                     LDLAYVRLFVNLSRSKEKFWQRDWDGMAEELAKGSEIVQHAENSPASNAESANTDPSS
                     TPGTASLTVDTPPTQSSSPEFGASKLPVSGNVNPERTQQAPQSSQTQTSNKQSISRRE
                     KHLRKAAFFAAESLSVPDKLGVTFANLTSRELPLQATLCAFDCVQVLAEWVATLQDRV
                     GPYLGILGRDKVDLTQVPAIMLLEEEDVRLLAKIDDIIRGAEIKMSMDMTQVGSNGGV
                     SSVDSKFQVDDNAGYATKLLRVTAYMFDKAAVWPVTRLITSCLETHANHMRARAEKSV
                     VAQI"
     gene            <726090..726967
                     /locus_tag="MYCTH_68404"
                     /db_xref="GeneID:11512668"
     mRNA            join(<726090..726552,726620..726967)
                     /locus_tag="MYCTH_68404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662544.1"
                     /db_xref="GeneID:11512668"
     CDS             <726090..726274
                     /locus_tag="MYCTH_68404"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003662592.1"
                     /db_xref="GeneID:11512668"
                     /db_xref="JGIDB:Spoth2_68404"
                     /translation="MALNLHDFIHKLMANHQPNQELSPHIRMVICSLIATGQSERSLA
                     TLFGVSRHAIHHAIEL"
     gene            727602..728066
                     /locus_tag="MYCTH_2303385"
                     /db_xref="GeneID:11512669"
     mRNA            727602..728066
                     /locus_tag="MYCTH_2303385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662545.1"
                     /db_xref="GeneID:11512669"
     CDS             727652..727882
                     /locus_tag="MYCTH_2303385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662593.1"
                     /db_xref="GeneID:11512669"
                     /db_xref="JGIDB:Spoth2_2303385"
                     /translation="MWTRVRLLLASLIFMFCSFVSAVTGQQPRCIYNGAQRLDDGWLV
                     NDTSLHSSGAFSRSVQVFCEMDRRGQVRQRGA"
     gene            <728307..>729648
                     /locus_tag="MYCTH_50837"
                     /db_xref="GeneID:11512670"
     mRNA            join(<728307..729147,729225..729393,729474..>729648)
                     /locus_tag="MYCTH_50837"
                     /product="bifunctional D12/D15 fatty acid desaturase"
                     /transcript_id="XM_003662546.1"
                     /db_xref="GeneID:11512670"
     CDS             join(728307..729147,729225..729393,729474..729648)
                     /locus_tag="MYCTH_50837"
                     /codon_start=1
                     /product="bifunctional D12/D15 fatty acid desaturase"
                     /protein_id="XP_003662594.1"
                     /db_xref="GeneID:11512670"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="JGIDB:Spoth2_50837"
                     /translation="MTRARGRKATTDGIKTEPVQPSEGPQYPDIQTIRDAIPAHCFVP
                     STWRSLGYVVRDVSMAAALGWAAFTYIPQLESFGWRTVAWMVYGYVQGLVCTGIWILA
                     HEAGHGAFSVHRRLNDVVGWTLHSALLVPYFSWKFSHHRHHRFTGHMGKDMAFVPATK
                     EDRKKRRLADLYLDRELLEDVPAVQLLKLLAHQLAGWQMYLLFNVSAGPDSQQRKASW
                     WRVSHFEPTSAVFRPSEAVYVAITDVGLALVAALLYLASTVVGWKTVFLMYGVPYFWV
                     HHWLIAITYLHHTHPEVHHFDAESWTFVKGALATVDRDFGFVGRHLFHGIIDTHVVHH
                     LFPRIPFYKAEEATEAIKPLLGDLYHREERSFLGQLWSTFTRCKYVEADPAVPGALKW
                     AE"
     gene            complement(730861..734016)
                     /locus_tag="MYCTH_2303391"
                     /db_xref="GeneID:11512671"
     mRNA            complement(join(730861..731328,731387..731395,
                     731571..732499,732569..733453,733554..734016))
                     /locus_tag="MYCTH_2303391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662547.1"
                     /db_xref="GeneID:11512671"
     CDS             complement(join(731003..731328,731387..731395,
                     731571..732499,732569..733453,733554..733819))
                     /locus_tag="MYCTH_2303391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662595.1"
                     /db_xref="GeneID:11512671"
                     /db_xref="JGIDB:Spoth2_2303391"
                     /translation="MTPRAGHGPSTSDQLPQGDEQATEGQSSELASGIRRETTRSTDT
                     GKTDRRGSANRGCQGEQVDGSKLSWLKGAPDKLGLDAATVTAMLRGSLPPTIGIAMLQ
                     SRRVAAYFSTLGYLIPIISVIAMAVMPRGKFMMNLMLNALAVCVGSAVSMLALWSAVR
                     ARQNTAGPASSPAAALAYNSSQSAVCAVWLFANIWFGNVVRAKLPAFNLPAITYSILV
                     NVSATFGSRMPTTAAAQSFVKQLMTAMLTALALAMGVNLLVLPVSSRLVVFKELAGGV
                     GLLRKLFALQKAYIVSLEPDATFDAAMQNDVFLAKSDRDAHQQGSEPKLTKEAESAKA
                     LEDTGAKMRELVGKMHADLPFAKRDVAWGKLDAKHLSELYKLFRNVYVPVLGMNTILD
                     IFRRFSARPDWDGLDGAPDEKDVEKHVWNEVMKQVQEPFDILAEAVDQGLEHAAIRLE
                     LIPKTKKKSGKPGKPGPDPPGAVDLEAAEELKPGNAGFAKVLDEKVQAFYSRKGELLK
                     KWVQERGYNLDEGLAEQSYFRSERDQVQLYIILYMEKLMHAAGEAVQDLVDFADEKVQ
                     DGTMSKKRLIVPTPHRLRKWFKAVFSNEDSSAEEAPDVMETGANLVYFGTEYNRKKDP
                     EHLPPETTWQRFGNGLRKITRFFGSEESAFGFRVACATMTIGIVAFLEDTQHFFLEQR
                     LVWAMIIITIGMTMTSGQSLFGLLCRIGGTIIAMCLSLGIWYIVDEHVPGVIVFLWLS
                     IFINYYFFLKFPRFLPAVMIAIVTQVLIIGYELQVLTIGKEASERSGQPFYPYVCFAL
                     PQRSTA"
     gene            734414..736388
                     /locus_tag="MYCTH_2303395"
                     /db_xref="GeneID:11512672"
     mRNA            734414..736388
                     /locus_tag="MYCTH_2303395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662548.1"
                     /db_xref="GeneID:11512672"
     CDS             734961..735971
                     /locus_tag="MYCTH_2303395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662596.1"
                     /db_xref="GeneID:11512672"
                     /db_xref="JGIDB:Spoth2_2303395"
                     /translation="MPTYYSPPPPTRSSAPVASRSISFSHSAQTRRGSNTTAATTSNR
                     TNPSALEPDKHDRPAAGGYEKKFPYLFLGSIAAASLLAHKHWPKGFPYGEKEDWELSD
                     LALRAKHRRLAEKAEKTEKAARQVARECLRRRERRGGGGGGWCERDCNACDDAAEGLR
                     GRCRGYGRGRGKCYACADETYGHVDDALSWERPRDRWGSSTRSAGSESRDRDRDRACS
                     TCGYSVFSSRRASSRDLADLSMATAAYRPSVPERYLLEQSSSTADVSHPGLRYYLKRS
                     SSITSSNTGSRVLSSTQQSHCDDSRPGEVYVYRDRPTRWRRASSDMSRDGRDVGGYSW
                     DY"
     gene            complement(<736330..>740273)
                     /locus_tag="MYCTH_2061173"
                     /db_xref="GeneID:11512673"
     mRNA            complement(join(<736330..737190,737250..737882,
                     737946..>740273))
                     /locus_tag="MYCTH_2061173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662549.1"
                     /db_xref="GeneID:11512673"
     CDS             complement(join(736330..737190,737250..737882,
                     737946..740273))
                     /locus_tag="MYCTH_2061173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662597.1"
                     /db_xref="GeneID:11512673"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2061173"
                     /translation="MAENAHAADSAAPRPVHPFFAQNRACTSVSIEPTQSDAQALDGT
                     AVLPPNTPAETKTSHDDATQNTDSCRSRRRKADQEPKEEDTQKRTRPSKRTKNVTSGG
                     DIGHLFLKLSNGVEGEKRLRQGNSSSNPSGQDEVSHETNNVAPNDRGGPTNDPDMKPP
                     QIADPSKALITGCVPEPTESPRAAEGTPTKPRKMLHFNPKTGTIGSPPKPKEPRPDAK
                     EAHEIEKMVGRRGRKPASKIVRIVYGTDPNVRVNLGKLIDGILGGKTRHLFTGSKKTN
                     SLNIKQDSPKAGDETPTAKPSKATHPFFLGRTKATNSVATDPKPKKPDPSSSSNTVHY
                     CSTPCSPRKSRAVSASKVPMPQFGVKNLGLKFPGAKLPAWPWQGMVHVRGDVDELPGL
                     ENEPMLVPFRKSKGNAIKMMPRESVISILADSMELPLVAETVRTVNTDEFIPPPPELR
                     LPQKHFESGSKLQSRVLSQLKTFQPSLANRASASETASIRGNHGSMGAPPQLARLFSR
                     ISSSLSAFDMSQCETANWVQKYAPTNATEVLQPEREIFFLRDWLQALMVQSVDTGSGE
                     PDKPKTGQKTKFSDAGRRKRRKKLDGFIVSSEDEGHEWYDLSEGEDDWAPSGFRGIVR
                     KTVMRSSNRLKGRDGDKTANTLVISGPQGCGKTAAVYAVAKELDFEVFEINASSRRSG
                     KDVLEKIGDMTRNHHVQQHHSSEAPNNEDTAADDDDVAKDIKSGKQSTMKAFFEAKTK
                     GRKSKQPAKSQTKGLEAEVKKEPSKSQRQSLILLEEAKRPFIMTCNDETLIPLHTLTL
                     HGIFRLSTPPKDLAVDRLLLIAANEGHALTRESVEQLYDSRGGDLRAATMDLQFWCQI
                     GVGDRKGGLDWFYPRWPMGVDLDDNKEVIRVVSQDTYRLGMNLLGRDPITDSKIPPRL
                     VEEEVLRQIWESWGLDAGHWQDSPEFACWAESLAPVSMTPAGRLPALEAYDDLASAIS
                     VADVCSSKSFAAFKEEPMDTTQPEQPAKIREDFVLGITHLDSPVITHYSGLPTSIACT
                     IKSLAKSSLSLHAGTFGQQAVAILHPLDETQAIRYLQKSFTSTIPGTAVIDRMDFAFA
                     FDPIAAPDPSPLQPVSYLEPSVFDRTLKLITLDVAPYVRSIVAYESHLQKQRVKLSTL
                     VSEGGKGANSSKRMRTTRAALSALEGGSRSTTRAERWFKADINPYLVAKTAGKDWNGF
                     GTRDPEPPNGSTKGSMHNSPQTSPDTTPTKTSKKAGLKSRKRKKVLRDGDYDNDDDAD
                     GLGCPPGDVSS"
     gene            740872..743973
                     /locus_tag="MYCTH_2303398"
                     /db_xref="GeneID:11512674"
     mRNA            join(740872..741150,741204..743973)
                     /locus_tag="MYCTH_2303398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662550.1"
                     /db_xref="GeneID:11512674"
     CDS             join(740965..741150,741204..743813)
                     /locus_tag="MYCTH_2303398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662598.1"
                     /db_xref="GeneID:11512674"
                     /db_xref="JGIDB:Spoth2_2303398"
                     /translation="MAAKLQIHKPYVLQALPQPLDGPNGPGRYLAGEVFGQKQDGKRR
                     KRTELAVAIDGVAVYLYDIISSQAVTSYLVSPQSVFTCAPYSLRWRQASSRTATRYTY
                     VSLSTKSASSSSLKQEIKLFKEETSGTGTTTATPVSRALGCDAPIVHIFASSPRAAMT
                     NLVRDNNSNHDLVLLAADGTILCLNGETLEEKWRASSSVLSKELLIDSKLGLRVDFVQ
                     PTLAADVVDGMFGGRNELFGVFQEKIHRDGFNPDFLVVITASKASQARHLHILALPSE
                     REAQQTGNERLISVFAAPLPAETGCTRYQLDVRAGTLQSLSGGTIATYAFNNGIPRLE
                     NRLQVPALSSFLRLSKTSVLAAAGNEFAVYNPIYRSLQASTPVDPEIGGDDGSAFEFV
                     TYLASREIVVGLRGQNLIAVQIEAPKNRITKRRAEGLLTDAIRRGIPREPPCEKRVRA
                     DHLSSAILAEPLPGSTEASCAEWQAQSAQADEFLRNNDLRSWEKLLAEAFKVPTKSSE
                     SEGEKGALTDGAASTAQLPEWAWPSSRTEYARVDRRWVSYAISKVFTWGEQSHGPDSL
                     RLACQFPESNVLTYLVDAGHLSTSNIKSAFRDEVREVDEVEDIIGKDIPILLAQADPT
                     MQLLLGYLSGTQLGSTELVSSIKLLLRSLGLFEDPSKSLVRLTENGDEMHGQENEAIN
                     MELDRAEEELQITEHYLGGHRTRGLGVAFSKLAACPSAATVQSLRRLFKPEEIIGLMN
                     VLRAELIKDGWTTRYLDRTGADQSEIEAPPDGSIQLIADLMSRCIDSVGLGGWMASDA
                     MLASSRNQEDSADFFSQFQAEVSVALEGIMEAVHLQGALAEAVSYAKRARKALAGLAK
                     GKAVSQPITEELPLGLKTDTRVSTERVRSGGEIVPRSSRQVGHFVSKKRGIYSVHRIS
                     EETLRGGAGATVVQEAR"
     gene            745795..748903
                     /locus_tag="MYCTH_2303400"
                     /db_xref="GeneID:11512675"
     mRNA            join(745795..746704,746790..748903)
                     /locus_tag="MYCTH_2303400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662551.1"
                     /db_xref="GeneID:11512675"
     CDS             join(746051..746704,746790..748604)
                     /locus_tag="MYCTH_2303400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662599.1"
                     /db_xref="GeneID:11512675"
                     /db_xref="JGIDB:Spoth2_2303400"
                     /translation="MTRSEDSPSIESVGAFARQLYRRARDAGTDFVDLAIAIHNLKNA
                     LKHLEAEARDYDSPLYSQADPAASSGTQNSAYSRQLRSLVEDSDFALKQVDTVLGTHG
                     EGPRTSAVGRNLDRGETIRRIDLIRGDIVSQCMKIDIFLDTVQLHGGTKLRPRLGDVD
                     RRQMEVIKNKVDAIANRLFQERNNRYSPVEADEEELWRSFKKELEREGFSPEVLQNNK
                     EVLRAYVRELESHQLPGGSTPPSVRGLLHGNEKPSMTVQSTPYPTDDEEARMNLNPSS
                     RRNEGRRRVPRPERTDSIPLDHAIQQLSFEQSSSSDLSDTESTASANTALISTRDLMA
                     LDRYCDGKVASLTGVGASLLPPARAPFYFVAPGTSPDTRHLPSGTQPLPIPGAVYPGH
                     DGQPVTLPPPYPSALSPGSPPPPYGSSLSASSRDASCDLATLSASALTTGHDLPQPPH
                     LPSRQYSRLAPDSKGQTIPLDATWTKINRKLVSPEVLEEAGVRYEARPSFVAVLGVLT
                     REQIEDYARRSFEVRRARSFPGKTRTRDTERQHGAGRQETYRDYYGRSGAKGGGGRGG
                     GDREAVRRDHEPEPVFDASDISDDEDNGRRRGFGQSRSRGRYTPKNYVPDEHKPLDSE
                     DEEGGKVYPTIVSPPASVDGDSLSPSSTVGPKPILKNKNPNHVRFGRSGPREISPGHY
                     SERPRDRERDRPMPRGRERDRDRYRRDRSRATDRDRNRDHDRDCDWDRDRDRDRDKDF
                     DYRSSLKRHSDRDRDRDRDRDHDRFRDRDRDRNRDRDRDLPRRGEEDRPSRRAALKDA
                     AGAIGVSGAAATLLSVLTQAVTHL"
     gene            complement(<749203..>752997)
                     /locus_tag="MYCTH_2062193"
                     /db_xref="GeneID:11512676"
     mRNA            complement(join(<749203..751875,752030..752143,752280,
                     752516..>752997))
                     /locus_tag="MYCTH_2062193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662552.1"
                     /db_xref="GeneID:11512676"
     CDS             complement(join(749203..751875,752030..752143,752280,
                     752516..752997))
                     /locus_tag="MYCTH_2062193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662600.1"
                     /db_xref="GeneID:11512676"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="JGIDB:Spoth2_2062193"
                     /translation="MAPPPRPLPEGGFKFTHEPSVAALNIPAKSFIAARSLISGAATG
                     ALVFSRATGEDRVLLIQRAAHDSMPLRWEVPGGACDEADETLLHGLARELWEEAGLRL
                     KRVVRQVGDEQVFLTSRGLVVAKVTFEVDVETSEPRAPEMASETAALPEVTLDPHEHM
                     RLNKDAMATPPGTFEALFDSSQPFKGVVVCCTSVPTELRADIAAKTAELGGQHKYDLT
                     PDCTHLIVGDYDTPKYRHVAKERPDVRVMAAGWVEAVRNIWVEDAEIDFFALEKEWQL
                     RTFETGGGEHTADGSEPQRRRLLCCMTGFEDPDERQRIIDKIEANGGLYTGDLTKRVT
                     HLIVHKPEGRKYHAAKAWGITTVSVEWVHDSVERGLILDEKLYDPVLPREERGVGAWN
                     KQRARISSLGKRLRENNAAREEGQRKLRKTASMKLNSQRDNLWGDILGKPQASGAAPA
                     AGPQQTVVQPAAPQPAAIKQLTHPAQPTQPTQPTQLTQPTQPAGGKSVNTQGSKLSSF
                     GVPEDGAVFASSCFYVHGFSAQKTEILVNTVASLGGLICHSLDEVVSMSGAQLAHRFL
                     IVPQTSAPETHPALPNNVYIITEFYIERCMHKKYFFNPSQHVIGRPFPRFPIPGFEDL
                     VICTAGFTGVDLNQVDKSIRQLGAKYEERFTANVSLLLCASLAVVRKQKLELALAWKV
                     PVVRADWLWESIASGTNLSIKQFMFPELKQHVDSPKVLAQAQEKSQGKSNTKSRQEKP
                     SSRDGIDKDLLPKPSTKPGQSRDLDESAFVTARENPQGGPNQRPKEPPTAEHDSSVTT
                     TAHFETAPTHACPTDNASISFGNKTLPSGAPLSETSSNSLNRAPISPRKPGGPAARKP
                     ISRVTSEVADSEATDGDIGQPDDLPAQDDEENTQKPAEQQPEHPEPGAEEKLLEAEEA
                     AAERLAISTKLVTSLLDSATAVPGSAAAPLPRPDGSSDETPGDLGILAKPKRRKRNIL
                     GRAISNVSAASSTSNGDTPTPGAAAGGVATSTTAAARVDPGDAPPAPTQLEYEDPEAK
                     RYKEQLMSKMMGRHGAGSAPVPAAKQEKLTLSEMGGYGMMQQQGLYDAAAGGQRRTRR
                     R"
     gene            754324..756497
                     /locus_tag="MYCTH_2303407"
                     /db_xref="GeneID:11512677"
     mRNA            join(754324..755057,755123..756031,756102..756497)
                     /locus_tag="MYCTH_2303407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662553.1"
                     /db_xref="GeneID:11512677"
     CDS             join(754850..755057,755123..756031,756102..756454)
                     /locus_tag="MYCTH_2303407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662601.1"
                     /db_xref="GeneID:11512677"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2303407"
                     /translation="MAIPVLFSALVLLVALLCCHATAALQQLAHDVGCVHLPVVHSTK
                     VDRFSDKRGIQLQLANRSDVAYYAQLSIGTPPQPVFVQLDTGSFELWVNPDCTTVSGS
                     DAVFCERAGRYDVTKSSTATSLGTNRTLRYGIGAANISYFTDTISLAGSPMMLQDVQF
                     GVATASEDAFSGILGIGYGKGIGTGYPNFVDQLWEQNVTRVKAYTLALGSKDSQEGVI
                     VFGGVDTSKFAGKLARLPVIPPAQSPDGVPRFWVEMKSLSITRPSGLNTVYDGGAMPV
                     FLDSGSTMTLLPANLTMAVARDFGAQAPDANGFYKIDCALTALNGTLDFAFDGVTVRV
                     PYKELTREVASNPPSCFLGIVASDRFTLLGDTFLRSAYTVFDLETDSIWMAPAVNCGS
                     SPAALSNVQDLSAVTGECGVREIAESTSSTQVPSTGVDDTEAGAVPTSTTTVVSQPSG
                     TTTQMGARPTLDNASNPLGAHRLTWVLVITAALHLFTGI"
     gene            complement(756683..757895)
                     /locus_tag="MYCTH_2303408"
                     /db_xref="GeneID:11512678"
     mRNA            complement(join(756683..757335,757407..757895))
                     /locus_tag="MYCTH_2303408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662554.1"
                     /db_xref="GeneID:11512678"
     CDS             complement(join(756865..757335,757407..757808))
                     /locus_tag="MYCTH_2303408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662602.1"
                     /db_xref="GeneID:11512678"
                     /db_xref="JGIDB:Spoth2_2303408"
                     /translation="MSLAGTKRHAANHRSLVARPRAGHDPCSKAVFWKYGSTLRVLRP
                     FKRFRIARGNLERATAGIIVSATKPEVITAAVSGWQANKSRGQNVLDNVKYMKLVQYF
                     TGILKFELPRSCRDNNGPALPEHGGRFYACHVEKKLAVFWLIAALKAVLGTTDLRRAR
                     ELKGAEIPEAWRSAWIFLDHSPCANVSKCWRPGWAVAAYQANIQPPLDSVGHFWTKSS
                     ERPGSRFTWRHGRSSCKATAKVQRGATSACAIGADEGSGASRAQTAPQPAPRNLVLRW
                     KQRAGFQTKRMHQG"
     gene            complement(757897..759549)
                     /locus_tag="MYCTH_2303413"
                     /db_xref="GeneID:11512679"
     mRNA            complement(join(757897..758548,758609..758914,
                     758986..759033,759091..759106,759335..759549))
                     /locus_tag="MYCTH_2303413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662555.1"
                     /db_xref="GeneID:11512679"
     CDS             complement(join(758493..758548,758609..758914,
                     758986..759033,759091..759106,759335..759367))
                     /locus_tag="MYCTH_2303413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662603.1"
                     /db_xref="GeneID:11512679"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="JGIDB:Spoth2_2303413"
                     /translation="MPGGVTVRDVDPHKFVAAYAAFLKRQGKLPVPGWVDTVKTGVAK
                     EMPPQDIDWYYVRAASVARHVYLRKTVGVGRLRKVHGSAKNRGSRPSKHVDASGSVDR
                     KILQSLEKIQVLEKDEEKGGRRITQQGQRDLDRIAQTVAEADEEEAEDDE"
     gene            760523..762528
                     /locus_tag="MYCTH_2303416"
                     /db_xref="GeneID:11512680"
     mRNA            join(760523..761016,761072..761327,761384..762072,
                     762137..762221,762276..762528)
                     /locus_tag="MYCTH_2303416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662556.1"
                     /db_xref="GeneID:11512680"
     CDS             join(760858..761016,761072..761327,761384..762072,
                     762137..762221,762276..762442)
                     /locus_tag="MYCTH_2303416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662604.1"
                     /db_xref="GeneID:11512680"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="JGIDB:Spoth2_2303416"
                     /translation="MVFALFSLLACAALVGATPFRHRVVDSLDEGATAEAHQRDNSTT
                     RAFSNVQIKTSDGKCLFVDGLSGNFRANLTPVQVADCGSTGGQGWDIVTAGRHVKGDN
                     VMLVVNTLTQTCLNFDPRQQAGSQVLLASCGGRAGGEGEVTDSQLFAFSGGAGPLSLQ
                     PRNRVGSCVVVKDGDIEVARCDNSDASQLFTFGDAAGEGGNNTIKINNKNGRNKKGHS
                     SSTCARSTRTVTVLPTQSGESTAAPTTTPAPTAGGGGGEGSAGPGTILTVNPTDPVPV
                     SRAGGILQPTAAAESHQRDATAERAFSGVSIRAPNGQCLFVDPTAGDFRQNLIPVSLV
                     DCTGAPNEKWDVITEGKHNTPNPNRPAALIVSALTQGCISFDGRRQPGDTVTIFSCGG
                     RADGDGETDGNQLFPFIGQTSFAFAPVNEDGKTCILPGDGRLDSGPCPSDGSQLFSIF
                     E"
     gene            763106..764297
                     /locus_tag="MYCTH_2303418"
                     /db_xref="GeneID:11512681"
     mRNA            join(763106..763666,763726..764297)
                     /locus_tag="MYCTH_2303418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662557.1"
                     /db_xref="GeneID:11512681"
     CDS             join(763517..763666,763726..764124)
                     /locus_tag="MYCTH_2303418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662605.1"
                     /db_xref="GeneID:11512681"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="JGIDB:Spoth2_2303418"
                     /translation="MTQLRTRSPDSSSRTFSTSAACRATHAIFNPQVDDDGDEMMLEI
                     TPRAAKRLSEIMTKDSNPNLALRIQVESGGCHGFQYLMKLVTLPPSLPSKESLPPAAE
                     ADDLTTVHEDDTIFTYSPDGSSSPGDLTAPKIILDLPSLQLLKGSKVDFTMELIGSQF
                     KIVDNPLATSSCGCGTSFDIKI"
     gene            complement(<764471..>765483)
                     /locus_tag="MYCTH_2062887"
                     /db_xref="GeneID:11512682"
     mRNA            complement(join(<764471..764930,764987..765153,
                     765340..>765483))
                     /locus_tag="MYCTH_2062887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662558.1"
                     /db_xref="GeneID:11512682"
     CDS             complement(join(764471..764930,764987..765153,
                     765340..765483))
                     /locus_tag="MYCTH_2062887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662606.1"
                     /db_xref="GeneID:11512682"
                     /db_xref="InterPro:IPR000517"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="JGIDB:Spoth2_2062887"
                     /translation="MSDYVLTLTCRTVPTQNDVLVPETLLKKRKSQEKARAERAAELE
                     KRKKANKEKRGVIFKRAEKYVKEYRDAEREKIRLARLAKQDGSFYIPAEAKLIFVIRI
                     KGINKIPPKPRKILQLLRLLQINNGVFVRVTKATAEMIKIVEPWVAYGYPNLKSVREL
                     IYKRGYGKVNGQRIALTDNSIIEENLGKYGIICMEDLIHEIYTVGPNFKQASNFLWPF
                     KLSNPTGGFRPRKFKHFIEGGDLGNREEHINALIRQMN"
     gene            766217..767495
                     /locus_tag="MYCTH_2303426"
                     /db_xref="GeneID:11512683"
     mRNA            join(766217..766402,766460..766482,766536..766567,
                     766684..766841,766906..767495)
                     /locus_tag="MYCTH_2303426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662559.1"
                     /db_xref="GeneID:11512683"
     CDS             join(766315..766402,766460..766482,766536..766567,
                     766684..766841,766906..767057)
                     /locus_tag="MYCTH_2303426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662607.1"
                     /db_xref="GeneID:11512683"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="JGIDB:Spoth2_2303426"
                     /translation="MAPPKRAARPAQENISLGPQVREGELVFGVARIFASFNDTFVHV
                     TDLSGRETICRVTGGMKVKADRDESSPYAAMLAAQDVAARCKELGITALHIKIRATGN
                     GTKTPGPGAQSALRALARSGMKIGRIEDVTPTPSDSTRRKGGRRGRRL"
     gene            complement(767495..770783)
                     /locus_tag="MYCTH_2303429"
                     /db_xref="GeneID:11512684"
     mRNA            complement(join(767495..769147,769204..770195,
                     770245..770783))
                     /locus_tag="MYCTH_2303429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662560.1"
                     /db_xref="GeneID:11512684"
     CDS             complement(join(767885..769147,769204..770195,
                     770245..770590))
                     /locus_tag="MYCTH_2303429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662608.1"
                     /db_xref="GeneID:11512684"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR008904"
                     /db_xref="InterPro:IPR008905"
                     /db_xref="JGIDB:Spoth2_2303429"
                     /translation="MSRFFRGGDDSSTESSSDEEELYTTSEEEEEEDQEQEESSEEEE
                     EDESTDEDEGPKKTGLSRFLVDQAESESEESDEEGTTKVKSAKDKRYDELEATITSIQ
                     NRQKIDDWGSIATEFDKLNRQVVKLLDGGKAPKSYIKCIAELEDFLNETLAKQKVTPK
                     NKKLNATNARGLNAVKQRIKKNNKDYQDQIDAFRKDRDAFMESSDEEEAPLPKPSKVR
                     FEQEAAASEEAAEDEDKGFSRVDKRGKAVPFSPESIQKHLRAIIESRGRKNTDRLEQI
                     RIMEELNKVAETPYLKIRVLQTLVSARFDLGSGTTTSMPLGHWKAAERELAALLTLLE
                     THKDHVVIEGAEEWEDDDKTPVLGPDDKYIKVPGSVVSYIERLDDELTRSLQNIDPHT
                     SEYIERLTDEASLYNLVLRGLLYYETVRKDPSLEVPQESLNRIIQRRLDHVYFKPSQV
                     VKILEENAWKQVQDGVDSAITPRGLSGDAGQLIHTLCNYLFNNSEGIIRARAMLCQIY
                     FLALHDEYYKARDMMLTSHLQESIANFDIATQILYNRTLVQVGLCAFRKGLVYDAQNT
                     LQDICGSGRQKELLAQGVMIQRYSQVSPEQERLEKQRQLPFHMHINLELLECVYLTCS
                     MLLEIPLLAQIGSSPDIKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQASKALAA
                     GEWKKATHFIHSIKIWDLMPSADEIKAMLAKQIQEEGLRTYLFTYAPFYDTLAIETLS
                     TMFELDSAKVAAVVSKMISHEELAAALDQVTNTVIFRKGVELSRLQSLALALSDKASA
                     LIETNERTLEVRTQGSANAFSGKDGRQGGQRAGGQRSGRSGARTGGNAQRQAGGTQFT
                     GGALGAAVRG"
     gene            771130..778839
                     /locus_tag="MYCTH_2303431"
                     /db_xref="GeneID:11512685"
     mRNA            join(771130..776011,776135..778839)
                     /locus_tag="MYCTH_2303431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662561.1"
                     /db_xref="GeneID:11512685"
     CDS             join(771365..776011,776135..778612)
                     /locus_tag="MYCTH_2303431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662609.1"
                     /db_xref="GeneID:11512685"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="JGIDB:Spoth2_2303431"
                     /translation="MSSYPPPPPPPGWGPPPPPPTPPPPGPPSSLPPPPAIPAPPPPG
                     YRPPTDPQIAKFAQKKKEWLRSQRNRFGEKRKGGFVETQKADMPPEHLRKIVKDIGDV
                     SQKKYTSDKRSYLGALKFMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNEIPR
                     VIEPVFFAQWATMWSTMRKEKRDRRLFKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQ
                     MDLDEEEEAAVYEWFYDHQPLLDTPHVNGPSYKRWNLTLPQMANLYRLSRPLVSEVVD
                     PNYFYLFELKSFLTGKALNVALPGGPRFEPLYKDIDPNDEDFGEFNAMDRIIFRNPIR
                     TECRVAYPYLYNSLPRSVHLSWHSHPQVVYHKTEDPDLPAFYFDTDINPISSRAVAPK
                     NIAVSHEDELFGQGNIEEPEDEAFELPATVEPFLADEELATEDTASAIELWWAPYPFD
                     RRSGRMVRAQDVPLIKHWYLEHCPPKQPVKVRVSYQKLLKTYVLNELHKKRPKSMQKQ
                     SLLRTLKQTKFFQQTTIDWVEAGLQVCRQGFNMLNLLIHRKNLTYLHLDYNFNLKPVK
                     TLTTKERKKSRFGNAFHLMREILRLTKLIVDAQVQYRLGNIDAFQLADGILYAFNHVG
                     QLTGMYRYKYKLMHQIRSCKDLKHLIYYRFNTDAVGKGPGCGFWAPAWRVWLFFMRGI
                     IPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRASVMADLMDMMPEGIK
                     QNKVNTVLQHLSEAWRCWKSNIPWKVPGLPAAIENIILRYVKAKADWWISVAHYNRER
                     IRRGATVDKTVAKKNVGRLTRLWLKAEQERQHNHMKDGPYVSSEEAVAIYTTTVHWLE
                     SRKFSPIPFPSVSYKHDTKILILALERLREAYSTKGRLNQSQREELALIEQAYDSPGT
                     TLERIKRFLLTQRAFKEVGIDMNDNYSTINPVYDIEPIEKISDAYLDQYLWYQADQRH
                     LFPAWVKPSDSEVPPLLVYKWAQGINNLDKVWETANGECNVMIETQLSKVYEKIELTL
                     LNSLLRLIMDHNLADYITAKNNVTLTYKDMSHVNSYGMIRGLQFSAFVFQYYGLILDL
                     LILGPQRASEIAGPPQNPNDFLQFQDRETETKHPIRLYTRYIDKIWVFLRFTADEARD
                     LIQRFLTEQPDPNFENVIGYKSKKCWPRDSRMRLMRHDVNLGRAVFWDLKNRLPRSVT
                     TIEWEDTFVSVYSKDNPNLLFSMCGFEVRILPKIRNQNDEFPVKDSVWSLVDNTTKER
                     TAHAFLQVAEEDIQKFNNRIRQILMSSGSTTFTKIANKWNTALIALFTYYREAAVSTV
                     NLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELGGLGMISGSHILIPASDK
                     RWSKQTDVGVTHYRAGMSHEEETLIPNIFRYIVPWEAEFIDSQRVWTEYSQKRLEANQ
                     QNRRLTLEDLEDSWDRGLPRINTLFQKDRSTLSFDKGFRARAEFKIYQLMKSNPFWWT
                     SQRHDGKLWNLNAYRTDVIQALGGVETILEHTLFKATGFPSWEGLFWERASGFEQSMQ
                     FKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFLHGKIPTLKIS
                     LIQIFRAHLWQKIHESVVMDLCQVFDNELEALSIESVQKETIHPRKSYKMNSSCADIQ
                     LFASHKWNVTRPSLLFDNKDVIEATTTSKFWIDVQLRYGDYDSHDIERYVRAKYLDYT
                     TDSMSLYPSPTGLMIGIDLAYNLYSAYGQYFPGLKAVVQQAMAKIMKATPALYVLRER
                     IRKGLQLYASESNQEFLNSQNYSELFSNQTQLFIDDTNVYRVTIHKTFEGNLTTKPIN
                     GAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQLI
                     VTRKGLLDPLEVNLLDFPNISIRASELQLPFQAAMKVEKLGDMILRATEPQMVLFNLY
                     DEWLKSISSYTAFSRLILILRALHVNQDKTKLILRPDKTVITQDHHIWPSLSDEDWIK
                     VEMQLRDLILNDYGKKNNVNVSSLTTSEVRDIILGMEISAPSLQRQQAAEIEKQQQEQ
                     QQLTAVTTKTQNVHGEEIIVTTTSQFEQQTFASKTEWRTRAIATSNLRTRANNMYVAP
                     VDSDVDDITYVMPKNILKKFITIADLRVQVAGYLYGSSPADNDQVKEIKCIVMVPQIG
                     GLRNVQLPQHLPQHELLKDMEPLGLIHTMSGNELPYMSAMDVTNHARLVDAHPTWNEQ
                     TTLTVAVSFTPGSVSLSAWALTPQGYKWGAENKDLGSDQPQGFSTTMGERRQLLLSDK
                     FKGFFLVPDNGKWNYSFMGSAFGGLEKKAIHVKLDTPLPFYSDQHRPIHFSSFNELED
                     IWVDRQDNFA"
     gene            <783874..>784786
                     /locus_tag="MYCTH_50303"
                     /db_xref="GeneID:11512686"
     mRNA            join(<783874..784285,784337..784570,784650..>784786)
                     /locus_tag="MYCTH_50303"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662562.1"
                     /db_xref="GeneID:11512686"
     CDS             join(783874..784285,784337..784570,784650..784786)
                     /locus_tag="MYCTH_50303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662610.1"
                     /db_xref="GeneID:11512686"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_50303"
                     /translation="MPPQHYTPTHHPHPILTDPAHLAGHPSARHLGHPGPSHFGAGPS
                     PHAVVTPLYQPLTPTHGHTGGVKRSRPDDLDLSVPGMPVLEHSNLEPMQQTPLGAAYA
                     QAPAPPTHHHHRLPDTGPPSKLMRREGDSSGGGGGGGAPSMVGQAGMPPPAPRPKGPK
                     LKFTPEDDQLLIDLKENKNLTWKQIADFFPGRSSGTLQVRYCTKLKAKTTQWTEEKDQ
                     KLRTALQDYENEKWRIIANKVGTGFTPAACRERAAQLSGESL"
     gene            complement(788528..789193)
                     /locus_tag="MYCTH_2303434"
                     /db_xref="GeneID:11512687"
     mRNA            complement(788528..789193)
                     /locus_tag="MYCTH_2303434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662563.1"
                     /db_xref="GeneID:11512687"
     CDS             complement(788627..788836)
                     /locus_tag="MYCTH_2303434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662611.1"
                     /db_xref="GeneID:11512687"
                     /db_xref="JGIDB:Spoth2_2303434"
                     /translation="MAAQWGPDMRGRIPLSLTPSDRVPCILSLPLVPLPLPPPPPGGS
                     RSDTPAFLVRDTDACEEKSRKAPIQ"
     gene            791795..794145
                     /locus_tag="MYCTH_2303435"
                     /db_xref="GeneID:11512688"
     mRNA            791795..794145
                     /locus_tag="MYCTH_2303435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662564.1"
                     /db_xref="GeneID:11512688"
     CDS             791847..794051
                     /locus_tag="MYCTH_2303435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662612.1"
                     /db_xref="GeneID:11512688"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_2303435"
                     /translation="MLHKPVIVVAPATVLRQWVNEFHRWWPPLRVSILHSSGSGMFNV
                     RDEGEIEDHVDDWEEKKPRKSSAAARKIVDRVVKQGHVLVTTYAGLQTYGDVLIPVDW
                     GYAVLDEGHKIRNPNTAITIYCKELRTHNRIILSGTPMQNNLTELWSLFDFVYPMRLG
                     TLVAFRNQFEIPIRLGGYANATNLQIMTAQKCAETLKDAISPYLLQRLKVDVAADLPR
                     KSEQVLFCKLSQSQREAYELFLKSEEMAAILNRTRQSLYGIDILRKICNHPDLLDPRL
                     KGKPGYKWGDDSKSGKMAVVKSLLPMWKRLGHKTLLFCQGVQMLDIIEAFVQRLDNIK
                     YLRMDGKTPVKQRQLLVDQFNNDPELDVFLLTTKVGGLGVNLTGANRVIIFDPDWNPS
                     TDVQARERAWRLGQKREVTIYRLMTAGTIEEKIYHRQIFKQFLSNKVLKDPKQQTTFN
                     LSDLHDLFSLSSYEDGVTETSEMFKGSDVKNFKRSGPKELIVPGHDAVPLRPRQVGAN
                     KDADEKEGDLRKIDGVAGLETYEDPSAPPSNEEDRLLEGLFASSNVHSALEHDEIING
                     KKTVKADRKLLQQEANRIAAQAALSLRRAGEQARRVPIGTVTWTGEVGEAGRPTNIRR
                     GRGGPSSATILAGVANRQGLGSGSPGSSRPGTPGAADQNLRAKDFEKMIPEFIKRHNG
                     QVPSKLLVDHFNRYCSGSRQADEFKLALGKVAKMEKRGSSMRAIWTLKPEYQ"
     gene            794464..795530
                     /locus_tag="MYCTH_2303438"
                     /db_xref="GeneID:11512689"
     mRNA            join(794464..794886,795002..795530)
                     /locus_tag="MYCTH_2303438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662565.1"
                     /db_xref="GeneID:11512689"
     CDS             join(794689..794886,795002..795484)
                     /locus_tag="MYCTH_2303438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662613.1"
                     /db_xref="GeneID:11512689"
                     /db_xref="InterPro:IPR012312"
                     /db_xref="JGIDB:Spoth2_2303438"
                     /translation="MPQDTASDAAGTPATVEMGPANDKPAPNQAADSASVPEQAAKPA
                     LAPLTPQEFRIYNRLAEQMDYFHDHFRQMYATLHTACTTNRRPANMSLKQFVDEGLRL
                     ARYLEMHHSIEETHLYPLLGRKMPEFRASSSPAGTGKGGGKRGKKEECELLRQHQIIH
                     DGMDEMADYLRRCKDKECELDLGVLRSKVEPWGDVLLKHLDQEVRELGAEKMRKYYTL
                     QEMKAFPI"
     gene            797201..798943
                     /locus_tag="MYCTH_2303440"
                     /db_xref="GeneID:11512690"
     mRNA            join(797201..797406,797651..797920,798022..798297,
                     798359..798943)
                     /locus_tag="MYCTH_2303440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662566.1"
                     /db_xref="GeneID:11512690"
     CDS             join(797693..797920,798022..798297,798359..798721)
                     /locus_tag="MYCTH_2303440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662614.1"
                     /db_xref="GeneID:11512690"
                     /db_xref="JGIDB:Spoth2_2303440"
                     /translation="MSVKIERDTTLKEAVRDAVLDHTANKGGLVGSAAAAISEAAHGQ
                     LPGTSGKHPISAVVGTALTGGRKNAGTKGYLAAYLQQLEDHPLRTKMLTAGTLAGGQE
                     LLASWLAKDRNKHGNYFTSRVPKMAAYGAFVSAPLGHFLIWLLQKIFSKRTSLRAKIL
                     QILFSNLIIAPLQNAVYLVAMSLIAGARTFRQVKATVRSSFWKVMRVSWITSPICLAF
                     AQNFLPENTWVPFFNLVSFVIGTYINTITKKKRLAALRKKHFGEGRTPGGSTIGGPRP
                     DDYPPLGPNPPY"
     gene            complement(<799612..>800553)
                     /locus_tag="MYCTH_2109793"
                     /db_xref="GeneID:11512691"
     mRNA            complement(join(<799612..799942,800093..>800553))
                     /locus_tag="MYCTH_2109793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662567.1"
                     /db_xref="GeneID:11512691"
     CDS             complement(join(799612..799942,800093..800553))
                     /locus_tag="MYCTH_2109793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662615.1"
                     /db_xref="GeneID:11512691"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="JGIDB:Spoth2_2109793"
                     /translation="MSRKGVGLAAFDRSRLTSAQYASHGSTLRSANAQALETQLAVFR
                     SLLQQFAQTHAKDIRSNPTFRAQFARMCAAIGVDPLASSSSSSSSSAGGGGSIWAQLL
                     GRSVNDFYFELAVRVVEVCSETRGENGGLIELKKVRERIMRGRMEGASEITEDDILRA
                     VGTLKPLGSAYSIITVGSKPYIRSVPKELSTDQSAVLEAAQLLGYVSVSMLMVNLKWT
                     RARAQTALEDLMAEGMLWVDKQSEEWEYWSPGFMLENQDFAGTTG"
     gene            complement(<801253..>802623)
                     /locus_tag="MYCTH_2062214"
                     /db_xref="GeneID:11512692"
     mRNA            complement(<801253..>802623)
                     /locus_tag="MYCTH_2062214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662568.1"
                     /db_xref="GeneID:11512692"
     CDS             complement(801253..802623)
                     /locus_tag="MYCTH_2062214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662616.1"
                     /db_xref="GeneID:11512692"
                     /db_xref="JGIDB:Spoth2_2062214"
                     /translation="MISSQVGHAEATGAGGLHGSRDGAPPRPAHLEKGDIFRTVGLPE
                     ELTIGLDAMAMTTNKSLQGFREIPPGTHFLWIQLPGGVSRSGCWFITGSRGLLRVKEW
                     DKYNEILGEPASSSGDARSQQDSLESIYSALKPYALHAHRDKSWTPMDNKDPIWARTP
                     GSLWSILTSAVSRQALVRITGKPDAQDYLVESTDGAKDDRPLAGQPPAGSGLNLLFTQ
                     DFRDLQVLDQGSMRDRVADTSSRIQSRLTTADQNSRITERDILADLQFTFLTGTHLSN
                     SACLEHWWNLVFKMLLRAYGLVLSHPRLVRDFLTVLYAQLFYTEHYVASSSSQPDHQD
                     EADDKGKKHGPSSDRAIFQYKPQYRGRLRQVLAEYRRRLNSLLEGLRGSTTPDQEAVG
                     RAFEDLEAWLWRKGWDLREGEGKPGSGGIRAVTAPDSEDEEDEQPVVVELDEQGREVG
                     LLSFSD"
     gene            complement(<806071..808174)
                     /locus_tag="MYCTH_2138805"
                     /db_xref="GeneID:11512693"
     mRNA            complement(join(<806071..806099,806162..806515,
                     806628..806800,806941..806944,807019..807465,
                     807526..808174))
                     /locus_tag="MYCTH_2138805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662569.1"
                     /db_xref="GeneID:11512693"
     CDS             complement(join(806071..806099,806162..806515,
                     806628..806800,806941..806944,807019..807465,
                     807526..807559))
                     /locus_tag="MYCTH_2138805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662617.1"
                     /db_xref="GeneID:11512693"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2138805"
                     /translation="MERAAPEYSQSDPASAAQYATQPEARSASYSNSATPTSEYSVYP
                     TTSRSATFPDMQRSYHPASNPPGSGGGMPQTPTSPSMPLPDGRSHQNPQPEQAKSDSA
                     LPIDPSIAGASPTYATHSQYPPYAAPPPDMSQGYQHPGTPGLYTQPRPDWGGYGQQPA
                     SSFVPIPGAQQHKRPRRRYEEIERMYKCGYNGCEKAYGTLNHLNAHVTMQGHGAKRTP
                     DLFKDIRREWKAKKKEEEARKAAAAEEERQRQAAAAAAAAAAAQNGGNTDPQTGVEAA
                     QPPTSYPGSGTVQLPPIGYQPARYAGPPPAGMQQPIPEYNNYPSYSPASPYGQSNQQM
                     YNTHNGGQPPSH"
     gene            complement(<814802..815537)
                     /locus_tag="MYCTH_2303448"
                     /db_xref="GeneID:11512694"
     mRNA            complement(<814802..815537)
                     /locus_tag="MYCTH_2303448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662570.1"
                     /db_xref="GeneID:11512694"
     CDS             complement(<814906..815374)
                     /locus_tag="MYCTH_2303448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662618.1"
                     /db_xref="GeneID:11512694"
                     /db_xref="JGIDB:Spoth2_2303448"
                     /translation="MLGWGSGKPGLSSPFSLSNPPLPFPLTNQGQGSRPLSNALLVAV
                     AIAWKVPFVSFLTRATCVYFLGSTTVLVDLQHPIFLLLQLQSLPGIASGPCAAIEWGS
                     DQPAHGWQHCLLYIICNAYGRAKGAHQTKNVSCLALQRRHAKASADSKEGVSIL"
     gene            complement(817983..820654)
                     /locus_tag="MYCTH_2303449"
                     /db_xref="GeneID:11512695"
     mRNA            complement(join(817983..818149,818213..818362,
                     818419..818547,819039..819146,819208..820328,
                     820449..820654))
                     /locus_tag="MYCTH_2303449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662571.1"
                     /db_xref="GeneID:11512695"
     CDS             complement(join(818091..818149,818213..818362,
                     818419..818547,819039..819146,819208..820328,
                     820449..820540))
                     /locus_tag="MYCTH_2303449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662619.1"
                     /db_xref="GeneID:11512695"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2303449"
                     /translation="MSSYGGGYSRGGGGYSSGYDRNGGGYSNGYSGSNGYSGGGGYSG
                     GGYGGGYGGGGYGGGYGGGGDRMSNLGAGLQKQHWDLDALPKFEKSFYREHPNVAARS
                     AAEVEKFRRDHAITVSGRDVPKPVETFDEAGFPRYVMDEVKAQGFPAPTAIQAQGWPM
                     ALSGRDVVGIAETGSGKTLTYCLPAIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQQ
                     EITKFGKSSRIRNTCVYGGVPKGPQIRDLQRGVEVCIATPGRLIDMLESGKTNLRRVT
                     YLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTCMWSATWPKEVRALAADFLTDFIQVN
                     IGSMDLAANHRITQIVEVVSESEKRDRMIKHLEKIMEDKETQNKVLIFTGTKRVADDI
                     TRFLRQDGWPALSIHGDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLN
                     YDYPNNSEDYIHRIGRTGRAGAKGIAITFFTTDNAKQARDLVSVLQEAKQHIDPRLAE
                     MARYGGGGSSRYGGYRGRGGGGYRGGRSQGINGPNAMPIGNRRW"
     gene            complement(821065..823970)
                     /locus_tag="MYCTH_2303459"
                     /db_xref="GeneID:11512696"
     mRNA            complement(join(821065..821339,821446..821525,
                     821606..821802,821858..821876,821936..822044,
                     822109..822177,822231..822381,822455..822614,
                     822775..823189,823329..823411,823486..823667,
                     823778..823970))
                     /locus_tag="MYCTH_2303459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662572.1"
                     /db_xref="GeneID:11512696"
     CDS             complement(join(821301..821339,821446..821525,
                     821606..821802,821858..821876,821936..822044,
                     822109..822177,822231..822381,822455..822614,
                     822775..823189,823329..823411,823486..823667,
                     823778..823830))
                     /locus_tag="MYCTH_2303459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662620.1"
                     /db_xref="GeneID:11512696"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="JGIDB:Spoth2_2303459"
                     /translation="MAPGRVLVIAGSDSSGGAGLEADQKVIAAHGCYAMTATTALTAQ
                     NTKGVYDIHLVPPEFLRKQIDAVIEDVGVDVVKTGMLASAETIETIADALTHHSVSTV
                     VLDPVMIATTGAQLLPPEAIHVLQSRLLPLATVVTPNIPEALFLLRQSDAGPAADIGA
                     VSKIDDLEVIGQAIRKLGPKWVLVKGGHCPLRKDGTVAETEEERETVVDVLVGEDSAT
                     GKEIVVRLESEYCASRNTHGTGCSLASAIASNLAKRMEIPAAVRAGCRYVQAGIRSAP
                     GLGGGNGPLNHFHSVYSLPFSPGYFVNYLLERPGVAPVWDRYINHPFVLAMGNGTLPI
                     ESFKGYLMQDYLYLQKHFARANALASYKASAMKDIAASAAIVTHIFKEMELHIGYCRG
                     FGISKEDMENTEEHPACTAYSRYVLDIGQSQDWFALQVAIAPCLLGYGAIAKQLHADK
                     RSKREGNVYWTWIENYVADDYVAAVKAGSELLERHAVLQSPSRIEELVGIFIHATKME
                     IAFWEMYKSR"
     gene            complement(824283..>829344)
                     /locus_tag="MYCTH_2138808"
                     /db_xref="GeneID:11512697"
     mRNA            complement(join(824283..827801,827956..829079,
                     829234..>829344))
                     /locus_tag="MYCTH_2138808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662573.1"
                     /db_xref="GeneID:11512697"
     CDS             complement(join(824393..827801,827956..829079,
                     829234..829344))
                     /locus_tag="MYCTH_2138808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662621.1"
                     /db_xref="GeneID:11512697"
                     /db_xref="InterPro:IPR000861"
                     /db_xref="JGIDB:Spoth2_2138808"
                     /translation="MWGTVDSRFVHRPSASRRGSGVVQPAAQTELANNQPGGIQTPTR
                     LSYPDVDASTAEPTGESNANSGSVARVESLERGGQMAGPSTMLSTSATPTPRPQASQQ
                     QQQQQQQQQQQQQQQQQQQQQQQPGNPRPSLERDALQPTAPNGGRNLSASAVNFASRG
                     PSLNPSPMPGSFSSELRSQANLSRAATRPDMFPALEKLDEDGDQSQETTIAHLREALG
                     REMKIKEGSENMLEALNSKKAKQTKEQRQRVEAELHSSNQRIKELRQKLTDAQRVRAA
                     PTTPTQATRGDGLFPGASSLRSPPSASRSGAGSDVDEPTESPTFALTEILEALDVEGM
                     TPDYYVSRANSLVDLFKRHPTLKYDLAWSVFGLRMQAMLLSESREVVAAGYRMIRYAI
                     SDINSIRNIRALNTDYLVTWAVVRAIAAAAEEPEERLRPICLETLAEILVRDPRLLVA
                     SGGMGPLHEALADGSYKASESLTAAFLYLLDTPHRRKYLRPGHELEILFTAFTDELSS
                     NERFLKQAVKSVASALRTWSGLMSLSMYNFRAIRSMITSMVVQAGPIRESIMDLIFSL
                     LRIKPPAWATSFLAGRRLTTYGRVANLRSTNTKSAQPEFEEDGGEQNFVEHYTALLLA
                     VFIKSGLIPALLKLTQNNESATLRRKSTLLIGEVLKLASRLLPPSWSSELQLLPDLFI
                     SAARLKEEDHFTATGVVYQISSVSRTLYRSSPSAYLPSTHHHMDPNALDEHPKASTAT
                     NFDDGTFRQLLLESNVLSSSNYTKWNWDVMTRLIEGPLTSGKRLEEAIKASKFIKRIM
                     SFYRPFKYKFSETKSSRNTQKYVRTGCSLMHALLQSPEGVKYLSDNKLLRQIAECLAQ
                     CDPTSGLTAQEPMFSKDRLADTLCGGYFPMLGVLSADVKGMQMLDRWRIFNMLYRILD
                     LKQRPDLIKLMLSNFDYSLQGHPRVLLSKALTAGTKEIRIYATNALRKYTTHPRVGPH
                     GSEASDSRWAIQLLVTQLYDPEIEVCATAVKILEKACNTKNNLEYIVECRPALDHLGE
                     IGAPLLLRFLSTSIGYHYLDGLDYISNEMDDWFLGRNDSYVSVIEASLARAFMDHQDD
                     TTNRISVFDEQQEMEADSHVPPHFYRELTRTMEGCKLLSEKGHFDEFAATIREYGMQS
                     DDPEMMVKVKGCLWAVGNVGSMELGAPFLELSDVVEQIVKIAQNHEVMSMRGTAFFVL
                     GLISRSTHGLEILSENGWDSNTNMLGHSLGLCIPSDLSQLFSLQPWEHVPVTAIDLPD
                     SQKTETVKLPAVPSRPRSESLIKALQEAEQQQQQQQQDEGGAVGGDGPGLLPPRVELD
                     PDPTNHRILELVIDMSNMVLYRRARSELMQIKMQRRAAGFSQPQLFRKVMSLLESHHY
                     RLVDRNMIVGLFDKSVLRAVVYGEDKSPDGSGTRREDSEDGDDSEEEEEEDDDDDEDE
                     DEDEREEKGKEENVAVRGQSGRESESKADEEDGQEAEKEGGEDEEGDEEEEEEDEDSD
                     GDDDEESDDDDDDDNQKEEREESSGDEQRTERQRSVSEPADTKSQRVMRGYSR"
     gene            830717..833167
                     /locus_tag="MYCTH_2315024"
                     /db_xref="GeneID:11512698"
     mRNA            join(830717..830965,831071..831720,831857..832896,
                     832973..833167)
                     /locus_tag="MYCTH_2315024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662574.1"
                     /db_xref="GeneID:11512698"
     CDS             join(830829..830965,831071..831720,831857..831984)
                     /locus_tag="MYCTH_2315024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662622.1"
                     /db_xref="GeneID:11512698"
                     /db_xref="InterPro:IPR002042"
                     /db_xref="JGIDB:Spoth2_2315024"
                     /translation="MPNLASARYGKDNVRVCKVQRDEKTGFHTVTEMTVSCLLEGQIE
                     TSYTAADNSVVVATDSIKNTIYIKAKEHPVNPPELYASLLGQHFLDKYPHISTAHVNL
                     AVHRWTRLEVDGAPHPHSFYRDGQETRNVEVAVSRGPGGIRIKSSIVGLSVFKSTGSA
                     FHGFVRDEYTTLPETWDRILSTDVDCSWTWKPFDTVEAVQQRVERFDKAWESARGIIL
                     RLFAVEESPSVQNTMYKMSEQILEAVPEVDRVDFALPNKHYFELDLSWHKGIKNTGKD
                     AEVYVPQSGPNGLIKCEVARDETTLAHR"
     gene            <833803..>834986
                     /locus_tag="MYCTH_2117900"
                     /db_xref="GeneID:11512699"
     mRNA            join(<833803..833826,834024..834153,834225..834302,
                     834427..834866,834915..>834986)
                     /locus_tag="MYCTH_2117900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662575.1"
                     /db_xref="GeneID:11512699"
     CDS             join(833803..833826,834024..834153,834225..834302,
                     834427..834866,834915..834986)
                     /locus_tag="MYCTH_2117900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662623.1"
                     /db_xref="GeneID:11512699"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="JGIDB:Spoth2_2117900"
                     /translation="MAVTTPFQTLFAVPMTCDGCAKDITGALYKLPGISKVEANVKDQ
                     LVSIEGTAAPSAIVEAIQATGRDAILRGSGASNSAAVSILETYSKKPDEEVTPAGTPG
                     ESWVNQRLVRGLVRMVQVSPNDTLVDLTVRGVPPGTYRATIREYGNLQDGASSTGPVW
                     GAQDEKSGAAPARGVLGTVQVGPNGYGNTFINRPFQVWEVIGHALVVSRQDESDGAPL
                     QNQEDTTVCSCTGKTLWEERRDEVAKGML"
     gene            838752..841222
                     /locus_tag="MYCTH_2303473"
                     /db_xref="GeneID:11512700"
     mRNA            join(838752..839018,839088..839237,839330..839665,
                     839727..839891,839950..840819,840879..841222)
                     /locus_tag="MYCTH_2303473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662576.1"
                     /db_xref="GeneID:11512700"
     CDS             join(839004..839018,839088..839237,839330..839665,
                     839727..839891,839950..840819,840879..840899)
                     /locus_tag="MYCTH_2303473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662624.1"
                     /db_xref="GeneID:11512700"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Spoth2_2303473"
                     /translation="MSLKQEIETWVEALKYYDNNEFDEALKTFDRIADTSKILFNMGV
                     INATLGQHEQAVECYQRAIKLDQYLAVAYFQQGVSNFLLGDFEEALANFNDTLLYLRG
                     NTLIDYSQLGLLFKLYSCEVLFNRGLCYIYLEQMEAGMQDLQYAVKEKVVEDHNVIDD
                     AIRDEAKGYTVFSIPVGVVYRPNEAKVRNLQQKDYLGKARLVAASDRSNAFTGFAGAE
                     LSKAVSAEPKDDRPAESISFAASNLVKPGLQSRRQQSEPPNNRNVFPPTPPPESDKAA
                     SVSRAQSVRNGPKPVPSRLNLEKIRSNERYEKASPDEGRPRPTRSASAAPSRGFTQRE
                     PPPRRRRDDDEDAYPDDVYDMYSGAGSRSSRSQRSAGGRTRDRYIEEEDEDGSDYDDA
                     SFDEGEFEMVSNNRRAGPGSVMSGGSRRGSSRRDVLRTVRVKVHADDVRYVVVGPAIE
                     FPDLVDRIRDKFGLRRKFKIKIRDDDSPQDMITIGDQDDLDMVMQTVRQNARKQRTDT
                     GKMEVWVQEI"
     gene            complement(<843425..844558)
                     /locus_tag="MYCTH_2315027"
                     /db_xref="GeneID:11512701"
     mRNA            complement(<843425..844558)
                     /locus_tag="MYCTH_2315027"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662577.1"
                     /db_xref="GeneID:11512701"
     CDS             complement(<843444..844414)
                     /locus_tag="MYCTH_2315027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662625.1"
                     /db_xref="GeneID:11512701"
                     /db_xref="JGIDB:Spoth2_2315027"
                     /translation="MDPSGATGGPSQAQPRPRKRARTARASEAGNAAAGCPLAPVPQA
                     TQGWGHHSQTVRAPVDTVPTQQQQPPFPSQQLDRSHQHQVADADGLMNGYSGVPQHTQ
                     YPDPQSTLAPATQPDSSGLSSLSALAGDHQHQQHAQQGQQHHQAQQQQQQQQQQQQQQ
                     QQQQQQQQRGANKPDRIIFQHQYGAPHPGSNSSPTSVANPSSASAGYNIPQWTVPDTN
                     TAPQQQQSSAPSSSSMPPQSPALGSSAGLAPPPEGIYRSFDDLLSSVQRTAKEQGYSI
                     VKLRASNYRDGKPTRYDLVCDRGGVKYSSTAKKRNPSTRKVDCPWRA"
     gene            845037..845769
                     /locus_tag="MYCTH_2303475"
                     /db_xref="GeneID:11512702"
     mRNA            join(845037..845355,845436..845499,845551..845769)
                     /locus_tag="MYCTH_2303475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662578.1"
                     /db_xref="GeneID:11512702"
     CDS             join(845227..845355,845436..845499,845551..845762)
                     /locus_tag="MYCTH_2303475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662626.1"
                     /db_xref="GeneID:11512702"
                     /db_xref="JGIDB:Spoth2_2303475"
                     /translation="MANNANNSNPSLSLKQPPAAKDSAEEEQQLEDMLARLDEVHLQL
                     RQLRSALPRMLEPLTVKQPSPQAAFAAFMQSVNNTNKEVANFQEAYYSLITDGLFQRA
                     RPGQKSPRSLKQWRATEHPDWADPDKKRRRVV"
     gene            846265..847335
                     /locus_tag="MYCTH_116020"
                     /db_xref="GeneID:11512703"
     mRNA            join(846265..846352,846443..846566,846852..847335)
                     /locus_tag="MYCTH_116020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662579.1"
                     /db_xref="GeneID:11512703"
     CDS             join(846315..846352,846443..846566,846852..847040)
                     /locus_tag="MYCTH_116020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662627.1"
                     /db_xref="GeneID:11512703"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="JGIDB:Spoth2_116020"
                     /translation="MAPSRVTYRRRNPYNTTSNLTRIVKTPGGKLRVLHIKKRGTAPK
                     CGDCGVKLPGIPALRPREYAQISKPKKTVQRAYGGSRCGNCVRDRIVRAFLIEEQKIV
                     KKVLKEQSQAEKKK"
     gene            848032..849532
                     /locus_tag="MYCTH_2303480"
                     /db_xref="GeneID:11512704"
     mRNA            join(848032..848881,848979..849532)
                     /locus_tag="MYCTH_2303480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662580.1"
                     /db_xref="GeneID:11512704"
     CDS             join(848158..848881,848979..849181)
                     /locus_tag="MYCTH_2303480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662628.1"
                     /db_xref="GeneID:11512704"
                     /db_xref="InterPro:IPR007523"
                     /db_xref="JGIDB:Spoth2_2303480"
                     /translation="MATPSTPLRLSVPASRALSSATARRAFFSSSSQRTPTVPLPTTC
                     RVHRQPALLSNNKYNNNNNSSSSSSSSSTSSSSGCCRKPSCNSYSPIIARAIHTTRPA
                     NRQRRPLAHNREEVPDQPPPTDFGQLDVLGSLPVPATAVVACRDDGFSLHSGVHIRGG
                     SGALLVGGEAFAWRPWELPPRRGDGEAASSSSSSSSSSSSSAAAAAGGTTKGGRAGLV
                     NAKGQWEVAEEAFAVLGAVWPRPDLLILGLGPEMRPLSPATRRAISNLGMRVEVLDTR
                     NAASQYNMLATERGVDDVAAALIPIGWKDGAR"
     gene            complement(849466..851833)
                     /locus_tag="MYCTH_2303482"
                     /db_xref="GeneID:11512705"
     mRNA            complement(join(849466..850044,850115..850866,
                     850932..851418,851519..851833))
                     /locus_tag="MYCTH_2303482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662581.1"
                     /db_xref="GeneID:11512705"
     CDS             complement(join(849826..850044,850115..850866,
                     850932..851418,851519..851635))
                     /locus_tag="MYCTH_2303482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662629.1"
                     /db_xref="GeneID:11512705"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="JGIDB:Spoth2_2303482"
                     /translation="MSKPQSANGSESEFEFIETPKAPTPTFEKVEDCGVRTTSYPTIK
                     NAPLPAEGAGTESFSNKLLFSILGGVPLYLSWKLGGGLKTALFLALFTTLPLLAAFWL
                     IVSTVSPRKNEKARLPGRPVEHYLTFKNPADRAKYHGRNKIPMETFHEMYFDGDVDFN
                     GDALEVLEYRHDWASFRFTFGLIRFFLTGMMPEVIMHTRSQDEEQVRDHYDRGDDFYG
                     WFLGPRMIYTSGIIGDINREETLEELQDNKLAAVCEKISLKEGERLLDIGCGWGTLAR
                     FASVNYGAKVTGITLGRNQTAWGNNALRKVGVPEEQSKILCMDYRDIPVPEGGYNKIT
                     CLEMAEHVGVRHFKSFCKQVYDMLDDDGIFFLQIAGLRKSWQYEDLIWGLFMNKYIFP
                     GADASTPLGWFIDKFEGAGFEVKAVDTIGVHYSATLWRWYRNWMANKDKIEAKYGKRW
                     FRIWEYFLAYSTIISRQGSATCYQIVLHKNINAFHRIEGVPTQYGLNGSTRATKADMK
                     AWAEANAADFPLVPAH"
     gene            complement(852112..853812)
                     /locus_tag="MYCTH_2303486"
                     /db_xref="GeneID:11512706"
     mRNA            complement(join(852112..852655,852727..852894,
                     852958..853256,853323..853812))
                     /locus_tag="MYCTH_2303486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662582.1"
                     /db_xref="GeneID:11512706"
     CDS             complement(join(852377..852655,852727..852894,
                     852958..853256,853323..853647))
                     /locus_tag="MYCTH_2303486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662630.1"
                     /db_xref="GeneID:11512706"
                     /db_xref="JGIDB:Spoth2_2303486"
                     /translation="MAEEEDRDPLSPLPPVPHHPATTSSPDSSPLSSVLPSPERYLDL
                     REQSESILRNYKRVDPSDDTTHVLEAFLKRLSKEGQMNLMTDLVSVPDKLRELRDFLV
                     AAVLKPMKMAGGHPPNIPDSPPCDAIEESLRTIHPSSRDDQVDLKDKCRGRDGFRCVL
                     SGLYDFNRAKEQRYPEEGSKTQLPCDSLECAHILPFALRKFEENKPVEKRNKAWIWWA
                     LRRYFPFIQGKIASDSINKPENAITLAHVLHVSFGNFWLALEPLGAYRRRTYEGGFKL
                     VGTEFIPEIITFQQHDDSVPMPDPDFLRLHFQVAEILDVSELSWKIDVASREGTRMRC
                     DIAPDGSTDIAFAIRTKMLMDI"
     gene            complement(853813..854977)
                     /locus_tag="MYCTH_2303488"
                     /db_xref="GeneID:11512707"
     mRNA            complement(853813..854977)
                     /locus_tag="MYCTH_2303488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662583.1"
                     /db_xref="GeneID:11512707"
     CDS             complement(853978..854919)
                     /locus_tag="MYCTH_2303488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662631.1"
                     /db_xref="GeneID:11512707"
                     /db_xref="JGIDB:Spoth2_2303488"
                     /translation="MSEDQSRSSRIAIQLGKPSASSPNGIKKRTRPTHVRRHRAHTLH
                     EDSESGEDSDRDQRTYGHQEAITSYDILGTSPDDGKARRRNDSVGLESGATKTQKNGA
                     EASQQKEEDSIDSKDGSKAGISGLQEKPVKWGLNINLKGAGRNSAGETGGSETRTGRP
                     DVEGASGPNGTDAKSIDDEALDALMGSRIPKRRHVDSDAADREPRAEDYRFVPVDDFG
                     ARLLRNFGWDGKMRGKVKEVTRHANLTGLGAKDAKGAEDLGAWNQKPAKDSRPVRLSD
                     YRREENKKRQRIEDRYADSYKRERERERERERERERG"
     gene            856369..861277
                     /locus_tag="MYCTH_2303490"
                     /db_xref="GeneID:11512708"
     mRNA            join(856369..857237,857406..859618,859684..861277)
                     /locus_tag="MYCTH_2303490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662584.1"
                     /db_xref="GeneID:11512708"
     CDS             join(856991..857237,857406..859618,859684..860895)
                     /locus_tag="MYCTH_2303490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662632.1"
                     /db_xref="GeneID:11512708"
                     /db_xref="InterPro:IPR006562"
                     /db_xref="JGIDB:Spoth2_2303490"
                     /translation="MRASGDAGGATLTQNPSTVDPARQPDLLSSPDSTAQSMLTPAVH
                     DASANTSPNSDAPQDLESGVETPKEKTGGHGTEKEDLNEAAQESTLGIGDTHEQHDGT
                     AAARVGRHLPDKVQPSVSAGSSGRFDDTGPNGQGKWDQGATTSMNIDKADGTATESQK
                     HAEVDSAQASRNGTACSSIPPHSVGSSNTAEKSMFESPMPGPSTTPAELSRQVSADAN
                     RPRGTGDEAASPRASSSQLVLHANKARDRRRRSTPTVIFGKQPKRPKPSEDGTVIVSQ
                     KPGYIPTDDYFTPLFIEGFTRQSTWMKPIEKLINQAHKTLSTSDQYISMLDHQACKIL
                     RRVYHLQQHDKWSLRQPVRCPEPTRPASHWDVLLQEMKWMRTDFREERKWKRAVARNL
                     ARACAEWVHSDPATRSLLQVNAVIPPRPVDAGTNGNKVERSEAEDGLPDLIHTDSPTN
                     DEDELPEPLDCVAPSAIFALPDDEVVFGLQPSKTAELLLQNLPLHGSPLMVPKFDVSS
                     TNYDPDAKWKRPAVPLSKYVEGEMVLANRGPPRKRRRYDYLAEEEDDDEDEIIFGDET
                     DNGAELQAENTSVALFSPEMKPIRDRLHAGHQFRPPTEHPMPPQSFFESRTASQWTLA
                     EDEQLKTLVRECSYNWSLISAMMSTSSLFASGAERRTPWECFERWVSLGSLEGLPNDM
                     ARTPYFKAYQARIDAAQRAIAQQNQNAQQQVGPNGAVAPIPRRRPTTSFRVERRRNQK
                     HLALIDAMRKLAKKREATAQKAQQAANLAAMRKANEVPRQQIQNKTPRDYSIMRWERD
                     QALAERMAAYAIRQADANARRLQKQNLPGQVPGTPGVVPGPQAAAQIAAANSLNNAAR
                     LNVPGQLGMPGQNRTPGRVSMPATAGAVPAAVQARIAAGGLVPPLQMASMQQAQLQAM
                     QAAQRLPMVNPQPDINLMLQARSIQNQQRAAIQQLQQQQQQAQQQGHPDQQHQQQQQH
                     QHQHQHQHQHQHQHQHQQHQQHQPQHQPQQQQQQQQQQQQSQHFQPQQQQATTQQHQV
                     PPQQVPQQQQINQQAQQLPQANGTQGSPPLRSVVNGLNQGAFLTNAQAMMASFGATNG
                     AGLATSPGANLSMPAVPGRSPGGILSQHITQRLAELEAHYRAKNPNLPPETVRQLATE
                     HLGRMIVQSQQQAAMNAAAGAVAQQPMNSPHQYASLLRAQQQAQAQQAAQQAAQVSQQ
                     QAGQHQRQTNASATPAPGK"
     gene            861279..863001
                     /locus_tag="MYCTH_2303493"
                     /db_xref="GeneID:11512709"
     mRNA            861279..863001
                     /locus_tag="MYCTH_2303493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662585.1"
                     /db_xref="GeneID:11512709"
     CDS             861375..862907
                     /locus_tag="MYCTH_2303493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662633.1"
                     /db_xref="GeneID:11512709"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2303493"
                     /translation="MAKRKREAAQDGDHAEAKGSTKKTNASAKTPRSTAFKLDRDAPV
                     TIQIIAGSYDRVLHGVTATVKPAMAVESAEKSKKKANDSSPLPKRQQQQRVEFADTFL
                     FNAHNSAIRCLALSPPSAPAPGQSQKVVLATGSTDERINLYSISAHPPSARAADEQKL
                     LSSLAPRPILENPKNRELGTLLHHTSNITRLVFPNRSKLLSAAEDSTIAVTRSRDWTL
                     LHTFKCPIPKPTGRPSGDTAPLGGTPSGVNDFAVHPSNKIMISVSKGERCMRLWNLET
                     GKKSRVLNFERTALSELGEGKHSTGEARRIVWGSSRGGEDEFAVGFDRDVLVYGMDCV
                     PKCRLMGDIKTKVHEFRYVETDASREETVLAVSTEDGRVLFFSTATEDLAEPPRDKTL
                     RVAKLVGRLGGKEAGVSGRVKDFSVLPVEDEDGRRSFFIVTASSDGRIRLWHLDAADL
                     DASGQTPRQVGKLLGMYETQNRITCVAAFVMIPRPQGVEESEYEFESDESEEDSDDED
                     EE"
     gene            864522..866231
                     /locus_tag="MYCTH_2303494"
                     /db_xref="GeneID:11512710"
     mRNA            864522..866231
                     /locus_tag="MYCTH_2303494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662586.1"
                     /db_xref="GeneID:11512710"
     CDS             864706..866157
                     /locus_tag="MYCTH_2303494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662634.1"
                     /db_xref="GeneID:11512710"
                     /db_xref="InterPro:IPR009904"
                     /db_xref="JGIDB:Spoth2_2303494"
                     /translation="MDGKPGEDGAGTTGPKIIRPIPRRPFNLALSSPTPPEEDDDYPS
                     PQPRISASDLRFLAPHQQQHAATPGSASGDGSTPLSHTTSYLNLTSSTLRGIYSPSTL
                     ASFTKGEDELDQEDEDEDEDQDNYLRDSDRPNDGDALPGLSARRSSLHPATRSSASSA
                     AAAAVTAASSPPVRKREVALQLVLRAALLFVLGVGYGVLVTRLPQNSHHQHHPSRRLA
                     AAYESHCEWRYLVFWGVAGVALGSLLPWFDRFWEERAQPSSSSSSSSSSSSSSSSSSF
                     SCPSSMARAEHADADAPVTSKPSLTSPPQTDWALVIRGIGAFVGIVFAIRRLPWASTM
                     QVSLTLALANPFLWYLIDRSKPGFLLSAAVGLGGAALLMGLDPEVMPAPTAAAAAGGG
                     GWAAAVRDRLRGGGGINADNTTAPGGAVPDGAGRDAAGGVLLGGLASRETIETGIWML
                     SVLFCSCVCFGNIGRRLALSSSAAGRGRWGGVR"
     gene            complement(867284..869792)
                     /locus_tag="MYCTH_2303495"
                     /db_xref="GeneID:11512711"
     mRNA            complement(join(867284..868453,868508..869263,
                     869330..869792))
                     /locus_tag="MYCTH_2303495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662587.1"
                     /db_xref="GeneID:11512711"
     CDS             complement(join(867341..868453,868508..869263,
                     869330..869599))
                     /locus_tag="MYCTH_2303495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662635.1"
                     /db_xref="GeneID:11512711"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="JGIDB:Spoth2_2303495"
                     /translation="MPAAIVDSHGILGVAAAGAFLNDLLARAESVKKTNSIEPPLEKS
                     DLGDLERQLSDALGYEVSADESADTKKIQRFALIETAARDIFKTLIATTPIESPAFVN
                     VWNLLDILSLLSDCELCDPALLFWLVEELLDSQTIAGCRKVFDFLESRRERITAKHFK
                     QKQLVILRTCNELLRRLSRALDPAFCGRVFIFTFQSFPLGDKSSVNLRGEYHVENVTT
                     YDQEPQPTDGERMDVDTDATPRKDKPMDPDALYPIFWALQESFNQPKKLFDPSHFAAF
                     KAGLEATVTTFCTINPEKPSRAKEKLDKPDDDAKPSLKRKRDDVDDELANSFNPKYLT
                     SRDLFKLEISDLAFRRNILVQALITLDFLLSLSPKAKEKLASVKTPNKSVTYSDQQLS
                     EEDTKWATQMRGSITRYLQRGVDGPFFERMVGTVLVRDKNWVRWKIENCPSIELPPMS
                     PQQFDEARATATRMARTRRLPNDSRSLEFLGDEDETSAMEKLQDPERYSLPELSSFRD
                     AIDDADFDIERATDDESKALAMESKASKAWKALRLASKTKLVVFDKIDDDDKIDVIFK
                     DKPVEEAEVEEVAANGEAVYPDDRRAIVIVDRTTSPGSRSELVKQFTAEHARVFTRVP
                     PHVTRKPQEGEVNGKDYHFVDVQAFNVMRDGDLFLEFSEEGDNVHGTNKRVVEGILDN
                     DRVPILEVDRDVSVFHSPQISAASETDKVL"
     gene            870061..874443
                     /locus_tag="MYCTH_2303498"
                     /db_xref="GeneID:11512712"
     mRNA            join(870061..870412,870471..870571,870621..874443)
                     /locus_tag="MYCTH_2303498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662588.1"
                     /db_xref="GeneID:11512712"
     CDS             join(870135..870412,870471..870571,870621..874237)
                     /locus_tag="MYCTH_2303498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662636.1"
                     /db_xref="GeneID:11512712"
                     /db_xref="JGIDB:Spoth2_2303498"
                     /translation="MPPAKRVKSSADSRPNAESSKRPTVEDLEGESEFASLARQHWLK
                     ATPKHASKAQAKVKVKNDVLKREIWDVLEKDNFPIKSLLVLEGLQTLESYLWPGYGED
                     SSNYHVLLIILIVNAKRRERLETWDIFADRPADFSDLFRRALSLTLDDSLTWTIRTHV
                     LLFIIHAFQSLDCAIVRKECAPLVSISIWHNLSTEEKRVAILEANPQLKKAWRASTKR
                     YDSADDATKSRLRFERSWLYTLVLDFLALLYTANPKPEHLLYCERFVELLTDLLSQLP
                     TRRYVNTLLQDMHVLPALTLSPIYNDEGSGLLREMCALFSHYTHFCVDDYSGAQLSLI
                     EAYDRHCGALARLQRTALKHFKEKLTLLALSNFGSIDKRSGLESLLQPLTDEELAQLT
                     QHLGLRTTYPDSAKIPVDRKFLMEVLLSTFERRKTFQEAARDLSVLPTEEELFDASLR
                     RTDHYDGARPVALPKLNLQYLSVGDFLWRALILYRCESFYAIRQDIEDVLARLKPESK
                     RGGVTTFSGFSRMALPIAKPTILEVVPPRVGQDKPSLVRAEVTIDLKRLSPQVRREWE
                     SLRSDDVLFLVAVDASRSRQSANGREPQSEAEKLGLVAVRAAEVLQVLDDKGRAIRDV
                     NAYFDGHGRSDSRRIHLGLDAAAYKADTEGKRNVYDGINLLVRRSGRENNFKPVLESI
                     RDLTLSDVPLAPWLHEVFLGYGDPAGATYKHLPNRVRTVDFRDTFLNWQHLVESLPGK
                     IVEPSDDVSGSFGPPYVLETIEKQPEDAVSKPSKKRRRDAEPALIAEIETVHVSTYKP
                     PNNGPYPVDAPKLNKVRFTPTQIEAIISGTQPGLTVIVGPPGTGKTDVATQIINNIYH
                     NFPEQKTLLIAHSNQALNQLFAKIVALDIDERHLLRLGHGEEELETEASFSKHGRVES
                     FLENRQRFLLEVSRLAASMGAPGAHGNSAETAGYFNSVYVEPAWAKFNDTVKSEEVGP
                     QEIVQAFPFHAYFADAPQPLFPPEADRETVLEIANGCYRHISKIFSELADVLPFEILR
                     RDKDKANYLLTSEARIIAMTSTHAAMRRGEIASLGFHYDNVVMEEAAQITEIENFIPF
                     AMQKPKDGRPGLQRVVLCGDHYQNSPIIQGLAFRHYANLEQSLFSRLVRLGVPTINLD
                     QQGRARPSISNLYRWRYPHLTDLPHTKTEEEFLTANAGFKFEYQFINVPDYKGKGETE
                     PSPHFIQNLGEAEYAVAIYQYMRLLGYPASKISILATYAGQKALIKDVLAHRCAKNPI
                     FGLPRVVTTVDKYQGEQNDCKSRCPSRLIDHRFERKKEGKKKTNMPFSQTSSSLSRAP
                     PASATSVTSVA"
     gene            878041..883160
                     /locus_tag="MYCTH_2303499"
                     /db_xref="GeneID:11512713"
     mRNA            join(878041..878772,878833..879261,879625..882612,
                     882670..883160)
                     /locus_tag="MYCTH_2303499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662589.1"
                     /db_xref="GeneID:11512713"
     CDS             join(878167..878772,878833..879261,879625..882612,
                     882670..883056)
                     /locus_tag="MYCTH_2303499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662637.1"
                     /db_xref="GeneID:11512713"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="JGIDB:Spoth2_2303499"
                     /translation="MTSTASQQNQNPAQTPAAPAAAPSYASAAGANKKPTSSPLIATG
                     SQPPVVVGSSTPASQNGKPSAATPMNNRPNITPAVPVTTPPVARGSSVVNGGADHARK
                     SSVTISANAPAGHIANGGSAGGPKGIQFGFNESPAIAHSTPQMGGAAPIPIPGSGNPR
                     IPSPAHSPSPIPQVPQQSGGGQRAPSIPPAPVTFGSFPGDNDRHMKQHNPVAMGQSPH
                     TRRDSQASAHGDGVGHGGPAHGRGGYQGQGRGRGNFNPQYNNSNMGYPPNRNFSGPNG
                     GRGGMPPYHQGRGGMQQFPNSPQPPRASPATTPAMPHVTPTMQPAALAAGAQPYHYPG
                     MNPAIPPYAHQMQMGAPYGMPPPMDTYRMNYQYPPQPMNHYMPQPSQFAPGPHQAFVP
                     PYGPGQPAAQPMSRNASQVSDRPASSTGQAQQAPAAAQGTPQQRPAQAAPAIVSSPAF
                     SRPKKSAAIVIKDSEGKVVDLTAAMKTPASPAPAVQPSKTPPAIVSTPTPPPKSSTPS
                     HGRTDSTTTGKTAEEVRTEFMNLVRKQADSAPSSDGKPKEDEATKSAEGKAAADKAAG
                     EKANEEKAAAEKAAAEDKAKEDARLEEEKKAAEETKAAEEAKAAEEAKAAEEAKAAED
                     ARAAEEAKAAEEAKAAQEAKAAEEAKEKEKEKAEADAKAKADAEAATESAKASKPKAE
                     KSPDEMDEEELERIIREMEEEDARREREQEEISARKKAQQEEEQKRAEALRLQTAAEN
                     DRKLREQEAEMERLEEERERRRREEEAKGNHVSVAELLSKPMSALKLSDKEPSEKTGA
                     ASDATTGTKTGTSDKTKSKPAALNLAPLKTTPVEAPQPSAALQSLRSARFLPGVEHNI
                     YPPGIASPNPALNAAVQKKGKIFRYDAQFLLQFQHVFTEQPSLEFHQQVKALIGDSDG
                     SRSASARTPGAGSGRQGSRAGASSAFPSGGAFGQFGASKTLPAGTTSEQRFAMSQGNV
                     GRTATGSIGGFSRGGAFPGQMSRTPSSNAAGLPSPRTDSRRGGSRKFGNAKQSEAQAA
                     KTMPLTHGQEVKPITISATGWKPTSIGNKAAQNPTAVLNNGGHLDPEMVQRKVKAALN
                     KMTPDNFDRISDQILTIAGQSKNEPDGRTLRQVIQLTFEKATDEAHWASMYAKFCKRM
                     LETMSPEIRDESILDKAGNVVSGGALFRKYLLNRCQEEFERGWKVDLPKPKEGADKKA
                     TEAALLSDEYYIAAAAKRRGLGLVQFIGELYKLGMLTERIMHECVRKLLEFTGVPDEA
                     EIESLTKLLRTIGGNLDSTEKGRAFMEAYFNRIESIINLEGLPSRLKFMLMDVVDLRK
                     AGWVSKEANKGPKTLEEVRAEAEAAAALKAAESARNSQRGAPGGRPMGGRGESRNFSY
                     NNAAPNHVGIDDLRRLKGSSSRTSSQNPSFGPTSMFNSRSNSGRARVGGPGGAFGRAG
                     EDSGASSRTGTPPVRDRDSVAHANAFGYVGPLT"
     gene            complement(<884559..>889267)
                     /locus_tag="MYCTH_2061829"
                     /db_xref="GeneID:11512714"
     mRNA            complement(join(<884559..886325,886441..888729,
                     888792..888895,888976..>889267))
                     /locus_tag="MYCTH_2061829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662590.1"
                     /db_xref="GeneID:11512714"
     CDS             complement(join(884559..886325,886441..888729,
                     888792..888895,888976..889267))
                     /locus_tag="MYCTH_2061829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662638.1"
                     /db_xref="GeneID:11512714"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="JGIDB:Spoth2_2061829"
                     /translation="MPKASKRDKFAEFRALRQAGKKKFDTYEVEDAPTLYEEVDEDQY
                     KKIVRARLNEDDFVVDDNGEGYADDGREEWDRVQTYYDSESDDAVPVRGKDRKSKKQR
                     DDEQAKRDANDRDISEYFMKGAAKAQSKPKVIKTEDDQKFIDDLLEEVDANVVPMPVS
                     RISKKRDRSAERRKTRPLSPPREARQPAPKKTKMLDGSASSPLASDVAMIEDDFVPPA
                     AVEDEPAAPVDVVMSDPAPSSPAATAAERRTQPKVDADEYDNDDDDDEMIEVAHAGAV
                     AAASVNLSASKQIKNVTKPDPPPKSSSPVRAPESAVDASSWNGINEKLNVISSSQPEA
                     RSLGKIDYKDAIEEDGSLNMYWTDYTELNGSLCLFGKVLNKKTGRYVSCFVKVDNILR
                     KLYFLPRKHRVRGGVETTEQVEMMDVYQEVDAIMTKMNVQMHKIKACTRKYAFELPDI
                     PAEAQYLKLLYPYTKPPLELGTKGETFSHVFGTNTSLFEQFVLWKKIMGPCWLRIEDA
                     DFGALRNASHCRLEVLVEHPNMIAPIGESESEDAPPLTLMSIALRTMFNAKENKQEIL
                     AISARIYEDVSLTDTTPADKLPCRTFTIVRPQGNAFPLGFEKMARERRKGLIKLMKQE
                     SDILSFFLAQVDLVDPDVILGHQFEGVDYSILLNRLYEKKTHQWSRLGRLRRSAWPSS
                     IGKVGGNVFAERKVMAGRLLCDLANDAGKSVMFKCQSWSLTEMCSLYLSGDNRRQDVD
                     NEHALKTLATSKEGLMDYLTHAETDTYFIAALALRTQILPLTKILTNLAGNSWARTLT
                     GTRAERNEYILLHEFHNQKYICPDKQPLRGRGRFDEENQEEDGGEGQKKDKYKGGLVF
                     EPEKGLYDKFVLVMDFNSLYPSIIQEYNICFTTVDRTSVSGDEEGVPPVPTVKEEAIL
                     PKLIRRLVERRKVVKGLMKSPNATPENIATWDIKQLALKLTANSMYGCLGFTKSRFYA
                     RPLAVLTTFKGREILRSTKELAESLNLQVIYGDTDSVMINANVDNMRDALKVGSEFKN
                     QVNKRYQRLEIDIDNIFRRILLQAKKKYAAINMVEVNGKYIDKMEVKGLDMKRREYCP
                     LSREVSTRILDEILSGEDTEVSVQRIHAYLREISGKMREQAIPPAKYIILTQLGKAPK
                     EYPNADNMPQVQVALRELARGKTLRKGDVVSYIITGDSKTTSEPAAKRAYTPQDVLKP
                     DSGLTPDVEWYLGKQIFPPVERLCANIVGTSTAQLADNLGLDVRRYVNNGASSSSSSG
                     GKHDHEIHPLESQIPDAVRFRDCARLTLRCRSCKASAPFEGLVGSADRVTPSGVSCPS
                     CKAILPTLSIVAQVESAVRAQTARYYEGWLVCDDSSCGNRTRQMSVYGSRCLGPKGLG
                     RGCTGRMRYEMSERDMYNQLLYFASLWDVDRALKRVSASADGGGGGGGGEALPPGELR
                     DNVVALADHNRTRFSTVKGVVEKYLEKCGRQWVAMDTLFSKLGLMVA"
     gene            889693..892302
                     /locus_tag="MYCTH_2303507"
                     /db_xref="GeneID:11512715"
     mRNA            join(889693..890439,890504..892302)
                     /locus_tag="MYCTH_2303507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662591.1"
                     /db_xref="GeneID:11512715"
     CDS             join(889906..890439,890504..892150)
                     /locus_tag="MYCTH_2303507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662639.1"
                     /db_xref="GeneID:11512715"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Spoth2_2303507"
                     /translation="MFVCRGCLRSLTSSRGTRIRSSRLLSHPQIATTSVSGRRAYTAN
                     GPSLDQRRAVEDAIRAAQQHPSPKESKPSGAQSPGDNDGDLAYDNVNTKGDEYGKQKY
                     EKKLEASVRKVLRLTTDPYHIAQHVAKVLEKGRFDEALMTTRMASRNNKVEVSWNHLI
                     DYLMKNHRLHAAVKLYNEMKKRAQIPNAKTYTIIFRGCAESPHPKLAVSEATRIYNFM
                     IKYGPLKPNTIHMNAVLEVCARAGDLESLFTVLATCNGSMRSPDAHTYTIVLNALKYD
                     TSKVGSANLGLIDAEVKREIQKNIHRARAIWSDVIANWRSAKMIIDEPLVTAMGRVLA
                     MGDYKDNESVLELLEQTMKIPRFDKPNVKLPDVSADAGADAAKLPVPEGQTVEAGNMS
                     PKDRKALANSRADKSPLYAKPGNKTLSLIFNVLAATRRTSSAGKYWSYFTNVLKVTPD
                     QYSYNWYLRVLTTGHASGQVAELVASMPTTLLTPLTFRRGFTACIRDNLNRHAFKHAC
                     RIFEVMITTQRYPDALAMRLFLQVARGSTRHFYESSPKQQQQQEQQQKQQERSDHHQQ
                     QQQQQQQQQTPGLPEPQKEGALTGKAGHGAQIITALSYMWEPFRILTGSLSYPEAATR
                     SPQEELDRKRGPMQEISATARRMIAGIDRVTNEEGMADREAVKLWRARRIVLQKLLER
                     YMRIMYPGGSAAQEEKERRTVLEEEERYERSSPRQAAGEASSSP"
     gene            complement(892304..892936)
                     /locus_tag="MYCTH_2303508"
                     /db_xref="GeneID:11512716"
     mRNA            complement(892304..892936)
                     /locus_tag="MYCTH_2303508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662592.1"
                     /db_xref="GeneID:11512716"
     CDS             complement(892463..892906)
                     /locus_tag="MYCTH_2303508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662640.1"
                     /db_xref="GeneID:11512716"
                     /db_xref="JGIDB:Spoth2_2303508"
                     /translation="MQPAPQTPKRHQLVSPDRSPPSSPAEIIVSPSTGGSEADPSSPS
                     SLTLSGSTIDSSPVVTPQSPSGSASPSQASVAAAEIDDVVESDRDEDEENLEEAIGGQ
                     YVGARGWANEGQPRFVERGRRGVVVDELVRGMARTRVVSPAGGLV"
     gene            complement(<893115..>893867)
                     /locus_tag="MYCTH_2059769"
                     /db_xref="GeneID:11512717"
     mRNA            complement(<893115..>893867)
                     /locus_tag="MYCTH_2059769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662593.1"
                     /db_xref="GeneID:11512717"
     CDS             complement(893115..893867)
                     /locus_tag="MYCTH_2059769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662641.1"
                     /db_xref="GeneID:11512717"
                     /db_xref="JGIDB:Spoth2_2059769"
                     /translation="MSSSRDFVGLAEQASLQTSRSRQSITASLRYKASYFLSRGGTIN
                     TTTSNDNDNNSTTAYNNPQTFQPHPLKGTRGWFRSVGARFHRHSHATLESSESSHDIQ
                     LELEENSHITNLPSSSETTSSRSQPARRRPFRGRLRLHSLPARFRRRGDSRFSRPSSL
                     SDSDKENFLAMTVPPARSRMVSNAGSWSSFRSGVQRAVRGKSGLAAHLSIKMLKQESR
                     SGGWQLSLLRGPFLTQSVFRRHLHTMHTQHLC"
     gene            complement(894523..896132)
                     /locus_tag="MYCTH_2303512"
                     /db_xref="GeneID:11512718"
     mRNA            complement(join(894523..894970,895061..895633,
                     895699..895823,895890..896132))
                     /locus_tag="MYCTH_2303512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662594.1"
                     /db_xref="GeneID:11512718"
     CDS             complement(join(894728..894970,895061..895633,
                     895699..895823,895890..895953))
                     /locus_tag="MYCTH_2303512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662642.1"
                     /db_xref="GeneID:11512718"
                     /db_xref="JGIDB:Spoth2_2303512"
                     /translation="MATNGNNSGKVAVDLERMIHEARDRRKNEELAAKIFGKGRRSST
                     PASKATAAGSLASRAGVKKQRAEPATRPRHSTGNIDGEWTHDLHETQARGPKAGGKAS
                     GSGAGSLAARITDPNAPLTGPASHKRQTRRAAQVAQALIRSELQQSQGQQRRADETAP
                     INGAIPTEPRAMAKPATTFNKGITIRGLAGPFVVMAQNFAPGTTAADIESAMTPVGGI
                     ITSCRLVKQHPIVIAEIVFESKEGADNVIATFNNQTIGNTPSIPPTQTATRPPPDNDV
                     VMDGSYGFDDPMDADLNTGRQPPTGPAAGVGGGLYSDSLVSANRRGRGFSRAGRFGGR
                     "
     gene            complement(897311..900894)
                     /locus_tag="MYCTH_2303514"
                     /db_xref="GeneID:11512719"
     mRNA            complement(join(897311..898216,898281..899019,
                     899075..899234,899291..899490,899553..900894))
                     /locus_tag="MYCTH_2303514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662595.1"
                     /db_xref="GeneID:11512719"
     CDS             complement(join(897420..898216,898281..899019,
                     899075..899234,899291..899490,899553..900338))
                     /locus_tag="MYCTH_2303514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662643.1"
                     /db_xref="GeneID:11512719"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2303514"
                     /translation="MEQWQAYNDPAGAGGPRRYNGSTGNQMSPRDFGSSGQNPAQQPP
                     AGFKYDNYQGGLNPHQTTSSAASPMSSPHLRDGNGDVPMQDSHDSYGSLSTSAKYPMR
                     PHHQHHLSSGRTANLQQEPSAAAQRYSPMEVMSPTSPYGPKTASSGQFSQQPAQRQSP
                     TRSSDYAPQQSPYYGSRQAAPQLPPINQYANNQETYSPSAMTPMDGSYADPKSPKRAP
                     PQSATHDRGPVPEFRRIRAPTDLKPKVNDQPPFRRANPEGGFISPLQALTVQLPATYR
                     ICNPAFKYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLI
                     LDVLGQGTFGQVVKCQNMKTQEVVAVKVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDD
                     HHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALL
                     NKARLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGL
                     PYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGNPPNWMIEMGKQAGEF
                     FEKRQDEFGRRTYHLKSMEQYSREHGVKEQPSKKYFQANTLPEIIKSYPMPRKNMKPS
                     EIEREMNNRIAFIDFVRGLLTINPLERWSPQQAKLHPFITQQKFTGQFVPPMNLKSSA
                     LNRSPAPGTQQQLQAEALSKQRAQAAQAQAQASTAAKGAYGSMGPVQYQQQGHAQQQP
                     LYGSNNMYTPTNTHPGAPPPYSGQQGGYGQMGMGQTGVQMPPANYTQSNMYAQQNRPR
                     QRASTMEQQSGIPASIQRVASHLDPNQPIRLQPSPAYYPPPPEGLAGMDHQTSNRQPR
                     RGSRAQQTGRGNRDFIRNLEERTLEEGFMGSGQSPWH"
     gene            complement(902533..904677)
                     /locus_tag="MYCTH_2303522"
                     /db_xref="GeneID:11512720"
     mRNA            complement(join(902533..903131,903188..903835,
                     903894..903989,904110..904677))
                     /locus_tag="MYCTH_2303522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662596.1"
                     /db_xref="GeneID:11512720"
     CDS             complement(join(902751..903131,903188..903835,
                     903894..903989,904110..904487))
                     /locus_tag="MYCTH_2303522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662644.1"
                     /db_xref="GeneID:11512720"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2303522"
                     /translation="MADNGPPTTSGQLPPPPQPNAGAPGYENGQNSGSNPSHIPPPPL
                     HIPQNTNPIPTAITSPMGGGGDKSGIMSPGSGAPFGRRAAPEPNKRALYVGGLDPRVT
                     EDVLRQIFETTGHVQSVKIIPDKNAKGYNYGFVEYDDPGAAERAMQTLNGRRVHQSEI
                     RVNWAYQSNNSNKEDTSNHFHIFVGDLSNEVNDEVLFQAFSAFGSISEARVMWDMKTG
                     RSRGYGFVAFRERADAEKALSSMDGEWLGSRAIRCNWANQKGQPSIAQQQAMQQMGMT
                     PTTPYGHHHFPTHGVHSYDMVVNQTPAWQTTCYVGNLTPYTTQTDIVPLFQNFGFVVE
                     SRFQADRGFAFIKMDTHENAAMAICQLNGYNVNGRPLKCSWGKDKTPNHHQQFDPHQP
                     YSPQSAQTPGYPGTPSTYFNQYGGGRCSREALAPGSVANVCTGSYGPGQQPGYAGPQA
                     QSPAAYGAQPMGYSGPPSAGGYGRGQQSGAQWNQPPPGQSFNNGFSGYQG"
     gene            906731..908420
                     /locus_tag="MYCTH_2303524"
                     /db_xref="GeneID:11512721"
     mRNA            join(906731..906863,906925..907068,907122..908420)
                     /locus_tag="MYCTH_2303524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662597.1"
                     /db_xref="GeneID:11512721"
     CDS             join(906813..906863,906925..907068,907122..908243)
                     /locus_tag="MYCTH_2303524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662645.1"
                     /db_xref="GeneID:11512721"
                     /db_xref="JGIDB:Spoth2_2303524"
                     /translation="MSVRRQIDRLPNVVNDVLVTTAKAFKAARRDGKANPAAAAAAIE
                     SRIPDAVERFNAILDDVESDILLAKAVLERDLKVVRAKRQQPPPGQKAVAPPAPMAVD
                     LESPKMAAKEPVTGLPGPPPSGTPTSGGQANKPVAPFPNMGFESTTPEAAGVPSPKAV
                     PQPNISKNLVRPGGTALAAAAAARPASAPPKKDVKVSPPQTNRPGGVATAPQTPLNPS
                     AQQVKPSSTPVGPNRQTPNLTPGNAGGVAAPVSAAPVSAAPALTAPASTAPASSAPAP
                     TTPVPTAPAPTASAAGNGSLFTDMTFSVAPPLNDSQPQKPAPQPQRRESQQQSAPPRT
                     DDANAGAESVPAPKAEQSTGAPADVASTDAGVRDAKNAEDNSMANIDDSIDGLFDLGP
                     GGMDSMDMEYDLSNGDNSNFNDMYFGTGDNSGGSGEFDDAFFNLNG"
     gene            complement(<908597..>909880)
                     /locus_tag="MYCTH_94336"
                     /db_xref="GeneID:11512722"
     mRNA            complement(<908597..>909880)
                     /locus_tag="MYCTH_94336"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662598.1"
                     /db_xref="GeneID:11512722"
     CDS             complement(908597..909880)
                     /locus_tag="MYCTH_94336"
                     /note="CAZy_ID 267874"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003662646.1"
                     /db_xref="GeneID:11512722"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_94336"
                     /translation="MMVLLRRLVAALGVLAPLVTAATLPALPLHSSGRWILDANNKRV
                     KLRCVNWAAHMETNIPEGLQHRPMDAIADWIAAQGFNCVRLTYSIDHALDPSLPVSTS
                     FTTNAASATGVSAAEMAALFGRVAANNPWITPGETTTRDVLAAAVDRLYARGVLTVLD
                     NHVSRASWCCSLTDGNGWWDEAAGYNPWNSRFFDTRAWLAGLEAMAAWARGHPGVVAM
                     SLRNELREFPLLQDVDPARPDWYAFVGRAGAVVHAANPDVLVVVGGVQSSTDLSHLRL
                     PGGGGMLDTSAWAGKHVWEMHAYSFTVTFPDVFGSCDVVRAEYGALSGFVLEQDRPYT
                     GPLILSEFGVGMEGGDKDGLSDEDDRYLRCLVSYMENNDADWAVWAVQGSYYVRDGQV
                     DYDETWGLMNHNWTGWRNPAFPAKLGNMWNMTQEP"
     gene            complement(911521..913398)
                     /locus_tag="MYCTH_2303528"
                     /db_xref="GeneID:11512723"
     mRNA            complement(join(911521..912824,912903..913398))
                     /locus_tag="MYCTH_2303528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662599.1"
                     /db_xref="GeneID:11512723"
     CDS             complement(join(911763..912824,912903..913142))
                     /locus_tag="MYCTH_2303528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662647.1"
                     /db_xref="GeneID:11512723"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Spoth2_2303528"
                     /translation="MAQTQAQTQPATLTAARDPPPADEQTSRAIPVPPQTNPPEARNR
                     GRLAVDTYSPVNQNGSFEFDRVLKSGYVQKRTQKTKAWRTIYLVLRPNALSVYKSDKE
                     EKLRRKIYLSDLTAVTLLKDPKNKRPNVFGLFSPSKNFHFQAPTAKDADEWVDLIRQE
                     ARIEEEEEELFLASPGARQSSYFPAAEVDNAGSNRALASPERFLSSSPESADPPARGL
                     DKPYARRPSHLDSSGLSNAELASHSDFSDSDMHRVPGASFESLAARQPSTSLGPSRQS
                     LGAFNTGRLSGTQPEADPDRVIWQGWMWFLRSKGGVRQWKKSWGVLRPRNLILYKDEA
                     ESSVLFLLYMSSIVNVVETDPLSRTKKHCMQIITDEKSYRFCTHDEEALVQCLGAFKS
                     LLAKRRELEAKAGNSHPIATATVTATATSTAAPPEARPHPA"
     gene            915008..916599
                     /locus_tag="MYCTH_2303529"
                     /db_xref="GeneID:11512724"
     mRNA            join(915008..915333,915401..915879,915950..916599)
                     /locus_tag="MYCTH_2303529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662600.1"
                     /db_xref="GeneID:11512724"
     CDS             join(915106..915333,915401..915879,915950..916349)
                     /locus_tag="MYCTH_2303529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662648.1"
                     /db_xref="GeneID:11512724"
                     /db_xref="JGIDB:Spoth2_2303529"
                     /translation="MADSNAARLSEEVLQELSNTEYACSNLQPLSGGTANFIFKGTLI
                     QPLANGTKEVAVKHGEGYVASVPGFRIPTTRCRAEVECLKSIGGLALTKGPYAVRAPK
                     LYYFNPDTNTQIQEYLPGALSLKDYALRHFSSPDPSRKPLCLELGRSLGAWLREFHAW
                     ASLPEQAELREELKSNEPMQKIKHMANYQTLVGTVSNFPSILGEAQETFEKIKDATAK
                     ELDRPDLQIIHGDFWTGNALLPDRPLENGDQLPVFIVDWEMCQFGLPPLDLGQMIAEL
                     YELSLFKNMDEGKWLIEGFTAGYGCVDDDFALRTALHVGTHLVAWGSRVAGWGSEAQV
                     QHVVGLGKDIILRAWDKDRVWFEGGDLACLFTKH"
     gene            917105..919156
                     /locus_tag="MYCTH_2303532"
                     /db_xref="GeneID:11512725"
     mRNA            join(917105..917416,917520..919156)
                     /locus_tag="MYCTH_2303532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662601.1"
                     /db_xref="GeneID:11512725"
     CDS             join(917310..917416,917520..918888)
                     /locus_tag="MYCTH_2303532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662649.1"
                     /db_xref="GeneID:11512725"
                     /db_xref="JGIDB:Spoth2_2303532"
                     /translation="MAGSNSTAGSLTLTRPCVKCRAQEATLDSRSQPVCRDCFTKFIS
                     AKCIKQIGILGKETRPPPSATNGPPTGTRRYLLGLSLGVSSTVLLHLLNENVEFQLAR
                     GRSAPFELTVVHIDDDTSLDHDGHGHGHPSSRSTSPETVLARYRARYPRFSFHSIPLS
                     SAIPKNHHHPESPTGPEHPADANDGGEGNKGGKCGANAEEAPPPPSPPPPPPSATSAA
                     TSAIAAAIAAAAAASSTTTAASRSDVTRLLTRRALLAQARARGCQALLLGHSTTALAE
                     LTLAEAAKGRGFAVPWLVGDGPAAGAAAGPGTGSENGSENGSENNGRGEVLLVCHPLR
                     DALRKELVIYAGLVDPPLTDLLGGSSSSSGSSAEGSSSENGGPSAAAASSSPSPSGAA
                     SAVVSHRDLSIEEVMRRYFAEVEESYPSVVANVARTTGKLVRAGEDAVGGQWCGLCGM
                     PLDEDGDERWRGELGIRERTGSVPELLGERLCYGCQRSTGG"
     gene            complement(919090..920720)
                     /locus_tag="MYCTH_2303534"
                     /db_xref="GeneID:11512726"
     mRNA            complement(join(919090..919433,919513..920189,
                     920271..920720))
                     /locus_tag="MYCTH_2303534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662602.1"
                     /db_xref="GeneID:11512726"
     CDS             complement(join(919195..919433,919513..920189,
                     920271..920287))
                     /locus_tag="MYCTH_2303534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662650.1"
                     /db_xref="GeneID:11512726"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2303534"
                     /translation="MSTTAGAFIAGGIAACGAVTATHPFETVKIRMQLQGELQDKGHQ
                     PHHYRGPIHGVSVIVRNEGLRGIYRGIGCAYIYQILLNGCRLGFYEPMRNALSTLIFK
                     DGKTQSLGINMFCGAASGVMGAAAGSPFFLVKTRLQSFSPFLPVGTQHRYRNALDGMT
                     QIYRTEGVRGLYRGVGAAMIRTGFGSSVQLPTYFFAKRRLMRHLGMEEGAPLHLTSST
                     VSGFVVCVVMHPPDTIMSRMYNQNGNLYAGVFDCLAKTIRTEGIFAIYKGFLPHLARI
                     LPHTILTLTLAEQTNKLIRKLENRILPSTALKTV"
     gene            complement(921571..923931)
                     /locus_tag="MYCTH_2303536"
                     /db_xref="GeneID:11512727"
     mRNA            complement(921571..923931)
                     /locus_tag="MYCTH_2303536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662603.1"
                     /db_xref="GeneID:11512727"
     CDS             complement(921637..923067)
                     /locus_tag="MYCTH_2303536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662651.1"
                     /db_xref="GeneID:11512727"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Spoth2_2303536"
                     /translation="MRDLPTTFSDAIHLSRALGIPYLWIDSLCIIQDDKADWNREAEC
                     MADVYGNATLTFSADAAPSGEDGLFQPVSRRRVPAAVKYCCPSSPAGDEDEPNYVYGR
                     RIFVHGRYTSAEKVHSITNAPPWVYEPLHLRAWTFQEYLLSRRIVHFVTGELLWDCRR
                     TEGCECQIQEVLTERPQFHDLLRTSWRIHGTVWWYFIETLSRRGMTYPSDSLPALAGI
                     AKAVSASWRHNDCYIAGHWKSELPRSLLWRRGGQLHHPGAHNYGGTNVASRRQARYVA
                     PSWAWPSVVGPVYHDNVYTDPPDVRERWVSSYDYTHIVCQVLNVSYELASSNPYGHLR
                     SGSIVIRGMTLMLHGCVDVEDSEHKGKQGRLHVRFIRDEWQPGQAASPEDVLYLPIVG
                     NCYRKDYIHSSRPPKLHRVVQTKGLALKAAAGQDDTFVRIGFLRVYFYRRRQAVWKDR
                     RERKRPRAEEILKTEFQLPVRTVTII"
     gene            <924324..>925599
                     /locus_tag="MYCTH_116006"
                     /db_xref="GeneID:11512728"
     mRNA            join(<924324..924467,924548..924782,924839..>925599)
                     /locus_tag="MYCTH_116006"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662604.1"
                     /db_xref="GeneID:11512728"
     CDS             join(924327..924467,924548..924782,924839..925599)
                     /locus_tag="MYCTH_116006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662652.1"
                     /db_xref="GeneID:11512728"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_116006"
                     /translation="MASTPMDLDDAPTSAATPSLNIARTLGANVPSTTAVSEVIPLYR
                     PTKLFQRDDIKDGKPRPYVLSIDFDDPGELCMTSESDETIQIYNVKDGRHDKSLLSKK
                     YGVKLAKFTHTSSSIIYASTQQNDAIRYLATHDNSFIRYFEGHEGAVTNLALHPGSDN
                     FISCSVDNTVRIWNIGTKQWIGKLLLNTPYLSAWDPSGNVFAVASPASGSILLYDYRK
                     YEKGPFSVFDVLKARGPADAEAAFRGWTKLEFSNDGKHLLLGSKGDGHFLLDAFDGSL
                     KAYLKKPGASTRRLAPGETDGGNVESSGECCFAPDGRYVLSGAKSDLLVWDTLMTPGS
                     DKVLEPAHVLEEKREMAVVAYNPRYNMIATADQELMFWLPDPNA"
     gene            <926207..>926765
                     /locus_tag="MYCTH_2060145"
                     /db_xref="GeneID:11512729"
     mRNA            join(<926207..926278,926340..>926765)
                     /locus_tag="MYCTH_2060145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662605.1"
                     /db_xref="GeneID:11512729"
     CDS             join(926207..926278,926340..926765)
                     /locus_tag="MYCTH_2060145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662653.1"
                     /db_xref="GeneID:11512729"
                     /db_xref="JGIDB:Spoth2_2060145"
                     /translation="MPYYAKSEDWLHQSSLLLQARPSTTRITTRYHLKPARRVPKLKN
                     SDQDAAGQKAQSPETQEKPPRGHLVLKTYDPHSGVTLKYKTSKAAEVTRLIQMLGTLG
                     RHMAAVPITEKAEDETMADAPAPTEGEGTGSGVQTPIGAQAQQQQQQAGGGGGKGKKK
                     KGGKR"
     gene            complement(926933..928885)
                     /locus_tag="MYCTH_68292"
                     /db_xref="GeneID:11512730"
     mRNA            complement(join(926933..928196,928252..928518,
                     928584..928885))
                     /locus_tag="MYCTH_68292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662606.1"
                     /db_xref="GeneID:11512730"
     CDS             complement(join(927249..928196,928252..928518,
                     928584..928613))
                     /locus_tag="MYCTH_68292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662654.1"
                     /db_xref="GeneID:11512730"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="JGIDB:Spoth2_68292"
                     /translation="MAAQVTPSKQATSAIEALKMESPVKKLDFSSSNKENASFDADLA
                     TLEAEIDANHQKSVMDKKEAPKPSVAPTIKPEEADEPLLQENPQRFVLFPIKYHEIWQ
                     MYKKAEASFWTAEEIDLSKDLHDWNNRLNDDEKYFISHILAFFAASDGIVNENLVERF
                     SGEVQVPEARCFYGFQIMMENIHSETYSLLIDTYIKEPAQRSHLFNAIETIPAIRKKA
                     DWALRWIADKKSTFAQRLVAFAAVEGIFFSGAFASIFWLKKRGLMPGLTFSNELISRD
                     EGLHTDFACLLFSHLNHRPSKQVIEDIIVDAVRIEQEFLTEALPCALLGMNANLMKQY
                     IEFVADRLLLALGNEKVYRSTNPFDFMENISLGGKTNFFEKRVGDYQKAGVMASTKKF
                     VQEDSDEPKGENGGDFTFDDDF"
     gene            complement(929632..931069)
                     /locus_tag="MYCTH_2303545"
                     /db_xref="GeneID:11512731"
     mRNA            complement(join(929632..930194,930252..930451,
                     930510..931069))
                     /locus_tag="MYCTH_2303545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662607.1"
                     /db_xref="GeneID:11512731"
     CDS             complement(join(929765..930194,930252..930364))
                     /locus_tag="MYCTH_2303545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662655.1"
                     /db_xref="GeneID:11512731"
                     /db_xref="JGIDB:Spoth2_2303545"
                     /translation="MEKLRTVCKRAHHLDHQFHCCCFGASLGWSAILGLIPVIGDVLE
                     LILSVLLVWEASRIYGGLPSNKRRLMYLYIALDFLVGFIPVIGDFFDVGYRANTRIAW
                     VLNDHLMDKAIKRVRAETGQPSGINGEKDRDLEQGIVRHVESFTAPMTVPPARTIPPG
                     RNLTGPHDPRNPYRMQGRRH"
     gene            931896..934925
                     /locus_tag="MYCTH_2303547"
                     /db_xref="GeneID:11512732"
     mRNA            931896..934925
                     /locus_tag="MYCTH_2303547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662608.1"
                     /db_xref="GeneID:11512732"
     CDS             932048..934657
                     /locus_tag="MYCTH_2303547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662656.1"
                     /db_xref="GeneID:11512732"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="JGIDB:Spoth2_2303547"
                     /translation="MSLRSFCLRIFQHCPLLAPFSAENHMRAFEEFMQYKTRVPVRGA
                     ILLNEAMDSTVLVKGWKKGANWSFPRGKINKDEDDLDCAIREVYEETGFDLRQAGLVP
                     KDDEVKYIQISMREQQIRLYIFRNVPMDTVFEPKTRKEISKVEWYKLSELPAFRKKGN
                     SSHDNAAAASNANKFYMVAPFLVPLKKWVLQQKKKDASRAAASSSHQAIHPPAEEPLT
                     EDDIGTHVEPVPGPSNGTPAIETMEGATRELQRLLKVQPPTQGLQMSPSSSTASKGEA
                     LMALLRKSAEPQQAPQQPHHPHSQTSNTAPDLAHTSGPGAHAPHHHGSTYGQPAPNYQ
                     PPSNFPVTPSSMQNTAPAYAGQDSAHAHDMSQTYGRNPFISSTQPQRSEPVLLHPQPL
                     PPQVQQSVLTRGILPTPVLLDAVGQGGQHGQQNGQQSYQRGPHAPAGGQYNQPGAPSP
                     YTVGANDSYATQQQTPKPAQLTDHAMALLNTFKYGTRDGGEHKAHGSAPQNPASVSVQ
                     QNQYHSASWANAASTTQASNPAAQLLPHPMPPVTAAGTSPRAIQPSDPQAGSRFPQPN
                     DTHRSALLEMFKKAGPRSPLSNEIKMQPGSSQQSPGTTRHNDTGSPGYKATSAAELLA
                     SAPGANHTPGRTDSELNRPYRPVQILSRPKQGEHSNSQDFASAQAQIQRLQQRLSPMG
                     STWQDAGNTGRQGMSSPRDRAFSHYMEQEAKRSPQPNYAAAHAASLPYASQSPSSTHF
                     ASPFQQQQQFQQSIGMQQRRKDSNSEQKQKLLSLFSKGQQQQQQSQQASPTGFTVEAK
                     GKGKETTVFEQPRSGSTPRSRVASFASAGANEPSGTGGSGQTSRRGSQTPISPADRNF
                     LLSYLESVTNAGR"
     gene            complement(935417..937265)
                     /locus_tag="MYCTH_2303549"
                     /db_xref="GeneID:11512733"
     mRNA            complement(join(935417..935436,935517..935732,
                     935791..936044,936103..936615,936679..936731,
                     936797..936890,936959..936968,937070..937265))
                     /locus_tag="MYCTH_2303549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662609.1"
                     /db_xref="GeneID:11512733"
     CDS             complement(join(935519..935732,935791..936044,
                     936103..936615,936679..936731,936797..936890,
                     936959..936968,937070..937134))
                     /locus_tag="MYCTH_2303549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662657.1"
                     /db_xref="GeneID:11512733"
                     /db_xref="JGIDB:Spoth2_2303549"
                     /translation="MTSPEGNTVTIGREYFNTLLRRAEYNSKPLESTGNFASVVISRA
                     EYDNLVLIARQYGNLRRNLLRGGVGEETVDLLSQDDETIRRAPTSAANQQADPNEDGG
                     ARLDSPTPDPSAAYAQQKDTQHSPRHGRSAWADSDVDEADNDDENGASEAGSRPEDRP
                     GARYTKPQGQRPQFERQCARTLQLSNLAEGTTHADIVNAVRGGMLLDIFLRSHDRSAT
                     VSFLNSEDAKKFYEHVRRHDLYIRNKRVEVRWNDRQFILQGHVANKISMGASRNLVIQ
                     GYDNRHTEDVIRGDLDHIHTLVVVKIEFVGSSCYIGLNSVHNAIYARQCMLTRLRYKG
                     KKISFDVDECAQPYPQPAPKPRKEVAPPRKKLARVPNRFQLLSPDDGDDDEIAATFGT
                     KNAVGITA"
     gene            939245..940507
                     /locus_tag="MYCTH_2303558"
                     /db_xref="GeneID:11512734"
     mRNA            939245..940507
                     /locus_tag="MYCTH_2303558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662610.1"
                     /db_xref="GeneID:11512734"
     CDS             939344..940288
                     /locus_tag="MYCTH_2303558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662658.1"
                     /db_xref="GeneID:11512734"
                     /db_xref="JGIDB:Spoth2_2303558"
                     /translation="MKAALSAGHLAVALLSLTPAVSALGWPRWLPELDTLVVRQDDSQ
                     DGTYHRSDTLYVYVHACSSNTHSADSSSPTPTPTPSKSASDNSDDEGSSTTSRDTSDP
                     ISTNLNTGGITSGTRTAKETGKSTRSSAPKKTEFDPQDPVGSVVMVTPAATDGYQLYK
                     IGDYVTWGWNYTDVQATPTGIDLYLKCSKVPQPWTLTQNMSYSTVGSYTWDTEQFQKS
                     HVADPLLTEQYTLVIADADGGISATPEPGYLAPFSGFMFGLYEPQPYSDTGDGWQCAS
                     CNGATSGLDNRAVGVAVVMSVVTVLSFTWFVTGFGAFF"
     gene            complement(940494..942464)
                     /locus_tag="MYCTH_2303559"
                     /db_xref="GeneID:11512735"
     mRNA            complement(940494..942464)
                     /locus_tag="MYCTH_2303559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662611.1"
                     /db_xref="GeneID:11512735"
     CDS             complement(940728..941522)
                     /locus_tag="MYCTH_2303559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662659.1"
                     /db_xref="GeneID:11512735"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2303559"
                     /translation="MPEPFLASEVKTLLRQLASGVAYLHDKWILHRDLKTSNLLLNNR
                     GQLKIADFGMARYVGDPPPKLTQLVVTLWYRAPELLLGASRYTGAIDMWSVGCIFGEL
                     LTREPLLQGRNEVDELTKIFELCGVPTEESWPSFRRLPNARGLRLPSGGKATGSAIRA
                     KFPLLTAAGVSLLNSLLALDPDKRPTAKEMLEHEYFKQDPKPKQEAMFPTFPSKAGQE
                     RRRRRETPNAPARGQQAADLGTVDFSGIFSGREREEKGGGFSLRMV"
     gene            complement(942762..942861)
                     /locus_tag="MYCTH_t97"
                     /db_xref="GeneID:11512736"
     tRNA            complement(942762..942861)
                     /locus_tag="MYCTH_t97"
                     /product="tRNA-Val"
                     /note="Anticodon: CAC"
                     /anticodon=(pos:complement(942826..942828),aa:Val,seq:cac)
                     /db_xref="GeneID:11512736"
     gene            943198..945751
                     /locus_tag="MYCTH_2303561"
                     /db_xref="GeneID:11509868"
     mRNA            join(943198..943401,943497..943585,943663..943805,
                     943871..944017,944073..944494,944551..944587,
                     944641..945751)
                     /locus_tag="MYCTH_2303561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662612.1"
                     /db_xref="GeneID:11509868"
     CDS             join(943368..943401,943497..943585,943663..943805,
                     943871..944017,944073..944494,944551..944587,
                     944641..945586)
                     /locus_tag="MYCTH_2303561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662660.1"
                     /db_xref="GeneID:11509868"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="JGIDB:Spoth2_2303561"
                     /translation="MAGRFVRASKYRHVFGKPTKKEFCYDNLHISRNAWDTNLVKVNP
                     EYLSVNWESGGGGAFAVIPLNERGKLPDQIPLFRGHTAAVLDTDWCPHNDRLIASASD
                     DGKVFIWEVPQGFTLYTDAEEITDVSPVSKLAGHSRKVGHVLFNPAAENILASSSGDL
                     TIKLWDIGTGQAGLTLKHPDVVQSLSWSANGAMLVTTSRDKKLRVWDVRQEKPVHEYP
                     GHEGAKNSRAVWMGEHNRIATTGFSRMSERQIGLWEPGRKDPIGGFTSLDSISGVCMP
                     FWDEGSNCLYLAGKGDGNIRYFEYENDKFEFLSEYKSADPQRGIAFLPRRGINVHENE
                     VMRAYKTVNDTYIEPISFTVPRRAETFQSDIYPPATGLKPAMSAKEWFDGKTAVSPKI
                     DLESVYEGKAPVEVPADYKPSPAAAPTPAQAPAPAPKKEPEPAPTPVRAPATVADQKT
                     SMSAMANKFQDVEAVEDEDETSSFEEISRPAPRTTLPVRSPAKPEPIATNAPPPQAKP
                     SSPVKSSEPSAAPATRPAASASPASPALEASLAQIKQLIEQQGQVISAQTEKITAQTQ
                     LISRLAAEVETLKKRVGTGTQDQSERIRQLELELEAARS"
     gene            complement(945751..948198)
                     /locus_tag="MYCTH_2303565"
                     /db_xref="GeneID:11512737"
     mRNA            complement(join(945751..947233,947282..947454,
                     947510..947740,947816..948198))
                     /locus_tag="MYCTH_2303565"
                     /product="glycosyltransferase family 22 protein"
                     /transcript_id="XM_003662613.1"
                     /db_xref="GeneID:11512737"
     CDS             complement(join(945916..947233,947282..947454,
                     947510..947740,947816..948112))
                     /locus_tag="MYCTH_2303565"
                     /note="CAZy_ID 268033"
                     /codon_start=1
                     /product="glycosyltransferase family 22 protein"
                     /protein_id="XP_003662661.1"
                     /db_xref="GeneID:11512737"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="JGIDB:Spoth2_2303565"
                     /translation="MNSKPAPEGLPGRHEAGFVGEPPRPKSKREEKHETTRRYEVHAQ
                     VAAAQVGDILRVLLLFRFINALCVRTFFQPDEYFQALEPAWRVAFGADSGAWLTWEWQ
                     HQLRSSLHPAIFGLAYKAAESLMSSLSLFPPFKALMLVALPRTLQAVFAALADFYTWK
                     LAMDIYGRQSNAPWAALWMTVLNPWQWYCSTRTFSNSLETTLTIAALCYWPWEVLIDT
                     KASRSQPLQQEGRLSSLRISLVLAAVAVLLRPTNLLIWLVVSGLSLIRLTPLGNSPLQ
                     TSTIVILLRESIICGATVLAVSLISDRLYFGFWTFPPYKWFYFNISQSLAVFYGRMPW
                     HYYVSQGVPLLTTTFLPFTIVGLYKATSSTNTLQSRILKTLNLSVLTMITILSFISHK
                     EVRFIYPLLPMLHILSAPYFTAFFTQPASSSAAPSSDGPVSLRRKLTLANLISLNILL
                     AGYLSLFHQPAPLSVLSFLRTEFERIHPDALDIDVPASPQGGKGEKELFALFLTPCHS
                     TPWRSHLVYPALRARALTCEPPLHIARGTKERETYLDEADRFYLKDADGMYGVRFLGE
                     EMWPLAAGNESTGTAKRRVGEVPRYIVGFEGIEPVLRAFFEHGNDGKEAPGKEMGVTL
                     TRVWSAWNGAFNEDWRRRGRLVVWDTGLYQGSRGEENREEEGRVVDEL"
     gene            949019..951042
                     /locus_tag="MYCTH_2303566"
                     /db_xref="GeneID:11512738"
     mRNA            join(949019..949733,949874..950575,950661..951042)
                     /locus_tag="MYCTH_2303566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662614.1"
                     /db_xref="GeneID:11512738"
     CDS             join(949224..949733,949874..950575,950661..950798)
                     /locus_tag="MYCTH_2303566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662662.1"
                     /db_xref="GeneID:11512738"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="JGIDB:Spoth2_2303566"
                     /translation="MAPHADKDNSPVRGANTASSKDRYHAASTKSAIAAENEFAAHNY
                     HPLPVVFARAQGVHVWDPEGKHYLDFLSAYSAVNQGHCHPELIKALTEQAGRLTLSSR
                     AFHNDVFPVWAEKVRQLFGYDMVLPMNTGAEAVETAVKIARKWAYKVKGVAPGKALVF
                     STSNNFHGRTMTAVSLSVDPESRGNYGPYLPNVGAINPSTGAPIRYNNVADLEAVLDA
                     HGRDTAAFIVEPIQGEAGVVVPDDDYLARVHELCRRHNVLLVCDEIQTGIARTGRMLC
                     SEWAGIRPDMVTLGKAISGGMYPVSCVLADRAVMGVIEPGTHGSTYGGNPLGCAVSIR
                     ALELVEEEGLVEKADRLGRIFREGVEAFQSPIVQTVRGKGLLNAVVIDESRASGRTAW
                     DLCLLLKDKGVLAKPTHGNIIRFAPPLVITEEELRGAIKTIGEALAELPTAKVTEGH"
     gene            956140..959832
                     /locus_tag="MYCTH_2303567"
                     /db_xref="GeneID:11512739"
     mRNA            join(956140..956682,956834..959453,959530..959832)
                     /locus_tag="MYCTH_2303567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662615.1"
                     /db_xref="GeneID:11512739"
     CDS             join(956557..956682,956834..959453,959530..959720)
                     /locus_tag="MYCTH_2303567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662663.1"
                     /db_xref="GeneID:11512739"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2303567"
                     /translation="MAERTSSSRRPRPASDEAIGNFVIDREIGKGSFAQVYSGRHKDT
                     GALVAIKSVELSRLNKKLKENLYGEIKILRRLRHPHIVALHDCVESGTHINLIMEYCE
                     LGDLSLFIKKRDKLITNSATHELARKYPVAPNSGLNEVVIRHFLKQLTSAIKFLREAN
                     LIHRDVKPQNLLLLPSPQFREANKMQKQILSASHDSLTPAAGLPSLPMLKLADFGFAR
                     VLPSTSLAETLCGSPLYMAPEILRYERYDAKADLWSVGTVLFEMATGKPPFRAGNHVE
                     LLRKIEASEDVIRFSKDCLVSAEIKGLIRALLKRNPVERISFEDYFSHPVITGPIPGL
                     VEDDIPKQAEKPAPAETRGPSGVDEGATLSRRTSLRRYPPPPPAEHDGREPGVSPSPK
                     PRRSSPLATPIEPKPNPLEQVSSPRLSYSPRQEGEEGLGIRRPAVQPSTSAPVRPVTY
                     VDRSRRYSNASVRSPAREPPAQEPAGRARPKSAASRPLTEEEKAAQDVAFERDYIFVD
                     KTAVEVNALADQISLYPQQAQSPKSGQIVRRATQQGAPTSTTGAVPSRSSKSPQGRND
                     HYRKPSYDKSLSGSPGSTTSVISRAIQDASLRLFGFKVPPQMLSKGQSPPQIYSPFPA
                     YPTPSVPAGLIMDGKQSTPVDEDSRVAQCIEEYATRSDVVYGFAEVKYKQLVPLAPSA
                     EHGLGGVLADKMGEEDEGLTTDAIVSISEEALVLYVKALSLLAKAMDIASLWWSRKNR
                     AESSNSVHPATRDSVNSQALALKINAAVQWIRSRFNEVLEKAEIVRLKLIEAQKQLPE
                     EHPSHPSNHPAETGAVSGSGTEGVFLSAGISAEKLMYDRAVEMSRTAAINEIASEDLP
                     GCEISYVTAIRMLEAVLDSDDDHLPKRRVSSSSSKDDKSVAAQDAPDGMSSDDKQTVQ
                     KMVQMINGRLASLRRRMRAIAAASKSQQQQQQQQQQQQQQQQQQQQQFVSRPRSGDVT
                     PRSVPV"
     gene            <961216..>962661
                     /locus_tag="MYCTH_2060907"
                     /db_xref="GeneID:11512740"
     mRNA            join(<961216..961588,961694..961998,962128..962260,
                     962315..>962661)
                     /locus_tag="MYCTH_2060907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662616.1"
                     /db_xref="GeneID:11512740"
     CDS             join(961216..961588,961694..961998,962128..962260,
                     962315..962661)
                     /locus_tag="MYCTH_2060907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662664.1"
                     /db_xref="GeneID:11512740"
                     /db_xref="InterPro:IPR010488"
                     /db_xref="JGIDB:Spoth2_2060907"
                     /translation="MVSARDPLVAPPSRVRENNNGNADPPGDSGSADDETTRLLAAWR
                     ISPETHDHILRTRILPAELDPFLPEVGGKSTRPRAILILGQTGAGKTHFTPRLLSALR
                     QQQQEEGGGGGGGGDDGGGGGEKRPILHLIADTYKRYHPHYAACLASARHAGLASRVA
                     GPAAARWLLAVCERAADARADPVVVEAAARRPDEFRAVARAFAARDYAVRVAVLAVPA
                     ALSRLGIAQEEEQKEGHGDRGMPVRFTPKAVHDASFEGVEAVVGWLDEDGEAGGGELL
                     DRIVMVRRGGEVVYGNERAENGWVKEAAALAALRRERARGLTDEERKTAEEGIRMLKS
                     LGDPKADREVEEIEELMAGLGIGDRTVSEMMPFDAADFVKPADLGRDDIHP"
     gene            complement(962762..965009)
                     /locus_tag="MYCTH_2303570"
                     /db_xref="GeneID:11512741"
     mRNA            complement(join(962762..962894,962952..963166,
                     963238..963757,963902..964623,964710..965009))
                     /locus_tag="MYCTH_2303570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662617.1"
                     /db_xref="GeneID:11512741"
     CDS             complement(join(962862..962894,962952..963166,
                     963238..963757,963902..964623,964710..964728))
                     /locus_tag="MYCTH_2303570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662665.1"
                     /db_xref="GeneID:11512741"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2303570"
                     /translation="MSELKHPSDEEDTKYPAAGKVAVGGDAARHYDSAPGSEEVVCPP
                     HTTDRRITTKIDAYIIPFVSVLYLMAFLDRVNIGNARAFGLEEELHMGGVEYNTALTI
                     FFVPYIVFEIPSNILLKHFTPRVWLSICCIGFGSVTVFQGLVQNYSGLLATRFFLGAF
                     ECVLFPGCFYLIGSWYRRAEAQKRFSLFFSSTSLAGAFGGLLASAIGKMDHIRNYRGW
                     RWIFLLEGCFTVLLGVIFLFTFPSFPEQATWLRDDEREYVKARLRASQGASGAERKIK
                     LRDVKDVMSDYKIWLGGFMYFGLIVPAYSYAYFAPTIIQSYKYDPITTQLRSVPPWAV
                     SFGFSMIVAILSDWAKHRFSFIIGSICIAISGFAVLLSVHDNLQVQYAALFLTCMGTY
                     SAMPVIVCWFNMNLGGHHRRAIGSAWQIGFGNIGGIIATYSFVKGDAPFYRKGYAICL
                     SFICLSVLSCFAYAAAITWENKKRSKQVHDLNLTEAQKLDLGDLNPEFRYML"
     gene            complement(968429..971841)
                     /locus_tag="MYCTH_2303573"
                     /db_xref="GeneID:11512742"
     mRNA            complement(join(968429..970915,970981..971136,
                     971464..971841))
                     /locus_tag="MYCTH_2303573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662618.1"
                     /db_xref="GeneID:11512742"
     CDS             complement(join(968610..970915,970981..971136,
                     971464..971737))
                     /locus_tag="MYCTH_2303573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662666.1"
                     /db_xref="GeneID:11512742"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="JGIDB:Spoth2_2303573"
                     /translation="MTPGIQPPMSQQQPASQQQQQPPPQQQQQQQQQQQQQQQQQQPR
                     PNAPATPNTPNTIAASQAQSAVSPPSKRDLKSWWKGFKLPSKHQESQEPRPQGIFGVP
                     LRQSITYANVAISLVDEDGKSYIYGYVPIVVAKCGVFLKERATEIEGIFRLSGSEKRI
                     KELKNIFDSPDRYGKGLVWDGYTVHDAANVLRRYLNDLPEPVVPLDLYEKFREPLRGA
                     TKPGNGEAEGPQLVEGFDMDAAIAKYQRLITELPPLNRQLLLYILDLLAVFAAKSDQN
                     RMTSQNLAAIFQPGMLSHPAHAMAPEEYRLNQCVIIFLIENQDHFLIGMQGTAADEKT
                     VEEVQKGTPVLNAPPTPNTKTGLVRSASTGSVGPESVAKEGSIRRNKSTSSRRSFHSN
                     GCPSPASPALATTPTAGLARSNTLPAKKSPALQSGRFASRNEPHVAPLTPVAAPATTV
                     VSSPGVVEEIATPPEETEPSASAPTAPSSSQPGLAIPGAKSQDKLLEPPTPDATTPSK
                     ERKLPTLFQRMASSEGDGRQPNKLRKKRIPGSANPSAHSSTASLSHSATASPNAETAN
                     PLEAVRPIAGAEESATTQPADTSSDLTPRPSHAVPNNVKSDTDPNSRASSGSTESGRP
                     EVSTAGAHPSPGNVTLGGTNADTSHSGYANADTLHPSSAQLPLQHKKSPPTSLHSSFN
                     ETSDLDQVDEPVAPPAEAPVPDTPNEKEKKRRWRLSRKKEDASPPSYPPLAAQPPIGS
                     NATASASGTSVNSSGKPGHSTAGDTSDRTTINTEAPLTEVSSKESRDESNKISSWIKN
                     KYREHKENVEQRRNKSPPAGERAVSIGSSLLSSRGKSLDLKRTEEEKQPVPQPVEAKP
                     PAPPQSGEAAPIPNQTSQSHTQPPPPQPLTTTTTTTTATTPPPPQSQQPQEPKAQ"
     gene            975530..>976463
                     /locus_tag="MYCTH_81466"
                     /db_xref="GeneID:11512743"
     mRNA            975530..>976463
                     /locus_tag="MYCTH_81466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662619.1"
                     /db_xref="GeneID:11512743"
     CDS             975714..976463
                     /locus_tag="MYCTH_81466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662667.1"
                     /db_xref="GeneID:11512743"
                     /db_xref="JGIDB:Spoth2_81466"
                     /translation="MQLNTLALTLAAAVSSVAAYPITGDDVNCRTGPGTSFKSVKTYP
                     KGTDVKLSCQTYGEVIFGNSIWDKTQDGCYVSDYYVKTGSNNMVTGECPDNGNGSGGS
                     VYQGKINRTEIISRAEYWTKQNVPYSMEKTYPDPQGRYYRTDCSGLVSMALHAMAPGY
                     STVTLPQIAVAISWDDLKAGDFIGTLGAGTGGSGGHVTVFQSWVDDAHTQYWSLECAN
                     KEKGCLRQKRNVKWKVGSNTAKPYRYTKVIN"
     gene            complement(977237..978360)
                     /locus_tag="MYCTH_2303577"
                     /db_xref="GeneID:11512744"
     mRNA            complement(join(977237..977730,977817..977930,
                     977998..978360))
                     /locus_tag="MYCTH_2303577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662620.1"
                     /db_xref="GeneID:11512744"
     CDS             complement(join(977333..977730,977817..977930,
                     977998..978253))
                     /locus_tag="MYCTH_2303577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662668.1"
                     /db_xref="GeneID:11512744"
                     /db_xref="JGIDB:Spoth2_2303577"
                     /translation="MTTKEHEAGEEEQTFLPKAPSSDDVSAEFGPEVRGRGASGPRKR
                     GVVWWLRLFLDIAMAGTIAYLLVAKPFVVSRETLRRTPVPRFPRKIYTFRNDPKYARE
                     DMWYNETETLRTLHNWIGLSSESRGYVVVKDASRYDLPEPYTVALDRHNDGPGYMMTV
                     FHQLHCLSYLAEHWQRGYAGFNLTEEVAHHTAHCFNYLRQGIMCSADTTLEGKTGAGP
                     GEGSEHECKDYDAVLKWANEHSAMKWRNALLPDTSIL"
     gene            979339..980229
                     /locus_tag="MYCTH_2303579"
                     /db_xref="GeneID:11512745"
     mRNA            join(979339..979459,979531..979600,979708..980229)
                     /locus_tag="MYCTH_2303579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662621.1"
                     /db_xref="GeneID:11512745"
     CDS             join(979449..979459,979531..979600,979708..979896)
                     /locus_tag="MYCTH_2303579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662669.1"
                     /db_xref="GeneID:11512745"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Spoth2_2303579"
                     /translation="MDTGLTASEQRELETRLQKRQVKEFMTVFGNLVDNCFNACVDDF
                     TSKALSGRESGCISRCVTKSMTTQTRLGERFAELNAAMTAEMQKR"
     gene            complement(980229..986355)
                     /locus_tag="MYCTH_2303581"
                     /db_xref="GeneID:11512746"
     mRNA            complement(join(980229..981851,981958..986008,
                     986081..986355))
                     /locus_tag="MYCTH_2303581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662622.1"
                     /db_xref="GeneID:11512746"
     CDS             complement(join(980490..981851,981958..986008,
                     986081..986151))
                     /locus_tag="MYCTH_2303581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662670.1"
                     /db_xref="GeneID:11512746"
                     /db_xref="JGIDB:Spoth2_2303581"
                     /translation="MATLTDRSYFPPLGECLSGNKIILSWRLVATALEDLACDRLRSA
                     AVSAFLRDGYVHQLLREPTKTFAPPTNETKLDFETKTGAINVVPSPNDPYNLDTIKDD
                     ARWLSRNVNINEVAALRVVIIEYQSRAHSHLTGPLSTQDVANVQEAAGVGDAQASAIV
                     ALLNVTTVADADSAWADFESETTRRRRLLATYLSERRSFLAAVDALLAFLLHSRAPGT
                     GVELDPLRNAVLQGAFGFDQNAAKPDTTQLDALAPTYIRTLEGCFDRMQMAPESLDNQ
                     MLTEQFEVDWIRTALTEAIHAMSLIFQILDLKASQFAAPALVTQWFALMDTCEFFEPV
                     PRGHELIAELLMPLHSLVAAISLKLLNVDRTLSYLDQDVDLLEEEEPYLASSDNLAQM
                     HTTIAAAASAGLISTMPVVFAWSLILHQMHVGYQERAERRDLLQNQRAQAGFELEYEP
                     SGRQRRNSAGSIVSIEASSYDVFLVSQQLERNIEPAENMARIATGRGQVYELMADMAV
                     CLGSGQLAAFRPVLGARARLTFQDLLKRSAHYVGYQAEPVSCLLSILSGGSQYWDISA
                     EAPSNEKSALDIYTRMLSDDTLNVQYASQSRNRFPYEFLPFASMCRILSAALVSDNES
                     SELITGLLVKNPSLTLNWDPRWDRSYELVFEEENTNSFRLTKDIDLFDAASKSNRRIL
                     PEEKCTISRGTFGRFVTDVGRVAKLEFEHSTLALFGKRLEVNLMAGAYDTALGYLSAD
                     ELIEGISLLATVLRAETLRSSKTDPDRGLRILTEASRLLSRGRDIMNVVCDTLDSLVE
                     EELADLDGPKTAALSSCLQFLHAALPVCPGRVWAYMARCPLINTDTRSGRLSRITANL
                     DMLAERYDLLLSAVKLFSSLVDSAKTSAVQRRSGISVNSRAKGEENPWIGASDKIVSR
                     VTLSIAQTSVDVFENSATWRFPSEVDRSVMIRDVVGIMHKLMLYTHSVGSTDTPRSLT
                     GPLAPAADYVVESFLSSSSSSLRFQPLLATLLAAFQLPDTTIYQRRAQIVSERLTTVL
                     EFATILLRVADYLNKASAGIQTQLFKSACVIARLPAIRHSFRIPAISLLSALVESAGK
                     SSGEPPSLLGYLGPQVSRSFIQIAAQLDKPFDRVAEVASTWRFFSTILRNRQQWMANC
                     LLTGKTPREALKGEAKISQLTAGSVLSTALEKLRAIKDISSQELLAVLDFFTSAQNYW
                     PWTIFAMQKDKTFLQELRAYVRDLKAPAVVSKANPAEACYQARIAAYIAETFAMQLYH
                     LRQMRQEQTFAAEVVNDLDYFLRDGVAVSDYNSSLHANFSRNFAKQYQGFSVDDFKRT
                     LLVPRDLGSQYYYALDVAESMLSYDAGWAGPRQNGFRREMEAANLNLSLVEAEVALFH
                     AWEYLLLELSICLLPKHQSVARQMLQVAEQCLEANQRPQPPENIFVVLAHSRANLGLT
                     LLQRLADYSLLPKDISQLLSLVSATINGVDNPWSKDQISYFRTLLKVLFVVLRGTKHS
                     NNAAPQKPTAESPVAVTQLVLTTLDRVVARSFRNLAALVHEPDAATTPEDLALITAIL
                     QACLSVPGIEQCQLQVLNIMSSHNVLQVATSLFSWSDRLAEKGDPIYGELALLLLLEL
                     SALPALAEQLACDGLLGHLTSANLAGFMRRANVSPFTDNAGAARCYAIWAKGILPLLL
                     NILGALGATIAPEVAFVLNQFPNLLRSSVDRLEAPGLSRTVPLSSRDAPGAGPHYFVA
                     LVALSEVHSLALLTRVLAALRSGNARDIPEVVWDSGAVLENVEFWLASRKVLRERLLP
                     LNPREAEWRGMKASEGSGCETKLEEKAVGLLEGIRDVLAEEEE"
     gene            986779..989707
                     /locus_tag="MYCTH_2303583"
                     /db_xref="GeneID:11512747"
     mRNA            join(986779..987421,987511..989707)
                     /locus_tag="MYCTH_2303583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662623.1"
                     /db_xref="GeneID:11512747"
     CDS             join(987099..987421,987511..989503)
                     /locus_tag="MYCTH_2303583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662671.1"
                     /db_xref="GeneID:11512747"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="JGIDB:Spoth2_2303583"
                     /translation="MPAASDIVDYSPHHPDPSPLIPTATNLILIDNYDSFTWNVYQYL
                     VLEGANVTVFRNDKITLEELIAKKPTQLVISPGPGHPNTDSGISRDAIKYFAGKIPIF
                     GVCMGQQCIFDVYGGDVSFAGEILHGKTSPLSHDSKGVYAGLPQGLPVTRYHSLAGTH
                     VTLPECLEVTSWIAKEDGSKGVIMGVRHKEYTIEGVQFHPESILSAEGRVMLRNFLHL
                     QGGTWAENERLQRATEGSKKASSAPDGDAKTAAKPKNNILQKIYAHRRAAVAAQKEIP
                     SQRPSDLQAAYDLNLAPPRISLVERLRNSPFDVALAAEIKRASPSKGIFALDIDAPTQ
                     ARKYALAGASVISVLTEPEWFKGSIEDLRAVRRVLDGMPNRPAVLRKEFIFEEYQILE
                     ARLAGADTVLLIVKMLEPEVLERLYKYSLSLGMEPLVEVQNSEEMAIAIKLGAKVIGV
                     NNRNLESFEVDLGTTGRLRSMVPKDTLLLALSGINSHQDVLDCKRDGVNGILVGEAIM
                     RAPDATKFIRELCAGPDAPAPESSSSAKPLLVKICGTRSAEAAIEAVKAGADLVGMIL
                     VPGTKRCVSHETALAISEAVHSSKKAAPAATEAVHVPQTATDFFALTGETLRKRAPLL
                     VGVFMNQPLAEVLEKQRLYNLDVVQLHGDEPLEWARLIPVPVIRKFGPGQVGLGTRGY
                     HAVPLLDSGAGSGQLLDVDAVKGALERDQGLSFLLAGGLGPENVAQAVAALGPLAERV
                     LGVDVSSGVEADRHQSLDKIREFVKAAKAIR"
     gene            <990531..>991703
                     /locus_tag="MYCTH_2117942"
                     /db_xref="GeneID:11512748"
     mRNA            join(<990531..990732,990858..991055,991112..991215,
                     991384..991617,991680..>991703)
                     /locus_tag="MYCTH_2117942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662624.1"
                     /db_xref="GeneID:11512748"
     CDS             join(990531..990732,990858..991055,991112..991215,
                     991384..991617,991680..991703)
                     /locus_tag="MYCTH_2117942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662672.1"
                     /db_xref="GeneID:11512748"
                     /db_xref="JGIDB:Spoth2_2117942"
                     /translation="MRSRKEKPIFRGLTIAAAGDLGGSAQWTDANAARWVGLREGRFV
                     REMSDEVTHVVCSGEEFRKGRGLVKMALKRPKTCQIVTLDWLEDSMLRGKRLDEEPYS
                     HLRALRRERERERKRLMVIKGLEKAVKEVNPQLYHLYRDHTFFQYQVVITRDNEEAGI
                     QGERYILSIFESNNSKPRMYWFVAKYYKKKGDAQPKIHRPSHAPGVFSREFALFESFF
                     RIKTGIPWAQRLVKAGTTDKSFFQYQPPTGGKPVG"
     gene            complement(992282..993880)
                     /locus_tag="MYCTH_2303587"
                     /db_xref="GeneID:11512749"
     mRNA            complement(join(992282..993549,993647..993880))
                     /locus_tag="MYCTH_2303587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662625.1"
                     /db_xref="GeneID:11512749"
     CDS             complement(join(992578..993549,993647..993817))
                     /locus_tag="MYCTH_2303587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662673.1"
                     /db_xref="GeneID:11512749"
                     /db_xref="JGIDB:Spoth2_2303587"
                     /translation="MARLMPGITATSIPRRADPLTDLTLLLSRLQRTILHADAEREER
                     LRESEFEREKAQANINYARSLLTKLEQETLAVKIHSRRQEVQADLVRKREVLEQLSER
                     LSDLAEFAAAGHAGNGEDEDSSDGEDILADIIVTPSESMESTKSPGIVPEESNEVPEE
                     VSEPIPTALDSPPPPPQTNEQSDTPSQPEQLPPSTTVHPPSLSSQPPPPPPPPPTTTT
                     TTTTTATTTSQTLRARQTEPPAPSTPSPAAATTSSALFGDGKRRSSAGATTTAISTTE
                     AILDHQRAEQDALSESILKLASELKASSRAFSASLEEDREVVERAGRGLSRTGQQLEG
                     VTRRMGLLQRMTEGEGWWGRMRLYAMVYGLMVVLVLVVFVLPKLRF"
     gene            994242..996469
                     /locus_tag="MYCTH_2303590"
                     /db_xref="GeneID:11512750"
     mRNA            join(994242..994652,994761..995030,995082..995286,
                     995361..996469)
                     /locus_tag="MYCTH_2303590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662626.1"
                     /db_xref="GeneID:11512750"
     CDS             join(994791..995030,995082..995286,995361..996274)
                     /locus_tag="MYCTH_2303590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662674.1"
                     /db_xref="GeneID:11512750"
                     /db_xref="InterPro:IPR003788"
                     /db_xref="JGIDB:Spoth2_2303590"
                     /translation="MRMCLTSDLGGYYTGALEEGRDQFGLKGDFVTSPEISQVFGELC
                     GIWYVAEWIAQGRQSKGVELIEVGPGRGTLMDDMLRTIQRFPAMASSIDAVYMVEASP
                     ELRVAQKNLLCGEDAPMTESKAGYHSVCKYNALPIVWTETIKSIPIAPEKMPFIMAHE
                     FFDALPIHAFELVYVPATQTATPSPTDTAAPSTKTSHPTLQWREMLVSPTPPGSTHES
                     LHTPASQSRDTPPPDFQLTLAKAPTRHSLYLPELSPRYRALKTTVGAGALLEICPDAS
                     LYAADFAARIGGSPQHPKPKPSGAALILDYGPGDGTVPTNSLRGIRRHRRVSPFAEPG
                     LTDLSADVDFAALAESATRASEGVEVHGPVSQADFLEWMGIRARVDMLVRAIKEAPGG
                     GGAAAAAIDKDKRVEDVRKAQARLVDRGPGGMGKVYKALAIVPENEGRRRPVGFGGDV
                     VV"
     gene            complement(996477..999126)
                     /locus_tag="MYCTH_2303593"
                     /db_xref="GeneID:11512751"
     mRNA            complement(join(996477..997828,997878..997952,
                     998011..998583,998651..998678,998733..999126))
                     /locus_tag="MYCTH_2303593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662627.1"
                     /db_xref="GeneID:11512751"
     CDS             complement(join(996852..997828,997878..997952,
                     998011..998583,998651..998678,998733..998807))
                     /locus_tag="MYCTH_2303593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662675.1"
                     /db_xref="GeneID:11512751"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="JGIDB:Spoth2_2303593"
                     /translation="MRRWASSLLLLLLSLWTAAALEIKLDQTDNQRCAGMYSKSSWGG
                     PVDPYIHVKFTGVGKDQGDDPMVSLLIFDWKDQDFLNVLPDGEDRAAICQPEYVEAGL
                     CNETDIGKFLVSPNATDQSVNVILTKAVHLKDSAPIKYPITKTGYFCVVTEKFGATTY
                     EAIVEFRNAYGELPATQIPKLPFYGGITIAYALVLVYVRRTAGPGHGLTTRRFWGFLY
                     FQHRSDILAVQNYITAILIFLVVEMLMTWGFYDYLNRHGSNVGSQVLLVVVAILNAAR
                     NSFSFFLLLIVCMGYGVVKHTLGRTMIYVRWLAIAHFVFGIVYAITSLVVNPDTAGPL
                     VLLVVLPLAGTLTAFYVWTLNSLNWTLKDLRERKQHVKETMYRKLWWCILISIIVIFA
                     FFFFNSFSFASASDPDYVPFHWKTRWFVLDGWLNLVYFADVAFIAYVWRPTANNRRFA
                     MSDEIAQEDDGTFEIANLDIGNPDESDDEDEEAKIGSGKQQGQNGGQAQSSAAGGQAQ
                     QSAQQQQQRSSQPSGAASSAARKPSQPVSRESLDGETIFAVGEDGKFSDEEDDDNEEE
                     SGQLVKGRK"
     gene            999283..1001381
                     /locus_tag="MYCTH_2303595"
                     /db_xref="GeneID:11512752"
     mRNA            999283..1001381
                     /locus_tag="MYCTH_2303595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662628.1"
                     /db_xref="GeneID:11512752"
     CDS             999413..1001230
                     /locus_tag="MYCTH_2303595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662676.1"
                     /db_xref="GeneID:11512752"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="JGIDB:Spoth2_2303595"
                     /translation="MGKGTDKLYINHSEWSSTDAYSASVGANARKQGGGAAHASFKRL
                     PFHFCAASLQPFKNPVCTPQGTIFDVEVIGAWLEKHKTNPVNGEPLAAKDLIRLNFAR
                     NADTAAQDDRNGAPAPTDGKGDFIDPVTFKVFTDNTHIVAIRHGNYANVFAWETVERM
                     NIKAKMWRDLVDDVEFTRKDIITLQDPQNAASRDLGQFRYLQEGQDAPLLTKEQAEQR
                     EQGGINVGALGRLGDKVLRAKEAVERARQARATGGDVNRITKSLANNPSSKTSSSSTT
                     TTTAAANPASRAPSAIQEKKLAPNAAIYTTGRTAASFTSTGLTPSTSTERAILSDEEW
                     MLRPRRIRHKGYARVETNLGALTVELHTETAPKAVWNFVRLAQKGYYRGVRFHRNIRN
                     FMIQGGDPTGTGRGGQSIWGRAFADELEGPHVHDGRGVVSMANKGKNTNSSQFFITYR
                     PAKHLDRKHTVFGRVVEGADSTLDKMEAVPVEEGTNRPLQDIVIQEVVVLIDPFEEFL
                     KEKNKKEEEDKSREEARRLGGNEDDRTTWTGKRIRADGAVVGDEKAKGVGKYLKDAIA
                     AAAAAQQDDGGGAESVETWEEPAKKKVKMGGGFGNFDSW"
     gene            complement(1001382..1004106)
                     /locus_tag="MYCTH_2303596"
                     /db_xref="GeneID:11512753"
     mRNA            complement(join(1001382..1003564,1003813..1004106))
                     /locus_tag="MYCTH_2303596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662629.1"
                     /db_xref="GeneID:11512753"
     CDS             complement(join(1001534..1003564,1003813..1003872))
                     /locus_tag="MYCTH_2303596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662677.1"
                     /db_xref="GeneID:11512753"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2303596"
                     /translation="MVYCGKPSKGCSNCRERKIRCDQKEPGCGQCEKRRQRCPGYRNL
                     VDLMFRDESSHVIKKAKARARKRANLATSPPTPPPDSCCLSATPESRTRHLSLVVPPT
                     PACSSSADRDGDHNDDSTSMLMSPESGSWPVTPPMAQLYNIPATCQEDGFAYFFSRYV
                     TADETVSCQRFDFLREVWKPSHDAHKDGVLASMTAVGLMGLASTTQSPCLMDAARKSY
                     CTALRLTKHALQDPTEAVKDSTMLSVLILGVFEIMAENTQKVITCRAFQEHVKGAAAL
                     ARMRGPAQFRTEAGRRMFSMLCERVAVSCAQRNEPMPEFLIELGNEMLRTAENEKPGS
                     QLMELKWKVLKLRYEMKSGFLSDPATIVDRLLSIDEEFENLIAELQPHWKYRILKVKQ
                     DHPAVFGGICHRYTSIQHANAWNHIRTTRILILETILAEIWRDFSSFPPTLDSARYLD
                     IFHKARRKLKHIVLDVAASVPQQLGLMNSADGSIGRGDRDSDGDDDCESAAPIATVEI
                     VSTPSPPVSPSARSSDSASTSGLSDPLSATGPRRRPGGGLTIIDVVKGRDAEDEAERY
                     MLLVSATSTIVWPLFVAGMSTVCSADMAAYAVGRLRTLYMETGIRQADAVANMLEEHD
                     MVAGLEVPVAGAEDGAGVQAGGGPPWVDMVGLGGSGHEADTGPGMGQDYDAMRPMPLT
                     SPGMTKPDSDLVWV"
     gene            <1007564..>1008805
                     /locus_tag="MYCTH_50254"
                     /db_xref="GeneID:11512754"
     mRNA            join(<1007564..1008064,1008215..>1008805)
                     /locus_tag="MYCTH_50254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662630.1"
                     /db_xref="GeneID:11512754"
     CDS             join(<1007564..1008064,1008215..1008805)
                     /locus_tag="MYCTH_50254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662678.1"
                     /db_xref="GeneID:11512754"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="JGIDB:Spoth2_50254"
                     /translation="LIIITGLPTSGKTTRARQLYDYLSTRLTSQSSSQHQQQQEQQQQ
                     QKNPSPNPSSSPRPPYRLHLISDSTLSIPRTVYDLSPASLPAHVRSANASEKDARAAI
                     YGAVKRVLSPRDIVILDGLNYIKGWRYQLYCEAKNVRTGSCVLQIGAGVERARRVNEA
                     RLARKRTADLEEGGSGDGDDEEPYEPSNWENLVFRYEEPNAMNRWDSPLFTLIWEDDE
                     AQTRAVFDKIWDAIAGEGRKPVKPNQSTVQRDKDPGGDYLYVLERETQDIVKKILERQ
                     PDEGGGTVALPRASNPAAGVQEAEGESDLVVELPGKKVGLPQLQRYRRAFVALNRGGI
                     GLEAVGKLAAERLRESFVGYLNDAFEKDG"
     gene            complement(1009696..1012079)
                     /locus_tag="MYCTH_2303597"
                     /db_xref="GeneID:11512755"
     mRNA            complement(join(1009696..1009908,1010002..1012079))
                     /locus_tag="MYCTH_2303597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662631.1"
                     /db_xref="GeneID:11512755"
     CDS             complement(join(1009751..1009908,1010002..1011961))
                     /locus_tag="MYCTH_2303597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662679.1"
                     /db_xref="GeneID:11512755"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="JGIDB:Spoth2_2303597"
                     /translation="MSTDYAYDEEGVLWPFFVFTLALIVTIPLTFLLVKRSRDPAASF
                     PRIQTSFKHAHTDTVDSLRKQERRKDRKIWLLFAVIAGWAVMGYMLYLIQTTDAPTHK
                     IWNPYEILNLPETATEKQIKSTYKKLSLRLHPDKAKPDPSKNETIEDLTARYVEISKA
                     YQALTDEEIRNNYIQYGNPDGKQGYSINIALPKVIVSDGNGKYVVLLYSALFGVLLPY
                     LVGSWWYGTLRRSKEGVLMESANRIFREYRDNIDEGGVVTALSTGKEFEELFKGDKAE
                     SGLSKVESRILAEGELTPLVGGLSVKDKETLEDLDNGPRRKTLALLWAYLGRIELDDA
                     ELNRAKFAVAPIAHSLNKAFNAIALAYMNTGPLLASYYTSQLLIQALPPKSSPLLQLP
                     YFTPAVVRAVEGDSRIHTSVQDFMDRPDAKRRSLVVGKGLLSEEQYREAVSVAKQLPF
                     LRVAKAYFKVTGERFIVPSSLVTLVVKGRFVPPGSEKVPDIDPNDLEDVDPAEDDLEA
                     ISGRKTQRLVGKDEKTGKPIYESVEAEHIPAPLAAAPFFARDHSPRWHVFLTDSKQGR
                     VAVPPFTFAQFDRPIFEADGRTPTFAMQTLKAQFQAPPQAGHYTFVMHVVCDSYVGFD
                     TKMEVTLIVEEASKAAAMAAEDEISEPDEDSIAGIMHAAKGGQTKKRQPASDDDEDSD
                     EESGTDDDDDDTSVTNTDTEPEN"
     gene            complement(1016722..1018235)
                     /locus_tag="MYCTH_2303602"
                     /db_xref="GeneID:11512756"
     mRNA            complement(join(1016722..1017409,1017470..1017905,
                     1017962..1018235))
                     /locus_tag="MYCTH_2303602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662632.1"
                     /db_xref="GeneID:11512756"
     CDS             complement(join(1016994..1017409,1017470..1017905,
                     1017962..1017964))
                     /locus_tag="MYCTH_2303602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662680.1"
                     /db_xref="GeneID:11512756"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2303602"
                     /translation="MSVPSTYKPSPLGYGTGSARSSPFRRPQSPASAAPLRQTTPSAT
                     PTKEGFSEVRAKFMGSSVTSPTPQEPRTSRGHATVEDGLNTHVLEQRSIPRPTTSNSV
                     GHGNALSQLQPSQVRTMREAFQILDRDSDGVVTREDVADMLNQLGLPSSAGDISHFFP
                     PSAPQTMTMALFLNSIASSLAALSPSSELLSAFSAFDDDDSGQIDVAELRDALLHTAP
                     EPGQEPLTALDVEKVIAGFTGRRAFSKHTAAGLGKRGEVFRYQDFVNTIAGGNGTAAQ
                     APHDSEDE"
     gene            1018844..1021655
                     /locus_tag="MYCTH_2303605"
                     /db_xref="GeneID:11512757"
     mRNA            join(1018844..1019747,1019804..1021051,1021121..1021655)
                     /locus_tag="MYCTH_2303605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662633.1"
                     /db_xref="GeneID:11512757"
     CDS             join(1018926..1019747,1019804..1021051,1021121..1021552)
                     /locus_tag="MYCTH_2303605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662681.1"
                     /db_xref="GeneID:11512757"
                     /db_xref="InterPro:IPR013925"
                     /db_xref="JGIDB:Spoth2_2303605"
                     /translation="MATSQFAPNLLKRTNSAVGYSNGTALQHRRSLTTIPSSRPTRSP
                     QPPEMDQTSDPSFKGKAPSTRTGASSQHSSLSASAQPRSDAALRRPRKLRSQYPRGSS
                     ENHVEYILVASFDIDRGPVMEHQYPVAITGDEHMLAELMLPDQAHVRNQDWTIFFLHK
                     DTSQEEDDAERRAKEERRARRRRKRDREKGIIHESDDEGDENGGLDDDDDDDDDDDDD
                     WDDDLSTDSEPESSEGPPLVYVLNLVNTKQDKTVKRGAVVKAMAICTRHPFLHIYKPL
                     LLLALDEYFKAPVPETLAMLYNAVNEMDLSLMPKLNWLEKHLLQSSDNKDLFVEKFEQ
                     MIEDRIAGTSGADVGQPLDASNAPPPRPTIFRSGSKAHIEGHAAYVVPRDTHEFESKV
                     MYKGIPIPVKVPVAVMPEIVGDFSLIKLIQNFSDPHSKSPQTFPLHPHLTTNGPNTHP
                     IIVLVNALLTQKRIIFLGHNMPSGEVAEAVLAACALASGGILRGFTRYAFPYTDLTKV
                     DDLLKVPGFIAGVTNPTFEHHPEWWDLLCDLSTGKMKISSKIEAAPITEGLVYFQQQN
                     PAYANLVHSSSSSGSSSNDLTGDAAFMAEILRCITTRAGERVIRAKWRAWVVKFTRIA
                     AAFEESVYGASALYIGTDEQDANLSAAAHGHGYVWVDEATKAKELAGNVTRIEGWRNT
                     RSYYSFIQDVARLHHVRPLKGIDLAHLHDRLRTQRLTPEQSKEIYHTLAKYVHSYDEI
                     CMLLSVAPESQAGLFYIALGLFHKDRDVRFKTAELLERVAEHEAGQHWWRVLSRFEKL
                     AYVRIKREAEAEMKAKLEREEKDAFGRDIGDRRIS"
     gene            complement(1021693..>1022886)
                     /locus_tag="MYCTH_2138853"
                     /db_xref="GeneID:11512758"
     mRNA            complement(join(1021693..1021971,1022092..>1022886))
                     /locus_tag="MYCTH_2138853"
                     /product="carbohydrate esterase family 1 protein"
                     /transcript_id="XM_003662634.1"
                     /db_xref="GeneID:11512758"
     CDS             complement(join(1021888..1021971,1022092..1022886))
                     /locus_tag="MYCTH_2138853"
                     /note="CAZy_ID 267771"
                     /codon_start=1
                     /product="carbohydrate esterase family 1 protein"
                     /protein_id="XP_003662682.1"
                     /db_xref="GeneID:11512758"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="JGIDB:Spoth2_2138853"
                     /translation="MAFETKATIASFGGKLFKLSHQSEETTTPMAVNLYLPPQSFASD
                     PPPRVPVLFYLSGLTCTPENCSEKGFFQHRASQLGLAVVYPDTSPRGLGHPGETDSWD
                     FGAGAGFYVDATRDPWRRGYRMESYVARELPRALFGDPQYGRFLDPDRVSITGHSMGG
                     HGALTLYLKNPGLYKSVSAFAPIANPSRCPWGEKAFSGYLGPDRDEWKKHDATELIRA
                     WKGGDLKALVDVGTADNFYKQGQLLPENLEKAAKEAGVEGLTVRYHEGYDHSYYFMAT
                     FSDDHVNHAAKHLGLL"
     gene            complement(1023146..1024316)
                     /locus_tag="MYCTH_115983"
                     /db_xref="GeneID:11512759"
     mRNA            complement(join(1023146..1023673,1023795..1023943,
                     1024109..1024316))
                     /locus_tag="MYCTH_115983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662635.1"
                     /db_xref="GeneID:11512759"
     CDS             complement(join(1023511..1023673,1023795..1023943,
                     1024109..1024198))
                     /locus_tag="MYCTH_115983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662683.1"
                     /db_xref="GeneID:11512759"
                     /db_xref="JGIDB:Spoth2_115983"
                     /translation="MLFSATIAGFLLAFLAQGSPVPTEHNKIGGVLICNDPNGQGHCE
                     YAVYELEKCYNLPPALVNNAATFAPDDAPFYCYPYLTACGGVCKSPTGCTMGAVSSDY
                     EHKFNLTEVGWNKYITSFDCHLNKTGDATSQ"
     gene            complement(1025133..1029116)
                     /locus_tag="MYCTH_107796"
                     /db_xref="GeneID:11512760"
     mRNA            complement(join(1025133..1025861,1025927..1025997,
                     1026056..1026234,1026294..1029116))
                     /locus_tag="MYCTH_107796"
                     /product="uncharacterized protein"
                     /note="Has EST support. More significantly expressed at 45
                     degrees C"
                     /transcript_id="XM_003662636.1"
                     /db_xref="GeneID:11512760"
     CDS             complement(join(1025672..1025861,1025927..1025997,
                     1026056..1026234,1026294..1029003))
                     /locus_tag="MYCTH_107796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662684.1"
                     /db_xref="GeneID:11512760"
                     /db_xref="JGIDB:Spoth2_107796"
                     /translation="MRPALSLVALAASAMAAHIPIRGERGLADRSDGYGHHKPDDAYA
                     YGGEKHDDKKHGNGYYALPRPDGYGYGKPGDVCKSGKPDDPYEIGKKPTGKKPDNSNE
                     SESGSDSGESDSEDESSKDPKYPDQDDKSGDKFKDGNYADKYDDKFKDGKYDDKHDDK
                     YGESDSGSGESDSEDESSKDPKYHDQDNKHDDKYGDKHDDKHGDKHDDKHDDKHDDKH
                     DDKHDDKHDDKHDDKHEDKHEDLKRDLSDKHEDSYGKDDKKDGDSYGKDDKKDDKEDS
                     YGKDDKKDDKEDSYGKDDKDDKEDSYGKDDKKEEDSYGKDDKKEEDSYGKDDKKDDKK
                     DEDSYGKDDKKDDKKDEDSYGKDDKKDDKEDPYGKDDKKDDKEDPYGKDNKKDDKEDS
                     YGKDDKKDDKEDSYGKDDKKDSYGKDDKKDDKKDDKKDEDSYDKDDKKDSYGKDDKQK
                     DDKDLYSGKKDSYKDDKKEHEKEDSKGEESGSEEEESGSEDEKGLLGDDFDIFNDDAE
                     ESEDKKKKSEKDDKKKHEKEDSEVEESGSEDEKGLLGDDFDIFNDDGEESEDKEKKSE
                     RDDKKGKKEGSEDEESGSEESGSEDEKGLLGDDLNIFDEDDIDIFSDNGKESKDGEES
                     ENEKKKSEKNDKKDKYKDDKNKDVYKDDKKDTFKDDKKDKYKDDKKEDKEGSSEDEEG
                     GSSEDEKGLFGDDLDLFGDDDFDLFNDDDEKSEDEKSKKDKKKDSNKDDKKDIYKDDK
                     KDKYKDDKKDKYKDDKKDKEEKEDSSEDEKGSASEDEKGSASEDEESDGLFGDDKEES
                     GEEDESKDDAWLELRSLNDRTYDDDDGDDDEYGYGEDESPEEDYETVTTEVIATYTTV
                     CPVTETYTKPGHTYTSTYTTTSTVKTAVPTTIVITKTEPPVTKTAGEVVYSTRTKLHP
                     VTETKVVGGSTVEITWTSTSTVVTKVRQTETIYTTSVATEYETTDVYTTISCPVTTYT
                     TVSKGSTIEVTKTNTFTVTNTVPHHKPHHTPSKNATTSSYPTYAPPPIVTAGADSLVV
                     NGGKAVALLAGMFGAVVLF"
     gene            1033271..1035848
                     /locus_tag="MYCTH_2303613"
                     /db_xref="GeneID:11512761"
     mRNA            1033271..1035848
                     /locus_tag="MYCTH_2303613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662637.1"
                     /db_xref="GeneID:11512761"
     CDS             1033357..1035720
                     /locus_tag="MYCTH_2303613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662685.1"
                     /db_xref="GeneID:11512761"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="JGIDB:Spoth2_2303613"
                     /translation="MSSLRILLIGNGGREHALAWKLAQSPLVESIIAVPGNGGTARLP
                     KTTNNTSVAADDYPGLVDLARKHGVNLVVPGPEAPLVDGVEGFFREAGIPVFGPSKEA
                     ARMEGSKTFSKDFMKKHNIPTAAYENFSDYDKACQYLKSIKHNVVIKATGLAAGKGVI
                     IPQNQEEALKGLKEIMLDKSFGSAGDEVVIEEFLTGDELSILSFCDGTTIKSLPPAQD
                     HKRIGEGDTGLNTGGMGCYAPTKLATPQLIARIEREILQPTIDGMRKDGFPFRGCLFT
                     GLMITPDGAPKVLEYNVRFGDPETQTVLPLLKSDLAKIMYACAGPVPYLEDVQVKVSS
                     KFSTTVVVAAPGYPESYPKNIPMRVANPPEGIHLFHAGTKLSGEGDALLTSGGRVIAA
                     TATGDSLRAAVDKAYEGVKLINFDGMYYRRDIAHRAFRGTRAADKLTYAQSGVSIDAG
                     NELVARIKAAVATTRRPGADAIIGGFGGEVDLSAAGHPGAPIIVGAIDGVGTKLIIAQ
                     KMNKHDTVGIDLVAMNVNDLVVQGAEPFMFLDYYGCSRLDVSVATSFVEGVAKGCIAA
                     GCALVGGETAEMPDLYTGDDYDAAGAAIGVMRASQRLPRKDAMAEGDVLLGLASSGVH
                     SNGFSLVRRIVANRGLQYTDPCPWDPAARSLGEALLTPTRIYVKPLLAALAQTGDAIK
                     GMAHITGGGLTENVPRMLPAHLAGEIDVGSWEVPAVFRWLAQDVEPAEMARAFNNGLG
                     MVLAVEASRAEEVARVLEGAGEKVWKVGRLVKRGPEGCVLRGLEAWA"
     gene            complement(1036406..1037997)
                     /locus_tag="MYCTH_2303614"
                     /db_xref="GeneID:11512762"
     mRNA            complement(join(1036406..1036801,1036857..1037997))
                     /locus_tag="MYCTH_2303614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662638.1"
                     /db_xref="GeneID:11512762"
     CDS             complement(join(1036605..1036801,1036857..1037574))
                     /locus_tag="MYCTH_2303614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662686.1"
                     /db_xref="GeneID:11512762"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="JGIDB:Spoth2_2303614"
                     /translation="MADFLLYVGYFLAGYTALTLFFYMLSAIIPKSAFVARALASYLS
                     LVISSLYGVVISVVLRASGRQQLAQWAVARSFKYLMGFSTGVTFEVEDPKGHLKNVRP
                     AVFIGNHQTELDVLMLGCMFPKYCSVTAKASLKKVPFLGWFMALSGSVFLDRANSKDA
                     RQALQGAANEIRDKRQSVYIFPEGTRSYAKEPMLLPFKKGAFHLAVQAQVPIVPVVVA
                     NYSHVLWIKGLVFNAGKIPCKVLDPIPTTGLTAADVDELTRSTRNLMLNELYALTEKA
                     RGQPVTKVEADGDNGVAKATGTDAKPAA"
     gene            1038972..1041486
                     /locus_tag="MYCTH_2303617"
                     /db_xref="GeneID:11512763"
     mRNA            join(1038972..1039851,1039907..1041486)
                     /locus_tag="MYCTH_2303617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662639.1"
                     /db_xref="GeneID:11512763"
     CDS             join(1039092..1039851,1039907..1041267)
                     /locus_tag="MYCTH_2303617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662687.1"
                     /db_xref="GeneID:11512763"
                     /db_xref="JGIDB:Spoth2_2303617"
                     /translation="MAASRRGQPPLSVRLAPPSAALADLPPISALFLIDFDVKAGYTI
                     IWKRAVPGLELEGAVEYKSLPSGLHTVTDDLIYFVHDGSHAGLSAFVNTPTDEEETRH
                     ARMISVGVLVPLSHGRLGRAWRHAEGLKDLAAKLAADRKQTQLLEQYWSRNAASETTA
                     PQPLKDIPLESPLLGIKTARPGLGKGHARNRSASDGTVLIPPGHCLSPFHPAWSLTSL
                     LDTFGPLVFPIHRAALLRKRILISCHAPVHEVCNFVYDISVLSNIPLSVCDVIDPAAP
                     VQRLRPLFCVGVHDISYLLESQVATKRGGPTVDPDDYPSNSEDSSSGWVACTTDSILA
                     MKEGLWDMLITMPPPYSSNAKQRVWPTVECPKGVPVKATQRDLRRFRSLCLGLARLAP
                     HPPSPKPRSSHSEASDSPTPALRLSQTAGSRSGTAAEDTDAIVEPVTWAALAYNGFMW
                     WASAGEKRHSDELDEQTHDASLLADLIPPVSPAVQQQQQQQPRERRPSLTAAAAPSGS
                     GMIPSLAPLTGRLSDEAEEEQDGDDGSEAQARIELAVVAYFHRLTTTILSVLADIVDS
                     TDDDDLLDLDLNDGHEAYTSEYDSPVGAAASSSGAGDRGSSSRRKTGQRRREEEEEEE
                     EEEEEARLLGATARAAAAAAGSGDERNRMGWVRVDSDALAEMGLDVWSQADADFVREV
                     SVRYFNRRAHVETKGVEVCGLRVC"
     gene            1042532..1043633
                     /locus_tag="MYCTH_2303618"
                     /db_xref="GeneID:11512764"
     mRNA            1042532..1043633
                     /locus_tag="MYCTH_2303618"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662640.1"
                     /db_xref="GeneID:11512764"
     CDS             1042665..1043300
                     /locus_tag="MYCTH_2303618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662688.1"
                     /db_xref="GeneID:11512764"
                     /db_xref="JGIDB:Spoth2_2303618"
                     /translation="MLLGVLAQVDRAAAPFAPAARETSAAQQQQEAAAAAAMTTARAT
                     ATGARSGGSGGAVAVAVETNRNGNAETDTAMDVDVGVAVSREEVMASIERDAGPRTST
                     STPTPRLTSGSDHTDPAGKAHPRSASLPINTLPTHRISHSSETPTAKTEPASKESSTN
                     PDPAAIKPKKKKAGKGDEFDDIFGGLDSNSKKPKKKKRKKGDEFDDIFSGL"
     gene            complement(1044018..1046826)
                     /locus_tag="MYCTH_2303620"
                     /db_xref="GeneID:11512765"
     mRNA            complement(join(1044018..1044420,1044490..1044966,
                     1045041..1045935,1046000..1046081,1046220..1046826))
                     /locus_tag="MYCTH_2303620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662641.1"
                     /db_xref="GeneID:11512765"
     CDS             complement(join(1044172..1044420,1044490..1044966,
                     1045041..1045935,1046000..1046081,1046220..1046361))
                     /locus_tag="MYCTH_2303620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662689.1"
                     /db_xref="GeneID:11512765"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="JGIDB:Spoth2_2303620"
                     /translation="MSMYPGHRGMGGVPPANGGAGRLNELLDQIRAEFESHIRQTETY
                     EHQIQAQVQEMQMIREKVYQMEQAQMGLKQKYEEEIAMLRRQLENRGGPPGPMNPPPQ
                     HVGPPQPPPQIGNPGNNTVIGAILSGQVTQGGLAPPPHPQQQEQQPSHLPPAPPGLQG
                     PPPPPPPPSQQPPFQQQYPQGPAPGGFPPQPPQSTASPGPGNKRAIGRPPAAGPATPQ
                     INTPVPYNGPGQSPQVPTHPTPDHTRMAQHPAPPPAHTNALGDLELERLPNHIKKVRD
                     DWWAIFNQSVPRVLDVDLVHTLQHESVVCCVRFSHDGKYVATGCNRSAQIYDVNTGEK
                     ICVLQDESIDLNGDLYIRSVCFSPDGKYLATGAEDKLIRVWDIAARQIRTTFAGHDQD
                     IYSLDFARDGRTIASGSGDRTVRIWDLETGSCNLTLTIEDGVTTVAISPDTKLVAAGS
                     LDKSVRVWDVKMGYLLERLEGPDGHKDSVYSVAFSPNARELVSGSLDKTIKMWELTTS
                     RQIGHGQQPPLKGGRCIKTFEGHRDFVLSVALTPDSEWVLSGSKDRGVQFWDPRTGHT
                     QLMLQGHKNSVISVAPSPVASPTGGFFATGSGDMRARIWSYTRLDRRP"
     gene            complement(1050845..1051641)
                     /locus_tag="MYCTH_2315050"
                     /db_xref="GeneID:11512766"
     mRNA            complement(1050845..1051641)
                     /locus_tag="MYCTH_2315050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662642.1"
                     /db_xref="GeneID:11512766"
     CDS             complement(1051235..1051636)
                     /locus_tag="MYCTH_2315050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662690.1"
                     /db_xref="GeneID:11512766"
                     /db_xref="JGIDB:Spoth2_2315050"
                     /translation="MDYLLYSLTFLAFLFATILYLTRARWVPPFQDRLHKAHFPGSAY
                     LYSHLGPGSFEDDIEAGLSSSNFDLTGNVEGGDSRSGLDDTAKREILRIMKKRRLKFD
                     EARKVYMEQRFKENGIGADGRPRDPKFVSFS"
     gene            1052196..1053192
                     /locus_tag="MYCTH_2315051"
                     /db_xref="GeneID:11512767"
     mRNA            join(1052196..1052271,1052338..1052423,1052483..1052506,
                     1052581..1052705,1052763..1053192)
                     /locus_tag="MYCTH_2315051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662643.1"
                     /db_xref="GeneID:11512767"
     CDS             join(1052232..1052271,1052338..1052423,1052483..1052506,
                     1052581..1052705,1052763..1052937)
                     /locus_tag="MYCTH_2315051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662691.1"
                     /db_xref="GeneID:11512767"
                     /db_xref="InterPro:IPR002672"
                     /db_xref="JGIDB:Spoth2_2315051"
                     /translation="MSNVSADLIWEVSRLQNSYLVKTKTGQFSRDPLNLTNLHSRKYA
                     GFANDKAIGISPNEKGGVKVISKKPAATNKPASSLYTVTYGGNKTSRKTYRAVANQAA
                     KNGYRPDLRAAAVARASAIRRSQRPVKPEPERKLRGNAAKKAAAAKQ"
     gene            1053753..1055654
                     /locus_tag="MYCTH_2315052"
                     /db_xref="GeneID:11512768"
     mRNA            join(1053753..1053776,1053868..1053931,1053998..1054029,
                     1054088..1054198,1054264..1054351,1054407..1054869,
                     1054926..1055070,1055125..1055654)
                     /locus_tag="MYCTH_2315052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662644.1"
                     /db_xref="GeneID:11512768"
     CDS             join(1053919..1053931,1053998..1054029,1054088..1054198,
                     1054264..1054351,1054407..1054869,1054926..1055070,
                     1055125..1055265)
                     /locus_tag="MYCTH_2315052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662692.1"
                     /db_xref="GeneID:11512768"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="JGIDB:Spoth2_2315052"
                     /translation="MVKAVVAGASGGIGQPLSLLLKLSPLVSELALYDVVNTPGVATD
                     LSHISSNAKTTGYLPANDGAKTAFKDADIIIIPAGIPRKPGMTRDDLFNINAGIVKGL
                     IEVAAEVAPKAFILVISNPVNSTVPISAEVLKAKGVFNPQRLFGVTTLDIVRAETFVA
                     EIAGKSNPQELTVPVVGGHSGETIVPLFSKIAPSVTIPDDKYDALVNRVQFGGDEVVK
                     AKDGAGSATLSMAYAGYRFAEKLLKAAAGVKGLVEPSYVYLPGIPGGKEIAEKTGVEF
                     FSVPIELGPNGAEKAVDILGDITDKEKKLLEAAVSGLKRNIKKGIDFAHNPPQK"
     gene            complement(<1055917..1057402)
                     /locus_tag="MYCTH_2091974"
                     /db_xref="GeneID:11512769"
     mRNA            complement(join(<1055917..1056048,1056114..1056203,
                     1056274..1056394,1056508..1056652,1056758..1057402))
                     /locus_tag="MYCTH_2091974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662645.1"
                     /db_xref="GeneID:11512769"
     CDS             complement(join(1055917..1056048,1056114..1056203,
                     1056274..1056394,1056508..1056652,1056758..1056935))
                     /locus_tag="MYCTH_2091974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662693.1"
                     /db_xref="GeneID:11512769"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="JGIDB:Spoth2_2091974"
                     /translation="MSFDPVMPPYNASDPAARFLSASCLDFLLIELVPMAYRVTNELG
                     AAAREQEGLLQGGSSGSAPAGAGAGAGTGTGTETTVMDEQEEREAVFWRLERIGYRVG
                     QGLVESRFSRDRPRFNDTLDVIKFLCKDLWTIVFRKQVDNLKTNHRGVYVLTDNSFRP
                     FSRMSAEVGSQAVIRAQPFLWFPCGIVRGALAALGITATVHAETTELPGAVFQIKTVS
                     TKP"
     gene            complement(1057593..1060374)
                     /locus_tag="MYCTH_2138861"
                     /db_xref="GeneID:11512770"
     mRNA            complement(join(1057593..1058353,1058409..1058634,
                     1058688..1058787,1058873..1059183,1059262..1059711,
                     1059915..1060374))
                     /locus_tag="MYCTH_2138861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662646.1"
                     /db_xref="GeneID:11512770"
     CDS             complement(join(1057963..1058353,1058409..1058634,
                     1058688..1058787,1058873..1059183,1059262..1059711,
                     1059915..1060062))
                     /locus_tag="MYCTH_2138861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662694.1"
                     /db_xref="GeneID:11512770"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="JGIDB:Spoth2_2138861"
                     /translation="MDDKAAEVQALVRTIQVPAISKATLQSICAVNGIPKTGNKSELQ
                     RRIIEQINSCSDRRDWARLHEIRESIVNRAPIFVTPALVSQTQNQPQSHSRPHSQSPL
                     SHLQLRSQPPSHSSYYQAAPPPTATASAMGSYSQPGYGAFDGLLAQHPPPPPYQQPPN
                     GSTGGRMRPNAGLVPPTIAYKPSPFYELKYQVGDVRTLEIMTAHRNSERISVKVQDHP
                     ALQLCLTDPSMRVMVMCTAGNVGPQDIAFPYQCELKVNGGDIKANLRGLKNKPGSTRP
                     VDITDALRFRPASYPNNVELTYALTQKKFYLALVVCKAISIETLVSQIQKKIRKESVI
                     AEITKSAGDPDVIATSQNLSLKCPLSYMRLKLPCRGISCNHIQCFDATSYLQLQEQGP
                     QWLCPICNKPAPFEQLAIDEYARQILTQTPESVEQVTIEPNGEWAVPGAKKEVTPDHE
                     TSYLDDDDVVVSEEVTKTARRASTGPSQAAAPTPHLATPTSVASRDASAAPRSSNKRP
                     APEVIDLTLSDDDEPPRPVKRPNQGFGLPSGGS"
     gene            1060658..1061560
                     /locus_tag="MYCTH_2315056"
                     /db_xref="GeneID:11512771"
     mRNA            join(1060658..1060964,1061021..1061062,1061117..1061560)
                     /locus_tag="MYCTH_2315056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662647.1"
                     /db_xref="GeneID:11512771"
     CDS             join(1060802..1060964,1061021..1061062,1061117..1061244)
                     /locus_tag="MYCTH_2315056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662695.1"
                     /db_xref="GeneID:11512771"
                     /db_xref="JGIDB:Spoth2_2315056"
                     /translation="MAKSARSRVVKENNRRLKQNVFGPVEAARAERLSAKLIALATAP
                     KPQKDIEMNEEPANETKEVAAKEDTMDVEDAKPASKKLSNKRKVEKRRRKKSSIVFPM
                     RGPKRNKK"
     gene            1062303..1065452
                     /locus_tag="MYCTH_2303639"
                     /db_xref="GeneID:11512772"
     mRNA            join(1062303..1062351,1062435..1062824,1062882..1063009,
                     1063068..1063438,1063490..1063701,1063762..1064045,
                     1064110..1064576,1064672..1065452)
                     /locus_tag="MYCTH_2303639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662648.1"
                     /db_xref="GeneID:11512772"
     CDS             join(1062594..1062824,1062882..1063009,1063068..1063438,
                     1063490..1063701,1063762..1064045,1064110..1064576,
                     1064672..1065288)
                     /locus_tag="MYCTH_2303639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662696.1"
                     /db_xref="GeneID:11512772"
                     /db_xref="JGIDB:Spoth2_2303639"
                     /translation="MPRLKAITTGSIPSFLDVVLNLDEGDESSSLASQDTWLAQMKAK
                     GTGKLVMYGDDTWLKLFPGTFDRAEGTTSFFVSDFTEVDNNVTRHVAGELKNDDWNTM
                     ILHYLGLDHIGHKGGPRSPHMLAKQREMDGIIRQVYTAMESESHLRSTLFVVCGDHGM
                     NDAGNHGASSAGETSPALVFIAPKLRALGRKLQSPVPEDESFQYYGTVEQSDLAPTLA
                     ALLGFPVPKNNLGALISDFLPFWPNTRDQVQLLMRNARQIKEIVLATFGPQIFETDPR
                     VDGLSEPNPDYQELAHTWRDLAERYGQADAELIPSINKWLHHAQEVLGSMASNYDMSR
                     LFLGQAAAVASLVAAVIAAVRSANDRAASFMPLSGVVLAYGIMMFASSYVEEEHHFWY
                     WATTAWFAYLGVRGFNRGNTSARLQTISCTALILATRIIRGWNQTGQKFAGGPDIVKT
                     YLNTNPALLWYLVSATYLWVHQNMVYGLSGLPIWLNYTIATGLVLAAFTFKVAFTLED
                     APELVASFARYALRLNFTQDASLIARARAVFIGLALVTAVTTLFMFARRRVSLGQSGS
                     STLLTLYTLLSLTQSRPQNIPLYLLFNAQYLVLSSPPLSGALSPAELSTTSLLLQHAA
                     FFALGGTNSIASVDLSSAYNGVASFDVAAVGVLTFVGNWAGSVWWALATYVMLLQRRE
                     AAAGGGRGGGGVVGTWRAHVGVLTLFVAGSVVAVMAACTALRTHLFVWTVFSPKYLYC
                     VAWSLGQHLVVNVLVGGVFYWLGVVEGGK"
     gene            complement(<1065594..>1069005)
                     /locus_tag="MYCTH_50142"
                     /db_xref="GeneID:11512773"
     mRNA            complement(join(<1065594..1065596,1065697..1066145,
                     1066293..>1069005))
                     /locus_tag="MYCTH_50142"
                     /product="condensin subunit Cnd3-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662649.1"
                     /db_xref="GeneID:11512773"
     CDS             complement(join(1065594..1065596,1065697..1066145,
                     1066293..1069005))
                     /locus_tag="MYCTH_50142"
                     /note="Contains conserved domain: COG5218, YCG1,
                     Chromosome condensation complex Condensin, subunit G"
                     /codon_start=1
                     /product="condensin subunit Cnd3-like protein"
                     /protein_id="XP_003662697.1"
                     /db_xref="GeneID:11512773"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Spoth2_50142"
                     /translation="MPPRASTRSTRSSTRASTASRASSTVNTDVPDEGPDNALRTQIA
                     SVFREAQRTTATHRKLVVTLRKIQEACCYEPTSVKKSASTAAATAADFDEDDFNAEFV
                     RCVLRVMPIKKSESVGEKTIRFIGLFLRHAVDKDNAAVGELDPDASTMPETPGTRLTA
                     HLVETILPLMTAKDKFVRYRSTQLISHVVNSLDAIDDDLFQKLRAGLLKRIRDKEAMV
                     RAQAVLGLGRLAGNQGDAEPDSDDSDDDGSSGLLERLLEVLQNDPSADVRRSLLVNLP
                     ILPSTLPYLLERARDQDAATRRAVYSRLLPALGDFRHLSLSMREKLLRWGLRDRDENV
                     RKAAARLFRERWIEDCAGTQPPAETGQPAEASPPNLDALLELLERIDVVNSGGENGVA
                     LEAMRGFWEGRPDYREAMIFDDNFFETLSAESVFVVRTFNDFCRNEGNGKFESLVEEK
                     LPEVTKVAFYLERYIKVLIDAIKRAEEQEVEDEEEEEDTAEQEFIVEQLLHIALTLDY
                     SDEVGRRKMFSLLRQTLSIPELPEEVTKLTVAALRDICAPDAAGEKEFCSIVLEAVAD
                     VHDTIVDDVPENDDESFHSARSEVSGDTTPTRSGKSKTPELSEEEAAQKAIKEIMINM
                     KCLHIVQCMLQNVSGDLQQNDHLVAMLNNLVVPAVRSHEAPVRERGLVCLGLCSLLDR
                     SLAEENLTLFMHFFTKGHTELQITALHILTDILNVHGAQLLSSNPALLKVYVKALRSG
                     AKHPEVQAAATVAVSKLLLGRVVSDHDVSAELLKTLVIAYFEPASSGNQSVRQALNYF
                     LPVFCYSRAENQDLMRCIALDALHTLYNVREGFDDDDADIDDEMVSLSTIAACLADWT
                     DPRKCYTPPSAGADGLGTDAAAEKRHVNADVHLDFAHDIIQRLGGNAPREEKKIIAAL
                     LGKLYVSPASSEDKTREVYAAICDAVDNQLVSDTASRNALYKIHVSLGKIVNSLDAAA
                     AASEAGAAGAGAPGGKYRRSVSRASSVGLAPSEDRTVVQPDVKIKEEEMEDEDMVSDT
                     GTAVHRSNDQSLVSEALSEDGGEG"
     gene            1069357..1072203
                     /locus_tag="MYCTH_2303648"
                     /db_xref="GeneID:11512774"
     mRNA            1069357..1072203
                     /locus_tag="MYCTH_2303648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662650.1"
                     /db_xref="GeneID:11512774"
     CDS             1069493..1071901
                     /locus_tag="MYCTH_2303648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662698.1"
                     /db_xref="GeneID:11512774"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2303648"
                     /translation="MGNSDKKRQREAEEAPAGPGESAAQTPDPPSKKARLDSHRQLFV
                     RSLPPDATSESLVEFFSQHYPVKHATVVLDPKTKTSRGYGFVSFADPEDAAEAKEKLK
                     NELFHGRRLQLDIALPRLRDASKVDPEVVSKTIEEKRKREAELELARKPPKLIIRNLP
                     WSIKKPEQLAKLFQSFGKVKFVDLPNDKGKLAGFGFVTLRGRKNAERAMEAINGKVVD
                     GRTLAVDWAVDKQTWEKLKDAADQDEAKAKSPKEKKSEKAKSDKKEEDEDDDPNMTQE
                     DRDLVNFFKNYGDNLEDEEEEDDQESEEDDEEKSHGEEDQDGDSESGEEEEEDQEEDE
                     DSESDVEESDDSDDEEDKKKPKKPLTDNSTTIFIRNLPYSTTDETLKAHFTRFGRVRY
                     ARVVMDRTTEKPAGTGFVCFVREEDFKACLKGAPRHKPAPMLAKHSVLQDETADPEGN
                     YTLDGRVLQVTQAVSKDEAARLAEESKGRRKEDKRRLFLLSEGAITPKSPLYSKLTPA
                     EIKMREASAKQRKKLIESNPSLHLSLTRLAVRNIPHSLSSKDLKALARRAIVEFAKDV
                     KEGRRLPISKEERERGGEADREAERRRREKGKGVVRQAKIVFETAQGSKVDEKTGGGR
                     SRGYGFIEYWSHRRALMGLRYLNGHPLKNEAGKTPRLIVEFAIENAKVVQRRRQQEEK
                     SRMAKEQKAAGGAGKDGKGKVKGKGNDKKEKGMEQKDGSGRSKGKGSKGRDGKDGKGG
                     KPGKGAKPGKGGKKSAAEAKAGVPPAKQGKKKADEKLALRTKIIARKRMMRKKKAAMR
                     AGKR"
     gene            complement(1072501..1074595)
                     /locus_tag="MYCTH_2315057"
                     /db_xref="GeneID:11512775"
     mRNA            complement(1072501..1074595)
                     /locus_tag="MYCTH_2315057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662651.1"
                     /db_xref="GeneID:11512775"
     CDS             complement(1072837..1074555)
                     /locus_tag="MYCTH_2315057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662699.1"
                     /db_xref="GeneID:11512775"
                     /db_xref="JGIDB:Spoth2_2315057"
                     /translation="MTKTEDGDLYNNNNIRGKNNNNNKNSSSRKSSESNPFIRFKQNV
                     DSSIHSALSTLRGSAASAGAGAGAADHSSRDPDNATSTTMATPTRTTMTTTTTTASTT
                     GTDTSLSMLTLSEQHLESRIALLAGGTPAEATLAWRLFLTRSAYSPLRLEHDPELGRP
                     GRKPVPRDVDLSSSSSAPPPPSSSSSSSSRDWDRDSWPWDVFDASRGAAGGGGGGGGS
                     EFGWLEAFEDLMRVSSGLELSDLGRRRQQHHHHVGFLGGGWGGLDHFFHPLPWSWHDR
                     GGMVGFPGGWWGGMREVAWLERMRSRGLTEVLFPVYDPGMGYQSPRTMAEWVERRRAE
                     EKREKAAGRAWEELLGEGRRAIEEADSWVEEAKRDMGKEIDSWRDVADEKGSSFFDGI
                     GGVVKTLGKVLEDEVKSLQRFGKERATKQKDDDAVENQKTPETENDLYSVIQSAFHES
                     ERSLSNFFKSISEARRSGTLAEPKPASPPRVDTTEVVEDGITKKTTKKEFVDEHGNAH
                     SKTETTWTDDKGNVIMRQVHSSVGRTDRWEKTITPAPAKHDTETSQEPKEPPKEPPKE
                     GGWFWK"
     gene            1075071..>1079116
                     /locus_tag="MYCTH_2091985"
                     /db_xref="GeneID:11512776"
     mRNA            join(1075071..1076234,1077460..1078400,1078464..>1079116)
                     /locus_tag="MYCTH_2091985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662652.1"
                     /db_xref="GeneID:11512776"
     CDS             join(1075195..1076234,1077460..1078400,1078464..>1079116)
                     /locus_tag="MYCTH_2091985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662700.1"
                     /db_xref="GeneID:11512776"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="JGIDB:Spoth2_2091985"
                     /translation="MATSQPSQPLQPTTPGQTSRPDADAVLDVASYNRGDFELPVVTV
                     HPSQHDGVRSTVFQRLGRPHDYDLGRLGRLPFEIVSLICLELDVSSAVRFSHVNRTAR
                     EVLASIREFRHLGAHALECLCVLLRTGLAPHVGILDVYSALTTQHCALCGSFAGFCFL
                     PTATRCCLTCVASAPATQMSYLSRVADAAGCSRTDLERRLPVLHTLPDRRRCIVAAQH
                     ALQSLREAGLEDPEEAISRWPDSLTLRFQAATSLPFLDRATGQAEPGVSCKGCQIAFE
                     SDFSDDHLELRDRFYSKSGFLEHFDDCEPAQKLWSSSQQGTAPVEEPQWTGLGRTFTA
                     PCGRRHSLARSEPGGAMRSWLPPPGLAHRSLPSPFPSSLTALSSDDDDSPEGELQNWS
                     SLIGIVTAICGNVLIALALNVQRYAHIRLHRKRARIRERARQATRHAGAGSQGRGSGQ
                     YGAAISSSRASNGTFNGALDRYVGARYNAEEDARDSSETEPLAQSFHSDGSDGGDGDG
                     DNGDYSNFDTPSKISTSYLKDPYWWLGQVLITIGEMGNFLAYGFAPASIVSPLGVVAL
                     VSNCVIAPIFFKEVFRQRDFWGVIIATTGAVTVVLSAETEETKLGPHEVWDAITTMEF
                     EIYMAVSCALIVLLMCLSPRYGHKTILIDLGLVGLFGGYTALSTKGISSMLSSTLFGA
                     FATPVTYVLVFVLLFTAIMQVRYVNKALQRFDSTQVIPVQFVLFTLSVIIGSAVLYRD
                     FERTTAQQAVKFIGGCLFTFFGVFLITSGRPRQDDDEEPALSDAEGIEETIGLAEQDR
                     ASPPTPPQPRRRRAASRADGSSRASRVSFSDVDEHISDQRTPRSTPSLRKHFVDSRQY
                     QPHFEDEDDDEQALLLSNPWQE"
     gene            complement(1081505..1083359)
                     /locus_tag="MYCTH_2303653"
                     /db_xref="GeneID:11512777"
     mRNA            complement(join(1081505..1082783,1082834..1083359))
                     /locus_tag="MYCTH_2303653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662653.1"
                     /db_xref="GeneID:11512777"
     CDS             complement(join(1081715..1082783,1082834..1083264))
                     /locus_tag="MYCTH_2303653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662701.1"
                     /db_xref="GeneID:11512777"
                     /db_xref="JGIDB:Spoth2_2303653"
                     /translation="MGLFRRNTGGSAAAGSSSSSAPVSPRGLGRKSTERANAPAMCRT
                     STAGTVGSETTAENRLRRRSSTFSQYSFSEAQQDFQEETLDPGPNPKSTSRRWKSWLP
                     VMFALVPPFAGLIFKNGTAFFSDLILLCLASIFLHWSVTGPWRWYDAAQQVREDQEGA
                     LEESFDSPKGKAPAKSDSESESWRDTPQAAEARQERARQLERALIRLRIFEVLALGAC
                     FIAPAIATYFLYSVRYLLSRRSEGVIANVNIGIFLLAAEVTPLSHSIKLILAHTLHLQ
                     RIVHSNPYRTVRMTPSRYRALLARVKELEEQMLELAERKPCEGCDCGDAQKQQAQARQ
                     MREQVTRDVRAAVGPDIDSVIRAVRRYEKKTSTLTSETDQRLAELRRSLDDVIALSAV
                     VARKKAEGWGILGKLAGGGWFVATLPVTATVATTSTVMSPVLRGAKWLAREGKQWLDE
                     LDDAHEGGDRDGRHQQRNDQVRDQPVKQRPVAGGSSLVPRSGTPTLRYA"
     gene            1085275..1086365
                     /locus_tag="MYCTH_2303656"
                     /db_xref="GeneID:11512778"
     mRNA            1085275..1086365
                     /locus_tag="MYCTH_2303656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662654.1"
                     /db_xref="GeneID:11512778"
     CDS             1085588..1086265
                     /locus_tag="MYCTH_2303656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662702.1"
                     /db_xref="GeneID:11512778"
                     /db_xref="JGIDB:Spoth2_2303656"
                     /translation="MAPPEDAADGFTPDLERGPAPLNQRHSTASGISGIGSVISSSDS
                     SIMGDPDQPPDHGEEWGPQHPCYPHLNPHVPIDSPEYANTRIIRVRRDWLLEGDLAPT
                     FSNLYPDILDPAGVSEQEFRRVIDKLNTELIQIFNPYSWRNILDNALGLATGWLWDDL
                     GFTSAKMRLRKLEQWIEQWNSEMEKTVGSEEGVIPPKIVPLRKTGYMTVWPPNSASGV
                     RMLTVAA"
     gene            1087170..1087241
                     /locus_tag="MYCTH_t81"
                     /db_xref="GeneID:11512779"
     tRNA            1087170..1087241
                     /locus_tag="MYCTH_t81"
                     /product="tRNA-Met"
                     /note="Anticodon: CAT"
                     /anticodon=(pos:1087202..1087204,aa:Met,seq:cat)
                     /db_xref="GeneID:11512779"
     gene            complement(1087721..1090256)
                     /locus_tag="MYCTH_2303657"
                     /db_xref="GeneID:11509852"
     mRNA            complement(join(1087721..1088232,1088301..1088944,
                     1089034..1089323,1089439..1090256))
                     /locus_tag="MYCTH_2303657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662655.1"
                     /db_xref="GeneID:11509852"
     CDS             complement(join(1087904..1088232,1088301..1088944,
                     1089034..1089323,1089439..1089936))
                     /locus_tag="MYCTH_2303657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662703.1"
                     /db_xref="GeneID:11509852"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2303657"
                     /translation="MSSPPSRLRAVLGHLLPTHSSTVSKDGNAPPPHLSHLSPTFFLE
                     RAAAIEPRAEAVYHVTANGAILRRSYAELADRARGLAYYLRKKGYRRVGILAPNTPAF
                     LESIFGVVAAGGVLVPVNYRLKEEDVRYILEFAEVDCVIVDKEFEGLLGGFRRAKPGV
                     EVIVDLDTDATEGELCGPFDEAVLEGLRYDRDTGNKGWTDLVSQTVANEDDMLAIPFT
                     SGTTSKPKGVIYTHRGAYLAAMANIVESGLNVPDGRCKYLWTLPMFHAVGWTFPWSVC
                     AVRGTHVCLRKVDYALIWRLLKEEGVTHFNAAPTVNTLLCAHKDAEVLPRPVRVTVAA
                     SPPTAHLFEQMTNLNLLPVHVYGLTETYGPITRGYLLPEWDSLPRHEKFANMARQGHG
                     FLTALPARVIKADQPEGVLIDVARDGKEMGEIVFSGNICCKGYYKDPEATRKLFAGGV
                     LHSGDLAVWHPDGSIQIQDRAKDIIISGGENISSVALESMLVEHPAILEAGVVAVPDS
                     HWGERPKAYVTVKEGSSTTLRGQEVIEWARNQSAISKFMVPREVEIVRELPKTSTGKI
                     KKNVLREWAKKGTPREVLVG"
     gene            complement(1092854..1095039)
                     /locus_tag="MYCTH_115968"
                     /db_xref="GeneID:11512780"
     mRNA            complement(join(1092854..1094707,1094794..1095039))
                     /locus_tag="MYCTH_115968"
                     /product="glycoside hydrolase family 1 protein"
                     /transcript_id="XM_003662656.1"
                     /db_xref="GeneID:11512780"
     CDS             complement(join(1093321..1094707,1094794..1094837))
                     /locus_tag="MYCTH_115968"
                     /note="CAZy_ID 267916"
                     /codon_start=1
                     /product="glycoside hydrolase family 1 protein"
                     /protein_id="XP_003662704.1"
                     /db_xref="GeneID:11512780"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="JGIDB:Spoth2_115968"
                     /translation="MSLPKDFKWGFATASYQIEGSVNEDGRGPSIWDTFCAIPGKIAD
                     GSSGAVACDSYKRTKEDIELLKSIGAKAYRFSIAWSRVIPLGGRNDPINQKGLDHYVK
                     FVDDLVEAGIEPFITLSHWDLPDALEKRYGGYLNKEEFAADFENYARVMFKAIPKCKH
                     WITFNEPWCTSILGYNTGYFAPGRTSDRSKSPVGDSAREPWIVGHNILIAHGRAVKAY
                     REDFKPTQGGEIGITLNGDATLPWDPEDPADVEACDRKIEFAISWFADPIYFGEYPAS
                     MRKQLGDRLPKFTAEEVALVKGSNDFYGMNHYTANYIKHKKGVPPEDDFLGNLETLFY
                     NKNADCIGPETQSFWLRPHPQGFRDLLNWLSKRYGYPKIYVTENGTSLKGENDMPLEQ
                     ILEDDFRVKYFHDYVHAMAKASAEDGVNVQGYLAWSLMDNFEWAEGYETRFGVTYVDY
                     ANDQKRYPKKSAKSLKPLFDSLIRKE"
     gene            complement(<1096556..>1097509)
                     /locus_tag="MYCTH_5082"
                     /db_xref="GeneID:11512781"
     mRNA            complement(join(<1096556..1097238,1097383..>1097509))
                     /locus_tag="MYCTH_5082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662657.1"
                     /db_xref="GeneID:11512781"
     CDS             complement(join(1096556..1097238,1097383..1097509))
                     /locus_tag="MYCTH_5082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662705.1"
                     /db_xref="GeneID:11512781"
                     /db_xref="JGIDB:Spoth2_5082"
                     /translation="MSFGRPLRGGCHCGRNIYVVQFPKDLDAANLVQVLFDSRPSHRS
                     ILATPLPAYLRVPLRYYRALTVPYHDDETNSQIHRVYQPAGEEHAMRHFCGFCGTPLS
                     YWSESPRSEADFIRLTLGSLLHEDLRDLEEWGLVPDPDSASGTGTPLEQEDEAAEGNR
                     GKSGEGKTRTDAATGAEGEREVGEAGGNVWGRVGVLPWFETLTEGSRLGTTLRRARGG
                     GTDPTERVRIEWEIAEWSAEDEKGDESPRKRKLDEVEDAVEAERTVGVRVQ"
     gene            1098754..1101193
                     /locus_tag="MYCTH_2303662"
                     /db_xref="GeneID:11512782"
     mRNA            join(1098754..1098929,1099039..1099261,1099312..1099808,
                     1099863..1100234,1100294..1101193)
                     /locus_tag="MYCTH_2303662"
                     /product="POB3-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662658.1"
                     /db_xref="GeneID:11512782"
     CDS             join(1098919..1098929,1099039..1099261,1099312..1099808,
                     1099863..1100234,1100294..1100903)
                     /locus_tag="MYCTH_2303662"
                     /codon_start=1
                     /product="POB3-like protein"
                     /protein_id="XP_003662706.1"
                     /db_xref="GeneID:11512782"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="JGIDB:Spoth2_2303662"
                     /translation="MAAIESFDNIYLDLSREHGKCRFAENGLGWKPAGGGDTFTLDAS
                     NIGGAQWSRAARGYEVKILQRNTGVIQLDGFKLEDYERLSKIFKNWYSANLENKEHSL
                     RGWNWGKAEFGKAELTFNVQNRPAFEIPYSEISNTNLAGRNEIAVEFSVADTGKSNGQ
                     NGATPGKGRKAAAGKDQLTEMRFYIPGTTTRKEAEGGEAGSDVDEEEKNAVTLFYDTL
                     IEKAEIGETAGDTIATFLDVLHLTPRGRFDIDMYDASFRLRGKTYDYKIQYEAIKKFM
                     VLPKPDDTHFMLCIGLDPPLRQGQTRYPFLVMQFKQDEEVTLDLNLSEEELNGKYKDR
                     LQPHYEQPIHQVVAYIFKGLANKKITAPAKDFTTHRQQYGIKCSIKASEGFLYCLEKA
                     FMFVPKPATYISYEQTQSITFSRVSGAVSALSTFDITVHMKSGAGSSQFSNINREDLK
                     ALEDFFKLKGLRVKNEIDEESTLMAAALRDEAMASSDEEVVGAKADRGSADEDEESID
                     EDFQAESESDVAEEYDSNHESDGSGSDESDVDNEVDDEEDEDLDDEEEEEEEERPKKK
                     KKTG"
     gene            1101842..1105561
                     /locus_tag="MYCTH_2303666"
                     /db_xref="GeneID:11512783"
     mRNA            join(1101842..1101948,1102125..1103661,1103721..1105561)
                     /locus_tag="MYCTH_2303666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662659.1"
                     /db_xref="GeneID:11512783"
     CDS             join(1101937..1101948,1102125..1103661,1103721..1105234)
                     /locus_tag="MYCTH_2303666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662707.1"
                     /db_xref="GeneID:11512783"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="JGIDB:Spoth2_2303666"
                     /translation="MDAQIENAIEIAWDPASDQALKGQAFEFLNQLRTDSQAWQVCTA
                     LFSRTPRASPVVRLVCLEIVNNAVHSQALDGASLGFLKQSLLDYVGRIYGGDAQDEVD
                     PPHLQNKLTQTLTYLFVSLYKEGWETFISDFLALAQKDNNLPGVVMYLRVLGSIHDEI
                     ADLMLSRPDNETRRNNELKDLIRERDMRKVAQSWQDLLARYSNQNDAVVETTLKIIGK
                     WVSWIDIHLVINQDMINLILPLVGRTHAAGNEDKVRNAAVDTFTEIVAKKMKASDKIE
                     MINFLNLREIVTQLLASPPLHEWKGTPRYDTDLAEAVAKLVNTIMTDVVRVLEDNKVD
                     TDTRAKAEQLLRDFLPSSLRLFSDEYDEVCSTVIPSLTDLLTFLRKVGQLPATYSEML
                     PSILNAIVLKMRYDETSNWGNEDEQTDEAEFQELRKKLQILQKSVASVDENLCIEFLS
                     NLVANMFSTLEQQGSQMDWRDLDLALHEIYQFGELALPNTGLAQKSQPNSLAAERLAV
                     MMSKMVESGVANYPHPAILLQYMEICTRYYSFFEDQQRYIPQVLENFVRLVHHDHVRI
                     RTRSWYLFHRFVKTLRAQVGNVAKTVIESISDLLPIKAEVPGNDADDDMSSDESDHSA
                     DAVFNSQLYLYEAVGCISSTSATPPSDQALYARSVMEPLFSDMSLHMERAKNGDAQAI
                     LQVHHIIMALGTLANGFAEASTTQPAKRPQPPEAVSNEFARAAEAILIALNQLNASDD
                     IRTACRSAFSRLLGVLGAAVLPQLPQWIEGLLSRSSSKDEMAMFLRLLEQVVYNFKTE
                     IYNILDVLLTPLLQRVFSGLSEPISGTDDEIQLQELRREYVSFVQVILANDLGGVLVS
                     AANQGTFESLVSSIINIAKTLTHGNFVPSRIAFNVLGRMASQWGGPDVATIGDNPSTT
                     GAAASPSIPGFDQFMLEHFHGLCWTVLQDSAFRPNTDAQSRQILSEIVGIQQILYVKT
                     GEAFVNHIQGVTFPQLGIDGTEYLRVLTTSREKKPVVNWLLNLLKGRR"
     gene            complement(1105903..1106728)
                     /locus_tag="MYCTH_88099"
                     /db_xref="GeneID:11512784"
     mRNA            complement(join(1105903..1105945,1105999..1106728))
                     /locus_tag="MYCTH_88099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662660.1"
                     /db_xref="GeneID:11512784"
     CDS             complement(1106000..1106239)
                     /locus_tag="MYCTH_88099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662708.1"
                     /db_xref="GeneID:11512784"
                     /db_xref="JGIDB:Spoth2_88099"
                     /translation="MSAGSCMRLITPAVLADARRRDAPYHHHHHGGLCRSDVPVTARA
                     ARVFMSNSSGTLRVATVTEAIQTKGTPTGTHMALG"
     gene            complement(1108985..1111148)
                     /locus_tag="MYCTH_2303668"
                     /db_xref="GeneID:11512785"
     mRNA            complement(join(1108985..1110613,1110778..1111148))
                     /locus_tag="MYCTH_2303668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662661.1"
                     /db_xref="GeneID:11512785"
     CDS             complement(join(1109175..1110613,1110778..1110838))
                     /locus_tag="MYCTH_2303668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662709.1"
                     /db_xref="GeneID:11512785"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="JGIDB:Spoth2_2303668"
                     /translation="MASPPKSAFEFLDFVNASPTPYHAVASAAALLDAAGFTKIQERD
                     NWASTVKPGGKYYTTRNGSSVVAFAVGAQWKPGNPIGMVGAHTDSPCLRVKPVSKRTA
                     NGYLQVGVETYGGGIWHSWFDRDLSVAGRVLVREGEGSFVQKLVKVDKPILRIPTLAV
                     HLHRQSNFDPNKEDELLPIAGLAEAELNKTAEPDAAGEAAGGESDFEPLRALPERHHP
                     AFLSLVAQQAGVDVSRIVDFELVLYDTQKSCLGGLRDELIFSPRLDNLNSTFCSIKGL
                     ISSVRSIPLDHDASIRLVACFDHEEIGSLSAHGADSNLLPAVLRRLSVLPGASSSSSS
                     SSSSSPESASQSASSDVAASTAFEQTLATSFLLSADMSHAVHPNYAAKYERNHTPALN
                     GGPVIKINANQRYATNSPGIVLVQEVARRARVPLQLFVVKNDSPCGSTIGPMLSAKLG
                     VRTLDLGNPQLSMHSIRETGGSADVESAIRLFESFLGHYGELERKILVD"
     gene            complement(1113569..1114186)
                     /locus_tag="MYCTH_2303669"
                     /db_xref="GeneID:11512786"
     mRNA            complement(1113569..1114186)
                     /locus_tag="MYCTH_2303669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662662.1"
                     /db_xref="GeneID:11512786"
     CDS             complement(1113828..1114004)
                     /locus_tag="MYCTH_2303669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662710.1"
                     /db_xref="GeneID:11512786"
                     /db_xref="JGIDB:Spoth2_2303669"
                     /translation="MSSFFSLVSLFLIFPCPFPWLSYLYTCATARLRQFPLGKQHGAL
                     ELSPASLKQCGPCS"
     gene            1117460..1123188
                     /locus_tag="MYCTH_2303672"
                     /db_xref="GeneID:11512787"
     mRNA            join(1117460..1117565,1118243..1118527,1118644..1118746,
                     1118806..1121538,1121672..1123188)
                     /locus_tag="MYCTH_2303672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662663.1"
                     /db_xref="GeneID:11512787"
     CDS             join(1118292..1118527,1118644..1118746,1118806..1121538,
                     1121672..1123009)
                     /locus_tag="MYCTH_2303672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662711.1"
                     /db_xref="GeneID:11512787"
                     /db_xref="JGIDB:Spoth2_2303672"
                     /translation="MAANIPQMVANGQMLMLQQQQQQQQQQQQQQQQQQQSSRDKQLQ
                     NLVSTHLMQSMSLAPINSWQSGVSIGDRFAKTINLVSNTLLAYPSPDWQKFALTAIEH
                     EKKLFLQSPDRQSYDHAMAQKTAEMVKRRQENATELQNHVNNDAARQAQLQAAQQRQQ
                     QMMLNQMAARGLGQPPQHGFQPMQNPMQVPVMPQQPQQLGMGMPTPGMLQNRPDQRQF
                     PMQMGQARQPGVPQVDPLGQLSQQDRARVNAVAMRLMGNTDEHTKNNIRQQMQQRMTA
                     AQLQEYAAQGKDPVFIYFQNQALMHLRAQAQRNLMQQRAGMPANMMRQAPNQGPMNPA
                     LMGNLARQAVMPDGQAFPPNMEDIRNEQQMGLLAQQAGQTVVPASTAPGRNATPAAMT
                     GMPPQARPGNQQGPNQTPRPTQVQPFGMPDATAAQVQAQQGVRAVPGRPMPGQPGAMA
                     APTAPPQASQSPAMNTLNAPMRQPPIPMGQGNGHPVSQGNPPMAATLNPQFNHQNNTR
                     PPSLQGNMTNTAMAGMVPNLGPDGAMRNFYAQLQQDRSGTSAFQGPKPGLMPGIPGPS
                     PAGPMGGPNQAGVVDASQKANGHMQPTTQPGLGQQQPKPVPSEADQRFNAFAQSPQGR
                     AAMSNMDVPPQILAQLRGIVPPETRKWSQLRQFLQANPGVVPAPLINRLGYWQTVQFK
                     QAWEKRQQAAAAVAPQGPNGPLPQQPGFQPPPLPPGMSYPPNISQVSRQEIEGVRRNP
                     QFANMSDEVLIEVVRKYKRDLWAKRAWEQHRQSQQARVNINLAGGVQKPGALMAQAPA
                     GQQGAVSAAPQPTTSMGVQQQTTQPPQPKPAAAPVSEAPAAPAKGARQQPLNPSPATV
                     AKSLKRPNPEDPNDVAGQPGGAAQRPAPQSETRPPSAASKPTVEQLMKLSPEQLAKIP
                     QEQLARLPPDQQKAIAMRIRQAMPPVPPELYARLKNLATEGHRLALDEVRQQEAQPQQ
                     GARITMSSPMFGETRLKLTQIAEKIKWFRGPVIGKWYSYTKDDSRARMFFKIRFKVSR
                     QFVDGDQMSQLPESLTITKDELDQYMNMLESMVQDIEMLKRSAGQSGAGAGVQVPPQP
                     SPLSAANLEKQTQALKQAQNRTATKAAQPPAAPTTSQPPFQFGMQKSSPAGNPEYLSE
                     QRITQANLVIPPARKKAKTGAGQASPPMAQQQTPNASSPQVGTPSPAAARKPEPPKLR
                     CPEPGCEINSIGFLTEEALNTHRQEEHVKPFENPHGFLQEQMAAALGLDAQGNPKASP
                     KPGAQSVSTPAATPMSISRSKQGQKPAATPMSRAGSMQRQGSAAGAKPGENAGTPGRN
                     LAAKQGAGTPQIPTAEDPWMSSTVDPQDLFSGLSSSLEAVTGTLVPDFGTYRSLTPND
                     TPESSKDSGTSEATSDIAETAALDIDLQVQPLDNDLLYDMTNINMENFGSPSMDMDMD
                     LFTNESMMFPLDDLQNDFSKPFRVDRELYSTEV"
     gene            1124242..1126569
                     /locus_tag="MYCTH_2303678"
                     /db_xref="GeneID:11512788"
     mRNA            join(1124242..1125108,1125248..1125463,1125594..1126569)
                     /locus_tag="MYCTH_2303678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662664.1"
                     /db_xref="GeneID:11512788"
     CDS             join(1124659..1125108,1125248..1125463,1125594..1126463)
                     /locus_tag="MYCTH_2303678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662712.1"
                     /db_xref="GeneID:11512788"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="JGIDB:Spoth2_2303678"
                     /translation="MDASSPVKRRVLGALDPNACSPNKARRHEGGKQQLFTPARHLSP
                     VKVKSVAPRQELSVGGASPTTRVSSASPSSSPSPSPFSSLSSSQSLVPDTPERETGVE
                     SRKRRSPNPSAINPPTSGMAAAAEAEAAEGGEPAAKRACLDGMREDGQSPPSSTSTTR
                     TTGTTRHRSASPDTPSVFDNSAVDNSQLTILTEPDATGPNPNPAPVPAPRARPRLTRE
                     QAREKAEILRLRLGLASYKVRTGQTDVPLDRLEARLAGDARHAGGSSASSFHGQTQAQ
                     GQSTHHGPTTSVAASFPPPGATAAAAAAQREHRRRLPGAPVRRASVGTERGHYSRPAP
                     PSRSQLLEEVRLALARETEQGQDRQHDDRHQNRHDRYDHHHQLHHDYRYSHMASHQYQ
                     HHHHHQRRQSEALLDTRHDPERYRYASNPADRRPRTATDVPGSSLVSSSLSSSSSSSS
                     SSAAAWLPSSSSRRRAASFAGNGGYLRKEENADENRRREEYEEDMDSRGGAASGLLSL
                     ARS"
     gene            complement(<1127597..>1131277)
                     /locus_tag="MYCTH_2138875"
                     /db_xref="GeneID:11512789"
     mRNA            complement(join(<1127597..1128167,1128300..1128727,
                     1128788..1130856,1130938..>1131277))
                     /locus_tag="MYCTH_2138875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662665.1"
                     /db_xref="GeneID:11512789"
     CDS             complement(join(1127597..1128167,1128300..1128727,
                     1128788..1130856,1130938..1131277))
                     /locus_tag="MYCTH_2138875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662713.1"
                     /db_xref="GeneID:11512789"
                     /db_xref="InterPro:IPR013633"
                     /db_xref="JGIDB:Spoth2_2138875"
                     /translation="MDKEQRQDKDKRRAVPKFGSFKPNPTPEPAPTARQTEEEIQSYK
                     DRQGRADKDSRSRDRGRDRREADRGHRRSSRERGRDRERHRSRGDPERDRERDRERER
                     KREKDSERGRHRSPVLSSNDLFVMDKRGDPLIVQYGSNDRSQVPVYHRFGGGRVIGSP
                     GFLIIHRDGVREQFSIRLPGEGSGSGSAFRDKALVAAAARLHPRRIKPEPEPAHSARP
                     PSEAFIPLSPPRKRKRHHNGHDEDGTHPPSPPDYRSTYGKARQDNLPSDSDSDSDSDS
                     SPSRSPSPEPEPDLPGPRARAADLSRRVKTHPSDIPAWLELVALQDSLFASASSSFSS
                     PSSPSSAIPDILGGRTAEEARSLAELKLSLYQEALPHAVSPQDRETLLLGMMREGARV
                     WEEGVLKKKWEEVGSPDAGFGLWKARLNYETGRVAGFAVEQVRDMIVGKLKALGRELE
                     RVAAAGREGEEELCRQVVYVFLRLTRLLHDAGFAELAVAAWQALLEMTFCRPPAEYAA
                     EAALTSFADFWEGEVARIGEDGARGWRHFVEAGEGMVDPPEPKSDKPSVVRGTMDPLK
                     AWALMEKQGAEKARMPARTLDEGTEDDPFRVVLFSDIKEFLVWFPSPVVPQVKPLLAD
                     AFLVFCGLPPAGLSGEPFLALLRDPFVAATGQGLDLGLGKEEAGTTTRDLTRHGPEFI
                     QHGGSLAISAQLLFCKSSKFRYLDEWSRIYEAADKQVDLSWVLRTIGYLVRDCGMEAL
                     ATYYLAMEWLNDDSARARKVAKGLLKQYSSNIQLYNAYALVEWANGNAEVSHKVFSSA
                     TGLVQPLSSDGQLLWNTWAWTHLESGQKDLALARLCSSVDKEFRGPIPSPALLLTAKS
                     QIASTRDYSLSSRQLGTAAQYAESLMLLEYLSAEGGSEPTSETQGNISAALSTIHAFS
                     HELQSRNLHDTPHHERLLQSAACLLYHHATHGPYRPSYVRDQLQTFVHLFPHNTLFLS
                     LFAWSQPPLRIDDPVRAVLRTRALAGRPLRPPHDRLGTRRFAIHHEARAGAGTAHSVR
                     AAFEAALDDGDDNACRGSAELWIRYLRFCCSRRAELGRGRAREVFYRAIGACPGAKEV
                     YMEAFGEGMAGMLSEAELRAVVETMAEKGLRVHVDLDDFLQGRRGEK"
     gene            1132486..1135896
                     /locus_tag="MYCTH_2303682"
                     /db_xref="GeneID:11512790"
     mRNA            join(1132486..1132560,1132619..1133035,1133147..1133532,
                     1133613..1134743,1134820..1135152,1135232..1135720,
                     1135802..1135896)
                     /locus_tag="MYCTH_2303682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662666.1"
                     /db_xref="GeneID:11512790"
     CDS             join(1132732..1133035,1133147..1133532,1133613..1134743,
                     1134820..1135152,1135232..1135720,1135802..1135864)
                     /locus_tag="MYCTH_2303682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662714.1"
                     /db_xref="GeneID:11512790"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="JGIDB:Spoth2_2303682"
                     /translation="MTGRRHGARLPEIVAAGNAAGIDDNTPAASSAEPQGYLSLPSSP
                     TAIRRPRSNMSRQGSNTEPPDERSPLLGGGNRTSRIRIHSAHGSPRVPALSRNQSYAD
                     SPRSIRHHSRGNSWGTRLMNAFSERQESSMADSKGSLYPEDRVWYDQFTSTDWVHDSI
                     ADAYRVKALRSRKDFWGRVYVLFDGAQGWLLSALVGFIVAVLAYVVNVSEATVFDFKD
                     GYCARGWLISEKKCCPHGPCTDWRDWGEVLQGFPFGERWTEYVVYIVAVITLASLSCL
                     LTLTTKTVVPSAYRLTTLDENLAAEAPAPQPEDGANGAAVSPRRLQEKREQPPMIYYS
                     AAGSGVAEVRVILSGFVLHGFLGLKTLIVKTLSLILSVASGLSLGKEGPYVHIASCVG
                     NIACRLFSKYDRNDAKRREVLSAAAAAGVAVAFGAPLGGVLFGLEEVAYFFPAKTLFR
                     TFFCCITAALTLKFLNPYGTHKIVMFQVRYLVDWEYFEILSFITVGVFGGAAGALFIK
                     ASKHWAKTFRRIPVIKAHPLLEVALVALVTGVLGYWNTLTKLPVSKLLYNLAAPCDDR
                     DNNLEDLGLCPEEIGDIPPILMNLFSAFLIKGVLTIITFGIKLPAGIYVPSMVVGGLM
                     GRLVGHVVQWVVMATPDWSIWGTCAKMPNATCIQPGVYGLIAAGSTMCGVTRLSVTLA
                     VILFELTGSLDYVLPFSLAILVAKWTADAIEPLSIYDLLTNMNSYPFLNNKHKPIFTS
                     DLADIVPRVRKERIIDITNSPVVPAPSLRAKLELLHKAGELDGGLPIIRDGVLVGLIP
                     APDLEYALDNLRDEASSLCLMAPVPRIDDSDDGSPDPTDFTPYIDPAPVALDIRSPMD
                     LVYECFVKLGLRYICVLRDGKYAGMTHKKTFVKYMRELEEKEGYE"
     gene            complement(1136842..1138915)
                     /locus_tag="MYCTH_2303685"
                     /db_xref="GeneID:11507341"
     mRNA            complement(join(1136842..1137591,1137753..1138915))
                     /locus_tag="MYCTH_2303685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662667.1"
                     /db_xref="GeneID:11507341"
     CDS             complement(join(1136864..1137591,1137753..1138365))
                     /locus_tag="MYCTH_2303685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662715.1"
                     /db_xref="GeneID:11507341"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="JGIDB:Spoth2_2303685"
                     /translation="MGSGATQQTRGHAGHGHGHHHHHHHGLHHHHHHDNVYLTSTNKS
                     DAGVRITRIGLYSNLGMAIAKGAGGYVFNSQSMIADAWHSLTDLASDVLTLATVSWSL
                     RPPTDKFPHGFGKVESLGSLGVSSMLLFGGLFMCISSCESLYAHFFLDPESARALLEH
                     GHGHSHAHHHHHGHGHDHAAGAPSLHAAWLAAGTVAIKEWLYHATMKVARERKSSVLA
                     SNAVHHRVDSLTGIVALLAILGANLLRDATWLDPVGGLFISLLVIRAGFSNTLAALYE
                     LADRSIDEEVRASVAKQVCKGLASLNDNHYDDHDHDHDHDADQHRSNSSSSVRGDDVE
                     LREVTGVKSGQNYLVDVELAVPGHWTVEDVRAVEEAVRARVGARVRGVRRLRVRFVPR
                     SSDPAAPPGLFDEFIPANVSPRSNPEPEPEVEEEDDEREEEEEGSGHGKGHKDL"
     gene            1139791..>1141074
                     /locus_tag="MYCTH_81379"
                     /db_xref="GeneID:11507342"
     mRNA            1139791..>1141074
                     /locus_tag="MYCTH_81379"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662668.1"
                     /db_xref="GeneID:11507342"
     CDS             1139866..1141074
                     /locus_tag="MYCTH_81379"
                     /note="Contains conserved domain SIR2-fam[cd01407], SIR2
                     family of proteins includes silent information regulator
                     2."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662716.1"
                     /db_xref="GeneID:11507342"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="JGIDB:Spoth2_81379"
                     /translation="MKKPLMRIPYTDILPAPNIIPHTARSLPGAIAALQEFLHAPSPR
                     DLPRSTVVLTGAGLSVASGLADYRGPNGTYRVNKTYRPIYYHEFLTSHEARKRYWARS
                     FLGWTTLRNAQPNPGHYAVRDLGRLGLVSAVVTQNVDSFHPRAHPDIPTLELHGYLRS
                     TVCTSCRTEMPRDGFQAELARLNPVWDAFLQEALATGALETEDPHERRARGFRVNPDG
                     DVELPQAPYTTFRYPACPKCLSDPPLLADGSRAAVEVDNDGAWSPTSKAGILKPAVVM
                     FGESIADGVKKAAEEAIDGAGKLLVLATSMATYSAWRLAKRAKDRGMPVAIVNIGGVR
                     GEEAFFAGLDPDQTGAQGVRLEMSTETLLPALVRELRQQPILQNAEPSSAEAASFLEN
                     DAAVFKNMLQ"
     gene            <1142361..>1148744
                     /locus_tag="MYCTH_2117988"
                     /db_xref="GeneID:11507343"
     mRNA            join(<1142361..1148491,1148642..>1148744)
                     /locus_tag="MYCTH_2117988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662669.1"
                     /db_xref="GeneID:11507343"
     CDS             join(1142361..1148491,1148642..1148744)
                     /locus_tag="MYCTH_2117988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662717.1"
                     /db_xref="GeneID:11507343"
                     /db_xref="InterPro:IPR005314"
                     /db_xref="JGIDB:Spoth2_2117988"
                     /translation="MDTPLSQADAVRGAVSSVATCTPATSALLKTLLLPKDSETPTVD
                     DANTRPAAKTANSARSRTNTVTRAPSKRARAAAAPAPDEGLSAREKAALATHVVNATL
                     KALGEAAKPSSAAAPRPAQEDDLVKTATKNAIRRSSSAPMSPLQPRSLNRQASSPVAA
                     AKHARSPSKSSSTTNLLSTVECARVALAALRQLPASGKITLPDLQLESGMSALVGRLI
                     NLNLQEQAVKELRILKRRLEGPSASEAKKAGKSANSDCKNTARLFSDLLDFGSVKASG
                     ARLLLIIATQIQVLRVLAISKKPSAIEAALPYLRQDQASSPINLLLAAAREDGADVSK
                     IARQTETLAQCLLSLTPSVSSKEDGTAQEARLSISPASALELQALALESRLHWWGLAK
                     HKGDAEKNIMVPLYRCLGAYMRRTSETPRSSYVVCSEIFNRIRRQLEAHGFHPAKGSR
                     QPFAGICQTLATLARDAQQMSDAIMWATKLREAMDPAAESIAKTCAVAAQLLSLHLKQ
                     PAKYLSDDQLLKEVVAGIQGPLRGDTAELDELLVNICAVRKGAMHYLLTLARNGDSVS
                     QPRPETKELLETFILQCPRFCLRWLGKPPGPQGSTKDYLRYDQRRQLMLQYFPHVLDS
                     AFITIKTCLDQSRLAWDLMDSILGDCNTLLEYTGSNSATSDPSASYYVKISHFYYLQY
                     SCLRQQSTDPKDVAPLRALRRSIECVKHRSSGEKEKARLTLKLERMAELCRTLGRVEE
                     ALGALQAIRTSLVEDGVLTSVAKALETKAPAVAWAADEKAEGLSRALLAISKMEHVWI
                     DWTVDLDETERAAALEHRLRFVLLREGSKEGAVSPEHPVVDALLRIYIPTKYPIRRLR
                     VLLLLLCSALGNLDKAPELLSVAKDAAQVEASGDLGEDSGLVGFLPHLKALHNSLSAA
                     VDAYRDHQALDACISTWRSIIASCQDKAALETVIDDVPGLLEYLQSVADFLRMKGRDT
                     TLAAVLELAASISRAVEGSKAEEVIQHSSCLALQYTNLGQSLRAEQVFQEVQELISDE
                     LRSEVLASFHLAFAEHFLALSSIRQAEDHLAQAQLAFNVDAAASQKHNRAERRRLVAY
                     ACYLQSLIALERGDSHHALAYSRDSVRTLFQDWAKLESRLVPRTLPEPNRADDQTIDV
                     SAVTIEGDTLQQSPGPEFWRLFHCLYRNVFRLSSMYAHLGMFQETMYYAEQALKMAKT
                     VNSEFYNAECAAWIGSVSWRAANATKSLEMLQEAAALLPDDNRSYSSAALACQIGSMY
                     LSQNNMEGAKLLLERAEAIAHNLAASPAAEQRADTAAVETEMAKLSITKKPTRGGGGG
                     GGRGGRKAAVAKTPGRKAAKGAIRTKATAPVPEPPVVVVAEEDAQLAKLRASILVQKA
                     VSMLRQKEWAAAQAALIEATAASKASGLLPVRQVTMASCLLGMSMEQMAQDPVFSVIQ
                     DSTISFPALSGSSEKPSPVRPKASSPKKSRAAAASQGQAVREAAPGLYVDNLRQAHDY
                     LLEAHSVAALSGDASLIHRISGMLQNVSLYLTATSAKAKAAVHSAQTSYSVELARNLT
                     WRRERKALLQEKNANKSDGLQWPATLQSASTRRSSLGFTLDLHKIQRDYIDIVPRSWN
                     VISISLSEGGHDLCITKLQAGQNPFVIRLPLERASSRDADSDVFDFQQGRAELLEIIK
                     QINKTCHDSRDMTVKGAKAAWWAEREALDERLKELLDNIETIWLGGFRGIFSQHVRRP
                     ELLARFQKDFLTILDKHLPSRRQVRGKKTTKPEQTAKATLDPNVLELFIGLGDATEPG
                     RDFDDELTDLLYFVVDILQFHGERNAYDEIDFDSMVVETMDALNAYHSAAHAAAAEDA
                     PANLHTILVLDKALHVFPWESLPCMWGLAVSRVPSLACLRRLILDCRRPGEREGRPDG
                     HHASVSAGGTYILNPSGDLTSTQATFSRPLAAHLPSPAWRSLTGRPPTEQEFATALAE
                     SQVLLYFGHGSGAQYIRGRTIRRLDRCAAAVLLMGCSSAALADHGDFEPAGPVWNYMM
                     AGCPAVVGTLWDVTDRDVDRFAAGLVEDLVEAVTRARGRCKFRFVTAAAAVVYGIPVY
                     VER"
     gene            complement(<1149962..>1150129)
                     /locus_tag="MYCTH_2060549"
                     /db_xref="GeneID:11507344"
     mRNA            complement(<1149962..>1150129)
                     /locus_tag="MYCTH_2060549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662670.1"
                     /db_xref="GeneID:11507344"
     CDS             complement(1149962..>1150129)
                     /locus_tag="MYCTH_2060549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662718.1"
                     /db_xref="GeneID:11507344"
                     /db_xref="JGIDB:Spoth2_2060549"
                     /translation="KGTYNTRNSLVVTDPTTTRALSSLTRAERTGCRAFCWVWSYVPA
                     ASRICDYMLES"
     gene            <1151920..>1152087
                     /locus_tag="MYCTH_2062645"
                     /db_xref="GeneID:11507345"
     mRNA            <1151920..>1152087
                     /locus_tag="MYCTH_2062645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662671.1"
                     /db_xref="GeneID:11507345"
     CDS             <1151920..1152087
                     /locus_tag="MYCTH_2062645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662719.1"
                     /db_xref="GeneID:11507345"
                     /db_xref="JGIDB:Spoth2_2062645"
                     /translation="GPQGQKGSYCNTYNTRNSLVVTDPTTTRALSSLTRAERTGCRAF
                     CWVWSYVLAAR"
     gene            complement(<1160069..>1162146)
                     /locus_tag="MYCTH_49795"
                     /db_xref="GeneID:11507346"
     mRNA            complement(join(<1160069..1160362,1160484..1160678,
                     1161478..1161910,1161986..>1162146))
                     /locus_tag="MYCTH_49795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662672.1"
                     /db_xref="GeneID:11507346"
     CDS             complement(join(1160069..1160362,1160484..1160678,
                     1161478..1161910,1161986..1162146))
                     /locus_tag="MYCTH_49795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662720.1"
                     /db_xref="GeneID:11507346"
                     /db_xref="JGIDB:Spoth2_49795"
                     /translation="MRSTDWATPLAAAPSAVGTMAILLKTASSDAAAGLPVKSRDVVG
                     DRGEVVSQLPYDLLHSNLQSCSDIGRSAFTEGRSTMDYVHKAAISIIRNGGKVESILE
                     MLENIEDARVNLKPEMQSVKRTAEISLERVRSLTENFQYWYWMICCLKNNVLESRGDR
                     TPPPPPFFSPSPSKRSRQELPPSNANKVCFPAGTVQAKSSRQLSDLKEQVNGLVAFFK
                     SILEEVSATVDNDVEDFLATIERGVQTFGDTNIISNINLRKPAQRRIRNTALQIQGSF
                     SGIRDITGTYVAISDRYIQPAINKMEALSATKGDEWDAKSEEFVRWCRQSMREIEEIT
                     RAAADGLESNMTERVSYLQHAIESTA"
     gene            <1163891..>1167828
                     /locus_tag="MYCTH_94266"
                     /db_xref="GeneID:11507347"
     mRNA            join(<1163891..1164875,1165001..1166433,1167556..>1167828)
                     /locus_tag="MYCTH_94266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662673.1"
                     /db_xref="GeneID:11507347"
     CDS             join(1163891..1164875,1165001..1166433,1167556..1167828)
                     /locus_tag="MYCTH_94266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662721.1"
                     /db_xref="GeneID:11507347"
                     /db_xref="JGIDB:Spoth2_94266"
                     /translation="MSDPSLYTVGWICAIEAEYVAAQSFLDEEHDGPESVATRDNNDY
                     TLGRMGRHNVVIAVLPDGEYGLTSAATVARDMVHSFPNIRVGLMVGIGGGAPSAKHNI
                     RLGDIVVSSPGDGEGGVFQYDFGKAVQNKKFEVTRRLDQPPQVVRTAVSGLKAQYRRK
                     GHKLAEAVDGVLANNTRLKATHARPDPKSDILYQSGYVHSDPNRDCAQICNASWYQKV
                     RTPRSVQEDNPAVHYGLIASANQVMKDASVRDSLIAEKDVLCFEMEAAGLMNHFPCLV
                     VRGICDYSDSHKNKAWQGYAAMAAAAYTKDLLARIAPNKIEAERKIKDALADVLNGVE
                     RVEEGVKAVGLKLDQQEDGAILDWVAPGDWHRRQHTDYLNQRQPGTGEWLLTSDCFRD
                     WLAAESQTLFCVGIPGAGKTILTSVVAQHLQSGAPARMAAAGAVGVALVYCNVELQHE
                     QGAEHLLSSMLKQLTQGLRPLPECVRKLYENHKNCGTQPSLADISGCLREVAKGYARS
                     FVLVDALDAYRPRGSHARERLVSELFGLQRDCGTNLFFTSRRIPEIEDLFSKAPGVVS
                     LEIEAHKGDIERFLDGNMSQLPKFVDRRPDLQKAIKEAIVTAVCGMFLLAKLWLDALA
                     KMHSPSELKSTLETLKGGAEACERAYEETMERRIEDEQFARRVLSWIVCAKRPLTTIE
                     LKHALAVRSSDTSLDGENVPDTDDIVSCCAGLVTVDKDSDVIRLVHRSAYEYFRRQDS
                     RARWFADAEARIAEICVTYLSFDAFKEGFCPSDQEFEARVRSHPFYSYTARYWGYHVR
                     ECQQLGEKVDVNSKNGTGSVGRTPLAEAQKWSDRSASHLRTAKLLAERGGISKEFNES
                     VGLDFDLSFFDKLRADTDSETDSDDSDMSEEQGGDDDADD"
     gene            complement(1169495..1170214)
                     /locus_tag="MYCTH_2303691"
                     /db_xref="GeneID:11507348"
     mRNA            complement(1169495..1170214)
                     /locus_tag="MYCTH_2303691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662674.1"
                     /db_xref="GeneID:11507348"
     CDS             complement(1169599..1169919)
                     /locus_tag="MYCTH_2303691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662722.1"
                     /db_xref="GeneID:11507348"
                     /db_xref="JGIDB:Spoth2_2303691"
                     /translation="MPPRVDRNLAKTRPSRLPNSIYGGRRFEPRSSSIALSFSGAKRH
                     GPSSARRWIWYWLGGAGIAILHGYDGANPVHSGRDSAAEEALASWPKERKTFMAEFRS
                     GPIW"
     gene            1171696..1173396
                     /locus_tag="MYCTH_2303692"
                     /db_xref="GeneID:11507349"
     mRNA            join(1171696..1172166,1172233..1173396)
                     /locus_tag="MYCTH_2303692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662675.1"
                     /db_xref="GeneID:11507349"
     CDS             join(1171841..1172166,1172233..1173130)
                     /locus_tag="MYCTH_2303692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662723.1"
                     /db_xref="GeneID:11507349"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2303692"
                     /translation="MAKANSQKAACDRCRGQKLRCIWDPKEPQCQRCARANAVCTIPP
                     PRPMGRPPRQYRSQSSSSHSRGQTQSLYSWSEENATSTAPVSDEDTDIAMNSANVLSD
                     PLDFLPWFPEPDGLSLSAPRGTFPTPVTAPAPIPNGTPNVNGTRPFGQQNEIFASPLN
                     NGGKPAEGNQSNHSGVDEADQMDYTTVENGGPGDDQIQLLTELCELNVALFQHPLHRE
                     KDKAGLRTMLASHSENARPQQPAEAPSADSSSNGSNGSSVIELNARELRTGNLFEMTC
                     RLMDIVTRIRAQEEAAAQGQERYDRSTALIALSCYTRLDVLYSRALDILVRIRNNGPI
                     PEGSHHLMPELVIDGFSMKRCLDLQLNFLIYLHGQARERIRSCIRSAEGTARVGRDRR
                     DSARQGSPAPARFDL"
     gene            complement(1175597..1176988)
                     /locus_tag="MYCTH_2303693"
                     /db_xref="GeneID:11507350"
     mRNA            complement(1175597..1176988)
                     /locus_tag="MYCTH_2303693"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662676.1"
                     /db_xref="GeneID:11507350"
     CDS             complement(1175898..1176863)
                     /locus_tag="MYCTH_2303693"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662724.1"
                     /db_xref="GeneID:11507350"
                     /db_xref="JGIDB:Spoth2_2303693"
                     /translation="MHPKRTYFLAPTRDQAPTGPIALGNLIRSPREPDFPLNDPNSPT
                     VRRLQSAATVVPEADATRSAHAARSLQPTVFLSFLSGLLGQNPVELSVAYSTAGGAAY
                     RIPRLETRTIHPSAADVAALFAEPAVQAALRDSRFTANLYLVTGLQIATHGAEYLVSG
                     ARARGVRLHFLTDLITTAAGGVPVGAGVGAEATEAMEGRSAGRIEGPFVLAYSLREVL
                     YRRKKVTGQRRPRIEGDLYADGERKVRIIKREEEEEEEEEEEEEGQVESFEAELAGLK
                     DEDPELPEYWDLIDVETGVDLDGAECQIVRVAADKHDGDDDLDED"
     gene            1178775..1181285
                     /locus_tag="MYCTH_2303695"
                     /db_xref="GeneID:11507351"
     mRNA            join(1178775..1179551,1179632..1179962,1180069..1180833,
                     1180924..1181285)
                     /locus_tag="MYCTH_2303695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662677.1"
                     /db_xref="GeneID:11507351"
     CDS             join(1179001..1179551,1179632..1179962,1180069..1180827)
                     /locus_tag="MYCTH_2303695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662725.1"
                     /db_xref="GeneID:11507351"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="JGIDB:Spoth2_2303695"
                     /translation="MLQIRKAQTVPIPVGRSERRQIEALPTFAPGTLIFLNHDPASEG
                     RLSASATSLVVQETRARSSSTGRALPESASLREPYDKEHRESRSSPPTKSSDRDLASE
                     STPSEDTLGEQRSKTLEESGPKPVLVNARKQDTEELGSGVDNPILIPSGVNPGPPKES
                     EPKSSVVNKGSISDATQQLVDDTSVDIWFGDIEKINEEILEPYRRQACKRVKVGILDT
                     GIDMKNTAFHKAEVRQRIKKRVDFCDPNGKGTGRDKCGHGTHCAALINRIAPAADIYV
                     GRVAIDFDSGVDENVVAKAITIALGSRGPGDASNNWDVDILSLSLGFQHYSEAIDTAL
                     RTSTRKGKIVLAAASNNGTLRAMAYPAWDPDVIPINSANARGRPSDFNPPAVPGRTLT
                     ILGENVPSAWITTTPTATTTASTTDMSGPDDAGAPEAAAAAVDLAATRRMSGTSVATP
                     IAAGLVALLFEFAMVEVPNDPVTQATLNDVLPNIKRQTGLNALLMGKAARTGDFHNIV
                     PMNLLNPNLTLGENAAVIKGVLARWFGFRRPIKGTDGV"
     gene            complement(<1181825..>1194022)
                     /locus_tag="MYCTH_68164"
                     /db_xref="GeneID:11507352"
     mRNA            complement(join(<1181825..1183996,1184069..1184580,
                     1184639..1186540,1186613..1187319,1187397..1193500,
                     1193576..>1194022))
                     /locus_tag="MYCTH_68164"
                     /product="polyketide synthetase"
                     /transcript_id="XM_003662678.1"
                     /db_xref="GeneID:11507352"
     CDS             complement(join(<1181825..1183996,1184069..1184580,
                     1184639..1186540,1186613..1187319,1187397..1193500,
                     1193576..1194022))
                     /locus_tag="MYCTH_68164"
                     /note="polyketide synthase/non-ribosomal peptide
                     synthetase hybrid"
                     /codon_start=1
                     /product="polyketide synthetase"
                     /protein_id="XP_003662726.1"
                     /db_xref="GeneID:11507352"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_68164"
                     /translation="MSSAQAKSEPIAIIGSGCRFPGSASSPSKLWDLLSKPRDVLSEI
                     PRSRFDPHGFYNPVGDTSGHSNVLHSYVLDEDVRAWDADFFNISANEAAAIDPQQRLL
                     METVYEALEAAGQRIGDLRGSDTAVYVGLMGEEYSSIQGRELDMMPTYHATGTARSIV
                     SNRISYFFDWHGPSMTIDTACSSSLVAVHQCVQQLRAGHSRMAVAAGTNLLLGPEPYI
                     SESTFHMLSPRGRSHMWDAEADGYGRGDGVAAVVLKKLSDAIADGDPIECIIRETGVN
                     QDGRTGGITVPSPDAQVALIEDTYRRAGLDLSSPSDRPQYFEAHGTGTATGDPLEAEA
                     IHRAIGSRLGPGEKLYVGSVKTIIGHTEGTAGIAGLMKASLALQNRLIPPNLLFKTLN
                     PRIEPFYKGLEVPVKAREWPEGAPKRASVNSFGFGGTNAHAILERYEPPTALPRAEMG
                     IVARVWTFTFSAASKASLSQALRNTADFLGQSPNISARDLAYTLNSRRSTFPYRVAYV
                     ARDVEGLRKRVLDSVGSPEWETQAVVRPPNRPMKILGIFTGQGAQWPGMGKQLLEASP
                     FAQARIQELELALATLPAADRPSWSLREELVAEGSKSKLHLAEYAQPLCTALQILLVD
                     LLTAANVKFSAVVGHSSGEIGAAYAAGVLSARDAIVTAYYRGVHTKLAGGPDGQRGAM
                     LAVGTSPEDAEDFVSLPRFEGRIGIAACNSPTSVTLSGDADAIEEAKEVFEDESKFAR
                     ALRVDKAYHSHHMRPCSDPYVASLRKAGVTANKPRDGCKWYSSVHDGAVLTGHANEEL
                     DSVYWARNMAQTVLFSTAVESACAEEQYTIAIEVGPHGTLKGPALDTMKAVTKSVPAY
                     ISCLSRNSDSSEAFANAIGQIWANAADGALDLDKYHITAHGLSGARPSIIKDLPTYPW
                     DNKRVFWNESRRSRALRLRTEPGHPLLGILSPDSNDTDLSWHTVLRLSNLPWISGHQL
                     QGQTVFPAAGYVALAAEAAKQLAKAAAAGPLAKIELKDLDIGKAIAFESDKAGIELVF
                     SLHIDKATEIDGHRVFETSFFARSVTATAESTDAALNASGRMQVTVAGDGAAEPLESL
                     PAQEAGPAAMTEVDDSLFYSELKQLGYGYSGAFRALHSMTRKSDFGRGRISKVDAASM
                     HPSEKDLLVHPGYLDAAFQAMFLAYSYPGDGRIWSLHVPVSIKSIRIDAARCRANSDD
                     YLSFDAAINAAESLSGKIDLSGDVDIFSGDGRTGLIQVENIRLIPFAPATESQDTQMF
                     YVNTWNTASPDGAIAAGDNRASQEDNELGWLLERVAHFYLRNLAESIRPDEEAGARWH
                     HKKLLEFARQSVALARGGRQRFFKKEWLRDTAETLEPLMDAFGDRVDVQLLRNVGEHL
                     ADAVRGQGDILTHMTKDGLLDRWYEESLGLGEYTGFLAEVVGQITHVNPHVRILEVGG
                     RSGNATKKILKRASHAFSHYTFTDVSPDAVEAAKSLFPDYQGRMSFQVLELGADLAEQ
                     GFQAHSYDLVIGVLALHTWPQDPEAYLSNLHQLLKPGGYLALLEATSGATVRLPAMMG
                     GLEGWWPAKNRGRGSTKRLSAAEWHAALVQAGFSGIETSTPELDVLPRPYSVLVSRAT
                     NEHIDLLLEPSSKNDASALSHIDELVIVSGRSLVSVRLAEKMRRLLELHSERITVVPA
                     AQDLASLDLSARPTVLYLADLDEPVFTRYTPEAHDGLKKLWTTAQTVLWATRGARRDN
                     PHAIMSLGLGRAMMVEQAHAKINVQFIDFAVDARLDAHMLVDELLRLQILGRLARESA
                     DFVWVKEPEFEVDAEGRKWVPRIVPHQATNDRYNSSRRQIVAEADPAKEVVEVVESHD
                     DNNGSQNRALIRVLAPEARRTDGEEVTRVRVLYSATVPLRPSSSQALYPFIGLDTATD
                     APVVALAKSIASIVEVPASSVVPYNYPLDEAPSRLRAITSHLLASLICSEAATVDGTT
                     LLVDPDDDLAESVAKLAGEKRLSVTSVTTSPASKRAYPGVSVSAHASSRTIRRALPPR
                     IASVIDFTKPSSWRGNFVAQIKALLPDAARFEKASSFQARNFSTTALAALCQEAVHLA
                     PTNLSKSGAVSADAYVADPQSSAASVIDWTASSSVSVSVKPSDALPIFRGDRTYVLFG
                     LAGAGGLGLPLAEYMVSLGARYIVLTSRRPSVDPHLIAEYAAKGVQIKAVKNDITDEN
                     DVRSLIADLRSSWPPIAGVANGANVLNDMSFEDMTFDDMNKVLRPKVEGTRILDQIFY
                     DDPLDFFIGFSSISIVLGRAGQSNYDTANIYMLGLASQRRARGLNASVIDIGPIAGVG
                     LMARDVSENVMNLLVSHGYRKMSGRDFLATFTNGILMGRVDSREPEELITGLTVHPKK
                     GKFQPTWVDNARFSHLLLNTDGASGASSEGSAQVESLEDLLKRARSPGDVGRVLRVAV
                     LNKLQNILSLSDELVNNPDALLQQGTSALGLDSLLAVELRTWMRSELGVDIPVLKILS
                     DTPVQGLVDYAVENLPAEYVPNLDPNGKDAITEESLTAPKAKEEHPKPVAASVPPAAP
                     PVATTTKPNGSPTLPSVPSSASETEAPTPTGSSSPASSVADPTESTSLVAPPSSQPVS
                     LSPSLTISQSPAIEKVLPMSFGQSRFWVMTQIVQDPTAFNISCDVEIQSEIDVRALSR
                     AVEMVGARHEALRTCFFHEDDQPMQAILKESPLRLETVSASVSDIDRLFQEVHNTVYD
                     LSKGETMRAMLVSTSRTHHHLLVGYHHINMDSSSFVVFVADMIKIYAGQKLSPPRMQY
                     SDFSKYQVEQLSKGNWDSLIAYWSNEFARLPDPLPILNVSPNTSRPRPNLTTYENRSI
                     ETRVSASVARQVKSACRKLKVTPFHIYTTILQITLARLAATDDICIGIADANRADVGA
                     TDSIGNFLNLIPLRLPTDLNLPFSSLVKATKNKVLHGLANSAVPFDVIMEKVGVQRSS
                     THSPLFQAFIDYRYVTEKLPFGKGHLEGKRYIVSKTPYDVMIEMIDTPTGEASLKLLT
                     QEALYTPEESQTIMGCYTTLLDAFTKDTELAAGQPQMFDAGEVNRALQLGKGEFLDLQ
                     HPTILTEVDETAAQQPGAVALRDSQGNSLSWSDLKLRSVAIGQSLVNLGLPARSRIGV
                     FQEPDVDWVCSMLGVWRAEKTYVPLETTQGVRRLADVAKEAKLAAVLVHDPTVPLVSQ
                     LALDDTVKVINVSTLPFNRLAATSFVSNHKPSDEAMIIYTSGSTGVPKGISIAHRVVV
                     NAARSFLHRWPMSPQTVLQQTPLSFDVSWWGAIIALATKGTVVVAGPEARRDPRALTD
                     LIVSKKVTFTFAVPSESVAWLQGGDLAALRSSAWTWHCSGGEPYSQNLINHLRLLDKP
                     DLRAINIYGPTETMIPNAYEVLYRSFSASDMPVPIGRVMPNYTARVVDAQGHPVPAGI
                     PGQLLFAGAGIADGYVGNPELTAERFPEDDLAPAEFVKQGWKLVHHSGDSGYLRESDG
                     QFILQARINGDTQVKLRGLRIDMLDIEAQLLSTAKGLVSDAVVHVRKPEPNNSSADFL
                     AAHVVLSEEGRARYATPAEQETFLDKVVAELRVPDYMRPAVIVAVTSLPLTHHGKVDR
                     KAVAKLPLTRALGKATETPVGAAAAVDLGGNENLNKMKDLWLNVLGESVHAHTLGPNS
                     DFFLVGGNSLLLIRVQGDLRKQYGLDVPLTQLFQRNTLAQMASLLDGKDRNNASATSG
                     IDWPREIKLQPALSHLRAPASPMPKSGLVIALTGASGFLGLELVRQLVRLPEVKTVHA
                     LAVRSQSKLAQVSSPKLVIHPGDLSKPQLGLTDTAATEVFKTSHAVIHNGADVSFLKA
                     YGSVRRTNLESTKDIVKLALQHGNVRHLHYISTAGIATMLGHDLYEESLGAFPPTSSP
                     EGYVLSKWASELYLERASAVTGLPVTIHRPTAIVGENAPHLDVMSNILHYSRQMATVP
                     SMSALEGTFQFVPVEDVA"
     gene            <1195042..>1195934
                     /locus_tag="MYCTH_50128"
                     /db_xref="GeneID:11507353"
     mRNA            join(<1195042..1195416,1195488..>1195934)
                     /locus_tag="MYCTH_50128"
                     /product="methyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662679.1"
                     /db_xref="GeneID:11507353"
     CDS             join(<1195042..1195416,1195488..1195934)
                     /locus_tag="MYCTH_50128"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003662727.1"
                     /db_xref="GeneID:11507353"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_50128"
                     /translation="KAGDWDRFAETYKQITESTNIKPVGAILDRLNALWPFKDATGFL
                     DNGCGPGTIMARLIDVYGTSLPPSCSLLCTDYSPAMIKQVEAAREKQEPASLWARVDA
                     RVLDALDLRGIGDNSLSHVAAGLLYNLTTDPHKCLTECRRVLQPNGVLAASAWEGNEW
                     LEMMQVLPIIKPELKSAVKAKWTSVSAMKADLAAAGFRDVEVESVPVQVPFESHDLFV
                     DTLLTYQPRMTALLRDFTEQEKATLRKLLIEEMKVYCPTEPGALNGVVLVATGCK"
     gene            1197107..>1198357
                     /locus_tag="MYCTH_115957"
                     /db_xref="GeneID:11507354"
     mRNA            join(1197107..1197331,1197411..1197575,1197674..>1198357)
                     /locus_tag="MYCTH_115957"
                     /product="2OG-Fe(II) oxygenase-like protein"
                     /transcript_id="XM_003662680.1"
                     /db_xref="GeneID:11507354"
     CDS             join(1197173..1197331,1197411..1197575,1197674..1198357)
                     /locus_tag="MYCTH_115957"
                     /codon_start=1
                     /product="2OG-Fe(II) oxygenase-like protein"
                     /protein_id="XP_003662728.1"
                     /db_xref="GeneID:11507354"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Spoth2_115957"
                     /translation="MPVPLLDASQVRAGPEARKSFLRDLIQSFQDYGFVRLTNHGIPP
                     ARVKEMFELAGELFSLDTETKLGFANIADGSPQRGYSAIGVEKTASLHGKLIGRNVDE
                     RLTDAREHFDCGSPLDEEYRNRWPQSESLGYFRKEMEAFYFEMEQVTAELLSWLEEGL
                     GVPRGTFNNLVTHEKNASELRLNHYPPVPASQLLSGQVSRIWPHFDLGVITLLFTSGV
                     GGLEVEDRKAPGPQTFIPVEAETQDELIVNISETLQRWTDDKLPAGLHRVSTPKELEE
                     RIKTDSSVEIPRRYSIAYLCKADRHASVGTLPAFQTEEKPHYQEMTAAEYHRQRLLTA
                     Y"
     gene            complement(1198863..1199872)
                     /locus_tag="MYCTH_2303701"
                     /db_xref="GeneID:11507355"
     mRNA            complement(1198863..1199872)
                     /locus_tag="MYCTH_2303701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662681.1"
                     /db_xref="GeneID:11507355"
     CDS             complement(1198891..1199634)
                     /locus_tag="MYCTH_2303701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662729.1"
                     /db_xref="GeneID:11507355"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="JGIDB:Spoth2_2303701"
                     /translation="MQSLSETVLTDDVGDRACSVEFVVGDNVGAARRADVVILSCHPH
                     QGAEVLGMPGMREALSGKLLVSMLGGVSVAKLEEGLYGNPRRSESPGLRPCHILQAIP
                     NVAAARQKSVTVVGGQSASIPGEVLELGHEVLRRIGTPVPVSTNQMPAATALCASGTA
                     FFSWFLEAMVDAAVAQGIERSKATHLAALTMAGAAELVVSGQDPAAVTARVTTPGGAT
                     ARGLATLERGEAKETVVKALQATTSKICS"
     gene            1200340..1202085
                     /locus_tag="MYCTH_2303702"
                     /db_xref="GeneID:11507356"
     mRNA            join(1200340..1201708,1201780..1202085)
                     /locus_tag="MYCTH_2303702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662682.1"
                     /db_xref="GeneID:11507356"
     CDS             join(1200562..1201708,1201780..1201868)
                     /locus_tag="MYCTH_2303702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662730.1"
                     /db_xref="GeneID:11507356"
                     /db_xref="JGIDB:Spoth2_2303702"
                     /translation="MARINRQTAYQKADEIEFSTSSADPLAAWRISGIKGPVWEQWYF
                     DSVADDGKSSVVLTIARDASYALLGRGTLRVELDVTFDDGSHYNNVDWISEAIVEDRS
                     GPKNTGTVDGSWTAPNKAYRYQIAADGSAAKVEIATPEVQGHFTLAALSPPLYPEGET
                     QEELKASGKTATTELLPKIHLVQVMPTATFEADLVVRDRLVRFRGIGGHMHAWAAGSW
                     FDTTLGWRVTRGVAGPYSVTLMEYTDMDGVVHSSGFVARDGKKLFGAKEVYATPRSSS
                     ALQRALRYTGAGKDERKPKHTVRWTPTYNTGFAGRFGDSSTGAILRFAAAEGEEYQFE
                     LVHRRKAFEYLFGSSDTGLTAFLGEIKGGKVGEEVYRGVQFSDVCVLPQGITKVYFFI
                     CMLIAVLTFGYINILETNT"
     gene            1202844..1204604
                     /locus_tag="MYCTH_2138881"
                     /db_xref="GeneID:11507357"
     mRNA            join(1202844..1202994,1203066..1203120,1203219..1203368,
                     1203440..1204004,1204088..1204116,1204195..1204287,
                     1204361..1204604)
                     /locus_tag="MYCTH_2138881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662683.1"
                     /db_xref="GeneID:11507357"
     CDS             join(1202910..1202994,1203066..1203120,1203219..1203368,
                     1203440..1204004,1204088..1204116,1204195..1204287,
                     1204361..1204496)
                     /locus_tag="MYCTH_2138881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662731.1"
                     /db_xref="GeneID:11507357"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2138881"
                     /translation="MERIPDTMTAVVFDGPHNISVQQRPTPKIQDDGDIIVKVQAAGL
                     CGSDLHLLRGLEKTKTTGFIMGHEFSGTVVAAGSGVKTVSVGDKIVSPFTVSCGACFY
                     CKNGFSSRCVHCLVFGTEGLAGAQAQFVRVPRADGTVMKAPPEISDDALVLMADVFPT
                     GFFGAKNAFAGLPRTQRPSDAVAVVIGCGPVGLSAIVSALEYKPRHLFAIDAVESRLR
                     VAKYLGAEPLNVADGQENIVKRIGELTEGRGADVVVEAVGLSPALRTAYDIVRPFGSI
                     SSIGVHNSSMPFTATEGYDKNVKIQMGRCPVRSIFPEALPVLAKAQHRFGFMFEKLVP
                     LSEAVESYALFSEMQVQKVIFKPWQRFERENRNTRL"
     gene            complement(1204833..1206156)
                     /locus_tag="MYCTH_2303707"
                     /db_xref="GeneID:11507358"
     mRNA            complement(join(1204833..1205748,1205819..1206156))
                     /locus_tag="MYCTH_2303707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662684.1"
                     /db_xref="GeneID:11507358"
     CDS             complement(join(1204928..1205748,1205819..1206041))
                     /locus_tag="MYCTH_2303707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662732.1"
                     /db_xref="GeneID:11507358"
                     /db_xref="JGIDB:Spoth2_2303707"
                     /translation="MTKIFATGVTGYLGGDAVYAILQAHPEYEISCLVRDKAKGALVS
                     EAHPSLRIVYGSLDDGDLLEEEAANTDIVCNFAHATHEPSVQALARGLARRTRPGPGF
                     LIHTMGSGTVIYDDVVKGRYGQGSDKVFNDLEGLAEVLSVPDFAKARGAENAVRQVGI
                     QLPNQVKTAVVSTGSAYGLGRGILKYRPTAIHELVRATLERKRAIVVGEGKSAWTNVH
                     VHDLSELYLKLVEHAAAGGEETGSGPAVWGGSEGFYFAEGGEHVWSELARSVSAEAAA
                     QGFLTQVEEPESIEPTEASKIMPMGQFFWGCNARVEGRRARQALNWQPHHPSLKEELG
                     SIIATEAKKLGLV"
     gene            <1206613..>1208349
                     /locus_tag="MYCTH_81364"
                     /db_xref="GeneID:11507359"
     mRNA            join(<1206613..1207195,1207322..>1208349)
                     /locus_tag="MYCTH_81364"
                     /product="cytochrome P450-like protein"
                     /transcript_id="XM_003662685.1"
                     /db_xref="GeneID:11507359"
     CDS             join(1206613..1207195,1207322..1208349)
                     /locus_tag="MYCTH_81364"
                     /note="Cytochrome P450-like protein"
                     /codon_start=1
                     /product="cytochrome P450-like protein"
                     /protein_id="XP_003662733.1"
                     /db_xref="GeneID:11507359"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_81364"
                     /translation="MTTFSIFGLERPAVLALSIAVGASYVIYLVTITIHRLFFHRISH
                     IPGPKLAALTYYYQSYYDFFPHQGQFIFKLDELHRKYGPIVRIGPDEVHVNDAKFYKE
                     MYGSSTHKRNKSPIWYWMHGLGAVGDQSMFITLDHDHHRLRKAGLGTYFSKRKVQELE
                     PRVKEKVLLLRQRLLERAGGAPVNLKDAFGAMALDIITQYCFNRCFGALDRPDLGREM
                     NKLMGVGVKINPFARTFPTLARTVIKLPRWALKWSGLVSTTAEFLDLADRLSAEARNE
                     AIRDLASGKYSQTDDADSRTVLHSMMRSDVLPEHEKTEKRLQADGMTLIAAGFDTTSR
                     TLTVIFYHLLTKDHIRARVLDEIRTLMPTPTSPLPTVAQLEQLRYLTCVIHEGTRLAH
                     GVAGRLVRIAPEEDLEYYSPFDGRRYTIPRGTTFGQSSYLVHTDESIYPNPAEFDPDR
                     YWTDDGRPTDAQRYLVPFGKGTRMCVGINLAWAELYLTIAALIGTVDMRIAPGTTEHD
                     VTMVQDLFVGVLPENPGVRVNVVGHLQA"
     gene            complement(1209116..1211039)
                     /locus_tag="MYCTH_2303709"
                     /db_xref="GeneID:11507360"
     mRNA            complement(1209116..1211039)
                     /locus_tag="MYCTH_2303709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662686.1"
                     /db_xref="GeneID:11507360"
     CDS             complement(1209400..1210866)
                     /locus_tag="MYCTH_2303709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662734.1"
                     /db_xref="GeneID:11507360"
                     /db_xref="JGIDB:Spoth2_2303709"
                     /translation="MYPFFTYSPNRHYFEYKWYNLELLRLLGAAPYGGCDAAEFLELV
                     ASLIPNDADDWNRKFLALAERTQSWAEEMQRNGHLSAARGAFLRASNYFRCAQYLFPI
                     MPAEEQPYFLSLYHRSISNFEQATKLMEHDVRRVRIPFQPPEYRAPLLRLPGWLHLPA
                     PSRRLKGRKTPVLICIGGADSTQEELYFLHVAEGPGLGYAVLTFDGPGQGLVLREDGV
                     PLRPDGEIVVEAVLDFLASYAEEHPEADLDLDAVAVTGQSLGGYLALRGAADARIKAC
                     VAVDPVYDFYDLAMSRMPRWFMWPWERNYMGDGFVDFAVREHAKLDVATKYTFAQGCH
                     MFGSSNPAQMIRDMKQYTFRLDRTVTADNKNRGRANRDYLEWVRCPVLVTGAGGDPKL
                     FLAEMSTSAIMRNLVNVPEGQKELWVPKAWSEGGAQAKSGAWPLLQYRTFKFLDEKLG
                     IQRPSSPKRVYENGYENGYTNGFVKNGYENGFVTNGYH"
     gene            <1211983..>1213963
                     /locus_tag="MYCTH_50920"
                     /db_xref="GeneID:11507361"
     mRNA            join(<1211983..1212401,1212489..1212694,1212770..1213671,
                     1213733..>1213963)
                     /locus_tag="MYCTH_50920"
                     /product="general substrate transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003662687.1"
                     /db_xref="GeneID:11507361"
     CDS             join(1211983..1212401,1212489..1212694,1212770..1213671,
                     1213733..1213963)
                     /locus_tag="MYCTH_50920"
                     /codon_start=1
                     /product="general substrate transporter"
                     /protein_id="XP_003662735.1"
                     /db_xref="GeneID:11507361"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_50920"
                     /translation="MSEGAGTGTGSAAESSEAAAKKGDEAGEGDATPPKTSHSLRFWG
                     IVASLAFTALCSSIEGTIITSALPTISAELGGDSSFIWVPNGYFLATMVMLPLMAQAA
                     NLFGRRWLTLISVAMFTLGSGICGGANSPAMLIGGRVVQGLGGGGIALMINIVLTDLV
                     PLRERGKYMAIVQMVSAVGAALGPFLGGLLTERSTWRWVFYINLPIGGTSLVALFFFL
                     RVATPPGGTWVEKLKRIDFIGNAIFIAATVSVLIGVTWGGAVYPWKSANVIVPLVLGF
                     VGIGLFLAYEWTLAKNPSLPRGAIVERTAATVLAVTFLTTLCTYWAFYFMPIYFQGVK
                     AKSAFWSGVDALPLFAGLFPFAIIGGILLSKFGRYKPLHLVGMAIVTVSFGLFSILDR
                     NSSTAAWACFQLLCAIGSGLMIAILLPAMQAPLDESLVAASTGVWTFVRAFSTVWGVT
                     IPAAIFDNEVAKKAAASLTDQSLVGYLTGGKAYQFATQEFLDSIRDPASRSEVIDIFT
                     SSIKIVWYVGTAFAGLGWLLVWLEKEVTLRSKLNTKFGIEEKKKQEEDEEKAKNEGEN
                     KDGEESKAADGAKRAELSA"
     gene            <1215630..>1217022
                     /locus_tag="MYCTH_48716"
                     /db_xref="GeneID:11507362"
     mRNA            join(<1215630..1216147,1216298..1216378,1216476..>1217022)
                     /locus_tag="MYCTH_48716"
                     /product="alcohol dehydrogenase-like protein"
                     /transcript_id="XM_003662688.1"
                     /db_xref="GeneID:11507362"
     CDS             join(1215630..1216147,1216298..1216378,1216476..1217022)
                     /locus_tag="MYCTH_48716"
                     /note="Alcohol dehydrogenase-like protein"
                     /codon_start=1
                     /product="alcohol dehydrogenase-like protein"
                     /protein_id="XP_003662736.1"
                     /db_xref="GeneID:11507362"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_48716"
                     /translation="MGSLQDLPPLPTTQTAVITTAEGRHAVARDRAVPACGPTSVLVR
                     VRAVALNPTDHKTPARVKTGGLTAGCDFAGEVVAVGARANDEPGDAAACAGIPRRWAP
                     GDRVLGVVYGSNPGAPAWGAFAEYVEADPVMLCRLPDGWDWETAASVGGSVHGSVALC
                     LFGEGKMGLDMGGKKDLQKVVLVYGGSTACGTMALQILRLAGYIPIATCSARNAGLVT
                     AYGAAATFDYNLETCADEIKEYTKSALWYALDCIGTAQSAALCYAALGRAGGRYVALE
                     KYPDSVAALRKVVKPTWVMGPVMFGRDLQLGEGYSQPADPSARAFARIWYPLAEALLG
                     SGALKNHPVKVVAPEGREEWPEAVIRGLGGLRDGKVSAQKLTVTIAA"
     gene            complement(1217761..>1219561)
                     /locus_tag="MYCTH_107763"
                     /db_xref="GeneID:11507363"
     mRNA            complement(join(1217761..1217970,1218068..1218334,
                     1218432..1218783,1219184..>1219561))
                     /locus_tag="MYCTH_107763"
                     /product="general substrate transporter-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662689.1"
                     /db_xref="GeneID:11507363"
     CDS             complement(join(1217903..1217970,1218068..1218334,
                     1218432..1218783,1219184..1219561))
                     /locus_tag="MYCTH_107763"
                     /codon_start=1
                     /product="general substrate transporter-like protein"
                     /protein_id="XP_003662737.1"
                     /db_xref="GeneID:11507363"
                     /db_xref="JGIDB:Spoth2_107763"
                     /translation="MATDAPPSYDSIISKVDNNIKQDPTVEGLKRAFDSLDDEEKTIL
                     AAREHEPIELNPEQLKQFHQGFSEGFSQVQEHLEWKAANCAEQCKKVATDFLNITDKL
                     SSISSLDGSEESQKLVSDFKSLEKEAEDLEKEAQGIHDSFSNFLADIYEYTARFDSWA
                     QKKEGSLNDKITQLNKDIQDLKKEISKITTAMIAIGAVAGFALPALAVGAAVAGPFAP
                     LVIGIAIFAAVGTVASVTALAFKKSSLDHEIEAKEDEKKKAQEQLGKIQKARTELKDL
                     GKSLDDDVNHIVGVINTAWKYCQADAVEIRRWLEQGQKDADLPPYMAIQLGKADGIYS
                     VVGRYLRKYADALANTSGSS"
     gene            <1221989..>1222153
                     /locus_tag="MYCTH_2062976"
                     /db_xref="GeneID:11507364"
     mRNA            <1221989..>1222153
                     /locus_tag="MYCTH_2062976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662690.1"
                     /db_xref="GeneID:11507364"
     CDS             <1221989..1222153
                     /locus_tag="MYCTH_2062976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662738.1"
                     /db_xref="GeneID:11507364"
                     /db_xref="JGIDB:Spoth2_2062976"
                     /translation="TYNTRNSLVVTDPTTTRALSSLTRAERTGCRAFCWVWSYVLGAS
                     EKCHYIVQQR"
     gene            complement(<1223127..>1225213)
                     /locus_tag="MYCTH_2118002"
                     /db_xref="GeneID:11507365"
     mRNA            complement(join(<1223127..1223165,1223266..1223690,
                     1223801..1224723,1224813..1224946,1225037..>1225213))
                     /locus_tag="MYCTH_2118002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662691.1"
                     /db_xref="GeneID:11507365"
     CDS             complement(join(1223127..1223165,1223266..1223690,
                     1223801..1224723,1224813..1224946,1225037..1225213))
                     /locus_tag="MYCTH_2118002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662739.1"
                     /db_xref="GeneID:11507365"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2118002"
                     /translation="MASGTTCVKEKPIDSTGESPSEGGTASDSNLEANLPAKTGNEAA
                     KSDPNASPRQIHGILWVLVVIAILSSIFLYSLDNTVVADITPAAVNAFGDVLKLPWLS
                     VGFLLGGAAVVLPFGRLYGLFDAKWLYILSSILFNVGSAICGAAPSMDALIVGRVLAG
                     MGGNGMYLGVMTLLSVNTSDRERPGYLSFVGLVWGIGTVLGPVVGGAFVESPATWRWA
                     FYINLCVAGLFAPVYLFWIPSFKPRAGTKSLSLVREFDIIGTVLSMGAITALIMATNL
                     GGALHEWNSGQIIALFIVSIALFILFALQQTFTVFTTLTTRIFPVQFTKNWNAVLLFC
                     LAAAVNTAGFVPIYYVPLYFQFTRGDSAIQAAVRLLPLIFVLSATILANGHLMSRFSY
                     FQPWYIFGSALTLVGGVLLSRITTDTPEGQIYGFEILTGVGTGCFIQAGYAVIQAVTP
                     PAEMAYAISYMMLAQLSGIALGLAIAGAVFVNGAISRLAAVLPGVSREQLQLAVSGTS
                     GAYLSSLSPEVRAAATDAIVLALREVFIPVYVAAAFSLVLSVLFTKRKMFNTVAIAA"
     gene            complement(1226735..1228077)
                     /locus_tag="MYCTH_2303718"
                     /db_xref="GeneID:11507366"
     mRNA            complement(1226735..1228077)
                     /locus_tag="MYCTH_2303718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662692.1"
                     /db_xref="GeneID:11507366"
     CDS             complement(1226913..1227992)
                     /locus_tag="MYCTH_2303718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662740.1"
                     /db_xref="GeneID:11507366"
                     /db_xref="JGIDB:Spoth2_2303718"
                     /translation="MGEPGLDGIVLDIPSGIGPAHSGSSDPHRASKPPRKDASNTLGS
                     YLSAALAQSNNPLTQGQARTVPETIPSNATETTTAQELPTMLALDAAPPSPGQFGVLS
                     GVSPAPVPISQKSSPPCSCLSDLVRVVQQLDDDEFRITTLSLDQVLHLQKWLVFQCCK
                     PLDCPKCLDLPTIHTVRLIVCDRLTEMFECIHSRIKRAGAILASQQGSDSGSHSISSS
                     SLLSSSSSSSSSSSSSSSDSLRSVPQPPPWSAAVGSGPLPAQLFCRSSGRAANTVACN
                     PLMFSEDFRSRYSDEEQVHMIRALLRLQTRDFRKLLLRLERACEGARNQARRSKIESM
                     MARLSKAEADIEDALRVVLHVWSTG"
     gene            <1231217..>1231797
                     /locus_tag="MYCTH_2126499"
                     /db_xref="GeneID:11507367"
     mRNA            join(<1231217..1231374,1231439..1231586,1231639..>1231797)
                     /locus_tag="MYCTH_2126499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662693.1"
                     /db_xref="GeneID:11507367"
     CDS             join(1231217..1231374,1231439..1231586,1231639..1231797)
                     /locus_tag="MYCTH_2126499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662741.1"
                     /db_xref="GeneID:11507367"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2126499"
                     /translation="MASWLISSLLTAASLALLVLPIDASPSPAHLRSSITFRDNSSTV
                     PVVRVLNGSRRPCFTVSQPLNSSWEGVRNATAYPKHCIGYGGDNVGYELSEDCLYLNV
                     LDDLHRALNSITTTAVDGVPLAHRFPPILDGDFVADYPSKQLREGASPECAR"
     gene            <1242133..>1245108
                     /locus_tag="MYCTH_101972"
                     /db_xref="GeneID:11507368"
     mRNA            join(<1242133..1242605,1242715..1242947,1243058..1244827,
                     1245080..>1245108)
                     /locus_tag="MYCTH_101972"
                     /product="glycoside hydrolase family 95 protein"
                     /transcript_id="XM_003662694.1"
                     /db_xref="GeneID:11507368"
     CDS             join(1242133..1242605,1242715..1242947,1243058..1244827,
                     1245080..1245108)
                     /locus_tag="MYCTH_101972"
                     /note="CAZy_ID 267941"
                     /codon_start=1
                     /product="glycoside hydrolase family 95 protein"
                     /protein_id="XP_003662742.1"
                     /db_xref="GeneID:11507368"
                     /db_xref="JGIDB:Spoth2_101972"
                     /translation="MLVTAFLILGYAAADAAAKWDGTRFAWYTTDAGDDFKSTLPIGN
                     GRLAAAVYGTGTEKLVLNENSVWSGPWLDRANPNSKDAVPKIREMLISGNITGAGQAA
                     LDNMAGNPISPRAYHPLVNLGIDFGHGSGISDYTRWLDTFQGTAAVNYTYHGTSYSRE
                     YVASYPHGVLAFRLSADQPGKLNANFSLSRSQWVLSRRASVSDGEGGHTVALSADSGQ
                     PSDAITFWSEARIVNSGGNATSDGTTVFITGADTVDVFFDAETSYRHPDADAAQRELK
                     RKLDAAVAAGYPAVRDGAVEDFSSLMGRVRLDLGSSGSAGEQPVPTRLSNFRQDPDAD
                     PELMTLVFNFGRHLLAASSRDTGPRSLPANLQGIWNDDYDPPWQSKYTININIEMNYW
                     PALVTNLAETHKPLFDLIDMAIPRGRDVARTMYGCERGFVLHHNTDLWGDAAPVDRGT
                     PYTVWPMGAAWLATHAMEHYRFTRNRTFLAEVAWPVLRETARFYHCYLFEWDSYWTTG
                     PSLSPEHSFIVPPGMTTAGAAEGLDISPEMDNQLLHQLFTDVTEACARLGLFSSSSSD
                     DDDDDAETCTTTAETYLPRIRPPAVHPTTGRIQEWRSPEYADTEPGHRHFSPLWGLYP
                     GRQLLLTRAGSGSGSSASGSDSASANLTTAAAAALLDHRMESGSGSTGWSRAWAAALY
                     ARVPGRGRDAWRHARQLVATFLLGNLWNSDSGGDSVFQIDGNFGFVAALAEMLLQSHE
                     TAPASMRGSPGNNNRRTGVRQGEQQQQEEEEEKEVFVVHLLPALPGDEVPDGRVDGLV
                     ARGGFVVRELVWAGGKFARASVLAQNGVSKTTAFWN"
     gene            <1247185..>1248879
                     /locus_tag="MYCTH_2060248"
                     /db_xref="GeneID:11507369"
     mRNA            join(<1247185..1247397,1247896..>1248879)
                     /locus_tag="MYCTH_2060248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662695.1"
                     /db_xref="GeneID:11507369"
     CDS             join(1247185..1247397,1247896..>1248879)
                     /locus_tag="MYCTH_2060248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662743.1"
                     /db_xref="GeneID:11507369"
                     /db_xref="JGIDB:Spoth2_2060248"
                     /translation="MARELPDDAKYALGRMKAQIDQLQEAISQMREKNAEFEIRLQTE
                     AQLRREMEMWWWADKFSKEHEKSPRSPRIRINSPELLRICFQIENELNPGHSRSYRDV
                     QELKPMVMIQPFKTLVYNAERIRGCYRQLDENLKRSPNARATKGLDMQPEPGTEPKRH
                     QDEQNIRNLAQPASKRQDPVVAPSLFSSIEDERRARDHLRCLLEFIDGDLKERTEHIR
                     GGNCSRVTFGELWLLFQPGDIVLWNSAPQVALVLGTVDPGHKATKPFRGRGLRRRDKK
                     KEEDDEDDCFVIMCVSIEFDGVQLGPSSSMVKIPRFEGEKSIRSLPIYPFAYSSAPNA
                     REAYIARGKKFLEMTKIRHMYYTGQTVDPTTMYVDSQVVIDVEEAFHQWPQWRPDIEN
                     LVGIDIE"
     gene            <1249521..>1250515
                     /locus_tag="MYCTH_2040766"
                     /db_xref="GeneID:11507370"
     mRNA            join(<1249521..1249593,1249646..1249693,1249780..1249899,
                     1250010..>1250515)
                     /locus_tag="MYCTH_2040766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662696.1"
                     /db_xref="GeneID:11507370"
     CDS             join(<1249521..1249593,1249646..1249693,1249780..1249899,
                     1250010..>1250515)
                     /locus_tag="MYCTH_2040766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662744.1"
                     /db_xref="GeneID:11507370"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2040766"
                     /translation="GQGLVILLHGAPGVGKTSTAGMYKECVAEQFNKPLFHITCGDLG
                     VSASDVESALERSFALASRWDCILLLDEADVFLSARIFLRVLEYYSGCLFLTTNRVGD
                     FDEALTSRIHLSLYYPPLNLVSTQRVVSLNLQRIEKGLKQKNIELHADMVSIGGFIAN
                     YWREHPRARWNGRQIRNACRTALALAEFEATKMGSPQLAEQSSSSPQLVSLEARHFKQ
                     VADAYLDFTEYLKDIYGVHADERAKENFLRA"
     gene            1262694..1266410
                     /locus_tag="MYCTH_2303722"
                     /db_xref="GeneID:11507371"
     mRNA            join(1262694..1263932,1264007..1266410)
                     /locus_tag="MYCTH_2303722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662697.1"
                     /db_xref="GeneID:11507371"
     CDS             join(1262788..1263932,1264007..1266251)
                     /locus_tag="MYCTH_2303722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662745.1"
                     /db_xref="GeneID:11507371"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2303722"
                     /translation="MSSSDAQAGVENFPSIELEFSPTTAGETEAHLAQPDPTLEGPNE
                     TLDSITAAHDMADTAHFGDFQFPYQDTLQDSPMNGLGPSFDDHGPDVFRTPQANPTSP
                     VQDRQDSVASITVHSSAYGGANAQRPSPEGSDNSTPGSNGNGSNPLEDPLSDEFGLGT
                     GGVADGTDLGGKKGEKSDSAPAWSELKTKAGKERKRLPLACIACRRKKIRCSGEKPAC
                     KHCLRSRIPCVYKVTARKAAPRTDYMAMLDKRLKRMEERIIKIVPKAEQDALAASVTR
                     AVVKPAIPGTLPGGGKATAKKRGADEAFGADLDHWARAPSRSRLDGPNKPSTILVQEA
                     EESKLLLEGGDALPSKDIQEHLAEVFFENIYGQAYHILHKPSFMRKLKAGTLPPVLIL
                     SVCAIAARFSNHPKLNTYPNFLRGEEWASTARDILTKRYEWPNITILTCLLILGLHEF
                     GTCHGGRSWALGGQAIRMAFALQLHKDLEHDPLRIPGKTQLSFIDREIRRRTMWACFL
                     MDRFNSSGTDRPTFIREETLKIPLPIKEKNFQYDLPGPTETLSGQVTEPVSEDNPNEA
                     RDNMGVAAWMIKAIALWGRIISYLNQGGKELDPHPMWSPDSEYSKLLKQTEDFINELP
                     ESLAYTPENLKVHETDNMANQFLFLHISIQQNILFMNRFAVSSPSGHSLQDVPKSFVT
                     KAGAKAFAAANRISELLKDAESYFITAPFTGYCAFLSSTVHIFGIFSGNPSMEATSKR
                     NLATNVRFLSKMKRYWGMFHWMSENLREQYRTCADAARQGNPASENAASPIFQYGDWF
                     DRYPHGVSQSDFLDPATYKKKEKGEDAVLEQKPELHTVEEYFTSLSPQSAENAAAANG
                     ANGANRPGQPNASQLKRKSVVRKASTTSRGSGPGSDQGLEPLQTDFARATAEQLRAAR
                     LHQRSFSGAAPNGGAQTSGAPPGHFNPLAVAGNGPGPYHPALSPISPVPFSHPHHHPH
                     APPQAFFPPDPFAMPLTATHHGMSRLDRQLVFGAYGGHSHAVDHPSLAGSGLAGWADG
                     NNPAAAAAALAAAEVRDGHPHGAAHGRHPGHPGHGHHQHPADAALHAAFGEPSSAWFM
                     PFNMEPPELGPEGLGGIGGGLDGFATMFGGGGAAGAGMHHH"
     gene            complement(1266994..1269426)
                     /locus_tag="MYCTH_2303724"
                     /db_xref="GeneID:11507372"
     mRNA            complement(1266994..1269426)
                     /locus_tag="MYCTH_2303724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662698.1"
                     /db_xref="GeneID:11507372"
     CDS             complement(1267192..1269315)
                     /locus_tag="MYCTH_2303724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662746.1"
                     /db_xref="GeneID:11507372"
                     /db_xref="InterPro:IPR007851"
                     /db_xref="JGIDB:Spoth2_2303724"
                     /translation="MAPAPVKGAKNPEAESQDDKPVPKKSLFEDSDSSGSEDDQEDGG
                     ATLGTSAELKINEEYARRFEHNKKREELHRLQEKYKSSGLGDEESEESSEDETEDDDA
                     ELITEELDAEISATLQAIKNKDPKIYDKNAVFYKPFDPDALPKKKEEKPMYLRDYHRE
                     RYLSGDIGADDDNGSAPNAPRTYAQEQDDIKKSIISEINAAAAAADEEEWSDDDAFIK
                     PVKKDEAPAENGVHPSRKPNITLTEEDVANADKNPEEFLNKFIASRAWVPEDGGSKWQ
                     AFESDEGEDNGDLAEEFEHAYNMRFEDPEKSNEFLKTYSRSLAAARSVRKEELTGRKK
                     KRALEKERKEAEKREREAERARLRRLKIEEASEKLAKIKKAAGMRGQKLTDEEWLKFL
                     DDAWDDDKWEEEMKKRFGDDYYAEPDDMSLSEEEEDSEDEGGKKKKKKKKPKKPKWDD
                     DIDINDIVPDFEDSAKPAITLSDEDAGAAEQEEDDGEATSDGEEDSDGERPAKKRKTS
                     KEIKKERIRAKREARAELAKIEALVDTKMELENPRALQSLGKKATGGFRYRETSPQSF
                     GLTARDILLAPSDAALNEFAGLKKLATFRDEEKKRRDRKKLGKKARLRKWRRETFGKE
                     YEHTGPTFGFEALLANDNTDAKGKGKGKGTGANAVAAGSGADKKKGAAEGKPEPVNGI
                     IEGERKKKRKRSKKKKSSAAMELDE"
     gene            1269563..1270914
                     /locus_tag="MYCTH_2303725"
                     /db_xref="GeneID:11507373"
     mRNA            join(1269563..1269881,1269943..1270006,1270081..1270914)
                     /locus_tag="MYCTH_2303725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662699.1"
                     /db_xref="GeneID:11507373"
     CDS             join(1269807..1269881,1269943..1270006,1270081..1270643)
                     /locus_tag="MYCTH_2303725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662747.1"
                     /db_xref="GeneID:11507373"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2303725"
                     /translation="MADSNAPKPSSSVKLVLLGEAAVGKSSLVLRFVNNDFQENKEPT
                     IGAAFLTQKCNLPTRTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDLTKPTSLIK
                     AKHWVAELQRQASPGIVIALVGNKLDLADDGAGSGGDAEDAGGEESGNARKISTEEAK
                     TYAEEEGLLFFETSAKTGYNVTEVFTAIANAIPETSLKTARGPGASHAAARTEEQRVN
                     LNGPRDPNAKEGCAC"
     gene            <1271479..>1271980
                     /locus_tag="MYCTH_2038181"
                     /db_xref="GeneID:11507374"
     mRNA            join(<1271479..1271519,1271581..>1271980)
                     /locus_tag="MYCTH_2038181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662700.1"
                     /db_xref="GeneID:11507374"
     CDS             join(<1271479..1271519,1271581..>1271980)
                     /locus_tag="MYCTH_2038181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662748.1"
                     /db_xref="GeneID:11507374"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="JGIDB:Spoth2_2038181"
                     /translation="ASLTLTEAQVELINSLPQDDIPAKLRCAICSKLAINAFRLPCCE
                     QAICESCQSTLPASCPVCEHSPLSADDCKPHKALRTTIKVFLRTEEKKRESNRPKGAA
                     PTPITPVDPSPVTAAAPAIPERPLSGEATQAGEDRQAPVGEPSAD"
     gene            1272427..1274781
                     /locus_tag="MYCTH_2303730"
                     /db_xref="GeneID:11507375"
     mRNA            1272427..1274781
                     /locus_tag="MYCTH_2303730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662701.1"
                     /db_xref="GeneID:11507375"
     CDS             1272500..1274698
                     /locus_tag="MYCTH_2303730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662749.1"
                     /db_xref="GeneID:11507375"
                     /db_xref="JGIDB:Spoth2_2303730"
                     /translation="MDPMTMQMYMNGGFQGMGMNGMNMNMGMGGYGGEPDNWNGQQSW
                     NVGQDNYNHPSASGMGNGDYGSFNSGFQTGFNQGNYGHQNQFNDYRRNQFGFRGRGRG
                     RGYGYGYGRGGYQHGYGGGGNWNEQGYGGHQQYQNGQGDYQAAGGEANADGNVDEFGR
                     SLRGDNAQGASGEQGQGAGEGVPRIGNREQGNDGGDGRGSLPPPQPNPDVPPNAPKGP
                     KAMLQGLPNTSYKHLQARGWVDDTKPTTPTGAAAPGFDRGRSRSNSVLGSHHNRYHNE
                     SQHERSRERDHSGRDRHRERGRDRDMDTSRSRSRTRSRSRSHSRSRSRSRSYDRKEQR
                     RSRRQRSYSPSGDEEDESGDERRHHRSSHRRKHSSYGNDERESKPRRDEHQEEGRSRS
                     ASPPADDSRRSYRSSRKERDSEKRRDRDREKDREKDREKDREKDRDGHRHRSHRSHRD
                     REHDRDRDRDRDREKERDRTRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRD
                     RKDRHRDRDRDRDRDRERERDRDRDRESRRDREKDKDRHHRSSKTTAADGEDEQPPSA
                     LDNTESSQHPRHPSIGSRGALGLEIKGAASAGTSTAAAAAAAAGAVDGTRRSSLATAT
                     PATGATDVHAAERAARDRERLLRETRRMASLTSLAAAAGGASGLKRSRESRDGGGGGG
                     GVGDEERKSSRRKGRRGEVIVGGDAVVADGEAEEERMRRLEEERERARYE"
     gene            1275835..1277609
                     /locus_tag="MYCTH_2303731"
                     /db_xref="GeneID:11507376"
     mRNA            join(1275835..1277352,1277419..1277609)
                     /locus_tag="MYCTH_2303731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662702.1"
                     /db_xref="GeneID:11507376"
     CDS             join(1276066..1277352,1277419..1277595)
                     /locus_tag="MYCTH_2303731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662750.1"
                     /db_xref="GeneID:11507376"
                     /db_xref="JGIDB:Spoth2_2303731"
                     /translation="MRPLTGDDASARSRTSDRTSDPDPLSTFRLPAAPQMTFTLGDES
                     TIGPSSQGPTIPSRRAKEHGAVPHTEQHPEHPEHSKPRIPSHLDFERTKEPATTTRPP
                     GSKGGTIDTLRQEGYDLSQPVSPLPRSTDTPNLSRPLTPVFLTTSGPASALSSVSSRR
                     NSLCLSEDLPSCPPSMRDGDVAVEDDDDDNDDDNNNNNNNNNNNNNNNNNNNNNNGNG
                     DQEGMNAEKQQQQQHGGGSADEGDISNIQGNDDDAGGGGDTSCEISPSMVDSGSAPQL
                     IMPSIKMPSRRPFTDDGKRMGRLKVLIAGDSGVGKTSLIKAIVQSCDHIVHVDPINPS
                     PSSSSVVMGRSGLTGAAGGVGSARQKAGSRRQSARESAQGTTQITEIYASTKPYPEWW
                     SEVDDLRVLRRRKSLGDSVLDRNICFVDTPGYGSGSSSMDTITPVSQYIEAHLQRISS
                     NSLSDGDLLNLLGGEGGVQVDAVFYLVSNRKMLAYPC"
     gene            1277544..1279003
                     /locus_tag="MYCTH_2303733"
                     /db_xref="GeneID:11507377"
     mRNA            join(1277544..1277569,1277645..1279003)
                     /locus_tag="MYCTH_2303733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662703.1"
                     /db_xref="GeneID:11507377"
     CDS             1277728..1278786
                     /locus_tag="MYCTH_2303733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662751.1"
                     /db_xref="GeneID:11507377"
                     /db_xref="JGIDB:Spoth2_2303733"
                     /translation="MSADQIAASKAQIHGQLKEADIRLFSFSLPSSPTDADKQGVYAV
                     SNATGSDHDTMDASLLMSPDYVQPLAPSELCTLVADVFSPGGVARLRHAVARKYVQWR
                     ASSGQSRTSSSLFSTPSLSRHNQASPLSLSLSLQRTSEAGTSNSYALARLADHAQREE
                     RLAQVRLANWAADLQRSLAREREEYASLARKERALWLAERMGECVRDGDLGSLVVSER
                     SRSRLGVATDASNRDEEGRTRAPRRQRRGRAGQGDAKEDYCHHSSHRHCHHHHQQQQQ
                     QQQQKRQQQSQQHKQDPLGLLEVADELRHKGLVALELLGGIGVLGGLALWVTRNYLHL
                     QPYGWLAAEWERFWYGQR"
     gene            1282751..1284365
                     /locus_tag="MYCTH_111645"
                     /db_xref="GeneID:11507378"
     mRNA            1282751..1284365
                     /locus_tag="MYCTH_111645"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662704.1"
                     /db_xref="GeneID:11507378"
     CDS             1283062..1283925
                     /locus_tag="MYCTH_111645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662752.1"
                     /db_xref="GeneID:11507378"
                     /db_xref="JGIDB:Spoth2_111645"
                     /translation="MPSPLPISVPGNTQPSKLAGSSPASPAALPSPFRPRANKKMSIA
                     QTYFLAHKARAKLSSEAARPDHNLRLLVGHANLLDSLMLELADAEREQESWFNQSVRG
                     ASHTSSEERRIQWADTIVEEPEQDWRREDAESVSDSDSDSDSDFDDDEDIEMADAVPL
                     SRIPSHTMLPHKAAYPPSVAEEEDEDDGMDEDEEEDLAELALRRTPSNSASSSSPPEL
                     EDDSDDSIEDESMPPSPPTPLIPTFEGSQKESTDTPTTIDQGDKAAFYEEGYYLPPRN
                     QARLISAISVY"
     gene            1288346..1290165
                     /locus_tag="MYCTH_2303736"
                     /db_xref="GeneID:11507379"
     mRNA            1288346..1290165
                     /locus_tag="MYCTH_2303736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662705.1"
                     /db_xref="GeneID:11507379"
     CDS             1288459..1289895
                     /locus_tag="MYCTH_2303736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662753.1"
                     /db_xref="GeneID:11507379"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="JGIDB:Spoth2_2303736"
                     /translation="MRSSRTVLASAGAAAAAAAAVSHNPASRACRSCFTCLTRLPVHQ
                     RRAFSRSAPRHAAPSSPSPAGLVELTSRKLISVSGPDAAKYLQGVITANLTPGYAGSS
                     PTSEHIRTDSGFYAAFLTAQGRILHDVFIYRDLRDTSHPPGHSWLVEVDAAEADRLQK
                     HIKRYKLRAKFDIRVLDDGEGRVWHAWDDNSASPSPITTLTSSSSSSSPTTTIITAPD
                     TRAPNLGHRILTFSPPSSSSSSSSSFSSSSSSPLPQIAADGRFPLLPEAAYTLRRYLH
                     GVPEGQAELLHGQALPHESNLDLTGAVDFRKGCYVGQELTIRTEHRGVVRKRVLPCLL
                     YPDHDGGGSAPEITTTTTTSSSAYYSFYRPEIAPGLSADMVPPEASIGRVGRKGRSAG
                     KWLRGVGNVGLALCRLEIMTDVALPGETGGPAFAEAEDEFVVGLGGGDGSDGGDGGDG
                     NETAAPKVRIKALVPDWLRKGLADKERH"
     gene            complement(<1290372..>1291424)
                     /locus_tag="MYCTH_2126511"
                     /db_xref="GeneID:11507380"
     mRNA            complement(<1290372..>1291424)
                     /locus_tag="MYCTH_2126511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662706.1"
                     /db_xref="GeneID:11507380"
     CDS             complement(1290372..1291424)
                     /locus_tag="MYCTH_2126511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662754.1"
                     /db_xref="GeneID:11507380"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2126511"
                     /translation="MMADQDLIAYARDAASRGDDLFALLATDATASESDIRRAFRRKA
                     LTAHPDKAGDAYDPALYERLERARDVLLNPEAREAYDSGMRAALQKKMHLEQMNEKRR
                     RLVEDLERREAEAKRARTAEAQPQALDAERRAMAARGRAKMEEMRRLREEAEARERLA
                     REKEERAGAPSGSTAAEKPETAGTSQNDNNNNNDDDDYDERIADLERRLKEAQQRKAE
                     KKQRKEERRAERKGRKEKQAAAATPTLAPGGSPPPPERSIHNNNNTTTTNNNNPPPPP
                     PPPTAAEPQADQDKVPPGPKPDASDPPKASDRFASTLARLRAAQAKKEEEKRRKAEQA
                     AAATAAATAATTTTAQ"
     gene            complement(1292059..1293536)
                     /locus_tag="MYCTH_81347"
                     /db_xref="GeneID:11507381"
     mRNA            complement(join(1292059..1292391,1292467..1293341,
                     1293409..1293536))
                     /locus_tag="MYCTH_81347"
                     /product="oxygenase"
                     /note="Has EST support"
                     /transcript_id="XM_003662707.1"
                     /db_xref="GeneID:11507381"
     CDS             complement(join(1292259..1292391,1292467..1293341,
                     1293409..1293450))
                     /locus_tag="MYCTH_81347"
                     /codon_start=1
                     /product="oxygenase"
                     /protein_id="XP_003662755.1"
                     /db_xref="GeneID:11507381"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Spoth2_81347"
                     /translation="MEKAAVQQDGLLIPLIDFSKFLNGSPSQKAETAKAVLAGFQTAG
                     FIYLSNIPIPASTVTQAFDTSAKFFRLPDSVKESLSWTTPEANRGYSAPGREKVTQLK
                     SAADVSALRTSIPDIKETFEIGRDDEPAYPNRWPPESDPESGSGPGHGEITGFRQIMT
                     SFFDALSELHTSVMRAIALGMDLPETFFDRFVCDRDNTLRLLHYPAVRKELFQISPGQ
                     VRAGEHSDYGTLTFLFQDDRGGLQVQSPSGKFIDATPMEGTCVVNAGDLLARWSNDTI
                     KSTVHRVVEPPRKEGEAQNGEVYPDRYSIGFFCNPNFKDYIEAIPGTYVTEADKKYEG
                     ITSGEYLVQRLKATY"
     gene            1294188..1295563
                     /locus_tag="MYCTH_2303738"
                     /db_xref="GeneID:11507382"
     mRNA            1294188..1295563
                     /locus_tag="MYCTH_2303738"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662708.1"
                     /db_xref="GeneID:11507382"
     CDS             1294341..1295522
                     /locus_tag="MYCTH_2303738"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662756.1"
                     /db_xref="GeneID:11507382"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="JGIDB:Spoth2_2303738"
                     /translation="MDDHSSKHRLVDIHTHMYPPEYVDILSSRTTIPLVRTFPSSPDP
                     RLILLESEIPSLERALADPDAPLPGRPLTKHFTSLPAKLAFMARHGIDTSVLSLANPW
                     LDFLPATEEAARTARRINDSFEAMCAAHPGRLFFFGTLPLTAPPPAILESVAHLAALP
                     HCRGVVLGTGGLAGGGMDDPALLPVLRALADAGLPVFLHPHYGLPNAVFGPRSASGEY
                     GHVLPLALGFPMETTVAVARMFLAGVFDAVPRLEMILAHSGGTLPFLAGRLESCVAHD
                     AALVGKNHAGAGAEKGRRRRRTVWEVLREQIYLDAVIYSEVGLKAAAEASGGAERLMF
                     GTDHPFFPPVGEGADAEGEWESVRLNAEAVNKALGDGSEQAAMVMGGNAVRVLRLYDD
                     A"
     gene            complement(1295588..>1297747)
                     /locus_tag="MYCTH_115944"
                     /db_xref="GeneID:11507383"
     mRNA            complement(join(1295588..1296717,1296801..1297248,
                     1297711..>1297747))
                     /locus_tag="MYCTH_115944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662709.1"
                     /db_xref="GeneID:11507383"
     CDS             complement(join(1295655..1296717,1296801..1297248,
                     1297711..1297747))
                     /locus_tag="MYCTH_115944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662757.1"
                     /db_xref="GeneID:11507383"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_115944"
                     /translation="MPILIGRRMGRSYTLDSVSPRKRRRTLSTDSDDGEPKVIKSVIN
                     VPSRIKRKVQAENKSAEAARPSDPEPEPTSRVTAPLDANTTFESLGLRPWLVQSLANM
                     AIKRPTAIQRESIPMLLKGRDCIGGSRTGSGKTVAFAVPILQKWAENPSAIFAVILTP
                     TRELALQIYEQIKAISAPHSLKAILVTGGADMRSQAIALAQRPHVVIATPGRLADHIR
                     TSGEDTICGLRRVRFVVLDEADRLLAANGPGSMLPDVEECLGALPPPAERQTLLFTAT
                     ITPEVMALKSMPRPPGRDPVFVCEVDTENLAIPPTLNQMHLQVPVTHREHYLHIFLLT
                     PANVEKSVIIFCNRTTTADFLHHLLRLLDHRVTSLHSRLPQRQRIDNLARFRASAARI
                     LVATDVAARGLDIPEVKLVINYDIPRDPDDYIHRVGRTARAGRKGDAVTFVGQRDVEL
                     VLAIEKRVGRQMEAWHEEGVNLETRVVRDALKLVGEKKREALLELEEQREVGGKRKRG
                     KQKLRLN"
     gene            1299294..>1301800
                     /locus_tag="MYCTH_81343"
                     /db_xref="GeneID:11507384"
     mRNA            join(1299294..1299929,1300148..1300861,1300919..1301580,
                     1301644..>1301800)
                     /locus_tag="MYCTH_81343"
                     /product="MAP kinase-like protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003662710.1"
                     /db_xref="GeneID:11507384"
     CDS             join(1299885..1299929,1300148..1300861,1300919..1301580,
                     1301644..1301800)
                     /locus_tag="MYCTH_81343"
                     /note="Similar to mkkA [Aspergillus nidulans]"
                     /codon_start=1
                     /product="MAP kinase-like protein"
                     /protein_id="XP_003662758.1"
                     /db_xref="GeneID:11507384"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_81343"
                     /translation="MAAPQNQSSDSPAAMPSHPALGIPQHNTSSQVPTMPAAPPLLRP
                     AIPGSRPGRAGPRLGLAIPPSPNAKPVSNPGAPAQRPALPTLHLATPMGSNVVPQEQT
                     QPLKPSLSLQSASGGSESSAAHSRSGSFGPLDGRASNPTSAGSQFSALSFASQFGIGR
                     QTGDPVSAVGSLYSNASESMDMDRDGSLHGLESFDEATLEKARTADVEDLDDDGWRIV
                     SMEKRIIELGNLGEGAGGAVTKCKLRGGNTVFALKVITTNPDPDAKRQIIRELGFNKG
                     CASQHICRYYGAFVDPATATISIAMEFCEGGSLDSIYKEVKKLGGRTGEKVLGKIAEG
                     VLHGLTYLHSKKIIHRDIKPSNILLCRNGDVKLCDFGVSGEFGTKGDASTFIGTSYYM
                     APERITGQSYTITSDVWSTGITLLEVAQHRFPFPADGTEMQPRATPLDLLTYIVKHPT
                     PKLKDEPEANIYWSSNFKYFIDCCLEKEPARRASPWRMLEHPWMVEMAAKRVNMRRYL
                     AQVWGWDENEPQASQKA"
     gene            complement(<1303816..>1307097)
                     /locus_tag="MYCTH_2060093"
                     /db_xref="GeneID:11507385"
     mRNA            complement(join(<1303816..1306344,1306402..1306611,
                     1306716..1306803,1306979..>1307097))
                     /locus_tag="MYCTH_2060093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662711.1"
                     /db_xref="GeneID:11507385"
     CDS             complement(join(1303816..1306344,1306402..1306611,
                     1306716..1306803,1306979..1307097))
                     /locus_tag="MYCTH_2060093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662759.1"
                     /db_xref="GeneID:11507385"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="JGIDB:Spoth2_2060093"
                     /translation="MSQRPGTHVPAVRVETEKTLGITQRSAAINFAWTGDIRKRYTDF
                     LVNEIRKDGTVLHLRDFEEEVIPPQADNKTDNKPKVQPISEDDRRAVVELLGEAVAQK
                     LIELDERVQAKEPLAPNERFVVFDPVTDRAKRGAIHQEIRRIFNSRFETVANTDGVIT
                     ATASKWALNSRATGQNRGGRRDNNNRNRDQAREFAEAGGEYLHFTLYKENKDTMDAVN
                     TIARLLKIKASNFGFAGTKDRRAGTVQRISVYRQKASNLIWLNSRIPNVKVGDFSYSK
                     EPLQLGQHGGNEFVITLKNCQPLAGDNCSLIQRMKMIQQAVECGLAYLKHHGYINYYG
                     LQRFGTYTIGTHMLGMKILKGDYEGFIEDILHVDEDLLKEVLSNQPQTYGTGKDQQNT
                     RDDLNRARGITAWKTTKKADKALEFLPKRFSSEIAIIRHLGKNPKDFTGAVLSITRGM
                     RMMYVHAYQSYVWNFVATRRWSKYGAKVIEGDLVLVTGSRRRDRSDDDEFNPYDDNDD
                     DNIYAQAHALTAADVASGKYTIFDVVLPTPGYDVSYPRNDIGDYYVEFMGRPENGSLN
                     PFDMRRKQREFSLSGNYRPLIGRLIGNPQYAVRAYREDTEQMYPTDLDYALHKKNAER
                     LAKDAAKTSTASAPQPHADPAVRSWAHFSKNPAMYDNALDTASRRRKAEDDPPSVGLP
                     VTNETWVQTAVDGNAKRVKVARHQQQLETQTEADVPPADVPATGPTMDADEPQEDAIR
                     TPLAGGDGAPLHDDAQKIPPSHIITDGPFPMIPLPKGAIPTTGIRGVSDTYYAETGKI
                     PYFGPLPAGFQMQPVGGDTSAGSVLQSADKSAPSGTNNVHNPTNKADNQVSSSMADPA
                     ATSTVNAQAEDKMGWYGTNLPKVPTSTVANTIDGQANGGNMALVKVGEPGDATSDAEV
                     INGVPVPKLRDASDNPLSSVDAGIDEGSIDPKADKIAVILKFQLKASNYATIVLRELM
                     GTTVEELAH"
     gene            1308921..1311274
                     /locus_tag="MYCTH_2303748"
                     /db_xref="GeneID:11507386"
     mRNA            join(1308921..1309197,1309294..1310273,1310348..1311274)
                     /locus_tag="MYCTH_2303748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662712.1"
                     /db_xref="GeneID:11507386"
     CDS             join(1309072..1309197,1309294..1310273,1310348..1311191)
                     /locus_tag="MYCTH_2303748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662760.1"
                     /db_xref="GeneID:11507386"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR014837"
                     /db_xref="JGIDB:Spoth2_2303748"
                     /translation="MAYFEQQRWVTVQEKTFTKWLNTKLVVRNLEVKDLVRDLSDGVL
                     LIHLLECLSNESLGRYAAKPKLRVQRFENANKALDFIKSRGIQMTNIGAEDVVDGNRK
                     IILGLIWTLILRFTINDINEEGMTAKEGLLLWCQRKTACYDEVDVRDFSASWNDGLAF
                     CALLDIHRPDLIDYDKLDKSDHRGNMQMAFDIAHKEIGIPKLLDVEDVCDVAKPDERS
                     LMTYIAYWFHAFSQMEKVENAGRRVEKFVNNMRGAWDMQSAYERRMAALLKAIREQML
                     SWQQAKFEGTYADAKAQAADFAAYKKGRKREWVAEKSELATLLGNIKTKLGTYRLRPY
                     EPPAELRLEVLDQEWANLTKAEMARGQLINETIRDIKNALRKSFADKANDFALALNTI
                     QLAISGLEGDVEDQLHHVRKLADNLPPLDAFLKTIAAVDAKCQEANIEENDFTTYTYD
                     ELCYELSLVQSSVSKKLSFLENQMVARNMTNLTPIQLEEFESVFRHFDRDDTNTLSEL
                     EFSAALASLGLIFSEDEMHDYFVETSGGRDRVTFEQFIRFMVDVTEDQNTAEQVFQSF
                     REVADGKPYVTEMDLRHSLVPDDVIEKLVEIMPVHNGPDMQADRGQPQYDYIAFMDRM
                     IGDPEVTGSGTGRASPSKGFVNGAH"
     gene            complement(1311712..1314256)
                     /locus_tag="MYCTH_2303750"
                     /db_xref="GeneID:11507387"
     mRNA            complement(join(1311712..1311985,1312055..1314256))
                     /locus_tag="MYCTH_2303750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662713.1"
                     /db_xref="GeneID:11507387"
     CDS             complement(join(1311803..1311985,1312055..1314214))
                     /locus_tag="MYCTH_2303750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662761.1"
                     /db_xref="GeneID:11507387"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="JGIDB:Spoth2_2303750"
                     /translation="MRSSLTFGGSSMASNSNPAQRPNPLRPVRSFRVERSPSPEPTTR
                     PKRASTFEAGPLPASSSVRTASGSHVPQGDGHEPPDTFVSRISEEAIEPPRASVDLED
                     LPIELISLTDRFIDSLSAKVHPTPPNIDNLSRLFQEFYATASSHIQTHVETLATLQKR
                     EDAPPPSSRASAASLLRAKAASLGSKEKPKASPSKPDSDQQLLTAEEYASRKKARRAL
                     EQKKSLLEEAVERRLCEGIYSKIYRHRSTQDEAQDAKLRSKTAALAVVGIGPVDLGVE
                     LGTAPNDPETTARKQEEVKEWLEQARKELVLMSQSKYPLGKLNHLKAAHKNIIDTLSH
                     FHPSSSADELMPMLIYTLITMPPEHLSVISDLNFIQRFRWGLKLTGEAAYCITTLEAT
                     ISFLETVDLSTLRADETPTGPLKNPGSSPAQKEDTFPPAFSPTSSGPAAISSNPSSQS
                     ASSSFNAALKQSQSPSPAGFRATVNELRARRLSDLVRNTPTPAQTFGAASDAVLNTAD
                     QSLKTIGASLGESYKFLLGKLRERAPDALLKDDGGAVIVPKTLEDARKLIGTPPLPGP
                     EEDATRTPQLSLRSPSPEPESERPPLLSFISGTARKVSRDHSADSARSAGSSSRRGGC
                     SSEADHHPSASSTTQVTATGSSPVITSPPIIDSMRSLGNSLNPMARLSAGIGGFRGFG
                     RSSAAANTAVAASAAAGAPTPPAKDGHGVGRDGGDLATAFPDLAAVLPPREQPKISPP
                     NKRFLELQNAADLKLGEVFELLKDYKRLAGALKDMGAFKE"
     gene            1316022..1318013
                     /locus_tag="MYCTH_2303752"
                     /db_xref="GeneID:11507388"
     mRNA            join(1316022..1316412,1316493..1317760,1317814..1318013)
                     /locus_tag="MYCTH_2303752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662714.1"
                     /db_xref="GeneID:11507388"
     CDS             join(1316203..1316412,1316493..1317760,1317814..1317916)
                     /locus_tag="MYCTH_2303752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662762.1"
                     /db_xref="GeneID:11507388"
                     /db_xref="JGIDB:Spoth2_2303752"
                     /translation="MFPKRREAGAACTSAGLVTARLLLSFLALPTFPVAAAGHAPSDA
                     QLPLAIEVGPVAPLIPEPPAPAEHTFTLRHIFHHGTYKHPHLHRKQDVTQPKADVWLP
                     AEDGYEAQRIGPLRARSNPLRIQRLVDRRPSVVDPIVAESRKQGFVSVLSPSAWTIDD
                     VPGPNVTDKDTVLTLALMAADAYVEKPGEADWEDVGAPFNRSLDFGWEGDGLRGHVFA
                     DETNSTIVIGLKGTSVAVFDGEGTTTNDKVNDNLFFSCCCAQQGPWTWQQVCDCATGT
                     YTCNNTCVTQALRDENRYYYAARELYANVTEIYPNSNVWITGHSLGGAVSSFLGLTYG
                     VPVVTFQAVPDALPARRLGLPVPPGADPDAPQEREYTGAFHFGHTADPVYIGTCNGAT
                     ASCSLAGYAFEAACHTGRECVYDTVGDLGWRVGIGTHRIKSVIRDVILKYDSVPECKF
                     TPECRDCGNWKMYESNGTESTMTSSVPTTTSKTRTRTETCKTPGWWGCLDETTTTTGT
                     ETSEVTTSTSSTTTCHTP"
     gene            1319225..1322604
                     /locus_tag="MYCTH_2303754"
                     /db_xref="GeneID:11507389"
     mRNA            join(1319225..1319419,1319626..1322604)
                     /locus_tag="MYCTH_2303754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662715.1"
                     /db_xref="GeneID:11507389"
     CDS             join(1319348..1319419,1319626..1322481)
                     /locus_tag="MYCTH_2303754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662763.1"
                     /db_xref="GeneID:11507389"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2303754"
                     /translation="MTDSPQPATPPVLAPNLEAQLMCSICTELLYQPLTLLDCLHTFC
                     GACLKEWFRFQADRVESAPGPPPPPSVPVFTCPSCRAGVRDTKHDARVFSLLDMFLAL
                     NPARARCEEDRRDMDARYSRGEPVLPRVRRLEDRTEEERLADEEDRRVIDEVRALSLR
                     EATERAAAAAGASASASASAVGGRSTGRGRSTGRGRRSREASRVRGSGERDEMGGSGR
                     RAHSVAMRSDGGGERETEGAMRRRRRGGSSETRQRPQQVEHQSSLRNLISADTMDARD
                     IEREVEEFARQIQEEGLLDGLDLDNLDLENNDELSRKITEAYRRRQRERRRDGGRRSN
                     ASAHSHRSDATAPRPRSRADDDSRPTSRHAAHSRAPSAGGGEERGRYPPSSSAHLDVQ
                     EPTRRRRGSSSGRSATLPVVPTQTDVRVGSRAQTDLSSRSRPVTSDAHVRRPSAGIEA
                     RSASSPTSATVSGSRADSPANRGLPFSARAAAGSGAQPEARSTSTSSRLRSSDQPAAA
                     PEVGVESPTPGSVSSPISPTVASPPASSRRPQPPRYKEPLINCITCHKEHIEYEVHYN
                     CSICHDGDWNICLDCWRRRKGCLHWFGFGSAARARWEKHNLTNLPTPPPHVLLAHRYL
                     PPKQPLSRAEGRRALTTENPLDRLQTGTFCSRCSAWTNDCYWRCDVCNDGEWGFCTDC
                     VDQGNACSHPLLPLAYQPPPPRLSSSSASSPSSSSPSPSAPPASSAPSNNNSHDAAVA
                     PVPASTPTGSFHPLSAPASPSCSTCRTPIPLTDSHFHCYACPSAPDQRQGSYKLCLPC
                     YGALVSSGSVAPENGPTGWRRCPRGHRMAVVGFVPDERQRGLWRRVVQRDLVGGRRAK
                     FEDLGSAAPPGLRVATWRDAAGRKFERLFSADVSASTTGAAAALGDGRFAKVFPPDGG
                     TGHRAVAGWGWTPAAGVEDELLFPRGAEILEVEDVNGEWFHGFYMGAQGLFPAPYVRL
                     VGR"
     gene            complement(1322556..1323854)
                     /locus_tag="MYCTH_2303755"
                     /db_xref="GeneID:11507390"
     mRNA            complement(join(1322556..1323361,1323481..1323854))
                     /locus_tag="MYCTH_2303755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662716.1"
                     /db_xref="GeneID:11507390"
     CDS             complement(join(1322631..1323361,1323481..1323646))
                     /locus_tag="MYCTH_2303755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662764.1"
                     /db_xref="GeneID:11507390"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Spoth2_2303755"
                     /translation="MNVAAARVSALRGLRPVASRFQPSTLPQIARSFSASARRSYEYI
                     EVSEPRPGVGQVTLNRPKALNALCSPLIGELNTALREFQASPTVAAVVLTGSERAFAA
                     GADIKEMAPLTFSEAYSKSFIESWSDLTTALKKPLIAAVSGHALGGGCELALMADILY
                     CTATANFGQPEIKLGTIPGAGGSQRLTRAVGKSKAMELILTGKSFTGEEAERWGVAAR
                     VFPTYEALLEGALKTAETIAGYSKVAVQAAKEVVNKSQDLALRDGVEYERRVFHALFG
                     SQDQKIGMKAFAEKKKPEWSHQ"
     gene            1324282..1325721
                     /locus_tag="MYCTH_2315074"
                     /db_xref="GeneID:11507391"
     mRNA            join(1324282..1324509,1324579..1324696,1324785..1325084,
                     1325169..1325721)
                     /locus_tag="MYCTH_2315074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662717.1"
                     /db_xref="GeneID:11507391"
     CDS             join(1324441..1324509,1324579..1324696,1324785..1325084,
                     1325169..1325254)
                     /locus_tag="MYCTH_2315074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662765.1"
                     /db_xref="GeneID:11507391"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="JGIDB:Spoth2_2315074"
                     /translation="MDVPDEPQTPFGTFTAQTNKLQRQYQALLDQSTPYVLYRWIGTG
                     AALFIFFLRVFLAQGWYIVAYALGIYLLNLFLAFLQPKFDPSNDALDNDMEDGAIGTL
                     PTKQDEEFRPFIRRLPEFKFWHSATRAIAISFLCTWFEIFNVPVFWPVLVMYWFMLFI
                     LTMRKQIQHMIKYRYVPFTVGKARYNKSSS"
     gene            1326104..1328042
                     /locus_tag="MYCTH_2303763"
                     /db_xref="GeneID:11507392"
     mRNA            join(1326104..1326447,1326528..1328042)
                     /locus_tag="MYCTH_2303763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662718.1"
                     /db_xref="GeneID:11507392"
     CDS             join(1326174..1326447,1326528..1327831)
                     /locus_tag="MYCTH_2303763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662766.1"
                     /db_xref="GeneID:11507392"
                     /db_xref="InterPro:IPR007133"
                     /db_xref="JGIDB:Spoth2_2303763"
                     /translation="MSSSQSRSGGERMIHQDYIARIRYSNALPPPPIPPKLLDIPNTG
                     LASGQYTAPGFASRLAREQPLNIEADAELGMPLDLVGMPGVFDGDESSIQAPAQPPPV
                     HPHDRPLLRPLSTLGKPKLGDTAVSFLRRTEYISSVTTKPKPADHVFLRASSGNTPKR
                     PEKRKASPEPDKGTPAWIKRRIEKSFEAAAANLADRTRVKHPSKRNLKVVDALPLLPD
                     LEAFPDSGAYVTVKFSTNPVNSSDSYDTRLLSGIFKPIERTAAEEQIYEAARAAWEAD
                     PTLPKPSQMMNYDLFLPADTLTGENFRKKFDVDNPDRDSHALYTSSEAGGSFRFPRVR
                     AYETAQEKEMDHDNKYDEEVILAFRDDEAASKGRVDDSAQKAVYYYPVMQRTTIRNQR
                     TKNIARTIGIADEEETHLDELHVRIDDPSDELKAELARYKHQPVGDLSDEDEGGEEEG
                     GEEEYAERTGEQEPDEEAEGEREDGDEEERAGRREEDSDRGSRSASPAAANGGPNHEE
                     QQSDVDQDADADGDEDE"
     gene            complement(1328090..1330160)
                     /locus_tag="MYCTH_115935"
                     /db_xref="GeneID:11507393"
     mRNA            complement(join(1328090..1328447,1328504..1330160))
                     /locus_tag="MYCTH_115935"
                     /product="glycosyltransferase family 90 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662719.1"
                     /db_xref="GeneID:11507393"
     CDS             complement(join(1328396..1328447,1328504..1330128))
                     /locus_tag="MYCTH_115935"
                     /note="CAZy_ID 270092"
                     /codon_start=1
                     /product="glycosyltransferase family 90 protein"
                     /protein_id="XP_003662767.1"
                     /db_xref="GeneID:11507393"
                     /db_xref="JGIDB:Spoth2_115935"
                     /translation="MSRLIHTAQTKAIPAAGAVKRPRNSFTSRPADLSSNGHFDEVKR
                     TRFDYFAHQPVWTHSRMSCPPESPARILEEEDQFDDIAKYAIGDLGFVSNWTAMSDIC
                     LSPSLSSTYGFFDRPNAYGVVHDLFPIFSQSKISSYADILYPSPWYWADKVPYSAAKD
                     PAWDKKQDRLYWRGSTTGGYSRDGGWRRQHRQRFVQKINAPDKAKILTPPSSLPPPPS
                     PSSSSTPTKPTTKKQQEQQQQQQQQQQQSRPPQQEQEQKQEEQQQKEQQQQQQQQQQQ
                     RQERETQQQEQQQQSAPPPPEQQQQQKQKQQQQQHDEQQQQQQQQQSAPPPPEQQQQH
                     NEQQQQQQQQQGEEEEEEQQRPQHQQQQQQQSYEPEQWTVREVPRGNYKSLLDVYFSH
                     VGQCDPGDCDAQRAFFEVKDYAKQEDALEYKHVLDMDGNAFSGRFYALLRSRSLVYKW
                     AIFREWHYEWLRPWVHFVPLSLHGEEWLETVRFFNSSGRASSEGGSEDAEVPKERKEG
                     AEEAERMAQRGRDWAGKVLRNEDLEVWFFRLLLEYGRVIDDDRENIGYAG"
     gene            complement(1331697..1333071)
                     /locus_tag="MYCTH_2303766"
                     /db_xref="GeneID:11507394"
     mRNA            complement(join(1331697..1332115,1332175..1332244,
                     1332508..1332700,1332926..1333071))
                     /locus_tag="MYCTH_2303766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662720.1"
                     /db_xref="GeneID:11507394"
     CDS             complement(join(1331926..1332115,1332175..1332244,
                     1332508..1332640))
                     /locus_tag="MYCTH_2303766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662768.1"
                     /db_xref="GeneID:11507394"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="JGIDB:Spoth2_2303766"
                     /translation="MVRTSVLHDALNSINNAEKAGKRQVLIRPSSKVIVKFLRVMQRH
                     GYIGEFEEVDNHRSGKIVVQLNGRLNKCGVISPRYNVRLAELEKWVVKLLPARQFGFV
                     MLTTSAGIMDHEEARRKHVAGKIIGFFY"
     gene            1333208..1334279
                     /locus_tag="MYCTH_2315077"
                     /db_xref="GeneID:11507395"
     mRNA            join(1333208..1333307,1333472..1333784,1333860..1334279)
                     /locus_tag="MYCTH_2315077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662721.1"
                     /db_xref="GeneID:11507395"
     CDS             join(1333305..1333307,1333472..1333784,1333860..1333984)
                     /locus_tag="MYCTH_2315077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662769.1"
                     /db_xref="GeneID:11507395"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="JGIDB:Spoth2_2315077"
                     /translation="MSDVEENNAPVQEEVEVSADAAKGQMSVLDALKGVLKLSLMHDG
                     LARGLREASKALDRRQAHMCVLNESCEEEAYKKLVIALCSEHKIPLIKVPDGKQLGEW
                     AGLCVLDREGNARKVVNCSCVVVKDWGEESQERSILLNYFQSEA"
     gene            complement(<1334440..1335141)
                     /locus_tag="MYCTH_2303773"
                     /db_xref="GeneID:11507396"
     mRNA            complement(join(<1334440..1334599,1334789..1335141))
                     /locus_tag="MYCTH_2303773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662722.1"
                     /db_xref="GeneID:11507396"
     CDS             complement(join(<1334493..1334599,1334789..1334962))
                     /locus_tag="MYCTH_2303773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662770.1"
                     /db_xref="GeneID:11507396"
                     /db_xref="JGIDB:Spoth2_2303773"
                     /translation="MGKSKESKSAGAKGGSGGKADKADKSNKKGGGSNSKAEGGDAKA
                     TKLKGTTINVRHILCEKFTKSEEAINRLKNGEKFDVVAREMSEDKAKAG"
     gene            complement(1335927..1337299)
                     /locus_tag="MYCTH_2303774"
                     /db_xref="GeneID:11507397"
     mRNA            complement(join(1335927..1336704,1336767..1337299))
                     /locus_tag="MYCTH_2303774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662723.1"
                     /db_xref="GeneID:11507397"
     CDS             complement(join(1336127..1336704,1336767..1336878))
                     /locus_tag="MYCTH_2303774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662771.1"
                     /db_xref="GeneID:11507397"
                     /db_xref="JGIDB:Spoth2_2303774"
                     /translation="MYPEDTRVGSVSEIQLPSVPPGDENVRADLGPAGASRASRATNH
                     LTHHHRASPPQANFGPPALLELSDSARESLAKHGDFGPEADQLSFFLELALVEEVKGT
                     PSLDFETVRISRLDKLVADLTVCGEGPFNLAPRFVHDVVAAGKLERKWRARFRVDYLM
                     IDEIRLRELATRWRTPAEPSRNESSSPHLWPTTAAVARPIVQPGREVTFGPGSYVTSI
                     RQCPCVPSPVS"
     gene            complement(<1337469..>1339632)
                     /locus_tag="MYCTH_2118030"
                     /db_xref="GeneID:11507398"
     mRNA            complement(join(<1337469..1338791,1338855..1339167,
                     1339247..>1339632))
                     /locus_tag="MYCTH_2118030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662724.1"
                     /db_xref="GeneID:11507398"
     CDS             complement(join(1337469..1338791,1338855..1339167,
                     1339247..1339632))
                     /locus_tag="MYCTH_2118030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662772.1"
                     /db_xref="GeneID:11507398"
                     /db_xref="InterPro:IPR015244"
                     /db_xref="JGIDB:Spoth2_2118030"
                     /translation="MSTSNPPPTEDRAASVQKIQTLLSAKDDTSRFVGLALLKSVLDN
                     TPELRNEQVITDLWASIPPKFLARLIKSGIGQQKQSDESRKESNDMLDLAVSVLHTFT
                     ALLPESAKQDPKLVDRIPQLVACLVHCSDETTRLTLEALVSLVSRPDGARVFTTAVED
                     LAPLTEIAAKQPLALDTLLFAWLNAAMAATTDKSSLRSKIDSTVGSLVASFKGTDAVT
                     LLSFLANLLPRLNPEALPSNPKWLPDLGTFIRNLVASRPTSAGRAAFTNLSAALLELY
                     PFHAPQLLFADQDTAGKSSSSSSPFSYLLINLILVDLRASLPTLLSQLNTPEYPPTAY
                     RLTSAFNVISHFIGYLLRALDAPDSSSAPFSLAISPDRLLSLRKSLTETLSLTTEYLR
                     DRWDASVAGAMGLHPEARTGAAVAPATGATHFTLAWDSIGTDVAADDPLVLAAVRALA
                     LWAREDDGELLRREVGGLCDMLVDLYRESGSNRGGGGGGGGGGGGNGQQQQQQQQRGR
                     RLDFRRAVLVAFEGVAADRKGRESVLSNGGWEVLVGDLEGILQASSAADDEDEAARGI
                     EIVRVLMQLAETERPGPREAWMDLVTHVAAWDVPEAKQSPVTEECQVAVLQLVTTLLV
                     NTHPGVQKRYVHSTSAVLGIAHQLQEKVKGDRALEEALDDVVGALITLR"
     gene            complement(1340590..1341130)
                     /locus_tag="MYCTH_2303780"
                     /db_xref="GeneID:11507399"
     mRNA            complement(1340590..1341130)
                     /locus_tag="MYCTH_2303780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662725.1"
                     /db_xref="GeneID:11507399"
     CDS             complement(1340684..1340977)
                     /locus_tag="MYCTH_2303780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662773.1"
                     /db_xref="GeneID:11507399"
                     /db_xref="JGIDB:Spoth2_2303780"
                     /translation="MDEPVPRHIDIADVDGIGKRSFAQIGLIKNSDYAIKIASNNTHQ
                     HHEREKEVYERLGQHTRILQYYGEVLIHSIERTQRGLLLQHHRNGTLDKSIRR"
     gene            1341261..1344730
                     /locus_tag="MYCTH_2303781"
                     /db_xref="GeneID:11507400"
     mRNA            join(1341261..1342368,1342460..1342612,1342681..1342795,
                     1342864..1342955,1343016..1344730)
                     /locus_tag="MYCTH_2303781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662726.1"
                     /db_xref="GeneID:11507400"
     CDS             join(1341391..1342368,1342460..1342612,1342681..1342795,
                     1342864..1342955,1343016..1344566)
                     /locus_tag="MYCTH_2303781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662774.1"
                     /db_xref="GeneID:11507400"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="JGIDB:Spoth2_2303781"
                     /translation="MAPTNAMNNWASSAGPSNSRPSRTSEDRGHGNAHSRPYEHGDDE
                     SDELDLLGDDPDPSNAAAADDGDPTAILRDDPLQTDLSSPLTFKRRQKQSHFLSQPGR
                     ILNRLVGRHYFSSSPRNSQDLPRPLPRTTRPATPGTTTDPSVNLNLNTLLPSNDNPDQ
                     TAAPHYKDLASAHPHHPHDWYAEGPGRRVGYEDLTAIDWIFEYTKERQRQRALRARTA
                     ALHVPLLGHLQRLLDASQVWVVLLLSGVAVGALAAAIDVATDWLGDVKYGFCSGDVDG
                     GRFYLGRTACCLGYDEGSQCRGWRRWGQVLGAREGGATWFAEGAVYLCLAVTFALSSA
                     VLVKEYGIYARHSGIPEIKTVLGGFVIRRFLGVWTLITKSLGLVLAVASGMWLGKEGP
                     LVHVACCCANIFTKLFPSINNNEARKREVLSAAAASGISVAFGSPIGGVLFSLEQLSY
                     YFPDKTMWQSFVCAMTAAMVLQAFDPFRSGKLVLYQVTYTSNWHGFELVPFVLLGVLG
                     GVYGGLFIKANMAVARWRKSTPWLPGPVAQVVIVAILTALINYPNRYMRSQNSELVSD
                     LFSQCSEMLDDQFGLCKTGAASAANILLLLLAAILSFGLAAVTFGLQIPAGIILPSMA
                     IGALTGRAVGIIMEIWQTNHPKFIAFHSCEPDIPCITPGTYAIIGAAAALAGVTRLTV
                     SIVVIMFELTGALTYVLPIMIAVMISKWVGDAFSRRGIYESWIHFDEYPFLDLSEETT
                     PIPDMPASQIMTRVEDLVVLTATGHTIASLSSILDAHPYRGFPVVSDPRDAILLGYIS
                     RAELAYTLHAATRPPRSLPPETEAFFAHQPMADPRTTLDLRPWMDQTPLTLPSGCRLQ
                     LAVSYFQKLGLRYVLFVDRGVLQGLLTKKDVWYVLNGAEETRRTSGTAGAGDGGVGAG
                     RGGAHLGLAREHGETEEEGEESAGLLRAVGLAEETGLASPGVDRGSIL"
     gene            <1345906..>1346983
                     /locus_tag="MYCTH_2109943"
                     /db_xref="GeneID:11507401"
     mRNA            join(<1345906..1345956,1346057..1346250,1346314..>1346983)
                     /locus_tag="MYCTH_2109943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662727.1"
                     /db_xref="GeneID:11507401"
     CDS             join(1345906..1345956,1346057..1346250,1346314..1346983)
                     /locus_tag="MYCTH_2109943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662775.1"
                     /db_xref="GeneID:11507401"
                     /db_xref="JGIDB:Spoth2_2109943"
                     /translation="MSVRQAAVGSLLAFPYEPWTLSCGMVVEILDGASDLRSRTAQTA
                     VSADGTQTAFLKLYDWRYATQLRDDKEMGPWAQVCAAAGREPFSSRDGGRLGRRPKRG
                     FLAYQSRAMYRSETSVYGRLEENCRGEPLASRLVAAVELDMAPPELEDHCREHFQVKG
                     ILLEYIANGFGFTLSELSFRAPPESWQVVVEQAVKIARALGDYGVLNKDVRPNNFMVR
                     PRRGSHGGDADGGPSGEYRVFVIDFGQSRLHRDDESDLDWGRAKWRQDEEGAVGLVMQ
                     NRLRMLGKEIMYTPSQRYRVFAERENDE"
     gene            <1347322..>1348624
                     /locus_tag="MYCTH_2126533"
                     /db_xref="GeneID:11507402"
     mRNA            join(<1347322..1347396,1347455..1347481,1347551..>1348624)
                     /locus_tag="MYCTH_2126533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662728.1"
                     /db_xref="GeneID:11507402"
     CDS             join(1347322..1347396,1347455..1347481,1347551..1348624)
                     /locus_tag="MYCTH_2126533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662776.1"
                     /db_xref="GeneID:11507402"
                     /db_xref="JGIDB:Spoth2_2126533"
                     /translation="MSNYKEILKKGWHPEKDGTTLKGQVKSLIGRGDDNTRRSYHVAT
                     PLNSLRDPASFGPPPKRNSNVVIGATSPATSSSSSPASQTGPAVAPRTAAAPEPASEE
                     PPPQPNPWRLDTTGLSTAHLPPPPTRKDGTDGRSPPAPPPAPGGGGAKAPPSLPPRLP
                     PRSGTASPATPSPPLPPKPQASATTTTSSSTPSPALPARPQASSPTTGPAQGYLNQSA
                     VNRLGAAGISVPGLGITPSYPNTSSSTAAAAPTQAPATASPPKPPRPQPSHMSELQSR
                     FGQLRTTADNAERHGEQIAGASRAVGALQQQQQQFGGGAAAAAGGGGPSGLAAVAGKK
                     KPPPPPPKKKDIQIPGFGAPGQKQEQGRELDHNKRGIGGGGQDDEPPPIPLATKPQF"
     gene            complement(1348761..1349838)
                     /locus_tag="MYCTH_2315082"
                     /db_xref="GeneID:11507403"
     mRNA            complement(join(1348761..1349052,1349109..1349268,
                     1349328..1349465,1349566..1349680,1349791..1349838))
                     /locus_tag="MYCTH_2315082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662729.1"
                     /db_xref="GeneID:11507403"
     CDS             complement(join(1348968..1349052,1349109..1349268,
                     1349328..1349465,1349566..1349680,1349791..1349805))
                     /locus_tag="MYCTH_2315082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662777.1"
                     /db_xref="GeneID:11507403"
                     /db_xref="InterPro:IPR001983"
                     /db_xref="JGIDB:Spoth2_2315082"
                     /translation="MIIYKDIISGDELFSDSFDVKEVDGVVYEVDGAFITVKKGADVD
                     IGANPSAEEQDEGVEDGEERVINVVHSHLLQSTSFDKKSYLTHLKGYMKTVKTKLQEA
                     GKSEEEVKDFESKASAYAKKIVANFKDYEFFTGESMNIDGMVVLLNYREDGTTPYFTY
                     WKHGLKEEKV"
     gene            1351173..1353192
                     /locus_tag="MYCTH_2092086"
                     /db_xref="GeneID:11507404"
     mRNA            join(1351173..1352020,1352095..1353192)
                     /locus_tag="MYCTH_2092086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662730.1"
                     /db_xref="GeneID:11507404"
     CDS             join(1351339..1352020,1352095..1352564)
                     /locus_tag="MYCTH_2092086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662778.1"
                     /db_xref="GeneID:11507404"
                     /db_xref="InterPro:IPR006088"
                     /db_xref="JGIDB:Spoth2_2092086"
                     /translation="MMANATIASDLPPLPVYEVRPMPDLLPFISDFWLSTIIPHVAYW
                     IVSLIFHVIDINDLFPQYRLHTPEEITQRNLASRYEVARDVIIEQIIQMTSSAILSMT
                     EPRQMTGMEDYEVAVWATRIRLAQRALPTILAALGLNAAAISKNMAASHPFIAGALAG
                     GHYPFLTTTLDDVTGTAVPAFATWELLLAKAIYWVIIPAFQFWVATCVLDTWQYFWHR
                     AMHVNKWMYTHWHARHHRLYVPYAYGALYNHPVEGFVLDTLGAGIAYKVARLTPRSGM
                     VFFVFGALKTVDDHCGYALPWDPLQRITSNNAAYHDIHHQSWGIKTNFSQPFFTMWDR
                     LLGTMWKGDTTLKYERARAAAAGKALKKQAGTGVSKRVNGKAEAKSDAK"
     gene            1354362..1356801
                     /locus_tag="MYCTH_2303791"
                     /db_xref="GeneID:11507405"
     mRNA            join(1354362..1354681,1354776..1356299,1356433..1356801)
                     /locus_tag="MYCTH_2303791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662731.1"
                     /db_xref="GeneID:11507405"
     CDS             join(1354496..1354681,1354776..1356299,1356433..1356630)
                     /locus_tag="MYCTH_2303791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662779.1"
                     /db_xref="GeneID:11507405"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="JGIDB:Spoth2_2303791"
                     /translation="MVRPYDPTLTETAVRVDPRDSREYAGNQEASPLYDICHHPEKYT
                     NVRYFDREMVVLDDANAKSPDHVILMPRDTSIKEMACLKTKHLPLLYRFRDQAHREIE
                     RMMRVDPGRIPMFRVGFHTIPSLFPLHCHVHDCSLSTDKMFHARHWKVNFSNMFVALD
                     RVIEEIERTGRIEVDADAYRHDWRTRPIRCPVCPGRQPQWEADITELAAHWRRHVDEW
                     KSGRAPLPPNVTPARLWEPSYPVILTTRRRSGFLGLLGDELDHLKAEFPGLEIHSYYT
                     DEWPRIPKYVLDKTTVYLSAAELPPPGYSLPRLEWVHLGSSGLDLLAAHPYNTHHHRG
                     LRVTSSTGSGSEAVAEWVLMNTMFLTRRMGAALRNQAGREWAPRALTGFRTISQLSVG
                     IVGFGSIGRHVAERFLALGARKVTAVNTTGPPLSSSSSSSPCGYSRLGEVTVLPLLQR
                     GGDGKPEARGGGGDDDDEKDGLREFLRDQDVLVLAAPLTPETRGLIGGAELAALPLGA
                     VVLNVARGPLLDERALAERLRSGHLAGAAIDVADQEPLDAASPLWDVPNLVITPHVSA
                     FHSKYNQNMLAIFEHNLRAHLCHRPVTEMRNVVQLPVPSEPSPLGSKSNAAPKRPTKT
                     AYAVKESSSKN"
     gene            1359570..1362240
                     /locus_tag="MYCTH_2079474"
                     /db_xref="GeneID:11507406"
     mRNA            join(1359570..1359624,1360034..1360241,1360321..1362240)
                     /locus_tag="MYCTH_2079474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662732.1"
                     /db_xref="GeneID:11507406"
     CDS             join(1359590..1359624,1360034..1360241,1360321..1361643)
                     /locus_tag="MYCTH_2079474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662780.1"
                     /db_xref="GeneID:11507406"
                     /db_xref="JGIDB:Spoth2_2079474"
                     /translation="MDPNTTLYTFMLRTPPSVKTVNLIGSWDNFTRGYTMERDSRRDR
                     GQWKGCYAFKDITCEGDAGSVPKRNGGLKMGHTYYYYYELDGACETHDPSQPSTNTCP
                     YLPGQTVNTLYIPVEQSGRKRSASMTSLNEADFKTMDPTSKFVTPRPAPTPPEPVRRL
                     GSAPLWMQQHQKRPSRSPSPSSRWHFSTARKLFSRKPSSCSLRDVITQAPQAEDERSL
                     RSEGNRSRDMSPESLRRFLVDDAAPAEAEHEDNSRPAIDIPEDIAEENEDDDNFATSA
                     VSETMPFTGLSPPPPRSLSPAGSTISTLNKKKEEAVPPGAQNSHTAVPSAPTRQPPLL
                     PTISTARAYVPHPGEFPLSALACQPFPDSPDSGSPPGFCLSEAEEEEEEEEDLDVDMD
                     MDMAEKGRDGALASSTAGAVGHPKSPLVARNIAATLSTYSLPRTAGTDAGKLVAAVGG
                     TGSTGTGTGTGDATTTTTNIPPVSSNDERLASSTAADAVSGPLLLTSPIPDAGLEDLV
                     TELGWMVETIGRF"
     gene            complement(1363137..1366156)
                     /locus_tag="MYCTH_2303798"
                     /db_xref="GeneID:11507407"
     mRNA            complement(1363137..1366156)
                     /locus_tag="MYCTH_2303798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662733.1"
                     /db_xref="GeneID:11507407"
     CDS             complement(1363329..1365893)
                     /locus_tag="MYCTH_2303798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662781.1"
                     /db_xref="GeneID:11507407"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Spoth2_2303798"
                     /translation="MATTTTTAVRELGAVGNVCLRCQLRQLVTSRARMRRGISSLSSA
                     AVVEDGHADMQPQKEDGTPPVSPVPSAPLHPIGSRRSSSVAMFQSIVQNQTQMPATPG
                     VSAGGTASIELVKDVARIQTMMEREGATLAQAYAYFEEVVHPQLTKEGSGVPQIVKNQ
                     IAAVLLNRLALEKPRDFESNELPSVTRITEIMIELDVLRPSAWATLVLWLVQHIYRQD
                     TVPDAYASLKDYETAMARRDALLRDLLGAWRAFCAQSVAVKEGSPDNASEEEEGKPKS
                     ERAGTQPQQRTTLQKAFGSMFPQYLVPSLLRPTFAAFATYKLLTDTFNPARATSGDAA
                     PFLQMMKRLIFRTRPPRLEDFKPIFDTFPDLPRFVWPKKRGKDEVKAFLRPISGQTFS
                     QRKNSIHRQLGNAVKSRDLEMVKKAWLELWGDAPVPDAARISELVQWPDLFDYFILAY
                     TMMRRPQQAIEVWNSMERIGIKATTKTWTAMLNGCAKANNARGIKTVWDKLLASGLRL
                     DAAIWTARIHGLFACREPQAGLRALDEMAKYWDARDDPRYAAVAVKPAVEAVNAAVSG
                     LLRLNREADATRVLAWASKRGINPDIYTFNILLRPLVRRGDMKGIDEVFATMRDANVH
                     ADVATFTVLLESTLSNIADLPPAQVISLVERILAAMKSSGVEINMQTYAKILYLLLRE
                     GDRAEEPVKAVLAHIWRRGLELTSHIYTMLAEHYFSRDPPDAAAVTALIENRRLHDNK
                     GIDPVFWDRVIKGYCQAGEVRRALDIFDRHFVGEGTITFGTLYDLLRPLVEAGDMEAA
                     MRVVEAARKIGKAEEAAGHHGGSEGKRFWRHRFWHLAYEHGLMGGPLVERFRKANV"
     gene            1366328..1368447
                     /locus_tag="MYCTH_2303799"
                     /db_xref="GeneID:11507408"
     mRNA            join(1366328..1366530,1366646..1368044,1368161..1368447)
                     /locus_tag="MYCTH_2303799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662734.1"
                     /db_xref="GeneID:11507408"
     CDS             join(1366662..1368044,1368161..1368277)
                     /locus_tag="MYCTH_2303799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662782.1"
                     /db_xref="GeneID:11507408"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="JGIDB:Spoth2_2303799"
                     /translation="MTSLVPRPPYTDEELRKLYPEGLELQLVQILMRHGERTPVSARF
                     QNAGLKPWWPYCASARQMRSVVLAASNATTGNHAFDTLEWKRRLETFGDDDGPVLARG
                     PNAERDDICDMGSLTDLGRQSTYNLGLRLRKHYVDRLAFLPPTISSADFLYLRSTPVP
                     RALESLQQTFSALYPPSAREPGPDGKFPTPTILTRVPGDETLYPNDGNCRRFAALSRA
                     FAQRAADRWNNTPDMEYLQKIYGKWMPPGSKVAVDSRPRLSGIMDTVNATLAHGPETR
                     LPDEFYDEKARAIMEKIGVDEWFAGYKESREYRMLGIGGLMADIVGRMVGTVEQQPRP
                     GGGRIRFGLSGCHDTTLAGVLASLGAYNTDRWPPFTSHIAIELFRESKAASAPPSEPA
                     KGNWWASILGSPPAPASIGRRPMTELTAAEREKLNGYYVRIRYNDEPVTVPACKLPGN
                     HLAGDESFCTLAAFKSVVDKFTPKNWKEQCRMNRDQPALPTGEPEWAGY"
     gene            complement(<1368659..>1369903)
                     /locus_tag="MYCTH_2109950"
                     /db_xref="GeneID:11507409"
     mRNA            complement(<1368659..>1369903)
                     /locus_tag="MYCTH_2109950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662735.1"
                     /db_xref="GeneID:11507409"
     CDS             complement(1368659..1369903)
                     /locus_tag="MYCTH_2109950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662783.1"
                     /db_xref="GeneID:11507409"
                     /db_xref="JGIDB:Spoth2_2109950"
                     /translation="MASNTDSHPEPAPPSTEPDTGRGAKEQAQEPAQTQTQTRAQAGP
                     ELVTEAESQRIDALLARYLALLDEYAALRTRLGDLQAAVFRDLARANFAAERGVRYYG
                     RDYYDERMQAVRRVRVRMPVPVPVPVPAQTQARARARGSSGGGAGGGEEGSSGDVDLE
                     EDNRAVTNGRADGAEKAEAAATAGLGGEEEGARAVNGASGGEGEGGREEEGGEKGGGW
                     TGPVFSVEVYPPPGGEPEDSESAVKRPGQEEESGPDGKGASGLVGKEAGKGEADGDGD
                     GDGDGEGDKYEKRWGGGGSTITATTTATTTATTATTATTTPEEGDEGTKKKPKPKPAD
                     PLRWFGILTPLPLRQAQSHSIKAVEEIIPRLATLSAEMAGVELEVRRARKRRAKAEKA
                     EEKRLAELGDMMAKVNVGASMT"
     gene            1372184..1373326
                     /locus_tag="MYCTH_2303801"
                     /db_xref="GeneID:11507410"
     mRNA            join(1372184..1372336,1372560..1372679,1372749..1373127,
                     1373210..1373326)
                     /locus_tag="MYCTH_2303801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662736.1"
                     /db_xref="GeneID:11507410"
     CDS             join(1372317..1372336,1372560..1372679,1372749..1373127,
                     1373210..1373284)
                     /locus_tag="MYCTH_2303801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662784.1"
                     /db_xref="GeneID:11507410"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2303801"
                     /translation="MVLGTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV
                     TVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPE
                     VHHHCPGVPCLIVGTQVDLRDDPQVVQKLAKQKMAPVRKEDGERMARELGAVKYVECS
                     ALTQYKLKDVFDEAIVAALEPPPPKNSKGNKHRCQIL"
     gene            1375066..1377520
                     /locus_tag="MYCTH_2303804"
                     /db_xref="GeneID:11507411"
     mRNA            join(1375066..1376346,1376462..1376864,1376928..1377051,
                     1377158..1377520)
                     /locus_tag="MYCTH_2303804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662737.1"
                     /db_xref="GeneID:11507411"
     CDS             join(1375231..1376346,1376462..1376864,1376928..1377051,
                     1377158..1377284)
                     /locus_tag="MYCTH_2303804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662785.1"
                     /db_xref="GeneID:11507411"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2303804"
                     /translation="MAAPQDLADRTKDASDLKCYIDPTSGKDDASADGSEAKPYQSLY
                     YALLQHLDKPAPVYLTRSAAPKEGSDGGAAAAPAWEEPAKSAMKKALGRVDAYKKKLA
                     KEQASARQEEEERKQRLKNLEEAKKIVLKEDPSLPPAVRIKINNKSVELGDGKTKKGT
                     RVKVYGRIHELRVQKTTTFITLKDGYGYLSCILPAGDLTKNYDALMFALETALVVYGE
                     MRAVPEGVKAPDNRELHVDYYKVLGAAPSDLDAITNKVSKEQDPWDAQMLDNRHLVLR
                     GENASSVLKLREFVELAFIDTYREMEFRKVSPPAMVQTQVEGGATLFKYDYYGEEAYL
                     TQSSQLYLETVMQSLGNVYCIEKSFRAEKSLTRRHLSEYTHVEAELDFIEFNDLLDHL
                     EEIISRVVDKVLAEETMRGYMKSLNPNFQKPSRPFLRMKYEEAIEWLNKQDPPILNEE
                     GKPHVFGDDIAEAAERRMTDIINRPILLTHFPVEIKAFYMKKDPQDPRVTESVDVLMP
                     GVGEIVGGSMRMDNYDELIEAYKKNGISHEPYYWYTDQRKYGSSPHGGYGLGLERFLA
                     WMANQHTVRTCSLYPRFMGRCKP"
     gene            1380212..1383064
                     /locus_tag="MYCTH_2303808"
                     /db_xref="GeneID:11507412"
     mRNA            1380212..1383064
                     /locus_tag="MYCTH_2303808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662738.1"
                     /db_xref="GeneID:11507412"
     CDS             1380475..1382919
                     /locus_tag="MYCTH_2303808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662786.1"
                     /db_xref="GeneID:11507412"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2303808"
                     /translation="MQDMPGHQAGPSAPGRFGHQSKPSNSDTGFSHSAFTSNISGFAD
                     RHPRRGNIPTINTQPIQQHHHQGGPANGADLTTPGTAFDMQFTPLLPSQLLLGSPFQP
                     GTPAAFATPHFQNVNNFQQAQQQGLQQQANGPSSPVQQNISPQVYQSIVSPSAYGAPQ
                     FYTPQSPTGSFNNVGGQLPVSLQPTSPVSMGAGMVTGTSRTVYLGNIPPDTSAEEILG
                     HVRSGQIESVRLLPDKNCAFISFLDASSATHFHSDAILKKLCIKGQDIKIGWGKPSQV
                     PTSVALAVQQSGASRNVYLGNLPEDITEEELREDLGKFGPIDTVKIVREKNIAFVHFL
                     SIANAIKAVTQLPQEPKWQAPRRVYYGKDRCAYVSKTQQQNAAQYLGIAPGYAHMLTG
                     ADRDLISSALAQQSVAAAAVATTAGGIGNLGNRTIYLGNIHPETTIEEICNVVRGGLL
                     HHIRYIPDKHICFVTFIDPTAAASFYALSNLQGLMIHNRRLKIGWGKHSGALPPAIAL
                     AVSGGASRNVYIGNLDETWTEERLRQDFSEYGEIELVNTLREKSCAFVNFTNIANAIK
                     AIEAVRSKEEYKKFKVNFGKDRCGNPPRQLQQQSPRGDSPAANGTTPNGNSPTGGSAA
                     TAAAAALFNTTTNPLTMYLQHVSQQAQQQAQQQAQQQQQQQQQQQQQQQQQNHVLAAQ
                     QAALFGTAASSPNEPGLTLEVPQGPVSGHQQSASISNGYVSNPSTSGATTIGGLLAPG
                     NPRASHNRAVSLPVFAPFENGGASPNSLHGSVGGEPGEPRRGHQYQASFGGMGAGFGL
                     AIQGNLNGWVEEEVAN"
     gene            1383949..1385599
                     /locus_tag="MYCTH_2303810"
                     /db_xref="GeneID:11507413"
     mRNA            join(1383949..1384052,1384201..1385599)
                     /locus_tag="MYCTH_2303810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662739.1"
                     /db_xref="GeneID:11507413"
     CDS             join(1383996..1384052,1384201..1385460)
                     /locus_tag="MYCTH_2303810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662787.1"
                     /db_xref="GeneID:11507413"
                     /db_xref="InterPro:IPR008685"
                     /db_xref="JGIDB:Spoth2_2303810"
                     /translation="MASRSDTELLTEHFGYPPVSLLDEIINSVNFLAERALNSIEQGL
                     LNAPPASLGFRPSRQRRPPRGPRSAADDNKNNDDDDDDDEEALARQRHRDEVESGTHQ
                     LETLLWASIDKNFDRFEIYVMRNILCLKQTEMDWLRLAHYDGLVFPPPGEEENGGGGE
                     GEGEGAGREGGGENNNDDDDDEKLSVESINRLRRRLQASQRLNCMLVAERARNAALLG
                     EMRRLVGVLPGQGVKVESGQSSAGGGGGGGGGGGGGSGGGDQQQQQQQQQQQQQKPPF
                     GFVHEKGDLTIGDAETPLSTTTAFLLSQLQSLRELSMALRGVMARLAAGDGAVQEEEE
                     EEEEEEDDREGGDGKGQKKKKKKSWRRERLEYVETATKRHLENVRGLELGKNGEVRDG
                     EWDGGGRSLARGEVESLERVADMLGGGRREDEDQDQDQDQDRMDES"
     gene            complement(1385598..1388504)
                     /locus_tag="MYCTH_2303811"
                     /db_xref="GeneID:11507414"
     mRNA            complement(join(1385598..1386202,1386266..1388504))
                     /locus_tag="MYCTH_2303811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662740.1"
                     /db_xref="GeneID:11507414"
     CDS             complement(join(1385736..1386202,1386266..1388249))
                     /locus_tag="MYCTH_2303811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662788.1"
                     /db_xref="GeneID:11507414"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="JGIDB:Spoth2_2303811"
                     /translation="MAADEDERKSSSSELSDIESTNISSDGDSDAGEPQQVEWLVTSR
                     AKRSTAGNRLKAMLANEEPAAEDSDLELLFAEDEDDAGFTDDAPEDASDVLMDSSSDD
                     EDKEDNGDELEGEKELERQARAKRAAERKRKAQDAIPARFRKKVRIEQPAPRPPRPKK
                     KSERLSWLPSPADMPTRASERRTTKMSKQQLHEKMISDELRRKKQLERMERKAKQLEA
                     MKKPPMTQAERLAEAAIVEKRNSKSLNRWEEAEKQREEERLRKIAALHSRKLDGPVIT
                     FWSGIQELQEGQDKHVGNLVSMEEKAPRKKRQSAAAVALAAKEAEASTPATPTEKPGE
                     KTLETPNLKTEQTDSPAPAVAQPAPPVASPAASAQEAPAIAALAPISAPTSTPISKPA
                     PTPPQPAPAPPPAVSPPASALVPPQVPATTPASAPVQTPAPVHAPATGPVRAPTIAQT
                     PAPAPAPVPAPPPVSAPTTGPVQPPAPAPVSTPMAPPPIPPPPPDTRTGNSGVLVAPV
                     LAPPPGISPSMGGQMPMLGLPPGVKPFLAAPNTTPSPSPLSMPPPAPAAAPGPQPTDP
                     PAASTPKPKVSVPPPPVPPTPAPTTPSQTPQTQLKSPSTKPPDTPQEPPAAASDPPRE
                     GKVTRSCIILQNFDEQAIKDKQVQTQILFGRKMNKLAKPAHPPLCVITNQPAKYRDPK
                     TGLPYYNSYAYREIQRVYRGDYKWSRLLGAWVGRGDYAARGVPEWFLDPSKAKPAEPT
                     EPSEQATKPAAGPTAEPVLAPVDGAVELKTEEKEGRPQDNPQNEARLEPVDGVKEPGD
                     GAKGTETAAPSVPQPAGA"
     gene            1388693..1390098
                     /locus_tag="MYCTH_2303813"
                     /db_xref="GeneID:11507415"
     mRNA            join(1388693..1388954,1389070..1390098)
                     /locus_tag="MYCTH_2303813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662741.1"
                     /db_xref="GeneID:11507415"
     CDS             join(1388813..1388954,1389070..1390067)
                     /locus_tag="MYCTH_2303813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662789.1"
                     /db_xref="GeneID:11507415"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Spoth2_2303813"
                     /translation="MFRHGARNFATSARRLAVAAAAAAAAEPTQHLIAVSKAQGIAKG
                     LTGAIGNTPLIRLNRLSEQTGCEILGKAEFMNPGGSVKDRAALYVVRDAEERGLLRPG
                     GTVVEGTAGNTGIGLAHVCRSRGYKLVIYMPDTQSQGKIDLLRLLGAEVYPVPAVAFD
                     NPQNYNHQARRHAERLDNAVWTNQFDNTANRRAHIETTGPEIWNQTAGKVDAFTCATG
                     TAGTLAGITRYLKEVSGGRVKSFLADPPGSVLHSYVSSGGKLIERTGSSITEGIGQGR
                     ITDNLAPDVGLLDGSLFISDEKSIEMVYRCLDEEGLYLGASSALNVVAAKEVAEKLGK
                     GHTVVTILADGAYRYADRLFSRKWLESKNLLSAIPEHLQKYIVLP"
     gene            complement(1390100..1391837)
                     /locus_tag="MYCTH_2303816"
                     /db_xref="GeneID:11507416"
     mRNA            complement(join(1390100..1391463,1391597..1391837))
                     /locus_tag="MYCTH_2303816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662742.1"
                     /db_xref="GeneID:11507416"
     CDS             complement(join(1390412..1391463,1391597..1391720))
                     /locus_tag="MYCTH_2303816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662790.1"
                     /db_xref="GeneID:11507416"
                     /db_xref="JGIDB:Spoth2_2303816"
                     /translation="MLTTTTGPSALRAAGGRTWLPISHGAAALQHRCLSTSSAYRAAR
                     IISFGETSTPELSQVLDDYREKVILPTYLSQEQRRKIYNPRIKHILQNDPITMEIDGV
                     VHKFRYRSMVADLPSTRGTLKQIISLLKTPADFQNIPPFLEGCVRARRKIEPVDYIRL
                     VRLAALNGQLQMIMDCVKAADKTGFKLDNSHVINELLAYIQRPAILGGFDEAKTKAAL
                     KQVRLVLNILESDEEHHRPGAKTAGAFPYYRDPQVLGARLHMAAARAVHHRGGKDEDG
                     RVARYAEELVALWPENAGLLDLQPDRAYRKRDGIMRYMLDRNTYLFMASPVLNGLTLA
                     AQVVDPALAMQLQNRADAVDSEVKAALASPLRKKGGRGEQLYNAIFNPQAQAEEAEE"
     gene            1391955..1393360
                     /locus_tag="MYCTH_2303817"
                     /db_xref="GeneID:11507417"
     mRNA            join(1391955..1392223,1392393..1393360)
                     /locus_tag="MYCTH_2303817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662743.1"
                     /db_xref="GeneID:11507417"
     CDS             join(1392052..1392223,1392393..1392955)
                     /locus_tag="MYCTH_2303817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662791.1"
                     /db_xref="GeneID:11507417"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="JGIDB:Spoth2_2303817"
                     /translation="MNVAPLARRPLGCLKASLRQARQQKMVFARCMATETAQAQTTST
                     PPPTPPSAPEHGFFALKDRKTKTLRTAFAVYPSTVAAGSKSLTPPPANALQALHEAQI
                     KKMDPTGARTALFAKTREAAKVGDVLMVTHRRGGEPFAGVLLSIRRRGIDTAILLRNH
                     LGKVGVEMWFKIYNKNVAGIEIVKRRNKRARRARLTYMRKPKHDMGSVEELVFAWKRS
                     RKVFSSGKAAGAAGGASKKATDSKKK"
     gene            1396302..1399588
                     /locus_tag="MYCTH_2303819"
                     /db_xref="GeneID:11507418"
     mRNA            join(1396302..1396553,1396722..1398379,1398445..1399588)
                     /locus_tag="MYCTH_2303819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662744.1"
                     /db_xref="GeneID:11507418"
     CDS             join(1396457..1396553,1396722..1398379,1398445..1399389)
                     /locus_tag="MYCTH_2303819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662792.1"
                     /db_xref="GeneID:11507418"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="JGIDB:Spoth2_2303819"
                     /translation="MGRFKKALVGQLKALRPAFLSTKPHFHFISVHYFYVVGLALLGS
                     VIVYGAGRGNIAYIDALFLASCSSTQAGLNTVDLNLLNTFQQVVLYLWPMMANPITIN
                     SFVVFLRLYWFEKRFQHIAREARLRRGTVSKAKTAPKANNADLERGVNGRKITVMLNG
                     ARSRITNDGMLLEGTQQPSDEQRLDLASPAARQDGAEASDEASEPRRPEIKFARTVTK
                     SDGLGEDPIKLPPVVRPDHEHIAFVERQRKGDDEVLRIPNPRDAERGMRPKRVEAGDE
                     EEADVPPRSAAAAAAAERYAEPLGNRADSRQQAITIEEPDRNKLQQYDSDDLIETARG
                     PRHVFSFLKLPRPRSLSRMTGRFQSSEPGPSGTARPGAQRRQSIQSIRTAFSRDRVEG
                     TPYLSWEPTVGRNSAFPDLTEEQREELGGIEYRSLKTLALILTGYFWIFAAIGVIGLA
                     PWIAESERYGKIVDQAGVSRAWWAFFTASSAFMDLGFTLTPDSMNSFNTAVWPLLLMA
                     FLIVIGNTGFPIMLRFIIWVMSHLVPVGTGVYEELRFLLDHPRRCFTLLFPSGATWWL
                     FWLLVIMNGLDLMFFIVLDLGSGPVVDLPAGLKVLNGLFEAVSTRTAGFSCVNLAALH
                     PAVQFSYMVMMYISVFPIAISVRRTNVYEEKSIGVYSTSDDEEQPGHSDLSYVGSHLR
                     RQLSFDLWYIVLGFFILNISEGDKLMANEFSSFAVLFEVVSAYGTVGLSLGYPGINAS
                     LSAKFSVVGKLVIIAMMIRGRHRGLPYALDRAILLPSESLNAREAADADARMNRIHSH
                     ASGATGARGSSLARRRSMTVDRGNIIASLLHPGPAVPAEPPLPEMHRAKSTEPPAGSG
                     APAADDQETYATRVSSRRTEPGASRRVDSGLPTQRTRTASGDD"
     gene            complement(1399917..1403068)
                     /locus_tag="MYCTH_2303821"
                     /db_xref="GeneID:11507419"
     mRNA            complement(1399917..1403068)
                     /locus_tag="MYCTH_2303821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662745.1"
                     /db_xref="GeneID:11507419"
     CDS             complement(1400297..1402888)
                     /locus_tag="MYCTH_2303821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662793.1"
                     /db_xref="GeneID:11507419"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="JGIDB:Spoth2_2303821"
                     /translation="MPPKRKAPPGQAGAAKAGRASAMSTPGPATPRSLDSSVMSDGDE
                     DFDEDVSEEQREREAMLSKEADEFVSKFTLGGKRLQGQKDDIGREVRRYDAASPFFRK
                     RDFSHLPLKPDHQNRPLWIDPDSCTIVLERFNPLAEQATDFLITIAEPKSRPTFLHEY
                     ALTPHSLYAAVSVGLRPKDIINTLERFLKTSLPDIVRKKIEDHTRSFGKVKLVLKHNK
                     YYVESADAEVLQTLLKDKVIGALRVQGSGDITTSYAPTMGGLVIPGTQNAAGVHQADL
                     KPGEKKPGEGSNVPNEADLFTALNEEDDDDDKEAVHSFEISDANVETVQKRCLDIGYP
                     ILEEYDFRNDDVNPNLEIDLRPNTQIRPYQEKSLSKMFGNGRAKSGIIVLPCGAGKTL
                     VGITAACTIKKGVIVLCTSSMSVVQWRQEFLKWSNINPDDIAIFTAESKQKFSGSTGI
                     IVTTYSMVTNSRERSHDSKKMMDFLRGREWGLMLLDEVHVVPAEMFRRVISSIKSHSK
                     LGLTATLLREDDKISHLNFLIGPKLYEANWMELSQQGHIAKVQCAEVWCPMPTEFYDE
                     YLRANARMKRTLYAMNPRKFQACQYLINYHEARGDKIIVFSDELYSLKQYALKLKKVF
                     IYGGTSQAERMQVLENFQHNPEVNTLFLSKIGDTSLDLPEATCLIQISSHFGSRRQEA
                     QRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSSKRQAFLVDQGYAFKVITQLANI
                     EKTPDLAFATPQECRELLQRTLVDNERGVEDDVETDDLFGKTGRSRGAGSGNGVKKPG
                     NGVRRTAGMLSELAGGQDMAYIEQNKAANKALKAKAKKGAGSEGQSKFFKSIQREKEK
                     ARARAGL"
     gene            complement(1403341..1405401)
                     /locus_tag="MYCTH_2133968"
                     /db_xref="GeneID:11507420"
     mRNA            complement(join(1403341..1403424,1403505..1403548,
                     1403637..1404594,1404661..1405048,1405112..1405164,
                     1405221..1405227,1405297..1405401))
                     /locus_tag="MYCTH_2133968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662746.1"
                     /db_xref="GeneID:11507420"
     CDS             complement(join(1404261..1404594,1404661..1405048,
                     1405112..1405164,1405221..1405227,1405297..1405327))
                     /locus_tag="MYCTH_2133968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662794.1"
                     /db_xref="GeneID:11507420"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Spoth2_2133968"
                     /translation="MASGYDRALSVFSPDGHVFQVEYAGEAVKRGTCAVGVKGKDVVV
                     LGCEKRSAMKLQDTRITPSKIGLLDTHVCLAFAGLNADARILVDKARLEAQSHRLNLE
                     DPVTVEYITKYVAGVQQRYTQSGGVRPFGISTLIVGFDKGSDTPRLYQTEPSGIYSAW
                     KANAIGRSSKTVREFLERNYKEDMDREATVRLTIKSLLEVVQTGAKNIEIAIMAPGKP
                     IEMLPVEDIENYVKNIEQEKQEEAAKKKTGRTPGTGSAAILTRGTQGESSEQ"
     gene            1408933..1411030
                     /locus_tag="MYCTH_2303826"
                     /db_xref="GeneID:11507421"
     mRNA            join(1408933..1410758,1410843..1411030)
                     /locus_tag="MYCTH_2303826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662747.1"
                     /db_xref="GeneID:11507421"
     CDS             join(1409130..1410758,1410843..1410875)
                     /locus_tag="MYCTH_2303826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662795.1"
                     /db_xref="GeneID:11507421"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_2303826"
                     /translation="MAARQQLTPVLRRLKLTRASCPSISRQCALRRSLSPPARCFSNS
                     RRQQFQKTSPAAAVQGKLTSETYPDLKRDSRFAQLTEEHVAYFRQLLGSESAVIDGVT
                     RSDAADDIEPFNTDWMRKYRGHCRLVLKPGSTEEVSQILKYCNDNMLAVVPQGGNTGL
                     VGGSVPVFDEIVINMGRMNKILEFDEVSGTLVAEAGCILEVADQFLASKGYIFPLDLG
                     AKGSCQIGGNVSTNAGGLRLLRYGSLHGNVLGIEAVLADGTVVDDLCKLRKNNTGYDL
                     KQLFIGAEGTIGIITKVSILCPQRSPAQNVAFFGLESFEQVQRAFREAKGQLSEILSA
                     FELMDESSQALVRQVTGNKRPLEGEYPFYCLIETSGSNADHDSEKLQAFLEDVMEKGI
                     VADGTLAQDETQIRSLWAWREGIPEALSHLGGTYKYDVSIPLRELYQLVEDTRARVEA
                     AGLIGDTDEFPVRAVVGYGHMGDANLHLNVSTRRFDERVEKVLEPFVYEWIAERQGSI
                     SAEHGLGLMKKKFIGYSRNPTMVGLMKNIKTTFDPNGILNPYKYL"
     gene            1412074..1415040
                     /locus_tag="MYCTH_2303828"
                     /db_xref="GeneID:11507422"
     mRNA            join(1412074..1412223,1412367..1412399,1412461..1412483,
                     1412770..1413381,1413439..1413582,1413664..1415040)
                     /locus_tag="MYCTH_2303828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662748.1"
                     /db_xref="GeneID:11507422"
     CDS             join(1412220..1412223,1412367..1412399,1412461..1412483,
                     1412770..1413381,1413439..1413582,1413664..1414833)
                     /locus_tag="MYCTH_2303828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662796.1"
                     /db_xref="GeneID:11507422"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2303828"
                     /translation="MVGVPGKYKGCETCRLRRVKCDNQRPHCRKCLDGGRICAGYERE
                     TVFIIGTLDDRGRCSSHPPRVVNKASGTGGGSTGGSSSGSGSGSKKARSRSSTLVTKE
                     SVGGGGGGDEGKESGTVVEVVVDGEPRPAWDDLVQLDCRRPRQRRGRYSTQLAGLGTD
                     LAGVVVRESGGGGSCLSLPAYGTPDVQLGMGTEELRLGPRCLVHLAAPDQGQGVAHSV
                     CMFLYQHGNDPYFANQPHWKDPFVQSDNVLRAAPEQFRSFPAHHFFARFYRPNAIMTA
                     LLNRTPTFLAESQWLSVPFEIHPKAPLDRLFDNLAVLASLLPRADHVLSQEPTFARRL
                     MAQELLNDCLDLEMEMGRWYTSLQHPSMSGSAGGGAGGKPLFWLSDSTVTRVNPPFNP
                     LIFRDNHTALALSYYWAALVLFYPTIWRLYFAAVIDAVVVMDTTTTSNPPSYLPHHQP
                     HQHQYQQHQYQQQQQQQLPQSTTPSMFTPLPIPPRLQDLDPMRYSLPQVRQIAGNVCR
                     ALDFLLLVLLPLPLLPPEGNKNSSSSSNNSNNTPVPLPGWAQPDLLWLPLLAVARLFR
                     ELGGIVSAQPGGASQAGAGMGMGMQMGVGMGLGMGAGLDMGLMDASSGDGGGGGGGEG
                     RLVEEMWCDGLRERLLGRVGEMREVVAGRRWFDVASL"
     gene            complement(1415821..1419415)
                     /locus_tag="MYCTH_2303831"
                     /db_xref="GeneID:11507423"
     mRNA            complement(join(1415821..1416554,1416614..1417382,
                     1417443..1418789,1418923..1419415))
                     /locus_tag="MYCTH_2303831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662749.1"
                     /db_xref="GeneID:11507423"
     CDS             complement(join(1416018..1416554,1416614..1417382,
                     1417443..1418789,1418923..1418948))
                     /locus_tag="MYCTH_2303831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662797.1"
                     /db_xref="GeneID:11507423"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="JGIDB:Spoth2_2303831"
                     /translation="MARKQATLGKFFGQANGAKGKPAPAQQTKLRFSTKAGDEKKEND
                     EEVVPKKEEVASEVEDNESVGSDKGTGKGDIEGIIRANNAGSTENSKKRGRPARPAVA
                     AKESKADVEEDAEVAAPASKRPRRGRKVVVDEDEDDVEMEDAPEPEPKKATKASSAAR
                     TKSPKGKDTEPEVAAKTEAEEDTPESSSSEVEEEEMQDEEEKPEVAAKARQKVQATLK
                     SDVKHPYPDWKEGDPVPYAALCKTFSLIELTTKRLEILAHCSLFLRQVLRLTPDDLLP
                     TVLLMVNKLAPDFAGIELGIGESLIMKAIGESTGRSLAVIKQDQKEIGDLGLVAVKSR
                     STQPTMFKPKPLTVRGVHKGLMGIATVTGNGAQGRKVDGIKKLLSAADANGTGKVDIT
                     KDKGGPSEAKYIVRFLEGKLRLGLAEKTVIVALAQAVVAHEAYQKGTVPSTSDLEKGE
                     SILKTVYSELPSYDIIIPAMVKYGIENLREHCKLRPGVPLKPMLAKPTKAITEVLDRF
                     EGQTFTCEYKYDGERAQIHYVAKDTDEQLSQSAMGATKEVGKGVAAIFSRNSEDLSKK
                     YPDILAKLPTWVKEDTKSFVLDCESVAWDVKEKKVLPFQQLMTRKKKDVKVEDVKVTV
                     CVFAFDLLYLNGEAVVKKSLRERRELLQQAFQPVEGEFAFATYMNGQELDEIQAFLDE
                     SVKASCEGLMVKMLDGEESGYEPSKRSRNWLKIKKDYLSGIGDSLDLVVLGAYYGKGK
                     RTSVYGAFLLACYNPGTDTYETVCNIGTGFSEAVLEELHKSLSEIVIDRPKPFYSHSS
                     GSQHQPDVWFEPRYVWEVRTADLTLSPRYKAGMKEGVDPSGEKGISLRFPRFIKVRDD
                     KKPDEATTSRQVAEMYRKQESVAKSKGPAVDDDFEY"
     gene            complement(1419433..1421643)
                     /locus_tag="MYCTH_2303832"
                     /db_xref="GeneID:11507424"
     mRNA            complement(join(1419433..1420324,1420384..1420470,
                     1420536..1420903,1420972..1421105,1421226..1421643))
                     /locus_tag="MYCTH_2303832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662750.1"
                     /db_xref="GeneID:11507424"
     CDS             complement(join(1419816..1420324,1420384..1420470,
                     1420536..1420903,1420972..1421105,1421226..1421369))
                     /locus_tag="MYCTH_2303832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662798.1"
                     /db_xref="GeneID:11507424"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="JGIDB:Spoth2_2303832"
                     /translation="MFSRAVRISRAVPIRAAQRAQAAPIAAARRTVTTNAASAQVDKT
                     SIPESDDEPFHIRLSDESFETYELDPPPYTLEVTKKELKDMYRDMVVVRQMEMAADRL
                     YKEKKIRGFCHLSTGQEAVAVGIEHAINKSDDVITSYRCHGFAYMRGGTVRSIIGELL
                     GRREGIAYGKGGSMHMFAKGFYGGNGIVGAQVPVGAGLAFAQKYTGGKKATIILYGDG
                     ASNQGQVFEAFNMAKLWNLPALFGCENNKYGMGTSAARSSALTDYYKRGQYIPGLKIN
                     GMDVLAVKAAVQYGKQWTEQDNGPLVLEYVTYRYGGHSMSDPGTTYRTREEIQRMRST
                     HDPIAGLKQHILDWGVAKEDELKAIDKEARNHVNEEVAAAEAMPFPEPTAKILFEDIY
                     VRGTEPQFIRGRTPDEVYYFH"
     gene            complement(1422263..1425007)
                     /locus_tag="MYCTH_2303838"
                     /db_xref="GeneID:11507425"
     mRNA            complement(join(1422263..1422718,1422790..1423138,
                     1423203..1423565,1423621..1424219,1424279..1425007))
                     /locus_tag="MYCTH_2303838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662751.1"
                     /db_xref="GeneID:11507425"
     CDS             complement(join(1422494..1422718,1422790..1423138,
                     1423203..1423565,1423621..1424219,1424279..1424713))
                     /locus_tag="MYCTH_2303838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662799.1"
                     /db_xref="GeneID:11507425"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2303838"
                     /translation="MPPYNRPLSFSERRGAVFNEELSLNTHNVKLSQQRPRGPPTPSM
                     STPAADFEQVTGSPPPPPTPAASPGPSHSKLNWSNAKEDEEAYLSGLRKYFMQCNSGQ
                     RTRLLADLLNLCTSAQLSFVHQFVSPLLKKDPFTTLPDELCLRILSFIDDPKVLARAS
                     QVSRRWRDLLSDDMTWKNLCVKHDYQRRLSEVDRLNPPTSPARTEAYSFGHREDDSTS
                     HDFAGALTSTSLPATFDGKSNSRPVLRSYKSHFKQRYLVDAAWRSGGRNLTRNITQDG
                     GVVTSLHLTSKYIIVALDNAKIHVFDTEGNALRTLQGHVMGVWAMVPWDDILVSGGCD
                     RDVRVWDLSTGACKHTLRGHTSTVRCLKMSDANTAISGSRDTTLRIWDIRTGLCKNVL
                     VGHQASVRCLEIKGDIVVSGSYDATAKVWSISEGRCLHTLTGHYSHIYAIAFDGQRVA
                     TGSLDTSVRIWNVQTGECLAILQGHTSLVGQLQMRGGTLVTGGSDGSVRVWSLERFCA
                     IHRLAAHDNSVTSLQFDDTRIVSGGSDGRVKVWDLKTGNLVRELVTQSDAVWRVAFED
                     EKCVAMALRNSRTVMEVWSFSPPEELLNEQSMLPPKRRLDAPVPDRPLSAFSLDYRGP
                     RSTGGAQDIDMPDAGPSTAPLQQSGPTFFQDA"
     gene            complement(1427543..1429127)
                     /locus_tag="MYCTH_2303843"
                     /db_xref="GeneID:11507426"
     mRNA            complement(join(1427543..1427918,1427975..1428766,
                     1428828..1428844,1428932..1429127))
                     /locus_tag="MYCTH_2303843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662752.1"
                     /db_xref="GeneID:11507426"
     CDS             complement(join(1427720..1427918,1427975..1428766,
                     1428828..1428844,1428932..1428967))
                     /locus_tag="MYCTH_2303843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662800.1"
                     /db_xref="GeneID:11507426"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_2303843"
                     /translation="MMAGLFFLIVTSVVMTVASFLAGALPLSLSLAQSQLRLIASLGA
                     GLLVGSCLVVILPEGIEALAAASEHSHDPAQPMPRLPGLVLREGDEPAENTGELPAFS
                     IGFALVLGFALMFLVDRLPRHATERFRAAPTSRHVSLEDLAGSSVSGEGESEGFLDSL
                     APLPKQTRGLATTLGLVIHAAADGIAMGASATTSNLNVGLIIFLAILVHKAPAAFGLT
                     SILLKQGLTKRAARVHLMVFSLAAPAGALATYFLVSLAGGANLEGESAQWWTGMLLLF
                     SAGTFLYVAMHAMREEENNPAGYDHSSSSNGYSESGGSAPRRRAKLELRDTLATVVGF
                     MLPLLTRFGHHHH"
     gene            1429610..1431496
                     /locus_tag="MYCTH_107723"
                     /db_xref="GeneID:11507427"
     mRNA            join(1429610..1429738,1429794..1431496)
                     /locus_tag="MYCTH_107723"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662753.1"
                     /db_xref="GeneID:11507427"
     CDS             join(1429720..1429738,1429794..1431256)
                     /locus_tag="MYCTH_107723"
                     /note="Contains conserved domain: pfam10394, Hat1_N,
                     Histone acetyl transferase HAT1 N-terminus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662801.1"
                     /db_xref="GeneID:11507427"
                     /db_xref="JGIDB:Spoth2_107723"
                     /translation="MSSDEAWSTSSNDALLLSLVTPSATGVKTIGHSFHPKFTYSLFG
                     DNEEIFGYKDLEINLRYNASDMRPNLSVTYSKKFPGVGDTEATDINGVLREILPDVAF
                     QSKKDFETAVNGLRKDWTPPGKLITTFRSHGNTFEVWKGTLADPAVKQVARRIQILAP
                     LFIEGGTAINVDDSDADRWTVFFLYQKKATPSDASGNPYVFAGYSTVYRFFHFRPLTP
                     PVTPSESEVEKAMLAQDFDLSQLPCRSRISQFIILPPFQGKGLGSRLYSCVFKEYIQH
                     PQTVEITVEDPNEAFDDLRDIANLHYLRQLPEFQALRINTDVAIPKVGAAPNNIVDQA
                     AYDAVRAKAKMAPRQFARVLEMHLMSQLPEPVRPGISPEKQAAKATKEQEHEYRLWRL
                     ILKKRIYKHNKDALGELEIPERIAKLEETVSSVEFDYARLLIKAEEQLKNMAEDERKD
                     EAAAAAAAAAAAAGPNGSPANGKRKAADDTQEQASKKARVEDE"
     gene            complement(<1431574..>1432646)
                     /locus_tag="MYCTH_2109970"
                     /db_xref="GeneID:11507428"
     mRNA            complement(join(<1431574..1432520,1432586..>1432646))
                     /locus_tag="MYCTH_2109970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662754.1"
                     /db_xref="GeneID:11507428"
     CDS             complement(join(1431574..1432520,1432586..1432646))
                     /locus_tag="MYCTH_2109970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662802.1"
                     /db_xref="GeneID:11507428"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="JGIDB:Spoth2_2109970"
                     /translation="MSATPVGSSSPELTMAVLGCGTMGIAILSGILSSLDEIQDANAK
                     PASSGTSTPLYETSATTRLPSRFIACVRRPESAKKLKNTFARHLSAVEIAQNDNVASV
                     QRADVILLACKPYMVKEVLSEPGMAAALEGKLLISILAGVTETQIATTLAEANGGGSA
                     PAGCRVVRAMPNTASLIRESMTVIGISNPPLDPDTLGLVTWIFKSIGDVVYLPPSTMD
                     VCTALCGSGPAFFALMLEAAIDGAVAMGLPRAEAQKMAAQTMKGAASLVLNGDHPALL
                     RDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREATVVASQLGQGVQGVNGTRFPGTQL
                     Q"
     gene            1433320..1434668
                     /locus_tag="MYCTH_2303849"
                     /db_xref="GeneID:11507429"
     mRNA            join(1433320..1433556,1433638..1433814,1433899..1434668)
                     /locus_tag="MYCTH_2303849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662755.1"
                     /db_xref="GeneID:11507429"
     CDS             join(1433401..1433556,1433638..1433814,1433899..1434351)
                     /locus_tag="MYCTH_2303849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662803.1"
                     /db_xref="GeneID:11507429"
                     /db_xref="JGIDB:Spoth2_2303849"
                     /translation="MADPFEVRMRFTNQLRQLNASVTSAQKAAQYALKYRDMAEDLHS
                     CILEQLERNNMNTRANIMYFIEHFLDMANKDGYDDYVRMMQRDIIRVVDAVAPDDGSG
                     AANVKVVRKVLHALQNKSFLDAQAVTEIEEVLKERDASAQELAMSPPPLNGDGMPDNL
                     GDMPPSRTLPPYDKRGHAPPKLDKKQIEQRIEEDRERHKRQRENIWAVPPGKNAEMEK
                     LWEETSDLGEDDHRMGEEEWAEWKAEFEARRCPHRKDDANGAH"
     gene            complement(<1434828..>1435531)
                     /locus_tag="MYCTH_2126562"
                     /db_xref="GeneID:11507430"
     mRNA            complement(join(<1434828..1435157,1435292..>1435531))
                     /locus_tag="MYCTH_2126562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662756.1"
                     /db_xref="GeneID:11507430"
     CDS             complement(join(1434828..1435157,1435292..1435531))
                     /locus_tag="MYCTH_2126562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662804.1"
                     /db_xref="GeneID:11507430"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="JGIDB:Spoth2_2126562"
                     /translation="MSLSCRYAAQCCARQLRASSAAPIRASSSLLQQRMTRRYNSTEA
                     ASSSSSSTTNPKISAIVDQISQLTLLETADLVASLKSRLNIPDLPVGGFAAAPAAAPA
                     AAAPAEEEEAAPAAAEKTLFTLKLQSFDAAAKPKIIKEIKNLLGLSLVDSKKFVESAP
                     KQMKESVPKDEAEKIVATMKELGAVVVME"
     gene            1435895..1451135
                     /locus_tag="MYCTH_2303853"
                     /db_xref="GeneID:11507431"
     mRNA            join(1435895..1441490,1441546..1451135)
                     /locus_tag="MYCTH_2303853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662757.1"
                     /db_xref="GeneID:11507431"
     CDS             join(1435989..1441490,1441546..1450953)
                     /locus_tag="MYCTH_2303853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662805.1"
                     /db_xref="GeneID:11507431"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="JGIDB:Spoth2_2303853"
                     /translation="MATIDLSRQRASLLGDAAAMQVLPRELLLIIQDHNSTQLLEAVA
                     NAALAAPAATDRILAHFESVSADICARWILSRPRLDVSVLASFARILPFSPSLSVFLI
                     SHLRDGVGGQAEGGSNARVLEALDLVSFQDADIPVVLLSLWRLNNFDKRTFSPLSKPS
                     QLQSLFAHRDPTVRYLAIRVFSQLHDASDQKLEAMLAKHIPKGTSLVADLDGRRVDYT
                     FLSLYEDARNQETRRLRNSLQADGSIAPESAQPRIPPQNLTPLVVKYGKTVLPRPLGP
                     VNTPSALALTPTTVENLESLGALLQRPGPILLHGLSGAGKTSLVHEVARELGKQKEMV
                     TLHLNEQTDAKMLLGLYTTDSKPGSFQWRPGVLTTAVKEGRWVLVEDLDRAPTEVMST
                     LLPLIERGELLIPGRGERIQASSGFRIFATVRTRLGMNDRENLPNLIGLRLWHLLHVK
                     ALPRDDLKEVINGRYPLLHKYIPGVLAVFDQLVACTSGSTRLSLGRTALDRPIGTRDL
                     LKWCSRLDDVLRAAGCKTGDEPITDTTRDRMFLEAVDCFVSSMHEPSARKILITAIAK
                     EMHLSPERVQHYLTSYIPDLEDTETRLVIGRASFVKQRRTSRVSKSKRPFATTVHAKR
                     LLEQISVAVKHREPLLLVGETGIGKTTVVQQLAESLGHRLVAVNLSQQSEASDLLGGF
                     KPVSSQSLAMPLKEEFDDLLEKTGVSVEKNREYLERISKRFAKGRWKEVSKEWRKAPK
                     MFEAILAKLESSQPRTETADGQPAKRRKTESSKLQRLLDLKPRWEMFSQSLDQFDRQI
                     ASGSAGFAFAFVEGKIVKAARNGDWVLLDEINLASPDTLESIAGLFQPSPSLLLSETG
                     EIERIQAHPNFRVFAAMNPATDVGKRDLPLGIRSRFTEIYVGSPDRDKKDLLTIIKTY
                     LKGNNSSIDRLADDVADLYLEIKKRAELKLLVDQANEVPHFSLRTLTRVLTYANDVAP
                     LYGLERALYEGFCMSFTTLLSEESERTVMPLIHQHLLKRPNILTVPPKKPTDGKKYVS
                     FKNTNKDHHYWLLQGNEIPKEREDYIITPYVERNLLNLVRATSTRRYPILIQGPTSAG
                     KTSMIEYLANYTGNKFVRINNHEHTDLQEYLGTYVSDSEGKLRFQEGVLVQAMREGSW
                     IVLDELNLAPTDVLEALNRLLDDNRELLIPETQEIVRPAENFCLFATQNPPGLYGGRK
                     VLSRAFRNRFLELHFDDIPESELETILQKRSRNTAPSDCRRIVAVYKQLTRLRQESRV
                     FEQKNSFATLRDLFRWALREAETRQEIAEHGFMLLAERVRKPEERDEVRKVIEEVFKV
                     KIDPDRLYDLEIAPELSNVRARNSQGVIWTRAMRRLYVLVKRAIKNNEPVLLVGETGC
                     GKTTVCQLLAEFEKKELHIVNAHQNTETGDLIGSQRPVRNRGAILDALFRDLKEAASL
                     LGREQDSLENLQEWYRSLGPEALNQLPESLRSKIRTGTTRSKALFEWSDGSLVHAMKE
                     GAYFLLDEISLADDSVLERLNSVLEPHRSLLLAEKGITDSFVQATEGFQFFATMNPGG
                     DFGKKELSPALRNRFTEVWVPAFTEVDDVHDIVVSKLDKRFKSRGGNKKHAKPISRII
                     VEFASWFGKTFRPSSATAFSVRDILAWVEFMNTSQFPSAELALLHGAAMVFIDTIGAN
                     PSALVAVDPREMASQRQMCLEHLSSLCGVDLTQAYFQEPQVTIDEKMLKIGDFSVDRS
                     LTGGSIDAGHEFSVPTTKMNAMRVIRALQGTKPILLEGNPGVGKTTLVTALARACGRP
                     LTRINLSDQTDLMDLFGTDVPVEGAEAGNFVWQNAPFLEAMQKGEWVLLDEMNLASQT
                     VLEGLNACLDHRGEVYIAELDQVFKRHPDFKLFAAQNAHHQGGGRKGLPSSFVNRFIV
                     VYSDVFTKQDLLHIIANKFCAIGSETQQRLIEFMSRLDDEVVNRRSFGALGSPWEFNL
                     RDTLRWGDLLTSRNPLLADRKPDDYLDVVIRQRFRSERDREQVDKLFSEVFGRAPESH
                     GLYHDVNPYFGQVGLATLKRNPLSQPTPFPAIDPVPRLKEIESIMISVEQDLPCILVG
                     PSGSGKSALLAHVAALAGKSLVVFPLNADVDAMDLIGGFEQADPHREVQACLSRLRDA
                     FQHQILLALPNPVPDAVLDLMAALSSLTGGADQYENILSLVETLQGGVSLPEDLTALL
                     SDASEVLRKPLTLENPRFEWLDGVIVRAVETGAWLVLDNANLCSASVLDRLNSLLERP
                     NGILSVNEHSGPGGEPRIIKPHPDFRIFLTVDPRYGELSRAMRNRSVEIYLDNLPAGT
                     TAVERIAPLDATMHRFHAAANILDQQAEDGQLVPLAHDVLSLGDSNKLDAYLQASREA
                     LAESSPSLIRSPAAIQNLSLVLSYIRSEDTNMLRQSLADLYSATPDKMLMPLHPLLNS
                     PMVPLLEQGREGLAAWLASCYEFYLAIRGAEQAMEKQLGKVNVSKPSSLNRLQRSWVA
                     DKVASLSRDSTVNAVRFLSSVLRAVKAFLCEKSGDHGSWKQRRAVLRRLLLFWKRTFE
                     SLIVASFEEARFQAHLTQGSSFLQQSMSTLQTDDSSRKLLSTIYDFLERDFVVGFKLL
                     SGLSMEVLWHQLRPDPIPDAQVLGQVLELERLAERFDSLRWRVDVNIATLRTIQDSMA
                     RVYAVIRTGKGDAAGLVRDLQSEITSLEAKIGEHSTTHTPFFASSFEGLRQALVLHQV
                     SQGKALEPGSSDVDVLASIPTASLMRLRCLKPTALKAVDCLLVQESSDVHPWEGSLSK
                     SLLLRYDAASSASLNELRSLEVEMPIMGKALTNASEALATEPLAKVERLLLKLIDEVV
                     AAHDESYRGLMMGAYENLLTPQKSNVVSHRELGAWLEHTSLLKGLSDNFPSHLSAVFD
                     RCFSKSLLALAASANGFRPRSATTSVAWICFALGCVELFVPDKIFDPHHRAQVEAEEH
                     QEHYQSLKAQIAALEAFELAFTGQRTNLRSQLLAEEVEGLGESPPVQKIYRPGGGELH
                     SLQGEFNNVLNALIGNEVAATHLRSLVSPSNDGSEELALVEDNIKLLISRLTSRFGAY
                     QDLTMPLVSFLRCVRMGLSLGRGVGLNEEVEKGNSQALVAVSPFLGGAIWKAETASLP
                     LLSLEFLSFIQTVVAVEGLDKLPQTLRQALHESLGAFHEEWTKKLEADRKIQEAKTSL
                     FRFKGSLEDQEEYDQEEFDQLFPDYTPDEEGVVKSKKPRRGGRDLSIMLAEAHEKIFL
                     SAPEPQQSIKGLCAQVARRVAREKRESAVAEPGLDSLLLPATILVFDEQVKALGSNVD
                     ASNYNFYTDANLAEVRKVLGLVNSIKQRFLELQDIDEIGHHQTLADVVQACDKVLEMA
                     IDDPLARIIVAIERLYAHVYEWHEGGWASKAHKATALYEKLRDTICDWRRLELLSWSR
                     LLDAELKKSYEDAKSWWFIAYGAVILEPCSILQQGHDLGDHAVKLLSILESYFTDATL
                     GQFRARLDLLRQLKNQLDQMVRDEPALALVRDAIQNFITFYSRYERRVSETITAGRAP
                     LDRSMKDVLLMFKWRDKNIEALRDSAHKSHHKLFKLVRKFRAVLEQPVRPIVEQGLPE
                     EDHSDAITEGGAEHVGARLDQSAIAFCQRALPNITSHPHWARMSNLPAVLKAMSKHGS
                     LPSTAINAAETLDSYVTDLSSSISALKKETPPTLTDENKELVRHLKTRKVTLYSETLK
                     TLRAMGFSRNLGTNILARQSSTAVILVGSGIVPDIDGATPGAIEYFYHKTLDLAPRFR
                     AAASGHSEDLSREVVHRSIGYLEGVLHVMFRQRQFLARAAAEERGLSGAVQAVGNLSA
                     GGDNSFRTQSRSANHAQVVRWLVQVLRVGIDLLDVHGKLGGADNATVRGTLQGWVEVF
                     TKLDAAHDRLPRLPGGFNSYAGEKLQGDVERELDSLRAALVEIAQARPDLAFIVRQIQ
                     PWTSIQATEVANGVLSSDHITDVADAALTLSSKILVALQNFQKAVQTLPQTTEDPSWL
                     LNYGDGLQISIEALRMSRITSEVNALIHRLGGLSSPETSTTSSALLRLLQPVLAQYST
                     ICTRNLKQFSALHRATCRLGYHLASSFVQIASQGFCTPQEKSDEKSGESGNVESGTGL
                     GEGEGAEDISKDIKPDEDLSELAQDPNNNAQADIEENKDAVDMGEDELEGELGSVGGD
                     EEEEDEKKDRDEDGEEEEEEMDEQAGDVDDLDPTAVDEKMWDGSGEDDAEKDQMGDQE
                     KGKKDDDQSAAAEGKKNEQKGDDQDEGNAPPDEVGEEQGDEDAEMEAGQEEEGMPQEE
                     LNRQDQNVQENETLALPDDMDLEIDDGGEESGEDDDDDDLDALSDVEEPEEKQADVPE
                     DASQSGDEEKGEEEEHRKDEDIPEGEAEQEEEIDAAGDREEEMDVDMEEQGKEEEQGE
                     EEGQDDEKDEKKRPVPDNGTSADQDDAAPSDVRNGGGQAEDANMQDEEVDNKAGQREQ
                     GALGKQSAEEDKAPGSKGALSNMDQEQGPSEETRDAESNNAQPFKKLGDALERWYRNQ
                     REIQAASESQEKTERSPEDMARAEFQHLQDETAEADTQALGTATNEEARPMDDAMAVD
                     TEMDEADNQIVPPEDEQEEQGGDVEMEDTEPAEPQDVSKHEREDGRSGVATRKGAYDT
                     GDADEGPRAEAPEDVEDEQIEETSSQLLATRITGEDEEAVPLRDYDEALEMWSDFQNK
                     TQPLSQSLSSQLRLILTPTQSTKLSGSFRTGKRLNIKKIIPYIASSYKRDKIWMRRAI
                     PSKRAYQILLCVDDSSSMSDENRSSSGRLALESLVMVARALTVLEAGQIGVLGFGTDV
                     FVAHALTDPPFTSQDAGARVLQRFTFRQEGTDMVRLLRKTIDHFREARLVQASGGGGG
                     GGGEDLWQLALILSDGLVQSRDHARLRPLLREAMEQRVMVVFIVMDDARENRKGHSVL
                     ELKEARFGPDGVPVIHRYLDSFPFPYYLIVHHLEDLPGALAALLRTWFAEVNS"
     gene            complement(<1452183..>1457670)
                     /locus_tag="MYCTH_2126564"
                     /db_xref="GeneID:11507432"
     mRNA            complement(join(<1452183..1454309,1454366..1454638,
                     1454692..>1457670))
                     /locus_tag="MYCTH_2126564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662758.1"
                     /db_xref="GeneID:11507432"
     CDS             complement(join(1452183..1454309,1454366..1454638,
                     1454692..1457670))
                     /locus_tag="MYCTH_2126564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662806.1"
                     /db_xref="GeneID:11507432"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2126564"
                     /translation="MPSKRKRDILEGFDPNKSDSEDENFDPTEVRPTSRRSAKKSRSS
                     KSKGRRKRSNRYRGSDIDDDDEVSDSEDESFGEYEDEQDDEDEDLPVGATGRRMRRAA
                     VKALSYKESSEGEEDEDEDSAKDGDGDEEEAKETSPKKPAGRPSRIVVLKTSQSARQA
                     AKRGNEEPAPNPPPTRRTRARTEEVEEPFLELSNSGRHAQPARASRSRSPEAVARTAR
                     TTRGGKGLKNPPPIEEATQETETKEDPDQAMESPDELALTKREDEPDNQDEEGGAERG
                     GEEEAAMEDKQEDQPEGEGPAAEEEDDDDAPYTRRTRASRATAAASAAAEESNAEPPT
                     TRAGGRRLRQRSGLRSKKGTQEPSSDFEPGDESGEGDDSGSEASKNGDASENESTPTP
                     RGRGNRARSRRSRRKKDDSGDEDIELDRNEMAEELEELRESSRSRPRRSRRRSPSIQY
                     EEPISKKRRTKPVDYSIPAIDPAVLEAEDDDEPVATPARNRRSGKGGSSSAWERTLNT
                     TYGPFGGGGGPGSLLGGPWGTGATGGVDSDSSDDEMVQRSGIGGGVGMTPTTAAPAVG
                     LYNPPVGQTHNADGVGGIGGGTPQVGKVKNQKAFADADPLGVDMSVDFSKVGGLQSHI
                     DQLKEMVQLPLLYPELFLKFHVTPPRGVLFHGPPGTGKTLLARALANSVGSGGRKISF
                     YMRKGADALSKWVGEAEKQLRLLFEEARRTQPSIIFFDEIDGLAPVRSSKQEQIHASI
                     VSTLLALMDGMDGRGQVIVIGATNRPDNIDPALRRPGRFDREFYFPLPDLEARRAIID
                     IHTKDWGISDEFKNSLAENTKGYGGADLRALCTEAALNAIQRTYPQIYSSKEKLVVDP
                     DKITIHASDFMLSIKKMIPSSERSTSSAASPLPRVVEPLLRNQYRAILRVLDNILPRP
                     KKTTALEEAMYEPFEDADHGFGREAMHQEFERSRIFRPRLLISGVPGMGQNYLASAIL
                     HHLEGVHVQTMDLATLLGDGRPMEQVIVSRFTEVKRHKPSVIFIPGVDIWWSSLTEAA
                     ITTFTTLLRSIPPSDPILLLGTAECPPEQLAPEILKELFGFSKKNRAVVERPERENRL
                     EFFENIISHLKKSPTEFPDPASRKKRVLEDLPVAPPPPPRTLTAEEIKAQRKADLRAL
                     NHLKIRLQPIMDQINRKYRKFRQPVIPFSQIAYLFEEADPNYVWPDIGNAEKRPYEIA
                     KDAEGTEGIRETATGKFFYNLETTTIEERLANGYYARPIDFYKDINKLYLDAKNIGDR
                     DRTLKANELRTNVEVDVDEIAQALAAQGMRFDEIYERQLQRAREAEEKARKKKALQPV
                     VDMIQSEAHGDVDSDSQGPVGIGLPLTQGVRTTTAARFQPIMSPESKGHGASTDSHRL
                     TNGTSGPSQADGEDVQMGGLDDDTQPTGPRPDLVSPLQWPHLGSRLPLGDSTRATAGT
                     QFSQRSAVTSIPPGVSPSAILNEASTTKTSDLSTSRGANNWSTQRSDTQRTNGVAHNQ
                     DESSLLLDTQLHTQQPGQSQSGQFIGPLSQSSSSGKEWPHSQADAMAKGMLQPRNGMG
                     IMGPPPGSGVGSIRVPEDNGPPSSQPQPRRPSAASLGNILNEDRSSNHASHLGSGASN
                     STGPGAHTPKSGSGPSSGGSGSDSKAPSGSAHASVGRGSGANSLHQSGSTNPSQQPVI
                     YEGSLYEFLQTLADRTSGCSVEQLEQIYRELMDEIWKTRHEWNRMTVLNRLISVFNDT
                     IGDIELVQGALVDSQKQKGGKEAAVAGEDGGGEVLDGVDGVGGVEGSQSQSQSQGNAA
                     EEPWFYLK"
     gene            complement(1458990..1460546)
                     /locus_tag="MYCTH_2303859"
                     /db_xref="GeneID:11507433"
     mRNA            complement(join(1458990..1460146,1460207..1460546))
                     /locus_tag="MYCTH_2303859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662759.1"
                     /db_xref="GeneID:11507433"
     CDS             complement(join(1459304..1460146,1460207..1460422))
                     /locus_tag="MYCTH_2303859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662807.1"
                     /db_xref="GeneID:11507433"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="JGIDB:Spoth2_2303859"
                     /translation="MALHSSAHRTVDYTAREERSKSVDTVLNHFLAVIDPRTGEVEVV
                     QAKKMVVRGTVRSKQAPSEAMQVSNARPTHSEMRMELGETFGTKKAKKAIQAVAENAM
                     LAAKSRGKLGEDDRALVDTIRDSSQHMATREELQAVVDMARPVPRGNFDADEIQDVYV
                     PAQIIGAEVLNAVPVMDWQEKVRKLEPVQVPARFVAHRIVRVAGNEDDVQRLKLLRYL
                     LWVITFWSITRQGRERGTRSIARRDDLREALAPAPEVVIENIRRKFSDNGVMRKTHID
                     LLMTHCCVFASIIDNFEVNTLDLREDLKLEQKQLNQYFMEIGARIKQTKSGDKVNHIA
                     KLALPLQFPKMRQPAKRR"
     gene            complement(1461108..>1461879)
                     /locus_tag="MYCTH_2133976"
                     /db_xref="GeneID:11507434"
     mRNA            complement(join(1461108..1461665,1461723..1461798,
                     1461855..>1461879))
                     /locus_tag="MYCTH_2133976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662760.1"
                     /db_xref="GeneID:11507434"
     CDS             complement(join(1461597..1461665,1461723..1461798,
                     1461855..>1461879))
                     /locus_tag="MYCTH_2133976"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003662808.1"
                     /db_xref="GeneID:11507434"
                     /db_xref="JGIDB:Spoth2_2133976"
                     /translation="KFSSRSYIQDESEVEKEARSPPQAQEKKDEGAVQINAQRHSTST
                     SPRHQIGHPVG"
     gene            1462907..1463566
                     /locus_tag="MYCTH_2303861"
                     /db_xref="GeneID:11507435"
     mRNA            join(1462907..1463101,1463156..1463202,1463261..1463566)
                     /locus_tag="MYCTH_2303861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662761.1"
                     /db_xref="GeneID:11507435"
     CDS             join(1462931..1463101,1463156..1463202,1463261..1463552)
                     /locus_tag="MYCTH_2303861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662809.1"
                     /db_xref="GeneID:11507435"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2303861"
                     /translation="MDRTIGNGGHAVVFLATELETGKHVVCKVHDIGRHSRTSKEVER
                     IRQEASLLSTLDHPNILSIRAAFETEQTIYVITELATGGDIFSLLLRYQTLGEWVIRS
                     IIRQVLRGVAYIHSKGVAHRDIKPENILCGVTPQVPYRIMLSDFGDSGICGFGRLKSA
                     VGTRFYRPP"
     gene            1463574..1464298
                     /locus_tag="MYCTH_2303862"
                     /db_xref="GeneID:11507436"
     mRNA            1463574..1464298
                     /locus_tag="MYCTH_2303862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662762.1"
                     /db_xref="GeneID:11507436"
     CDS             1463664..1464173
                     /locus_tag="MYCTH_2303862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662810.1"
                     /db_xref="GeneID:11507436"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2303862"
                     /translation="MLTLQLFLGYQELPNLDSTVFRNQRDVDRYLGLIFTSLEPRGRI
                     SDAAQRFVCGCLAYDSGKRPTARQAFYHDWLQSPASDRRTFKRLEAANVLSWRPQRVK
                     YPVIENLTNKVCGRDCRDHPNRVKEGNNNEVSPHFMTSVPSGEDVRKEDKKDDESMRA
                     HGGGGPTAW"
     gene            complement(1464299..1465355)
                     /locus_tag="MYCTH_2303864"
                     /db_xref="GeneID:11507437"
     mRNA            complement(join(1464299..1464729,1464935..1465355))
                     /locus_tag="MYCTH_2303864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662763.1"
                     /db_xref="GeneID:11507437"
     CDS             complement(join(1464424..1464729,1464935..1465234))
                     /locus_tag="MYCTH_2303864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662811.1"
                     /db_xref="GeneID:11507437"
                     /db_xref="JGIDB:Spoth2_2303864"
                     /translation="MKRFQLMQRVNVEGLYGVVQEALPHLKARAGGSAESAGERRGAR
                     SIVVCPPIYSRFFRGKTAYAIGKVGMSVLVKGLGMDFERERLVEQGLGIAGLWPAVAI
                     ESAATEQFTSKDPSYAKDLRKPTIFSDAVLAMLRVPAAVVNGQLELDEDFLRKQAGIT
                     DFSKYSVVPGATPRRIMPAELPDLTVKEQDDEGMRVDSSRL"
     gene            complement(1466097..1467789)
                     /locus_tag="MYCTH_2303867"
                     /db_xref="GeneID:11507438"
     mRNA            complement(join(1466097..1467085,1467149..1467789))
                     /locus_tag="MYCTH_2303867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662764.1"
                     /db_xref="GeneID:11507438"
     CDS             complement(join(1466413..1467085,1467149..1467483))
                     /locus_tag="MYCTH_2303867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662812.1"
                     /db_xref="GeneID:11507438"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="JGIDB:Spoth2_2303867"
                     /translation="MSTDPIPDDEDYVSEEDSDFAPDDAPAEESCVSDDDEDEPADAE
                     QPIPAKRKREGGDDAAEDAGFENSGDEAIIEKGKKRLKKSKKQDDEQADEDEGGEGGL
                     IKTRRMRAAEKAEKRTAVASGPVTIDVDALWAQMISEPVVGRRSLETAAAAQPRADGN
                     KPPSQPQSTPSKPDESDLIRIKRTYNFAGKVHTEEKLVPRDSAEAKLYLAEKGADAAS
                     TDDDPAATQKRMPRKAFRSVFEPVAAENLSQRSDLNLAMSERLKARERAKEAEAKKLN
                     TVEKSRMDWAGFVDREGIKDELELAGKSKHSFAARQEFLARSEAIREEEARRLRMAGR
                     A"
     gene            1468441..>1469819
                     /locus_tag="MYCTH_81258"
                     /db_xref="GeneID:11507439"
     mRNA            join(1468441..1468530,1468815..1469121,1469196..>1469819)
                     /locus_tag="MYCTH_81258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662765.1"
                     /db_xref="GeneID:11507439"
     CDS             join(1468466..1468530,1468815..1469121,1469196..1469819)
                     /locus_tag="MYCTH_81258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662813.1"
                     /db_xref="GeneID:11507439"
                     /db_xref="JGIDB:Spoth2_81258"
                     /translation="MSSTSVLTPEEKEHFLTHGWIKISNAFTREQAEEVTANMWTRLG
                     MDPNDQSTWTRLRTNMPGHRKFDPAVFAPRAWAAICELCGGEDRIDPASREWRDSLIV
                     NLGDAKHDGKPIPPQDLPDWHVDGDFFVHYLDSREQALLVTPIFTDIVPNGGGTIICP
                     EAIPKIAKHLYDHPEGVSPRMTPRGEPGFEKGQHEDLSFFRNVAKSCSNFVEATGQVG
                     DVYLMHPLMLHAPSSNALRRVRIITNPAVSLKTEHCFDREDGNYSLVEQVTLRALGKD
                     RLPGWKATGPREARVPERVRIQEKMKQEELKRLAELEAKKAQQAKEGQQTVSAAA"
     gene            1470218..1472363
                     /locus_tag="MYCTH_2303871"
                     /db_xref="GeneID:11507440"
     mRNA            1470218..1472363
                     /locus_tag="MYCTH_2303871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662766.1"
                     /db_xref="GeneID:11507440"
     CDS             1470317..1472077
                     /locus_tag="MYCTH_2303871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662814.1"
                     /db_xref="GeneID:11507440"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2303871"
                     /translation="MSDSENDDYRVEEEPVLGSDDPLRVFVPKSFGKTTKEANVAAQI
                     EQTRRQVEKPAAPKQKRPASDSDDRDDSDSDDSESDEEDVAEKFPVTHEMVLKTHERA
                     VTSIALDPAGSRMVTGSLDGKVNFHDFPAMTPTTLRAFKSIDPWETKKSAPADSHAIQ
                     HLEFSRHSGSVFLCVTAHPQAKIMSRDGGIVTEFVKGDMYLRDMNNTKGHVGEVTSGT
                     WHPADPNFCVTAGSDSTLRIWDVNNKRSQKDVIVFKSKAAGSAGRTRMTAVAWGASAQ
                     GNSPVLVSAALDGSLVMYSGNGPFTRPAAEIKDAHRPDTWTGGIDISADGRMVVTRGG
                     DGLIKLWDTRKFKQPLVKVDHPSTSDRYPTTNIKYSPDSRYIITGSASGHLHFLNPAN
                     LRPEHVTPITPGIPLITVNWHPKINQILTGSANAETRVLYNPSLSTRGALEVMSRAPK
                     KRHVDDDPAFTMDQSQLGLSPDAIVTPGALPSAKRGAGGVSASGKTSRDRYRPQVQQI
                     TPFMRSQPDEKHIEENIPLSRMLHEDPREALLKYAEVAKKDPVFTSAWAKTQPVTQYA
                     ELSDEEDEAKEGRDAKRVKR"
     gene            complement(1472358..1472429)
                     /locus_tag="MYCTH_t96"
                     /db_xref="GeneID:11507441"
     tRNA            complement(1472358..1472429)
                     /locus_tag="MYCTH_t96"
                     /product="tRNA-Gly"
                     /note="Anticodon: TCC"
                     /anticodon=(pos:complement(1472394..1472396),aa:Gly,
                     seq:tcc)
                     /db_xref="GeneID:11507441"
     gene            <1473443..1478650
                     /locus_tag="MYCTH_115909"
                     /db_xref="GeneID:11509867"
     mRNA            join(<1473443..1473532,1473616..1477641,1477736..1478650)
                     /locus_tag="MYCTH_115909"
                     /product="SNF2-family ATP dependent chromatin remodeling
                     factor like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662767.1"
                     /db_xref="GeneID:11509867"
     CDS             join(1473443..1473532,1473616..1477641,1477736..1478020)
                     /locus_tag="MYCTH_115909"
                     /note="Contains conserved domains: QLQ domain, HSA domain,
                     P-loop containing Nucleoside Triphosphate Hydrolases,
                     Helicase superfamily c-terminal domain and a Bromodomain.
                     Contains conserved domains: QLQ domain, HSA domain, P-loop
                     containing Nucleoside Triphosphate Hydrolases, Helicase
                     superfamily c-terminal domain and a Bromodomain"
                     /codon_start=1
                     /product="SNF2-family ATP dependent chromatin remodeling
                     factor like protein"
                     /protein_id="XP_003662815.1"
                     /db_xref="GeneID:11509867"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006562"
                     /db_xref="InterPro:IPR014978"
                     /db_xref="JGIDB:Spoth2_115909"
                     /translation="MASVQMPPAVQPGSAIPAGMTQQQAQEVYMRFQQMKKQGVPSND
                     PEFIKTQSILAALQRHSELRKQQLQMQQQMQQQQQQQQQQQQQAMQNGANGIVNGTQP
                     GRPGQPATTQTTMPPSTTSLGASALPATSGAPAANTTTAAPAQGQASQFTQAQLNLLW
                     TQIKAFRMLGKNAGVPIQMQRAIFEHRARRRMSLAKQGTQSPTTANPPSDAPSQDGPK
                     PGPNGADAQAPSVPQPKSFKTVKSPYDGGLVRQTISYIDHGRRKNRLIIPGIFPTGID
                     FEQLRADREKIVFNRMSARYAELKSLPGNLAHWDASQDSLVADDTAKRKAIIEMKKLA
                     LYSKQRALRDRIGKQMMHYDNLAMTTNRAAYRRMKKQNVREARVTEKLEKQQRDAREN
                     RERKRHIDFLQAVYNHRNEVLNAGQVQRSKTQRLSRLMYAHHFNIEKEEQKRIERTAK
                     QRLQALKANDEEAYLKLLDQAKDTRITHLLRQTDGFLKQLASSVRAQQRQAAERYGEQ
                     IDIPPDESDIDEDDEESGRKIDYYAVAHRIKEEVTEQASILVGGTLKEYQLKGLQWML
                     SLYNNNLNGILADEMGLGKTIQTISLITYLIEKKHQQGPYLVIVPLSTLTNWNLEFDK
                     WAPSVAKVVYKGPPNARKMQQEKIRQGKFQVLLTTYEYIIKDRPLLSKIKWFHMIIDE
                     GHRMKNANSKLSATIQQYYSTRFRLILTGTPLQNNLAELWAMLNFVLPNIFKSAKTFD
                     EWFNTPFANTGGQDKMELTEEEQILVIRRLHKVLRPFLLRRLKKDVEKDLPDKTEKVI
                     KCKFSALQARLYKQMVTHQKIAVSDANGGKTGARGLSNMIMQLRKLCNHPFVFDEVEN
                     QMNPANVSNDLLWRTAGKFELLDRILPKYKATGHRVLMFFQMTAIMDIMEDFLRFRGL
                     HYLRLDGTTKSEDRSELLRQFNQPDSPYFMFLLSTRAGGLGLNLQTADTVIIYDSDWN
                     PHQDLQAQDRAHRIGQKNEVRILRLISSASVEEKILERARFKLDMDGKVIQAGRFDNK
                     SSETDRDAMLRTLLETADMAESGEQEEMDDDELNMILARNEEELAIFQKLDEERSRDP
                     IYGTAPGCQGVPRLMTEDELPDIYLNEGNPVEEEVEMALGRGARERTKVKYDDGLTEE
                     QWLMAVDDDEDTPEAAAARKAARREKRELNKLRRKGLLTGSMENSPAASRASTEDAET
                     PVKKRGRKPGSKNQDKRKAEEGDDEPPAKKRRGPQGRPRAVGLNGSDNRLAPEVREKL
                     QKSLKRIFDGLMNLEVDDDEPQENPDGDDDGPPKRLIIGPFVKLPPKRDWGDYYLIIA
                     NPICMNDIQKKIKREEYQSLGDMRKDLDLMVSNCRTFNEESSGICQDVNLIETYFKEQ
                     FEKELSENPDLRALEDPSAAAAAGSATKDGSVAPSTAATDGTPQPTPSGPTRIKLVSN
                     SSSAGAGASASNGGGSQANGGSGGAQSDEE"
     gene            1479237..1479347
                     /locus_tag="MYCTH_t82"
                     /db_xref="GeneID:11507442"
     tRNA            1479237..1479347
                     /locus_tag="MYCTH_t82"
                     /product="tRNA-Thr"
                     /note="Anticodon: TGT"
                     /anticodon=(pos:1479270..1479272,aa:Thr,seq:tgt)
                     /db_xref="GeneID:11507442"
     gene            complement(1479526..1481665)
                     /locus_tag="MYCTH_2303876"
                     /db_xref="GeneID:11509853"
     mRNA            complement(join(1479526..1481211,1481290..1481665))
                     /locus_tag="MYCTH_2303876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662768.1"
                     /db_xref="GeneID:11509853"
     CDS             complement(join(1479895..1481211,1481290..1481484))
                     /locus_tag="MYCTH_2303876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662816.1"
                     /db_xref="GeneID:11509853"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_2303876"
                     /translation="MDSSAVDNDTRGWILSIFSGLACILGASVVCIDLPIRLIPSKRH
                     FRIQESNAFLASSLSLSFGVMLFSALYSMLPSAMRYLAKDDWDEHTAGFLMMGCFIGG
                     FIGIQLVSRILHQYMPSHVVDCDHTHENLADEELGQGNHHHHQHHHHHQSLSKVSSHQ
                     AGDDAPHMVEMTDAVTESTPLIPPVSQAPINGHIHTEVLDGDAAPAAEAVTHFDGSQR
                     RALTQIRPPLADVRTRVMSFFKDTKANCDEDGPCYGYSDPCGQECFKHIGTRSALSRT
                     ATSLTENGDSGLESAVSTPRYRIVRTPSHPHDGDHHHYHHNAHVHTHSHDGDLECPED
                     TEAQHHHHVPTNAFLSIGLQTVIAIALHKFPEGFITYATNHASPSLGFSVFMALFVHN
                     IAEGFAMALPLYMALGSRVKAIFWSSLLGGFSQPLGATVAFAWFKLAKNTNLDIDSTA
                     YACLFAVTAGIMVSVALQLFVESLSLNHNRNLSIFFAFLGMTLLGVSNALVSH"
     gene            <1483359..>1484444
                     /locus_tag="MYCTH_51411"
                     /db_xref="GeneID:11507443"
     mRNA            join(<1483359..1483484,1483677..>1484444)
                     /locus_tag="MYCTH_51411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662769.1"
                     /db_xref="GeneID:11507443"
     CDS             join(1483359..1483484,1483677..1484444)
                     /locus_tag="MYCTH_51411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662817.1"
                     /db_xref="GeneID:11507443"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="JGIDB:Spoth2_51411"
                     /translation="MSKATIAVIAAVSAGAGAAATAAMYSLRKSETTATTTTSATTYG
                     FPGPVADLASRQALISSYDRRTRNPHWVAEHITPASLNMRDGDRKNSNFLEDPAIPEK
                     FQAKLKDYFRSGYDRGHQVPAADCKWSQTAMDETFYLSNMCPQVGDGFNRDYWAHLED
                     FCRRLTQRYPSVRIVTGPLYLPKRDPQDNKWYVKYEVIGNPPNVAVPTHFYKVIYAEE
                     QTAPGGKVALAAFVLPNAVIPNDKPLADFEVPLEAVERATGLEFATKLPPSRRKRLCA
                     ETSCSIIVKEYAERQKAFAKK"
     gene            complement(<1484963..>1487294)
                     /locus_tag="MYCTH_49818"
                     /db_xref="GeneID:11507444"
     mRNA            complement(join(<1484963..1485047,1485108..1486810,
                     1486895..1487010,1487195..>1487294))
                     /locus_tag="MYCTH_49818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662770.1"
                     /db_xref="GeneID:11507444"
     CDS             complement(join(1484963..1485047,1485108..1486810,
                     1486895..1487010,1487195..1487294))
                     /locus_tag="MYCTH_49818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662818.1"
                     /db_xref="GeneID:11507444"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_49818"
                     /translation="MAHEGRDHGDRGFGFGGGGVGGHDGPPPRVRGRRPVTDYGATIV
                     HWMRHRQPRYKGSFAGETERPSISYIVDMLPPHARTTSAADSVPSRHLHSSLNKIKHP
                     INVVRWTPEGRRLLTASSSGEFTLWNGTGFNFETIMQAHDSAIRALAYSHSDDWLVSA
                     DHDGIIKYWQPNFNNVESIRGHTDPIRDLAFSPTDVKFVTASDDSTLRIFDFAAGAAE
                     STLTGHGWDAKSCDWHPTKGLIVSGSKDHLVKLWDPRTGRCLTTLHGHKNTITKTLFE
                     RVRGQCLATSARDQTARVFDLRMMRDICLLRGHDKDISTLTWHPIHPNLLSTGGSEGS
                     LFHYLLDEPNTPPGHSASVAPYDAADPASAPAQTIYPAHRIPYAHDFAIWSLDWHPLG
                     HILASGSNDRITRFWARARPGEADNFNDRYHIGEAAAEAQGTWDRRGHRHMRQVEEEQ
                     ELEDEMDGLVDQKMPIKQPPGSLPGLGTAASSSSAAAAAAAAAAAAGGAIPGLPGLVP
                     PPPPPPPPGTVIPGMAGPNGNGSGSGSGSSAAQLPFPLPPPPPPPAIASMLVGDGKNP
                     PDFAAIAEMMKKHGIVPPPPPPPPPGRVLPPGLIPPPPPPPGFPLPHGFPPPPPHLAA
                     GAAAGAGAGGDQHGSGGRRRAPLPSQEESLRMEQSKGNYTRVR"
     gene            1488970..1491436
                     /locus_tag="MYCTH_2303878"
                     /db_xref="GeneID:11507445"
     mRNA            join(1488970..1489520,1489596..1489636,1489773..1490595,
                     1490680..1490868,1490955..1491436)
                     /locus_tag="MYCTH_2303878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662771.1"
                     /db_xref="GeneID:11507445"
     CDS             join(1489184..1489520,1489596..1489636,1489773..1490595,
                     1490680..1490868,1490955..1491193)
                     /locus_tag="MYCTH_2303878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662819.1"
                     /db_xref="GeneID:11507445"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="JGIDB:Spoth2_2303878"
                     /translation="MDADASKTVAEATGVEGPRDGTSTRAVNRRSGAPVTLEPSDPHA
                     AARDTITTTTQPNGITNGSADANPRRPIRSKYRHVYAVHSKSKPSCLSHDATETPSFI
                     GFRNLMVIVLVAANLRLVIENIQKYGVLICIRCHDFHPNDVRLGLALYVLIPCHLMIA
                     YLIELVAAANARRSRAKSQKRDGSSSPTEDESRRFLRTWRIIRIAHTINVSAALAITS
                     YVVYYYIHHPLIGTLSELHAIIVWLKTASYALTNRDLRHTFLHPAKGELDALPDIYAQ
                     CPYPANITFSNLAYFWWAPTLVYQPAYPRTDRIRWVFVAKRVGEVACLSAFIWFASAQ
                     YATPVLRNSLDKIATLDYMSILERLLKLSTISLVIWLAGFFALFQSFLNALAEVMRFG
                     DREFYEAWWNSESLGTYWRTWNKPVYQFFHRHVYSPMRSRGWSQFMSSTTVFFLSAIL
                     HELLVGVPTHNLIGVAFLGMFLQLPLIMLTARLERLKSANGRLLGNVIFWVSFTIFGQ
                     PFAALMYFYAWQAKYGSVSKIPPAAHGATCPVAA"
     gene            complement(1491392..1492952)
                     /locus_tag="MYCTH_2303882"
                     /db_xref="GeneID:11507446"
     mRNA            complement(join(1491392..1492474,1492822..1492952))
                     /locus_tag="MYCTH_2303882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662772.1"
                     /db_xref="GeneID:11507446"
     CDS             complement(join(1491679..1492474,1492822..1492862))
                     /locus_tag="MYCTH_2303882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662820.1"
                     /db_xref="GeneID:11507446"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="JGIDB:Spoth2_2303882"
                     /translation="MNDASRPLPWSPDRFSRHQRGEHDDDDAAAADAAMLPYLRHQPK
                     SLSGIAARSFCLGIAFAVGVTGTVAILVLTASPLWRLPFFLAALALFHFLEFWTTAAY
                     NTRAADVHSFLLTSNWPAYAIAHSFASLECLLTSLLWPPAGGGGGGGVLARRGAVPLV
                     GAGLALVVLGQAVRSVAMIHAGQSFNHVVQYRRRSGHVLVTTGVYGLLRHPSYFGFFW
                     WALGTQIVMGNLLSLVGYAVVLWKFFSSRIRIEEDYLVAFFGQEYVEYRKRVPTWIPF
                     VP"
     gene            complement(1493378..1494258)
                     /locus_tag="MYCTH_2303885"
                     /db_xref="GeneID:11507447"
     mRNA            complement(join(1493378..1493634,1493703..1493996,
                     1494075..1494258))
                     /locus_tag="MYCTH_2303885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662773.1"
                     /db_xref="GeneID:11507447"
     CDS             complement(join(1493514..1493634,1493703..1493996,
                     1494075..1494088))
                     /locus_tag="MYCTH_2303885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662821.1"
                     /db_xref="GeneID:11507447"
                     /db_xref="JGIDB:Spoth2_2303885"
                     /translation="MEAPSRVRRDIPADYTVPPFPSLFWPPQSAKIILYELDEMWKFT
                     LFWTLILYGLFHLGAVGVAMLMQGGKRMSSWKYLWLVPLVYALIAGAEALIAGTLVGL
                     IVGASYLVGGFYMSTWIPFVWGWVNVLVLIVSSFRIQGGL"
     gene            1494415..1497401
                     /locus_tag="MYCTH_2303887"
                     /db_xref="GeneID:11507448"
     mRNA            1494415..1497401
                     /locus_tag="MYCTH_2303887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662774.1"
                     /db_xref="GeneID:11507448"
     CDS             1494630..1496858
                     /locus_tag="MYCTH_2303887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662822.1"
                     /db_xref="GeneID:11507448"
                     /db_xref="JGIDB:Spoth2_2303887"
                     /translation="MSIDRLLTTVLQLYQDVHDDERTEQIYGSTALLLTNLSNPLNLS
                     LLTSQLLIAPAIWGRRDGMRTCYRIISIFNTAAIHVRRNELEREQSRYKNNKSKNNND
                     NNIQPARTGGGGLGSDAWAAAVLKGADDQSGRWQHLLVFSGVLMGMEGGQRRSLSRSM
                     RGTVERAVVTATNLAIRNRAPEPPAPSGPVALALNYAFPLLSESSRAGLDCDALVPIA
                     LRAMLGGDGLQDGVLLTSMDQDVRQAEDKFMWLESSPSFLHLRQLEQRPLVAGLGPLS
                     TLLSYAVRHARDSAVVLQLQDDLVAFTSGLLQYWQTNKLCELDASEETIFLTQETLQT
                     TWPALWQFLKRIMYASVAILHSIVARSLLDRRLKHHTVEPTVATKTLHALRNLYFISS
                     RNGSDAFQVYTFTYLTSLDILSRYGPACAAFLRSVLPPSSASGIPPHPLHRTLDLFYL
                     NTAEHLPLNLPPQDCEALIIAPATPYLTTPPSLFSSSSSSSSSAPSALVPLFEAAHSA
                     VLAVLSCPHNAPLTTRVVPFYADALFSSFPARISPRQFRLAFRTILQILSPPFAVSWE
                     QVELGECLLEMVRYRVRDAGRDILPPAPPPASSSSSSSSSSSSSSASGDAGQQRGAER
                     EEASEQSTLVLTLIDALPFLRMDIFEEWLGLVAAAVHEVVGERLKEAVKRRFWEVLGS
                     GEMDVEHAAVAAAWWGTKGGREAVLFGRGIAPHGARQGQGREEPFVMSGAIVKEGRES
                     RL"
     gene            complement(<1498106..>1499035)
                     /locus_tag="MYCTH_2062613"
                     /db_xref="GeneID:11507449"
     mRNA            complement(<1498106..>1499035)
                     /locus_tag="MYCTH_2062613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662775.1"
                     /db_xref="GeneID:11507449"
     CDS             complement(1498106..>1499035)
                     /locus_tag="MYCTH_2062613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662823.1"
                     /db_xref="GeneID:11507449"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2062613"
                     /translation="SLSFRKHQTLQRHVRVAHLGLAAFVCAAEEGCRAGFDTAGALRR
                     HVEREHGEVRFWCEECAGDGAGDGDVRRVGFRTLPQLQAHMRKEHVDCLFCDVRCGSQ
                     ADLERHVDMYHSGTTVEDRKTVGCTWEGCGKKFTRVSNLNTHIRTAHEGLRFVCGQVD
                     TYQTDDIADWNWREEGCGQTFVSKLKLEEHVRYVHLGRKRPPNQYTVKSARPGEEDEM
                     SAAVPTRTIPCSVEGCGAKFVRHADLDKHLQKNHPISQEDVIDPRLQEADGNREQFWI
                     ESAIPAVEEPSFDSDWAEMRRLIDLDALVDAKE"
     gene            1500110..1501346
                     /locus_tag="MYCTH_2138933"
                     /db_xref="GeneID:11507450"
     mRNA            join(1500110..1500168,1500288..1500572,1500740..1500859,
                     1500929..1501346)
                     /locus_tag="MYCTH_2138933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662776.1"
                     /db_xref="GeneID:11507450"
     CDS             join(1500131..1500168,1500288..1500572,1500740..1500859,
                     1500929..1500965)
                     /locus_tag="MYCTH_2138933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662824.1"
                     /db_xref="GeneID:11507450"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="JGIDB:Spoth2_2138933"
                     /translation="MSDYGADDDREPLNDEPAFDEDPDEYYEPEPEPADEDEAAREAE
                     QDGEHQDADHVIASGDPNATANVGKGSEKSHKDKKIPNDQRTTTPFMTKYEKARILGT
                     RALQISMNAPVLVDLEGETDPLQIAIKELREKKIPLIVRRYLPDGYYEDWTCEELLQ"
     gene            1501641..1501732
                     /locus_tag="MYCTH_t83"
                     /db_xref="GeneID:11507451"
     tRNA            1501641..1501732
                     /locus_tag="MYCTH_t83"
                     /product="tRNA-His"
                     /note="Anticodon: GTG"
                     /anticodon=(pos:1501674..1501676,aa:His,seq:gtg)
                     /db_xref="GeneID:11507451"
     gene            complement(<1502164..>1503993)
                     /locus_tag="MYCTH_94171"
                     /db_xref="GeneID:11509854"
     mRNA            complement(join(<1502164..1503341,1503423..>1503993))
                     /locus_tag="MYCTH_94171"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662777.1"
                     /db_xref="GeneID:11509854"
     CDS             complement(join(1502164..1503341,1503423..1503993))
                     /locus_tag="MYCTH_94171"
                     /note="WSC carbohydrate-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662825.1"
                     /db_xref="GeneID:11509854"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_94171"
                     /translation="MAPFKMVAAAAALALVGHVQATEIPLPPCLDPFQPFVYSGCFGE
                     SAGTQLLPFRPPLDQQEGTVEKCVATCKGNGYRYAGLVYYGVCYCGQTVNGPQVDDSQ
                     CDLPCNGNKSETCGGNGHFSVYSDPTFLPVDHVTVADYEPLGCWTDDSSLGRALTYRQ
                     VQLDSATLTTEKRLQACRDGGFPFAGTEYSGECYCGVVIGNDTYAAPADECDMPCNGN
                     ADETCGGRSRLNLYVAEELGSLQPCGYQPSVSSSTSLPPSSTVTSTTSSSTSSSTAPP
                     ETSTITSTSTTPATSTTSTSSSACVSTTVVPPQCEYKCGKWCSSPLPDWNDPKTCKNA
                     WSSCHVQVASCFKQAGWPDVLDCFEFSQWCADIAKYCDSNPRGGCRKDDFWGKKPPKG
                     GAHPSTTITVTATCAPATGTEPPATSTKPPASSTTTRCPIPTPTNICIQPSSPLYGYG
                     PGKPVGGIDMPVVSCNDLPNEWAQFPFKGYTDRDSRNCRKYQRNQCTNVCADACKEQY
                     EDCVNVYAEGCKRKPHGRRDVGYFEFRGSVEKRTFGWNDDFSGAVNKCKAQYSDCLRV
                     NRGVTGAGKCTKPCGW"
     gene            complement(1506803..1510367)
                     /locus_tag="MYCTH_68011"
                     /db_xref="GeneID:11507452"
     mRNA            complement(join(1506803..1510121,1510178..1510367))
                     /locus_tag="MYCTH_68011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662778.1"
                     /db_xref="GeneID:11507452"
     CDS             complement(join(1507200..1510121,1510178..1510288))
                     /locus_tag="MYCTH_68011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662826.1"
                     /db_xref="GeneID:11507452"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_68011"
                     /translation="MVLLVELAVEQKKGKLAKDALYQYKNIAQNTNVGTIELVLKKFI
                     ELAAEKVTAAQQKADEVQSSIEATSSVDDLEASETPESILLATVSGEQSKDRTDRAIV
                     TPWLKFLWEAYRTVLDILRNNARLELLYQSTAMQAFDFCLKYTRKTEFRRLCELLRNH
                     VQTAAKYSAQMHAINLNDPDTLQRHLETRFQQLNVAVELELWQEAFRSVEDIHTLLSL
                     SKRPPKNVMMANYYEKLTRIFLVGENYLFHAAAWARYYNLLRQSAAMMAAGQSKKSDN
                     PPASEADLQKAATFVVLSALSIPVISTSRSRGAMVDFDEARKNKNSRLTHLLGLSQAP
                     TRATLFRDALSKAVLRRASPQIRDLYTILEVDFHPLSICQKISPILALVGADEEMQKY
                     IVPLQQVILTRLFQQLSQVYETVDLDFVESLAQFPEPFQVDRATIEKFIMNGNKKGDL
                     AIRMDHATGVLSFDVDVFSSAKAVHAGSAAGSAESETGSVQRLQSTPSQIVRSQLTRL
                     AEVLYTTCRYIDPSFNAAQIKARDAALARAKAGAEKEHLEILARKDVIQKRKDKASEL
                     QAQREKENARKKMLQEQALQQAEAQRLAEEQRIREQKRLASEREQIKKREVENMLKDM
                     KLDDVELEDLDNLDSNKIRMIKLQQLEREKNTIAEKLRLTGKRLDHLERAYRKEEAKK
                     LPEDYAKQRERDLAAYELMKAQTLKEAEIKHKEDLELKHRLSRLMPYYEAFRADLHER
                     RRDMFEKRRRDAERELEKAVNQRRKEYRERKLREKREREEKERALREAEERAEREREE
                     ERKRQEARKEELARIRKEREEERERAREAQARQQQREEEAMARRRAEKAAAAAAAAMP
                     IREREPIASAASGAGGPPRLTIGGKTPSWREREAAKAAAAAAGASAGPAAPPAMERTD
                     SSDRAGGPPRLALAGNKPSWREREAAKAAAAAAAAAGGSAPPERGSLPPRVPSGRGVP
                     LDRVGSGRGGERDNGPPPEPLKPSGAPGKYVPKFRREG"
     gene            1511926..1513490
                     /locus_tag="MYCTH_2315098"
                     /db_xref="GeneID:11507453"
     mRNA            join(1511926..1511996,1512280..1512690,1512754..1513490)
                     /locus_tag="MYCTH_2315098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662779.1"
                     /db_xref="GeneID:11507453"
     CDS             join(1512530..1512690,1512754..1512874)
                     /locus_tag="MYCTH_2315098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662827.1"
                     /db_xref="GeneID:11507453"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="JGIDB:Spoth2_2315098"
                     /translation="MPQYTSRDVGDPSQIKKTKQSMADLKLRRLTELNSRLREDLERE
                     RIPVSQAAKSIIAYCNSTRDYMVPSVWGPVPKGEDPYAPQQSGGCCIVM"
     gene            1513475..1514718
                     /locus_tag="MYCTH_2303896"
                     /db_xref="GeneID:11507454"
     mRNA            join(1513475..1513906,1514070..1514718)
                     /locus_tag="MYCTH_2303896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662780.1"
                     /db_xref="GeneID:11507454"
     CDS             join(1513808..1513906,1514070..1514639)
                     /locus_tag="MYCTH_2303896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662828.1"
                     /db_xref="GeneID:11507454"
                     /db_xref="InterPro:IPR007843"
                     /db_xref="JGIDB:Spoth2_2303896"
                     /translation="MAETPQSSSSDPRLPRVTIRFCTQCKWMLRAAYYAQELLSTFSL
                     SLGEVALQPATGGVFTVEITTTSAAAAAPSQTQAETTATATTTTVVLWDRKADGGFPE
                     TKELKRRVRDVVQPGRDLGHVDRDYHHHGRDAGKQQQQQQHGDGGAGEGVSAAAAAAA
                     AAAAGGSSDGGDGDGDHHRGREEVKGEGGNEGGGGGRRARREGTAGAGCGIDGKENRC
                     EDCK"
     gene            complement(1515531..1518388)
                     /locus_tag="MYCTH_2315100"
                     /db_xref="GeneID:11507455"
     mRNA            complement(join(1515531..1516155,1516256..1516284,
                     1516358..1516657,1516723..1517124,1517220..1517588,
                     1517745..1518388))
                     /locus_tag="MYCTH_2315100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662781.1"
                     /db_xref="GeneID:11507455"
     CDS             complement(join(1516137..1516155,1516256..1516284,
                     1516358..1516657,1516723..1517124,1517220..1517399))
                     /locus_tag="MYCTH_2315100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662829.1"
                     /db_xref="GeneID:11507455"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2315100"
                     /translation="MADQHDVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKARE
                     IFISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
                     TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
                     IAAIIDEKIFTMHGGLSPDLNSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSE
                     NDRGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEF
                     DNAGAMMSVDESLLCSFQILKPAEKKQKFGRGR"
     gene            complement(1521336..1526302)
                     /locus_tag="MYCTH_2303901"
                     /db_xref="GeneID:11507456"
     mRNA            complement(join(1521336..1523331,1523415..1524448,
                     1524521..1526302))
                     /locus_tag="MYCTH_2303901"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662782.1"
                     /db_xref="GeneID:11507456"
     CDS             complement(join(1521642..1523331,1523415..1524448,
                     1524521..1525630))
                     /locus_tag="MYCTH_2303901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662830.1"
                     /db_xref="GeneID:11507456"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Spoth2_2303901"
                     /translation="MQYSSAAAVAAAVVQSEGYKPREERGWEEFHPNLDIEATFMIYQ
                     ADEVDGVIKSVPPTPAAQASADPVDGTGTPTKEANPGASHEANGTPSGRDKQPLGASL
                     AEAATPSRRRSARPARESFSLYATRSLDSGGLPKIPKVLPISGQSSKERLDLKQPQYR
                     RTNRIALFESKTFGQARYVDRSMMNVGYQESDQFIRPERGLIKATDANMEEEVDPTKA
                     DGDAVQHSAGAVGRVEYDMDEQDDMWLEKLNEQRKASDLDPITREIFEITITKIEKEW
                     HALEKRIPKPNPKPPQTHRPRSSSAAAVNGEPQAGEEQDSKCAVCDDGDCENTNAIVF
                     CDGCDLAVHQECYGVPFIPEGQWLCRKCQLIGRGIPTCIFCPNTDGAFKQTNSSKWAH
                     LLCAMWIPEISLGNHTFMEPVMEVEKVPKTRWRLTCYICNQRMGACIQCSNKSCYQAF
                     HVTCARRCRLYLKMKNSQGALAVLDGTLPLKAFCDKHCPPDYAEQHNVAQATKEAKRF
                     YKRTMKGRIWADSQASALQLAATHRNARTEHPPDESQITGAKVSAVLADNKKKGQPPK
                     NVWKLPSGAPIIPQAVFDLVESALARFPIRKRKDFVGEACKYWTLKREARRGAALLKR
                     LQLQMETFSSMELTRRNFAAMGPSGKARLDRRVEFARGLVAELDKLTELCKLVEERER
                     LKLEMAELEAEMVNTCYFPIYKLLLPVLEKAFSLDKNVFRQGLQELQAKMDRRYYVTT
                     LPFTQDLCRAINEGINNPPESVVQNSGRPVEASPSKHNNYAEIGARRRLGKRIVKSLQ
                     PYLETALRAEAEITDQPHDVLRKELEGMLEASVEVRQQLPVASITVSPDEDAAAGRQG
                     QVDVHMADAPAEGQIIVADQSGGEEDAEGEPDDDLVSPDRDNIQVGGYDEPTPRPNGV
                     LSAAHSVSGEPQPDTTTPHLANGVTSLDKSSTSPPSLPGTSYSTLPPPAGATAPPSHH
                     QPDTTTTTTTSSSHPLTPPRSNTGSASTASFNVTQNSNNNDNKDNDNDNNNNNNNNDN
                     GASTTTSTTGNTCAVTNTNTNTNFLTHGGIPWYLAGFELRGTTAVQEQWTPGREAVRS
                     LSEELTDMDDEALRDLEFDVDEERTITIRGDGVYGAGVGGADDGGGGGGGGGGNDGGG
                     DDGEEDDGDEDGAKDVDGENAHHNGGGDGDGDDSGGSEEGKKRNGSGDDTNGVARTPP
                     SPQLPQPPPQPQPKPPPPPRSQPAGAGVGNAKKAVAAAGSSSPRKRTRSEVAAAAAAA
                     SRSLRRGVRSSSRKK"
     gene            complement(1529177..1532109)
                     /locus_tag="MYCTH_2303903"
                     /db_xref="GeneID:11507457"
     mRNA            complement(join(1529177..1531785,1531878..1532109))
                     /locus_tag="MYCTH_2303903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662783.1"
                     /db_xref="GeneID:11507457"
     CDS             complement(join(1529263..1531785,1531878..1531910))
                     /locus_tag="MYCTH_2303903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662831.1"
                     /db_xref="GeneID:11507457"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2303903"
                     /translation="MDSEDGEIFIKQLASFVRTHEKALANALQFKRQNAPRHGASQSV
                     SSIPTGTVPPSPTVPERPSTAGSASSTLAAALSLGTLNFTSHSVKSAKLALTPHHLFY
                     LLSRFEELGIPVGPMKVRLENLHDSNVSANYVSFLGQSQRSKNRGSDVGSIRSVSSIR
                     TVMSSMSALWASFSIGSSISAARTEKQKAAIQADLKYLYSAFTKIPCLRLAPDWRARL
                     IKGYEEFPFDSAVPLYAFKNVQALEVCDIDFRQFFGWDRLADQLRSLTLKRASIDDPT
                     DILIDIVLDDMDRRRRRTSKGHTSPSRPWPRASSPRRSPTASNNELAKSAPIPGLSEP
                     RKSTVDLQVGSLNSEGGGDQSGSGGPESRRPSVARIDSEELNSPSKDDGRTRSHSPRR
                     PGSSRNPSANVRGSNKIRRSGSGSSHSSLSDSWHNSRGSSSNLLPAGVLPASKWRFLK
                     HLSLADNSLTAIPPGSLNPLANTLNSLDLSSNLFTQIPDSLASLTALRALNLAHCMIE
                     SLHSLTRNPLPAISALNLRANRLQSIAGIEKLLPLERLDLRDNRLSDPMELARLTGIP
                     DIREIWVEGNPFTRTHRDYRITIFNLFRRTPGYTEDIMIDATGPSYAEKRYLAERAEI
                     PPAVPVVKPEPPEIPAVDVSRPAIIYDAPHKEPAVLRKERPLPKTVTSEVNTNSTRRR
                     RAPKRRIVDLATNDNPIPYARPVDRHSDAVHNNTDAGDHYRTSQPAGTPETTQDAVAE
                     TSVHNKADVAREVPRIDTNVVPQLPSMFGSPGNKAHWDVGGELYRQRIEDIRNKVGNG
                     YLSVLSEEGWDASSRPSELHQEAEFSAPSPSINSDPTMTRPNMQAIPSGGAFA"
     gene            complement(1541170..1542855)
                     /locus_tag="MYCTH_2303908"
                     /db_xref="GeneID:11507458"
     mRNA            complement(join(1541170..1542533,1542656..1542855))
                     /locus_tag="MYCTH_2303908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662784.1"
                     /db_xref="GeneID:11507458"
     CDS             complement(1541480..1542520)
                     /locus_tag="MYCTH_2303908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662832.1"
                     /db_xref="GeneID:11507458"
                     /db_xref="JGIDB:Spoth2_2303908"
                     /translation="MASFPRGFGPRLLLLVRQQAPCDCAATQARQLLRARFSTSRLLQ
                     KAVKTARPAAAPKTTPNAASKPTLPKASSAAVPGTTVSAAPAQAARPSSYAEQLALRG
                     RTLLYESPSHFWFRAGCFSSATFCVSYTVYQYWTVILHPPEGLMWWIPHAFGAILVFM
                     AGMGAYFVMGAGRIVRSIEAVPAAAVAKQLASGTTATTSPIYIEVATRRMAPFMPPKK
                     HLLPPEEVQLPFRMYSVFSAARAPELPVGQRPMGLAERVRAERAAREARLAERKYTMD
                     HILTAPFRDARKAFGTAWSGIKRSFHREGFAKIRLGKQEYKMDVTGGWALDDGRAMDR
                     LLPIRPNAMRTR"
     gene            1543057..1545073
                     /locus_tag="MYCTH_2303910"
                     /db_xref="GeneID:11507459"
     mRNA            join(1543057..1543236,1543459..1545073)
                     /locus_tag="MYCTH_2303910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662785.1"
                     /db_xref="GeneID:11507459"
     CDS             join(1543161..1543236,1543459..1544687)
                     /locus_tag="MYCTH_2303910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662833.1"
                     /db_xref="GeneID:11507459"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="JGIDB:Spoth2_2303910"
                     /translation="MATFVTACRMSARLAARKVQHDAVRGFRTSAAVLAAQNFTMPAL
                     SPTMTEGNIAAWRVKEGEKFSAGDVLLEIETDKATMDVEAQEDGILVKVIQGEGSKGV
                     QVGTRIAVIAEEGDDISSLQIPPDETPQAAKAAEAPKTQAPAPATPASPEPESTPATS
                     PPKTPVKPGGKTLNKSYPLLPSVIHLLKENGLDESAVSGITPTGPNGRLLKGDVLAFL
                     GKINANTPAKVSARFEKASHLDLSNIKVAKAPEPKKPAKEAAPASPPPPPPKSVVTLP
                     VSLEAVMEAQKKIHKSLGVFLPLSTFVERASELANDELPLPADYQPTADELFDQVLGL
                     DKVGGRKASRGSYVPQVASLPSASAVFASTPNKTKEQVDILDILTSKPKPAAKKTTVL
                     PGQPAGTNLFSLQVPKAEERRAQVFLERVKIVLENEPGRLVL"
     gene            complement(<1545185..>1547355)
                     /locus_tag="MYCTH_2060682"
                     /db_xref="GeneID:11507460"
     mRNA            complement(join(<1545185..1546674,1546812..>1547355))
                     /locus_tag="MYCTH_2060682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662786.1"
                     /db_xref="GeneID:11507460"
     CDS             complement(join(1545185..1546674,1546812..1547355))
                     /locus_tag="MYCTH_2060682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662834.1"
                     /db_xref="GeneID:11507460"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="JGIDB:Spoth2_2060682"
                     /translation="MPTATPAAGWAWEGAAVDKTPFPGPNAESVSQQRVLLSAFRYWQ
                     HLMKVGEDYTPAEGRLVPMPHSVAAGAREALQKLCTICSGELPAALLPFAESVEVTSA
                     TENGDEVHFPTPLREQEAAAAIKALEACAAAAIAKLRYGTESKRIRIDADRVSAFLMS
                     AYLTTLDGMDKSDPRIKDRIPDTDLNKAQSVLYRRMSANLYGTKNPGEYFHIHGSLDA
                     DVTLEMLGLPKENPEMTDYHAIIDYIESAVKEHTAAELDALNLAHRQAGIQALTWAQF
                     QATPHGKALLDLPPLTVRPNPADAHVTPPVPFPSTTAAVSSSPGGRRPRQALAGIKVL
                     ELCRIIAGPTIGRSLAAHGAQVLKVTPPHLPDVPFFQLDVNAGKRAVHLDLRPSCPAD
                     RAAFAALLADADVLIDGYRPGALARLGYGPDQLGRLARARGRGFVYVAEDCFGGADLE
                     PERGAEWAGRPGWQQVADCVTGAAWAQGAFMGLDEPVVPPFPMSDYGTGALGSAAALA
                     GLYRRAAEGGSWVCRTSLVQYDVFLMGLGLLPAEEQERLRRRHADEAGFFALRHSDSV
                     DEVGRRALASMRLAVPHLFADGGRAVMQEAWSEPFRGVLRWPREAVEIDGLRVGHVRT
                     ARPNGWDKEVVSWEGWEEEEEEIIVGEDDDDNDEEEEDDDDDDDDGEAEKLNP"
     gene            complement(<1547940..>1549412)
                     /locus_tag="MYCTH_2126592"
                     /db_xref="GeneID:11507461"
     mRNA            complement(join(<1547940..1548150,1548214..1548291,
                     1548408..1548450,1548725..1548778,1548856..1549025,
                     1549108..>1549412))
                     /locus_tag="MYCTH_2126592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662787.1"
                     /db_xref="GeneID:11507461"
     CDS             complement(join(1547940..1548150,1548214..1548291,
                     1548408..1548450,1548725..1548778,1548856..1549025,
                     1549108..1549412))
                     /locus_tag="MYCTH_2126592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662835.1"
                     /db_xref="GeneID:11507461"
                     /db_xref="JGIDB:Spoth2_2126592"
                     /translation="MPIFNLRPAVFATRGLPRDDGTHANLDQLKHHCVHRFFPRFRWA
                     PAVLEETQSATWATKGFGLSFRAAVTPADQPPSSGGGGGMLLDVAEDGKEAALLLHEC
                     YLTFTYPHSVAVTVPKFPAEGLNKVQTTGRPGGSEDGRGIVPTIRFHLTDLARWISGQ
                     EKMSRLLLATPSGNTYRFPPVTISTNGLPTSVTEVPRYGTSYYRGNELSFHILQSGGV
                     GSDLVDRVIKAQRLTAVFLAGDKVHRSATRDSALTFTTPRRTEKPLDALRYPIAPRGG
                     GGEAPWEHVV"
     gene            1552296..1555269
                     /locus_tag="MYCTH_2303918"
                     /db_xref="GeneID:11507462"
     mRNA            join(1552296..1552820,1552910..1553127,1553178..1553529,
                     1553599..1554289,1554356..1555047,1555150..1555269)
                     /locus_tag="MYCTH_2303918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662788.1"
                     /db_xref="GeneID:11507462"
     CDS             join(1552589..1552820,1552910..1553127,1553178..1553529,
                     1553599..1554289,1554356..1555047,1555150..1555166)
                     /locus_tag="MYCTH_2303918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662836.1"
                     /db_xref="GeneID:11507462"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2303918"
                     /translation="MQAWSQPRKSEQQPGDASMSGMMTSQPPLSMPAQDHTRQGFLRN
                     PKKTPSRNNMKGLPEETSIYTETRMLQDQTGRLLYIGDASTLSILQLTRIIIENTAGS
                     DIGSPFIDDPKRHRILESIIDFPDDVRIPSPLPDKETADVLIASYFTNTCGLVEILDK
                     ASFLRSVEECYRDPPSSGNDFLCNLYLVLAIGLLLATPPPGSHEEMVVQRQLAAQPNR
                     AELFFRSARSMCDPAAGFEDADFWSIQALALMTIYMLVNSKRNRAYAYLGMAVRSAFA
                     LGLHREETMNDFIFTPAQMRVRRTLWKTLFILDRFLAATLGRPTAISEDDCSCKILPD
                     DNAADIPSMVGSEADQIHARCLDACVESAHIIGVTLKVFSRRKISTARVQEIVDMSKN
                     WDQASHTQPYRRHSGGGSADPAHRVASLHVGLFSLHSLILLTRQLFVMHNWMLVEERS
                     GIKKSAQIRESSMARFSEACVIASYRTIRLARSAWSDGYLPRRNPFVIYFVFAASLVI
                     LMNQFSSLYYTSEYNKTMRDALDIVAYCAESDSQAQRVLDIITRFSQVVDKWTENHSH
                     SAPKLSDDFSCLYSQPSHSGTASGHMPPGPALDTGFHVRTSPQTASGPDPGLLTPPSI
                     PKVPILDVLSAQAPSAALEARASGMSPPHASIPPATLLRNRPSVLAHSSLATTELLGG
                     NFEFDIDGLWYSCTNYLPPVPSVAPGISSLALQFPPPVIGAPTEPYDKPVF"
     gene            complement(1555249..1556163)
                     /locus_tag="MYCTH_2303921"
                     /db_xref="GeneID:11507463"
     mRNA            complement(1555249..1556163)
                     /locus_tag="MYCTH_2303921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662789.1"
                     /db_xref="GeneID:11507463"
     CDS             complement(1555372..1556061)
                     /locus_tag="MYCTH_2303921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662837.1"
                     /db_xref="GeneID:11507463"
                     /db_xref="InterPro:IPR000627"
                     /db_xref="JGIDB:Spoth2_2303921"
                     /translation="MSDDRRNETQLLCDIVGLESLVDEITSKMLGTSNSETPSAILGP
                     FYRHDAPLLPNGSSIVRNLSPAVSWYDQAVADSALITGRVLASSGAPIKGAIVDVWHT
                     APNGLYEQQDESQPDMNCRGRFQTDAEGRFAFYALRPVAYPIPNDGPAGKLLNLLDRH
                     PYRPGHIHVIVSAPGFRALTTQLYDDRDKYISKDAVFAVKDELVVKFVPREGDPNARW
                     SLKYDFVLGRG"
     gene            <1556754..>1557795
                     /locus_tag="MYCTH_2126595"
                     /db_xref="GeneID:11507464"
     mRNA            join(<1556754..1556843,1556983..1557080,1557133..1557271,
                     1557517..1557561,1557625..>1557795)
                     /locus_tag="MYCTH_2126595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662790.1"
                     /db_xref="GeneID:11507464"
     CDS             join(1556754..1556843,1556983..1557080,1557133..1557271,
                     1557517..1557561,1557625..1557795)
                     /locus_tag="MYCTH_2126595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662838.1"
                     /db_xref="GeneID:11507464"
                     /db_xref="JGIDB:Spoth2_2126595"
                     /translation="MTVDIYENPCVARMKHGHATPPGLPECRTTSHGSTRTVAGQAAK
                     QVLSTDPGRRCAAYTEGTVICICLDPGHIWNTDVGTNIFWKRDTVSNRRGGLVEIQLD
                     ANIGVPMSPDIAYRPFHLIKQQSAGAKCLGPEQDPAQPSASQETPVSSDSSGQGTRWV
                     VVFSFLAFLVPARTAPIAAA"
     gene            complement(1559887..1563673)
                     /locus_tag="MYCTH_2303924"
                     /db_xref="GeneID:11507465"
     mRNA            complement(join(1559887..1560473,1560563..1560804,
                     1560859..1561064,1561121..1561316,1561363..1561581,
                     1561646..1561985,1562054..1562376,1562501..1563532,
                     1563606..1563673))
                     /locus_tag="MYCTH_2303924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662791.1"
                     /db_xref="GeneID:11507465"
     CDS             complement(join(1559983..1560473,1560563..1560804,
                     1560859..1561064,1561121..1561316,1561363..1561581,
                     1561646..1561985,1562054..1562376,1562501..1563171))
                     /locus_tag="MYCTH_2303924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662839.1"
                     /db_xref="GeneID:11507465"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Spoth2_2303924"
                     /translation="MAKASSSTSSDVPLQPLTSSGARREDSMADSTREPSISRPGRSR
                     SPTRPSSPESPLAHLRARIPLFSPSHHRGDDGGHLDNARSDSGSEYELLLDPNLPADY
                     SQRHQPIPRHSLSSVDHHHHHHHHDGTGPKISLDSEDLDPLVSGGEEGEDGDDHEDEV
                     EDSPYPEVRAAVHPYDDPTLPCNTVRAWTIGLALIFLGASMNTLFSLRSPNISLGALI
                     AQVIAWPLGRGWARFVPDKEVRMPLPWFGKGTRMGLGIKRVRLALNPGPFNIKEHAIV
                     VVMASVSFSVAYATDIILAQKVFYKQDFGLLWQLFLVVSTQSLGYGIAGMMRRFLVYP
                     ASMIWPGNLVSVTLMNAMYESTEDRDPTIIGESMPRYRWFALVTAGSFIYYFIPGFLA
                     QFLSSFAFMTWLAPESPVVNQLFGYTTGLSLLPITFDWTQISGFVGSPLIPPWHAIAN
                     TMIGVVLFFVVLASVLHYGGAWYSQYLPMSDSNTYDNTGKPYDVSRILSADYTLDVEA
                     YNNYSPLFLSTTFAISYGLSFAAIASLIVYTYLHHGKTIWRQYKSSTTEKPDIHMKLM
                     RRYKEAPTWWYMSLFFVMLILGFVTVLAWPTNMTWWAFLLAVLISFVFSLPIGIIQAV
                     TNNQIGLNVLTEFVYGYIQPGRPLALMIFKTFGYITMSQALTFVSDLKFGHYMKIPPR
                     TMFMAQVVATTFSCFIQVMVLNYALKTIPNVCEPTQPDHFTCPGGRVFFSASVIWGLI
                     GPARIFSPGQIYSSLFICFFLGAVTPIVIYLLAKRRPKSFLRYLMAPVIFGGAGAIPP
                     ATPLNYLSWGIVGYVFQYLIKKRHFGWWSRLNFLTSSGLDLGLALSTLFIFFAFTLRE
                     VEPPRWWGNEVIKETMDYRGEAVQVVMAPGETFGPAAWG"
     gene            1564058..1566118
                     /locus_tag="MYCTH_2303929"
                     /db_xref="GeneID:11507466"
     mRNA            join(1564058..1564684,1564894..1565616,1565690..1566118)
                     /locus_tag="MYCTH_2303929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662792.1"
                     /db_xref="GeneID:11507466"
     CDS             join(1564217..1564684,1564894..1565616,1565690..1565851)
                     /locus_tag="MYCTH_2303929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662840.1"
                     /db_xref="GeneID:11507466"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="JGIDB:Spoth2_2303929"
                     /translation="MRRVVVTGLGAVTPLGVGVRRTWRRLLASESGLVSVADRGRDAA
                     ERARWRELTSTVAGVVPTAAAVTATAADNDHPALSRGRDDGLWRPADWLDAADERRMS
                     TFAQYAVAAADMALRDAGWRPAGDEEREMTGVCLGSGIGNLDELYATSLAFNQGGYKK
                     VSPLFVPKILINLAAGHIAMRYGLRGPNHAATTACTTGAHSIGDAARFIAFGDADVMV
                     AGGAESCIHPLTFAGFGRSRSLSTAYNHDPPASCRPFDADRAGFVVGEGAAVVVLEEL
                     EHARRRGATVLAELKGYGCSGDAYHMTAPREDGSGALSSMKRALKNAGIRPAQVDYIN
                     AHATGTQVGDAAEAAAIRSLMLGEEGVEDESRVTVSSTKGAIGHLLGGAGAIEAIFSI
                     LAIAENAVPPTLNLNKPDVGARFNFVPHQAQQKNVRVALSNSFGFGGTNASLVFSRLD
                     "
     gene            <1566645..>1567350
                     /locus_tag="MYCTH_2034929"
                     /db_xref="GeneID:11507467"
     mRNA            join(<1566645..1566804,1566938..>1567350)
                     /locus_tag="MYCTH_2034929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662793.1"
                     /db_xref="GeneID:11507467"
     CDS             join(<1566645..1566804,1566938..>1567350)
                     /locus_tag="MYCTH_2034929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662841.1"
                     /db_xref="GeneID:11507467"
                     /db_xref="InterPro:IPR007129"
                     /db_xref="JGIDB:Spoth2_2034929"
                     /translation="SSYFIYKATETHYKACAAQADYAIEPADRKSGKLRTTADGEEIG
                     VSKGGPWHQDLGLLPTFSTWAHVTMLHMYLIVVRLRCLDRDAQQAWQAQLVNHFFYHA
                     EAKMEDVHELTSRTIRQTYLKDLFVQWRGLILAYDEGIVKGDAVLASALWRNLFKARE
                     DVDARALAAVVAWMRASLKQLGEMTDEEVEL"
     gene            complement(1567542..1568800)
                     /locus_tag="MYCTH_2303933"
                     /db_xref="GeneID:11507468"
     mRNA            complement(1567542..1568800)
                     /locus_tag="MYCTH_2303933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662794.1"
                     /db_xref="GeneID:11507468"
     CDS             complement(1567665..1568522)
                     /locus_tag="MYCTH_2303933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662842.1"
                     /db_xref="GeneID:11507468"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="JGIDB:Spoth2_2303933"
                     /translation="MPAANPLLPELTLIVAATQQMGIGRNGTLPWTGLRKEMAYFARV
                     TKRLPPAPSQHPHQQQQHPHQQQQHPHQQQQHPHQQQQQSTGDGQQQQQQLVQNAVIM
                     GRKTWESIPERFRPLPGRWNVVISRKAAAAAARGGGSLGAPGGEENPVMAAGLEEALR
                     YLGGRPGVGRVFVIGGAQIYRAALETAQARRVLLTRVRTEFECDTFFPLRLDEANADA
                     DAAAAAADADADADADAVIATAAAAAAKGWRRSGQEEMDAWVGEEVPRGVQAEAGTEY
                     EFEMWERVD"
     gene            complement(1569025..1573308)
                     /locus_tag="MYCTH_2303934"
                     /db_xref="GeneID:11507469"
     mRNA            complement(join(1569025..1569809,1569905..1572831,
                     1572906..1573026,1573106..1573308))
                     /locus_tag="MYCTH_2303934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662795.1"
                     /db_xref="GeneID:11507469"
     CDS             complement(join(1569102..1569809,1569905..1572831,
                     1572906..1573026,1573106..1573108))
                     /locus_tag="MYCTH_2303934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662843.1"
                     /db_xref="GeneID:11507469"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Spoth2_2303934"
                     /translation="MPDAVKAAHYIQQLDDARCNENWDAVPELIRKVRKHAPDRVCLA
                     LTAEIEHSIAKANLKPTPSARTASAEGNARPPSSSTAPAGGLEAANHLPDLFTAIDAE
                     AAHPEDRFQARVCAGWLLWVLREYPAALARLPRTLHDKGGATTTTTTDNINNNNNNNA
                     SPDGDDHAADDDGEKPPSEWTRVCGLKAAYLRANCLARDGQREGALDAFEAALPGLSA
                     VWAAGPADARPQTRYWAELFLTECCMLAAQALREGARSLTDPNCLACFRAWARYWAAG
                     KGGPSPGGYGFRGSVPRRQVWGEYYSALSGILQADLPFPTGGSTVADAVAGGGGSENS
                     ARVRLRTELKKVEAIYQGLLYSETKFPRADEERTEVEDFVRRLMQNWEVLNGRGWKEH
                     ELGAGGRDALCHATLDSLYGAAAKTYHSTAILRHMFTVHLAVAEFDLAFKAFDSWLEL
                     VKKGKARVKKTGHREPALDGNATVFETISTCIAALCRFGGREAAEKAHKLAEELAGLV
                     AEEEEKEEGGRREPDNADPLDEAVPPATLAVAWQSIGLARAQWARMTFESDSRATLQE
                     KAIQCLRKSLSPAYGNGLDARGVFALGMLYAEQRKLPASIEIVKTALLAERLPGTGRE
                     ELRLGPYWRERSLIPLWHLLALMLSARQEFVMAARACEGAVEQFKDPHVLFGSRQLTG
                     GYRSEHLKEAGIKDRGGDGLVDEMDDYEKEGILQIKMTQLAILEVIEGPAVAVNASTE
                     LLTLFPRLFGDLDQKVELSRAEPPKTSGTMRSLRGSVFGGKSDEARLKQQGPASDEGK
                     PATTPPRPRTTQSVATTGQSSVNDPADPFSSRRSTKSEDMKRSRNSLRKRDRSGSRQR
                     AFSTSSPPGPPPLEGDKSFAAFDERNLPSHSAPKQTAEPPREDLRRSTPRSRAGTASQ
                     AEVRTGQVVGTFSQLLPFVTFSPDHGRRRRKAILTKVWLVIAGFYRRAGLLDDAGQAI
                     SEAQRAAEELEADVMNEASGAMSVRQAGWGMEKSSEEVIADVWAEKGNLWLARGRPYQ
                     ARADFETALTHFPDHPGAIVGLSNILLDIHTEKLLPPPAVPGLDLGRLGLADDDGVFP
                     STPGGAAITTDPATTRANINRADKFPALPSEPLGLGRASPESKAKPAEALVNGHSASK
                     QQQQQQGAAATSTPSLLGPPLPPPHEASSLPLNDRLAARDRAFGLLSGLTKLGSGWNH
                     SEAWFTLARAYEESGQLEKARDALWWCIELEDGRGVREWDVVRGGYVL"
     gene            1573471..1576432
                     /locus_tag="MYCTH_2303936"
                     /db_xref="GeneID:11507470"
     mRNA            join(1573471..1574093,1574185..1576432)
                     /locus_tag="MYCTH_2303936"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662796.1"
                     /db_xref="GeneID:11507470"
     CDS             join(1573758..1574093,1574185..1576284)
                     /locus_tag="MYCTH_2303936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662844.1"
                     /db_xref="GeneID:11507470"
                     /db_xref="JGIDB:Spoth2_2303936"
                     /translation="MAAPSELKVLCRRLTSAPADDLPRLCPLLVSHVLRCGDPLSAPA
                     DAKAKDKSSETPVLVHKLRTHISTLLTGKSSSGRFAAVCLIKAVIDVGGWESLRASGP
                     WIRGLIGLLQKPDPLASKELCIVTLTKIYVLLQGYQTLVREMATPTLPDFVSACLRLI
                     SPPASGKPLKAPAVFIDTVACSLSKLVVLYPTTLRPFAVQMKAALKAYVAPTPSDGVY
                     PVPQNLRESARRLFVLLPYTAPKNGSSDEWAKAIQSTILDCHATVDQVFRAVVESWES
                     ATGYRGGPLGTGPDPSGGSDEGDGLPSWVGVQAGAERLVGLLDFLAEYFNSPTKAPVS
                     VPLGELLDLTARITLVTPPSGTEDSIETNPAIGRDEKAELWSVLPDIHIAVLRFHRAL
                     IRRLRENSVPLATDILDQTVRVSTASRHIPAMREAAYALASQLLHLAGPTLPKLTVDS
                     LAPLIQSTCRDILLSTGHLEPTPPSPSSTSNIANLTKQQTHQPPRNHAPSTNADAYLT
                     APASSSPSSSSSLLAPSLSTPSHLTATASALLRVFFTHLPQTALSPDLRSLLDRTAIL
                     SHDRDAMLASCLHPYRDSRGRYYPSILPFLVRRFPRELGVEVLRSNLVRAGAGAGAGG
                     AAYQGMAVGEGLEELLLDREERGTGAEKDREGGAEDGAQREGKDGAENGGQKAKVVGH
                     GDGGGGGGWGGDAMDVDSGSAGAAPPRSANPFAVVTSAAAAGEEKREVPVRTASPLKR
                     KSEVFEADTGKPPKRLDTGKAAAAPQVAVAPPTKQGEEKEGSSDDEGDSEGSVQIDMT
                     LEDDEEEEEDEDE"
     gene            complement(1576433..1578232)
                     /locus_tag="MYCTH_2303937"
                     /db_xref="GeneID:11507471"
     mRNA            complement(1576433..1578232)
                     /locus_tag="MYCTH_2303937"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662797.1"
                     /db_xref="GeneID:11507471"
     CDS             complement(1576951..1577937)
                     /locus_tag="MYCTH_2303937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662845.1"
                     /db_xref="GeneID:11507471"
                     /db_xref="JGIDB:Spoth2_2303937"
                     /translation="MPSSPVPDEAKGLPPEPQADPATEHAKNGPGKAPEPAETEPQKS
                     ESSSRADGAPSHSDSHSEGEYSGSDTSERREPETGNEAQPSLPNEPLPGGDGGDGGDS
                     TAPPLPNEPLPSDPAAPPLPAEPVPDPEDDGWEYHWNPNDQSYWFYNRFTGVWQKENP
                     RVPTDSSAAAAAAATATASTTTPTVAADGTVLSNPASIAGGYNPAIHGDYDENAWYAQ
                     ALRAQSAAATTTATTAALHGGDAYATAAYFNRHTGRWQAPDQGPERHSDEAKSRRQMR
                     AYFDVDAAANMHDGRSLKAERAGIKPSRAELRMFKEKRRAKKEEKRRAWLRD"
     gene            1579753..1581058
                     /locus_tag="MYCTH_2303939"
                     /db_xref="GeneID:11507472"
     mRNA            1579753..1581058
                     /locus_tag="MYCTH_2303939"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003662798.1"
                     /db_xref="GeneID:11507472"
     CDS             1579863..1581050
                     /locus_tag="MYCTH_2303939"
                     /note="CAZy_ID 267870"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003662846.1"
                     /db_xref="GeneID:11507472"
                     /db_xref="JGIDB:Spoth2_2303939"
                     /translation="MGPIRRILCLPTSLSSLVFFLVSATAPGIAAAGKDPALTDDSQC
                     GCYLNKGNSSTYFTYHRFFDFRSLPQYAGVPAVIQDAESSPDADPTSDYFKRDEWSSF
                     WLLGSWNNSNGARPDATVTMVNSPNNVYIEANTEPDPSSQTYLTLRTQRLSDFQTAAE
                     IESASSGFKYLSLRMRARTVGAAGAITAVFTYRGSDMLADVQESDLEIRTADKRNLVH
                     YTNQPAYTDDGDVVPEATRKATMPHGLDWTAWAIHRLDWTPGLTTWYVDDVEVARIAF
                     QAPRDESNIILNAWSDGGRWTGNMTRFDAAYLQVQWLELLYNSTDPDETKRSRRRQQQ
                     DGDGCNAVCSIDETPELGTPVLLWKNGPSQVNGAGGRSVSTGSVPTWGVVVMVLFAME
                     LLI"
     gene            complement(1581451..1583612)
                     /locus_tag="MYCTH_2303940"
                     /db_xref="GeneID:11507473"
     mRNA            complement(join(1581451..1581981,1582153..1582330,
                     1582481..1583612))
                     /locus_tag="MYCTH_2303940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662799.1"
                     /db_xref="GeneID:11507473"
     CDS             complement(join(1581644..1581981,1582153..1582330,
                     1582481..1583386))
                     /locus_tag="MYCTH_2303940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662847.1"
                     /db_xref="GeneID:11507473"
                     /db_xref="JGIDB:Spoth2_2303940"
                     /translation="MSKPGWAPGYSDLPEPIDQHQNYPEVVAHDLPYPATTFYEQDKH
                     LAHSDHATAQGYPFTPASQPTTVPSEPEGRVLGLRRRTCIWLAAICGVLVVIGIGLGV
                     GLGLGLRSSGSSDQEGAPTAASTPSPSLVPDAGTTNSTNNLFEGSSLAATNYTDPDGY
                     VHLYVFFQAANKELTVSKWDSQNETWATLSISKMLSSTGVNLEPIPASPIAAYTYLNP
                     TFQTRVYFLTAGNSIREIITSEDPSLTSNWRQGILGSSKLITAGQGSKLAALRPQCGT
                     GEDCQFYYPSMAMAYQGDDGVIALSRADDWKPMDIQFGPAEPGAVIGLASVMRDNITD
                     VGWSLFFDEDGTLQEFNSELLLSQWTRGKSTGFAPEAGSGSPNIASFSYDLVNIMIVD
                     VDPDGDLEVRTWDTQSWSDLQPPNLVPSDGAPESPKFSAVAGNSQRRVFGIADGVIHQ
                     WEFFSLSPLQWSYRGMVPTEVKT"
     gene            complement(1584862..1586842)
                     /locus_tag="MYCTH_2303945"
                     /db_xref="GeneID:11507474"
     mRNA            complement(join(1584862..1586413,1586492..1586842))
                     /locus_tag="MYCTH_2303945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662800.1"
                     /db_xref="GeneID:11507474"
     CDS             complement(join(1584980..1586413,1586492..1586629))
                     /locus_tag="MYCTH_2303945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662848.1"
                     /db_xref="GeneID:11507474"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="JGIDB:Spoth2_2303945"
                     /translation="MASSAATPAAAAAAAVKKPKLHGRAFYESIGSPKYIVAPMVDQS
                     EFAWRMLSRSFLPESERSSLLAYSPMFHARLFTESQKYRDQHFQPTKPDSNELFLDGN
                     PAIDRPFFVQFCANDPQALLSAAKLVAPYCDAVDLNLGCPQNIAKKGRYGSFLQEDQE
                     LIHQLIKTLHENLEIPVTAKIRILETKEATLKYAQNVLSAGASILTVHGRLREQKGHL
                     TGLADWEMIRYLRDNLPPETVLFANGNILQHEDLEKCLAATGADGVMSAEGNLSNPGI
                     FAPPPPVGQEPRGYWRGKDGKGGWRVDEVFRRYLDIIHQYVLRKPPPPRRPLFVPGDD
                     TAWMDEEIVLPCVDGPEARPKKRRSEVGKENPALLAANFIGMQPHLFHLLRHLVSRHH
                     DVRDALAKTRLGEMDMYEAIYKMVEKKVAEGLLEYERTGGKSVEEDTPPPLGEGEEED
                     DPDSSARAVRECKRPWWVVQPIVRPLPKEALARGAVQMSKKERKRMAAELEEKEEADA
                     KRRKEAVGMSLLPRR"
     gene            complement(1588871..1591935)
                     /locus_tag="MYCTH_2303946"
                     /db_xref="GeneID:11507475"
     mRNA            complement(join(1588871..1589202,1589288..1589703,
                     1589761..1590733,1590858..1591935))
                     /locus_tag="MYCTH_2303946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662801.1"
                     /db_xref="GeneID:11507475"
     CDS             complement(join(1589155..1589202,1589288..1589703,
                     1589761..1590733,1590858..1591646))
                     /locus_tag="MYCTH_2303946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662849.1"
                     /db_xref="GeneID:11507475"
                     /db_xref="JGIDB:Spoth2_2303946"
                     /translation="MYHGGSGATQQYHRRGTSNHNPAASWQQSRTQRTTSSPAVPTMQ
                     SLDYLQPAVARPWYSASASMTNLPSTANYGSQMGVGTRDDSGLPVPGTTRPSTSPRVS
                     QSSNGSTTPQSSLAPAAPLRTAPERYRRSTLRGDSTGTATGAATSAQLRVPHSAVSNR
                     PNSFVGSASGSAIDDAGFSHNQPHGEFRRVRRRSMPALDSPGFPISQTPHELKQLAES
                     NHPRNADSDGKVGKTGNSQKTGDKTSNDEQAGNGRIAEANASPSSSANRNGSDAAASP
                     TMSPSPDPAGAGAAGQDSSRVVSIPPRTSSTDAAHAKRAPTPSPLSKPVTMDTAGESD
                     QVADAPGSATQEPASPPRSESPAAKQLAAINEKRGKSKSKTSRLRRAFSFGSAAEFRK
                     AANDSEAADNGAGKLHKDRTADDALDEEQARIAERQEAAGIGNNIYSGGRFFHGSTDN
                     LSISSTASSASIMIRKMGRGMKKGTRSLVGLFRPKSIVGTPAADEPPVAATQSSVSMI
                     TAEAERERVNVSADPKAQGGGTGFPRLERNSIDAAKVPVVEAERAGSSETDSTKARKS
                     IVGGEKERAEVLAAVRKGILKNRTGSSSPSPRPSDTRGSAFDLPSVPSVTDSPNSSAP
                     STPNEDSQGHRRPGAVTIGSEDYFVSALRLRQDNNNNNNSNNKATPGTPQSTKRCTTF
                     SPRIVFFETWPSQEYDRRGDIATCNRLTPMLAQQIKEELNSFKMEMEVHENSKIYTHF
                     F"
     gene            complement(1598279..1601901)
                     /locus_tag="MYCTH_2303950"
                     /db_xref="GeneID:11507476"
     mRNA            complement(1598279..1601901)
                     /locus_tag="MYCTH_2303950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662802.1"
                     /db_xref="GeneID:11507476"
     CDS             complement(1598688..1601813)
                     /locus_tag="MYCTH_2303950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662850.1"
                     /db_xref="GeneID:11507476"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="JGIDB:Spoth2_2303950"
                     /translation="MASSDSETSARRRYSPDDDRSPSPVDRRRSPSPRRGRSLSRDSR
                     ASRDYDRGVSPAPRDASRSPSRDRSPSARSPSPPPPRRRSPSPRDRSRPRSHDRSPAR
                     SPPRRRYPPPARRDADRYRPPKKERTPPPAAPAKTEEEKLADARAEYQKLLNMRSQGV
                     YLPPHKLRALQAAITDKSTKEYQRMAWDALKKSINGLVNKVNTANIKYVVPELFGENL
                     IRGRGLFCQSLLKAQHASLPFTPIYACLAAICNTKLPQVGELLVKRLIMRFRKAFKRN
                     DKAVCLSSTMFIAHLVNHQVVHETLAAQILLLLLAKPTDDSVEIAVGLMREVGLFLEE
                     MSPRTTNAVFDQFRNILHEADIDRRTQYMIEVLFQVRKDRYKDNPVIREELDLIEEED
                     QITHRIGLDEDIDTQDGLNVFKYDPDWEANEEEYKKLKAEILGEGSDEEEDDDEEEEE
                     ESDEDEEDEEQKALEIKDQSNADLVNLRRTIYLTIQSSADPEEAAHKLMKLRLPPGQE
                     PELVSMIVESCAQEKVYLKFMGLLGERFARINRMWMELFEESFMKYYSTIHRYETNKL
                     RNIARFFSHLLASDAIGWHVFSVIRLTQEDTTSASRVYIKILFEDLQENMGTAKLKAR
                     MSDEALQPSFQGIFPHDTAANLRFAINYFTAIKMGFLTDEMRNYLANMPKPTLPPPVH
                     DSDSDSVSSYSSYSSYSSRSRSPSRSPSRSRSRTPRRAIDRGRGRGRSVSRTPPRRGR
                     SYSRSRSYTRSISTGRSPSRSPSLSRSRSRSRSRSRSPVRRRAAARGRRSISRTPSRS
                     PSPSRTRDGRGRGRGRSYSRSPSPWSASRSRSRSLSRSPSPARRRGRSYSRSVSRSRS
                     PSRSRSPPRSPSPVAGPAGAAGKRRRGGSYSPSPPPARRQRRYSRSRSRSVERGGGVP
                     GGAGGGGGGRGRGDSYSRSLSRSRTPSRSPLPPPSPSPRGAAGNGRGGGDRRRGGGGA
                     PGRGGGYWEDDRDGYRNGGYRDRGRGRGRSRSPRSPARSPAGPSGGKRRRYYSDSRSR
                     SPGPSKRGRAD"
     gene            1602296..1603239
                     /locus_tag="MYCTH_2315106"
                     /db_xref="GeneID:11507477"
     mRNA            join(1602296..1602443,1602583..1602663,1602796..1603239)
                     /locus_tag="MYCTH_2315106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662803.1"
                     /db_xref="GeneID:11507477"
     CDS             join(1602441..1602443,1602583..1602663,1602796..1602984)
                     /locus_tag="MYCTH_2315106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662851.1"
                     /db_xref="GeneID:11507477"
                     /db_xref="InterPro:IPR009914"
                     /db_xref="JGIDB:Spoth2_2315106"
                     /translation="MLDKLVGLAMLVAASVVFLYYTIWTLLMPFVDADHPLQNFFPPR
                     VWAIRIPVILILLGSAVVGSFLSVVMIRSNRKKAAKAKAAAAKKKA"
     gene            complement(1603957..1608129)
                     /locus_tag="MYCTH_2303954"
                     /db_xref="GeneID:11507478"
     mRNA            complement(1603957..1608129)
                     /locus_tag="MYCTH_2303954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662804.1"
                     /db_xref="GeneID:11507478"
     CDS             complement(1604039..1607101)
                     /locus_tag="MYCTH_2303954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662852.1"
                     /db_xref="GeneID:11507478"
                     /db_xref="JGIDB:Spoth2_2303954"
                     /translation="MAGSPGNLISLAGESPPTAPSSYEDTRGIRSGWSSPRPAGGYYP
                     SSASPPTAGRRPLSFHMENQYSPPDPHLQLAAAATRRSSMHSHYAQLRAASNPPLPHQ
                     PQPHFYGAPAVDLDLQPQTGMKAGERGYYFGFDTLSPQDTDRVPGKDAVVLAGYEGGL
                     EVFSVGKRGLESAAGLKGLRGGVYHAKILPWTPESSGLYPLVAVVIHGPVFPPPAPEG
                     AADGDYDAVSAERSEAMSNASPDPATRNLGNRVAPGFVDSYQTTVEVFSLKTGRRVSV
                     LLDAPKVSLKSPITSPGFKAPPPTGAFHIHADGGNVVVSSGVTGECWIYRQAPAANEH
                     PFHFRCHGKLWTTLQQPPKGGEAAQESERSRSPAPSRPRPQVAILSVSGRWIAYCPAA
                     PSSQIALRALVPVPTSGRAPGLASVTPPQLPTANVDLDLPLTESVMNRIMRDATQELI
                     QGAKWVGKQGWQAWNNYWNPQPNQPQQRSPILAPQSWGGTGATRADSSQFPPTHGTVA
                     QPIAKEPGLVSILDLETLSSSVNPHPIATFAIPHGCSFLSFSPTGLSLFSASSKGDVQ
                     SVWDLMRIQLTKSSPLQAAGSPSGGPRVRQVAQFSRMTVARIVDVAWTRPNGERLAMV
                     TERGTVHLLDLPSSAFTWPPPRRRRGQQAQAAASEGPTTSAVSIASNALSSVREVARP
                     LINRQRRSNPTTPATTGAGLGEYATHGGKVIAASISHSLGKTGNAINQLRHTGENRVS
                     LPSSSSLPRSACVIWVSGKRAHSLFVLGNGLVRTFPAKSRRALSGTSDKRAPRLSRYA
                     DFQVPLLPDHVLSPLVKHILDPDEFLDVENLDAADNTLVLNQPRLRTRVQDLSAESSI
                     PQAEIESSAPYQPFHTDRRVALYELGPAQQEADLTAPMAATSLDETPQESTPRRKKGS
                     RQAQAQDTPAASSKPSGPWVFGQPIQATRLDLGVPQLLDDDPFSLALDDSRALPASAM
                     ERILQRTGDDDAQIVVTTRRRRGAASLQDEDGFFEDDCEVLDFADQRV"
     gene            complement(<1609776..>1610305)
                     /locus_tag="MYCTH_2019141"
                     /db_xref="GeneID:11507479"
     mRNA            complement(join(<1609776..1610035,1610110..>1610305))
                     /locus_tag="MYCTH_2019141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662805.1"
                     /db_xref="GeneID:11507479"
     CDS             complement(join(<1609776..1610035,1610110..>1610305))
                     /locus_tag="MYCTH_2019141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662853.1"
                     /db_xref="GeneID:11507479"
                     /db_xref="JGIDB:Spoth2_2019141"
                     /translation="EVVPGGESGYEPWYPSNVAIESFVQEFITRFYQISDDPGRDEEW
                     VNCFDAGATVMIGNEVARGKQEIRKMRKRMWKDVEARKHQVAEVFPGSFSAEVAAMHE
                     AEYMLFGAVAYRMKDGKGDAVARWAGHAQLKRDSVTAPWRMVFYRVYLQQ"
     gene            complement(<1611497..>1614048)
                     /locus_tag="MYCTH_115886"
                     /db_xref="GeneID:11507480"
     mRNA            complement(join(<1611497..1611522,1611978..>1614048))
                     /locus_tag="MYCTH_115886"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662806.1"
                     /db_xref="GeneID:11507480"
     CDS             complement(join(1611497..1611522,1611978..1614048))
                     /locus_tag="MYCTH_115886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662854.1"
                     /db_xref="GeneID:11507480"
                     /db_xref="JGIDB:Spoth2_115886"
                     /translation="MTTDAILRPDMDEAVSPRQQAPPIEQAMQPMGQLNNPLNHLDLR
                     ADPDAQATVSDFLDFTEHLPADITRSLTLIGKLGESYVDSSVNVHKLSTAWGRLPDTP
                     PADQPSPVDLRAEIAENLQHALNSRIFSLSEAQRMTENVLRHHARAKTILAKLSTMQE
                     NYTPAEEHKSPVATKSPQLSRASKAVSRADEKKVRRPRVPRITVPGEVLAPYDLDYDA
                     YTTGTDSSSSSSEEDEEAVTPAPPARIRVVKGASRTSRPGRPPRSGTSTAPNSSGPLL
                     STSAAIAQLPPPPQNPVIGSPDAPWGQLTPYELAKLRKRMKKNAAWTPSDTMVARELN
                     MLGRGVEAFRAAKKKAEEEGRVFEGKLPVPDIDPDTGQARMPAGALTLEALTSDEKTL
                     SNRGMKLNEAKKLKREMLAKMAAEEAEESARRFDAIARTLMSDPNQANAPATKAKAQR
                     KRKRDSAPETETEKLETAEGQAQRPQLKRTKTETPVPPPVLTPGGSQLAHETPAQPLQ
                     RNSTAGVLHSTTPIPVPIHGQEQSITARSAVSVPSTTSPASSNAGGTVAPSPAPVKPP
                     AAETPIPPPVISPRKSTTPIVPPTRETRKTQAARAQEQQQQQQQQQQQQQQQLEARIA
                     QVAGAISRSASPATVPKPEPDAPSATTTVTRHAASRGKAASQEPQPSLAADRPRRAST
                     ARNTPAPELFFFSSSS"
     gene            complement(1615625..1616422)
                     /locus_tag="MYCTH_2303957"
                     /db_xref="GeneID:11507481"
     mRNA            complement(1615625..1616422)
                     /locus_tag="MYCTH_2303957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662807.1"
                     /db_xref="GeneID:11507481"
     CDS             complement(1615767..1616075)
                     /locus_tag="MYCTH_2303957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662855.1"
                     /db_xref="GeneID:11507481"
                     /db_xref="JGIDB:Spoth2_2303957"
                     /translation="MYEHEQIMTFDEPMMLGSSSTPGSGSVRKRKSIRSDDSLSLHGP
                     MEVDGSVKSMASISMAGDFSVRDRIEAYGNLEIDGTLSCGGKVKSMGNVRVRGQVVCM
                     "
     gene            complement(1617350..1619653)
                     /locus_tag="MYCTH_2143673"
                     /db_xref="GeneID:11507482"
     mRNA            complement(join(1617350..1618796,1618954..1619035,
                     1619132..1619653))
                     /locus_tag="MYCTH_2143673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662808.1"
                     /db_xref="GeneID:11507482"
     CDS             complement(join(1618119..1618796,1618954..1619035,
                     1619132..1619415))
                     /locus_tag="MYCTH_2143673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662856.1"
                     /db_xref="GeneID:11507482"
                     /db_xref="JGIDB:Spoth2_2143673"
                     /translation="MARVKEAAAEAANSVAEGTAAAAAEAAAHAAVPPSPKRVARLPG
                     PVRFALAVVLSFALSSLGRLFVDHCSNNEIGGIAGEGISRKELSILAAWKLFGLALGW
                     WYDYDGFDLAALALLSHGPVTFLISVFYGIRAITAGAYLAVDVVSAFVPFLLLRRLSG
                     AHAAAPGVPNRDIVADRGIQVLTSLHSALVYSVVLFLAGRFVLPNTLVLYFEGIPTIQ
                     PAADAPLLGFGSPTTQLLSLLFGLAARTFIFAPLVTTPTTAEDRKNAEFDPVSASLGQ
                     TVAWNLWGYTTRTKVSLIRTAVAMLFTAVGTYLDTVLVISGVEPYGAAVYAGVWVIAT
                     LVTGLSLRYVGSI"
     gene            complement(<1620818..1622642)
                     /locus_tag="MYCTH_2138951"
                     /db_xref="GeneID:11507483"
     mRNA            complement(join(<1620818..1621628,1621764..1622341,
                     1622449..1622642))
                     /locus_tag="MYCTH_2138951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662809.1"
                     /db_xref="GeneID:11507483"
     CDS             complement(join(1620818..1621628,1621764..1622341,
                     1622449..1622463))
                     /locus_tag="MYCTH_2138951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662857.1"
                     /db_xref="GeneID:11507483"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2138951"
                     /translation="MASSKEIQQTSRPLSHRPSISSTSVPGGLTLSRQSHSRNNSHSL
                     LGSALNGSHRITRRKSMTNTGANVAAVAAALQESGDMAMPLPISVNSRRNTISKSGLS
                     RSAIVGSLPSPPASLPTHRFAGGHGAANGQESAIDDELNDMSGDDAESTFRKARVRRA
                     SDGQPLVKEGGRKSNRPELRCEKCGKGYKHSSCLNKHLWEHTPEWSYTSKLLISKHQQ
                     VQLLEAASVLVAMNNSAGNNPAAAPANTTPPDSARDFSSDRDSASPAASGYSEQPDRG
                     SADTTPPPQLDAIHPANASYNGFGKRNCIGNGLSRSYQTGPYASSAAGSLPRGSGFGH
                     FRQLSQDQRPTSSGRNATGQDDRELAAAVELLSCSFNSNGGSRTAQVPPDAPPVPPLP
                     AQYLDQDILSGTSFINSFPSRAPESFTRGEIRRTDRADTKMEESGESVMGDDDEDMRS
                     RARSDEDDDGVFGRMEE"
     gene            1626360..1627610
                     /locus_tag="MYCTH_2303964"
                     /db_xref="GeneID:11507484"
     mRNA            join(1626360..1626991,1627100..1627610)
                     /locus_tag="MYCTH_2303964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662810.1"
                     /db_xref="GeneID:11507484"
     CDS             join(1626896..1626991,1627100..1627558)
                     /locus_tag="MYCTH_2303964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662858.1"
                     /db_xref="GeneID:11507484"
                     /db_xref="JGIDB:Spoth2_2303964"
                     /translation="MSSDVFRRVGRGGAGNFYSKQDIQAVEKATETDLEAQSQPHADQ
                     SLARTRTIGTGCGTDTGPSYARTGRGGAGNFTFPTISSSSSSSSAAADADAQQRGDQE
                     RAEADRTETAAAVTASLAAKSTAGGLSGRGGAGNWTAGSGGGGDRGVQEEARKTVEEL
                     ERRVLDEVAGGLPPPAKAYTRSRR"
     gene            1627856..1628986
                     /locus_tag="MYCTH_2303965"
                     /db_xref="GeneID:11507485"
     mRNA            join(1627856..1628389,1628559..1628986)
                     /locus_tag="MYCTH_2303965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662811.1"
                     /db_xref="GeneID:11507485"
     CDS             join(1628103..1628389,1628559..1628697)
                     /locus_tag="MYCTH_2303965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662859.1"
                     /db_xref="GeneID:11507485"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2303965"
                     /translation="MSSALAIGAGVAVAAFLVRFPVLPQSSYNPSNHSKAKRSARKAN
                     HSLFSSAKQGRAGLVAWRRSRGGVGALGKAFYKGGFEPRMTKREAALILSLNESGITK
                     EKVRKAHRTLMLLNHPDRGGSPYLASKVNEAKEFLEKNT"
     gene            complement(<1629601..>1631630)
                     /locus_tag="MYCTH_101870"
                     /db_xref="GeneID:11507486"
     mRNA            complement(join(<1629601..1629715,1629789..1630190,
                     1630261..1631001,1631054..1631106,1631175..>1631630))
                     /locus_tag="MYCTH_101870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662812.1"
                     /db_xref="GeneID:11507486"
     CDS             complement(join(1629601..1629715,1629789..1630190,
                     1630261..1631001,1631054..1631106,1631175..1631630))
                     /locus_tag="MYCTH_101870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662860.1"
                     /db_xref="GeneID:11507486"
                     /db_xref="JGIDB:Spoth2_101870"
                     /translation="MADEDFLRYLREISGEDAAVWDGFDPSSWRHALEESAVEGLEGA
                     ESADGASSPLQDLAYSSDDSAEMILNYHKLTAAERARQNHGVSKLSKARQLASEEVAF
                     PHKLAELEAVKWEETGLGLGGRSADGELFVPWPLVESYPDMFVGKANSVRAAPLFTLD
                     ALHEKRVWDLYYIHCPEDMQMDPVIFVPTYQFQHLLDVINAKLETRFTIPPGSNKERF
                     MMSFGTEKSPLPRFLGRSDSAQTFKALCGAIPEPHPDDDLSKVPQLGVEEFRKLLKRT
                     RADRKKAKRSDRNRLKRIEAHKAWGRSIKRVQRYLGLRARAGDGMAARLTESDFSRLI
                     INEPEQFVLFVAIDIEAWEQDQNLITEIGIAVLDTTEVKDIAPGEGCQNWFPLIEARH
                     IRVKENSWATNSRFVRGCADHFSFGTTEFVRESDIAQLLKGVIDDATFVDRVDGTKKP
                     RPVVLVFHESSSDIKYLKSVSYYVEAARNVIEVIDTRTMHQHLVRSNDSASLANVLGH
                     LGIPCQYLHNAGNDAVYTLQAMIGLAAKKLEASLQRRRDKTEGHIPYAEFKQKEGWTS
                     GEDTDGGYAVGLLDAQLGWGSE"
     gene            complement(<1632775..>1635333)
                     /locus_tag="MYCTH_2118116"
                     /db_xref="GeneID:11507487"
     mRNA            complement(join(<1632775..1632786,1632910..1633379,
                     1633432..1633643,1633701..1634098,1634151..1634669,
                     1634722..1634782,1634840..>1635333))
                     /locus_tag="MYCTH_2118116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662813.1"
                     /db_xref="GeneID:11507487"
     CDS             complement(join(1632775..1632786,1632910..1633379,
                     1633432..1633643,1633701..1634098,1634151..1634669,
                     1634722..1634782,1634840..1635333))
                     /locus_tag="MYCTH_2118116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662861.1"
                     /db_xref="GeneID:11507487"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR014893"
                     /db_xref="JGIDB:Spoth2_2118116"
                     /translation="MADKEATVYIVDLGESMADCHNGRDESDLDFSMRYVWDKISTTV
                     AASRKTWTVGVVGLNTEETVNAQHSEGLEGYEHISVLQGIGPMTMSSLRDLRSMILSS
                     RTHGGDAISAIVVALTMIEDFTKKLKYNRKIILVTNGESPIDDESSEEVANRLNELNV
                     ELVVVGVDFDDPDYGYKEEDKSRGKANNEKILRKLVEQCNSGVFGTMQQAVEELAIPR
                     IKPVRPFKAYDGPLTLGDPQKYQSALSIHVERYFKTKRAVPPTASTVVTNPERGGPSQ
                     PQAPGEDIVMGGTEFSGVKHMRTYTVDDPDAPGGKRDVDFEELAKGYQYGRTVVPFSE
                     SDFSVTKLETKKSFTIIGFIPFSSYSQFINMGETGVVVAQKHNEEAELGLSALIHALH
                     ELESYAVARYVQKDGTQPQILLLKPNPALEDDFECLYDVPLPFAEDVRSYQFPPLDKV
                     LTVTGNVIKEHRLLPSEDLKQAMSDFVDAMDLTGFDVDEEGKPVEYAPIDELYNPVIH
                     RLNQAIRARAVDPDSPIGPPAEILLRFSKPPEKLLDKAKAEIDALIDAAEVKKVPAKA
                     QGRRGRKEPVKPLSGLDIDALLGENKRTTISSDNAVPEFKQILATASDDATIESAAKQ
                     MGEIIRKLIRDSFAGLNYARAAENLRVMREELIALEVPGLYNKFLTGLKKSILSGELD
                     GDRREMWFKHIIGGHLGLISRDESEVSEVTAEEARAYKE"
     gene            1635824..1638148
                     /locus_tag="MYCTH_2092214"
                     /db_xref="GeneID:11507488"
     mRNA            join(1635824..1635945,1636035..1636068,1636161..1636461,
                     1636567..1638148)
                     /locus_tag="MYCTH_2092214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662814.1"
                     /db_xref="GeneID:11507488"
     CDS             join(1635908..1635945,1636035..1636068,1636161..1636461,
                     1636567..1636733)
                     /locus_tag="MYCTH_2092214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662862.1"
                     /db_xref="GeneID:11507488"
                     /db_xref="JGIDB:Spoth2_2092214"
                     /translation="MGFFSPAPYHILSYGILLGATVFHTFIGGIISFRVLPRPQFGAL
                     MAKIFPVYFAMQAGLPAALALTYPGSRNPFGVAGGLAGVLDPSNRWTVLAPLASALLC
                     AVGNLVAVGPQTTRVMEERRQQERKDGKKAYDAPPHSREMQVLNRRFSMLHGISSLLN
                     LGTLVATVVYGVTLSSRLS"
     gene            complement(1639555..1641143)
                     /locus_tag="MYCTH_2303980"
                     /db_xref="GeneID:11507489"
     mRNA            complement(join(1639555..1640146,1640207..1640430,
                     1640477..1640541,1640621..1641143))
                     /locus_tag="MYCTH_2303980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662815.1"
                     /db_xref="GeneID:11507489"
     CDS             complement(join(1639710..1640146,1640207..1640430,
                     1640477..1640541,1640621..1640980))
                     /locus_tag="MYCTH_2303980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662863.1"
                     /db_xref="GeneID:11507489"
                     /db_xref="InterPro:IPR010721"
                     /db_xref="JGIDB:Spoth2_2303980"
                     /translation="MALPVVHTLEECADFSRAVKPFIPQLYDLPAKLLDVFAGHETLR
                     QLYTETNPVISGFAISVFLGAVFLVVAEINRNYSQVDRCWSLLPTLYIAHFDAWARLT
                     GLPSRRIDAALLFSTIWSIRLTYNYWRKGGYGIGHEDYRWEIIRQQVPKVVFHIFNWT
                     FISFIQSILLFAIAAPVYTILLASTIEPDLSSADIASVAVELGLILIEYIADEQQWVY
                     QSAKKQYKDSAKVPRGFEQADLDRGFVTSGLWAYSRHPNFAAEQSIWFVLYQWSCYAS
                     KTLYNWAGAGPSFLILLFQGSTWLTELITAGKYSEYRDYQKSVGMFTPKGLSPYKGPG
                     VKVPKVIRTSELAKMQEQKEKKKQKQK"
     gene            1641694..1644340
                     /locus_tag="MYCTH_2303986"
                     /db_xref="GeneID:11507490"
     mRNA            join(1641694..1641879,1641936..1642133,1642190..1642368,
                     1642420..1642589,1642641..1643974,1644075..1644225,
                     1644285..1644340)
                     /locus_tag="MYCTH_2303986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662816.1"
                     /db_xref="GeneID:11507490"
     CDS             join(1641796..1641879,1641936..1642133,1642190..1642368,
                     1642420..1642589,1642641..1643974,1644075..1644116)
                     /locus_tag="MYCTH_2303986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662864.1"
                     /db_xref="GeneID:11507490"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="JGIDB:Spoth2_2303986"
                     /translation="MTRVLCVAEKPSIAKAVAGHLSGGHYQTSNTRDAYIKNYTFDFD
                     FGPPWGHCSVTMTAVKGHLTTVEFPGDYKQWEYPPPDRLFDAPIMTVVSSDSKSIAKN
                     IEDQARHASALVIWTDCDREGEHIGSEIRDAARKGNARIQVKRARFSNVERAHILSAA
                     RRLTALDDRQVDAVSARIELDLRIGYAFTRFLTLNLRPLGGPLSNLTLSYGSCQFPTL
                     GFVVDRYFRVKNFVPEPFWGIKVMHERDGIQVGFNWSRHRLFDRMSVVILYERCLAAR
                     TAKVTKVQEKPTKKWKPLPLTTVELQKMATRFLRMSGQQAMTVAEKLYNKGFISYPRT
                     ETDRFDKGMDLRALVRKQTQDNRWGSFAQALVDGAFQQPRQGRHDDKAHPPIHPITYA
                     APAALDDNEKRVYELVTRRFLACCSEDARGMATDVEILYGDETFTAHGVIVLERNYLD
                     VYPYENWTGTAQLPRFTVGERFEPTEAMVTEGKTSPPGYLTEADLIALMDANGIGTDA
                     TMAEHIEKIQERQYVQTVVRRGGGNQGAAAADDDDGEADPPPAARGGRGRARGRGSRG
                     GAARGGRGGGGGGVREFIPTSLGVALIEGFDRMHFETSLGKPFLRKEMELKMKAICEG
                     RTTKQVVLHESLSEYRQVYEQSRAELNILKAACRQYVFQQQNGA"
     gene            1646239..1648787
                     /locus_tag="MYCTH_2303987"
                     /db_xref="GeneID:11507491"
     mRNA            1646239..1648787
                     /locus_tag="MYCTH_2303987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662817.1"
                     /db_xref="GeneID:11507491"
     CDS             1647007..1648092
                     /locus_tag="MYCTH_2303987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662865.1"
                     /db_xref="GeneID:11507491"
                     /db_xref="JGIDB:Spoth2_2303987"
                     /translation="MASAVRDIAMTSGRDNLAAVAARSVPVATNPTDLPTPPNSISPS
                     LPPHGLKAQLQRARLDSIDSDLDLLDGRGEHDAGLGSPPHDSAGAITPAMLAKFHLPE
                     ILLNHGPLPIRHIMGYLTTSVPGFAGIAPAKARRLVVAALEGKGSGNDGGGRDGDVEF
                     LKVGWGRWDAKRRGQPPRDSLSRQASPGAHPNSIPIIKTPGWDSERSRLGANLGSSSG
                     GFSAAFSHDDRFMDTDMDMMDHEADKMSLDGSGSASCSEAPDDDDMPRHNDDPEDATD
                     DEDWAAVGAAALRASSYQARFNQQSPFNSIHPFGGGIRSFSAGMARPPQLNAPPRNLN
                     VPSTSGVVAADAQEREAVEALLRLGSM"
     gene            complement(<1650578..>1652415)
                     /locus_tag="MYCTH_107689"
                     /db_xref="GeneID:11507492"
     mRNA            complement(join(<1650578..1651149,1651218..>1652415))
                     /locus_tag="MYCTH_107689"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662818.1"
                     /db_xref="GeneID:11507492"
     CDS             complement(join(1650578..1651149,1651218..1652415))
                     /locus_tag="MYCTH_107689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662866.1"
                     /db_xref="GeneID:11507492"
                     /db_xref="JGIDB:Spoth2_107689"
                     /translation="MEAPNRNRSPQTDSSSPSALTDEREPPRGPLLQRRQQLTEALAR
                     SPYDLILYLERAVVHSDLAYPDLAAGDAYRALLLADEVRDESFEYHDQAKESLRGYRT
                     APCPEVLNHGSLVEDLDQIVDGQGVEAAGECNILANIASVRCFQILSLSLLLCGCLKS
                     ALEFCERGLKMVPHNRELHEIKDYIEQVARRRLRKGPDEPIEIHMLPDRGVVRREVYP
                     WNTHEPDRFCADSLSFLNSKLAKIAPKCEVKVSSLPVLLDGASNTDQYDIIPTCNQLG
                     LFAKQDIGPGEPVLEEYSLLTANNRHKESTCDACGTELPPLQSDSKAVSCPECHDTIF
                     CDEFCFAKAQELYHPAVCEKDVDSIAKDPDPSVIDESLYLLLLARLLAMSTHQDIHPL
                     EVPEIKYIWGDFVSVALNDVDGSITDEPPPEWTLPFSFKYNVETPLHILEKMDIDIYA
                     TLDRHDLWVFNTAYAKFRGTASARKNPRDGRPDVAAVHPFWCLANHDCNPNVTWEWGG
                     RMLLWARETRVVGNQPGGIRAGEEILNHYCDVNLPVQQRREWAQGSLGGWCMCQRCRE
                     EAAAAVATAAGEPREEVNGNGAS"
     gene            complement(1654025..1655793)
                     /locus_tag="MYCTH_111604"
                     /db_xref="GeneID:11507493"
     mRNA            complement(join(1654025..1655284,1655365..1655433,
                     1655496..1655517,1655578..1655793))
                     /locus_tag="MYCTH_111604"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662819.1"
                     /db_xref="GeneID:11507493"
     CDS             complement(join(1654518..1655284,1655365..1655433,
                     1655496..1655517,1655578..1655643))
                     /locus_tag="MYCTH_111604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662867.1"
                     /db_xref="GeneID:11507493"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_111604"
                     /translation="MSKPKYLTGDSAAINEFIDRFDVFLLDCDGVIWSGDHVFEGVPE
                     TLELLRSRGKKIVFVTNNSTKSREDYLKKFTSLGIPSNVEEIFGSAYSSAIYISRILK
                     LQPPKNKVFVIGEAGIEHELRSENIPFIGGTDPALRRDITEQDRQGLADGSLLDPDVG
                     CVLAGLDLHINYLKLAHALQYIRRGAVFLATNTDSTFPSHHTVFPGAGSISAPLAYMT
                     GRQPLALGKPSQAMLDAIEGKFQLDRARACMVGDRLDTDIKFGIEGRLGGTLAVLTGV
                     NRPADWEADDAVAVPAFYVDKLSDLRAAAEQ"
     gene            1657640..1658916
                     /locus_tag="MYCTH_2315114"
                     /db_xref="GeneID:11507494"
     mRNA            1657640..1658916
                     /locus_tag="MYCTH_2315114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662820.1"
                     /db_xref="GeneID:11507494"
     CDS             1657883..1658668
                     /locus_tag="MYCTH_2315114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662868.1"
                     /db_xref="GeneID:11507494"
                     /db_xref="JGIDB:Spoth2_2315114"
                     /translation="MGGQANLYSFPTVDALAPALRAYVIHCQDAGIARHGVFKVAVSG
                     GSLPKTLAQALLASATSEADKVRWDKWEIFFADERAVPLDHADSNYGLLRAELLDKLP
                     ADGPRPAVHPIDPSLLDDTQELADGYEQELVKSFAGRDSVRLPIFDLILLGCGPDGHT
                     CSLFPGHELLRETAAWVAPIEDSPKPPPRRVTLTLPVVTHAVKVAFVATGAGKKEVMK
                     EIFEQGNGLPCALVNEGCGERCSWFVDNAAVEGVTYPRRPFSL"
     gene            complement(<1659410..>1661086)
                     /locus_tag="MYCTH_2118124"
                     /db_xref="GeneID:11507495"
     mRNA            complement(join(<1659410..1659828,1659944..1660336,
                     1660473..1660792,1661019..>1661086))
                     /locus_tag="MYCTH_2118124"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003662821.1"
                     /db_xref="GeneID:11507495"
     CDS             complement(join(1659410..1659828,1659944..1660336,
                     1660473..1660792,1661019..1661086))
                     /locus_tag="MYCTH_2118124"
                     /note="CAZy_ID 267976"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003662869.1"
                     /db_xref="GeneID:11507495"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="JGIDB:Spoth2_2118124"
                     /translation="MRLCWYGSLGQRGPRRFGSQNAIDAAATGPSPSETRYLQPRLDF
                     DIRAAARSAIEAMNKKFYSSAQAIWSPGDPWWLSGVALTAVIDYMRKTGTGDYLGQVE
                     NIIRVQRTQHPQNGGEFRADSTDDTGWWGLAMIRMYDLTGNSTYLNIATEDETFMYKY
                     WTSFPCGGGIYVDTKTKTYKNAIANELYIKLAASLHNRIANDTKYLSRAETAWTWFQR
                     SGMIKGDNLINDGLAASSNGACYNNRLPVWTYNQGVILGALVELYRATSSESYLTSAR
                     AIADAVLSNDGSTNPQLSSPYDGEGGGGVLTEASCKPDEPDGCNHDQQVFKGVLAYNL
                     AELDAAVPDGSRPYRAYLERNAQSAYVNAREQATDLYDVGWAGPPFRNSTIGKQASAV
                     GLLVAVV"
     gene            1662633..1665579
                     /locus_tag="MYCTH_2303995"
                     /db_xref="GeneID:11507496"
     mRNA            1662633..1665579
                     /locus_tag="MYCTH_2303995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662822.1"
                     /db_xref="GeneID:11507496"
     CDS             1663250..1665388
                     /locus_tag="MYCTH_2303995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662870.1"
                     /db_xref="GeneID:11507496"
                     /db_xref="JGIDB:Spoth2_2303995"
                     /translation="MAAVAKPRDSPLPSLPPKLTGPPLRSIPRRPVAAPVTSTSALSP
                     TPSPAAASPNPLPSPGGSISSLLSAYSDHTDDEPLSASADSPEGILDPKSDYSVVSPN
                     LDVQKGSAVAGSPTRGLPSLPSDQDAQKQEPRGRVFEGDDKELPPPPPLKDSQRSLSR
                     PRTPPDLQQQITQPSASTDAGSPSGKGSPQQGELWRRRSLKADKNLVVPDLKLVSSHG
                     STAASAQNSSQSSYSGQSGLESQPLPPPPPKSNPEPSKPAPAQRPPPRGANGGLPGRN
                     IRPARSEEPAAQGEGSMGQEGSRVKENLETVKRGRSGEEELSSQGTGPAATVSSAASA
                     AVSSASAARLPTPEHGVNDAHSPLPDTAVSPMSPASSPRPAGETKPITRKAVGAPGAQ
                     LRHAKSSQSLAPGPEGTGLGVRSPAGLPMSPRPDVNQIQKQTQPPAPPGVDNSKASSQ
                     EQILPVSPTPDRDQTSSQKHYIPYSPPADQNKASAPAQPAAPSPQSDEVARSSPAAPT
                     GASSGNTSTQFAARQTPYPQDPIREPIRPRAFSETESIETVKPRQQYEIPPVLIDSFP
                     SADSTSTLGGGELLPLREPDPNEPDHTDHPGAARFPRGWYTPLPADTIPDARPLTQRH
                     YDCLTQHRYMTANRQRTNPVACRTCGHKDRNAECYICSACYLNVCSGCVAVIRRCKGD
                     LRAVLKEVEKGGSRGSRVSGGNGERNVGQY"
     gene            1665978..1668427
                     /locus_tag="MYCTH_2303996"
                     /db_xref="GeneID:11507497"
     mRNA            1665978..1668427
                     /locus_tag="MYCTH_2303996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662823.1"
                     /db_xref="GeneID:11507497"
     CDS             1666299..1668179
                     /locus_tag="MYCTH_2303996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662871.1"
                     /db_xref="GeneID:11507497"
                     /db_xref="JGIDB:Spoth2_2303996"
                     /translation="MSSTTSTSALSRTRSLRKPTKTETTGSSGEARNVSPSRLPVKGG
                     QDHPGVATTGATRTTRNATIGPGATRSNRPVSGVFARISSTTSTSSRPREEDSPGGPK
                     TSSPPGRPTRAASICQSSASTRLSSGVPAARPTTSSGVPASRRTASGAGPGIRHTRAK
                     SSVTTLSSTTTLRPPPQTCATTSTSTAVLPDRSRPPLTSLTRRSPASGATPPSPTATT
                     SSRRPLSTSSLPGPPKLSQPGKQLGKPLPRPPSQSSSTTTTTTTTTTTTTTTTSNSTA
                     TPTKTTANNNNNNNNNKPAAAATTRPAFTTHQQSFTPLKPPAPKPPTAAFLAPPSPSK
                     LPANVALSAETARLQAELLQLHLLHRAADGTRRAWADSARAALAARFDALRAQADAAA
                     AAECALEEARAVAVLREWGGAPPTGASLEEKIAGLDEVLTGLWGVGEPGGKYERVVRG
                     FEGWAGQVERVVESRRNRGRLHPSRRTSREQSDGREDGGEEDEEQQQRRRQRQQQEKE
                     EEGEEMEDIFIPAPSAAWKAEHAALLRRVEEWRRKLHELGDAPPPEEGEPPSSLGRIL
                     AGCRALADGMLAELELMEQIEREAAADEMAWVKEMNRLDSDVADEGATPRPTAGAIWR
                     VL"
     gene            complement(1668604..1671369)
                     /locus_tag="MYCTH_81165"
                     /db_xref="GeneID:11507498"
     mRNA            complement(join(1668604..1670245,1670326..1670626,
                     1670710..1671369))
                     /locus_tag="MYCTH_81165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662824.1"
                     /db_xref="GeneID:11507498"
     CDS             complement(join(1669053..1670245,1670326..1670626,
                     1670710..1670997))
                     /locus_tag="MYCTH_81165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662872.1"
                     /db_xref="GeneID:11507498"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_81165"
                     /translation="MSAIPQPTQAPPAQEDNSSNNNNNNNNNDATAPAPAPAPAAAAP
                     ASATSNPASTDNTPAPSTGAAGSASSSSGQNDTFPCHWEGCKEVCQTPEALYEHICER
                     HVGRKSTNNLNLTCKWNQCRTTTVKRDHITSHIRVHVPLKPHKCDFCGKSFKRPQDLK
                     KHVKTHADDSVLVAGRGPQDQPGGMNPGYRPHPGNKPPSGFYDHNGHMRATNTGHFGH
                     PHQNGQPSYYGQQQPPPQPTYHTPMYYSHPMGGPRTDYMGHQPQRFNEARKPDFETLN
                     EFFGSIKRAQIDPRSYSQIGRSLMPLHATLGLHAGGGLAAEYMPQAPHTLGGVGGVSH
                     GPLTQHYYLPPMPNLRTKEDLQQIDHMLEQMQATIYDNSGSPNTQYAPVDMRHSPAYS
                     SRPAVDGYAVSAAQVMSPVSAPTHSDGGTPAVTPPSSTLSYTSGHSPTASSAGMSPSS
                     RHSSTSVSYPSLPSRPNLPYPSSAGLGSTFAHNEQRRLSGGMLQSPSGARRDGNQTPT
                     PKALDGAAVSSPSEGSEGGDNETYDEWLHNVRAVEFLRNYVRQRLERHDYDSDSDDGR
                     VDNSRIDPALVDRSRDRVNYPSLPPVQ"
     gene            complement(1673760..1676691)
                     /locus_tag="MYCTH_2304000"
                     /db_xref="GeneID:11507499"
     mRNA            complement(join(1673760..1675301,1675357..1675449,
                     1675511..1676002,1676060..1676691))
                     /locus_tag="MYCTH_2304000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662825.1"
                     /db_xref="GeneID:11507499"
     CDS             complement(join(1673917..1675301,1675357..1675449,
                     1675511..1676002,1676060..1676576))
                     /locus_tag="MYCTH_2304000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662873.1"
                     /db_xref="GeneID:11507499"
                     /db_xref="JGIDB:Spoth2_2304000"
                     /translation="MIWDRRAMSRHNVNPSYSDAIEHHGLPWGGALWLDRAVQKETTP
                     SDSGSSFIRALRFCRDHAGLLAVLSRTGQLRVLSTRREYVDPEVRVDGSPELLEVRRS
                     YELDPLYTEPSRKSDRIVSFDWITMSSPVLQPRVLVLRAGGTFDVLQKPSFTSEYPFK
                     LIPWQPPHRGQTDGTNYRELMQFEPTQAREIYGPFLTEQALADVPLFGPQKANIKELV
                     ERSLTSGLPDRRLLSEEANDSSLLFDGASSIADQLKALRLAAKQGKEQPDDMLLSQLE
                     RHEKLLTDTRDMANLSSKEQFVLDNAMLLRAQEGYRFDPVKNQKIVADDPWLTDVWAW
                     VAGAETAAADGGMMSDPLDISYMGVHTVWTNNLGSKPQMRLSDDAPPPDEAGWERCLN
                     AINKKLGIPKVGGAVETKRRHHRELCLEICSFGRSFDIEFERAVSTSAPGRESTWYTM
                     VAAQALFRGDTNGAVQVLKRASSEHPELLFVSLALQLIGKGGDDDTKTALDFDERVAC
                     KTDPYLRAISAIIATGDWAVIAGQKTLPLRDRCYVAVRYFSDDALTAWLEDELAAAIE
                     TGNIEGIVLTGITDSLVDILARYVHKFNDTQTAALLLSICAPRFIDDIRATAIRNAYR
                     HYLQRHRAFFFRAKFDVESTLRSKHHGRPTLPLPARQIGLRCVYCDVEFKTESLAPRS
                     ATGPGSRTGSSGIPSFMTAAAAAAAAATPSSTTSTSRTEARASRQQANPYTEKMVASG
                     ISCPNCKQHLPRCVVCLEVVGMPRSDRPEQNADPDVRRTARFPTFCVACGHVLHLDHA
                     RQWFARHRECPVPECRCLCNTRVNEELEYS"
     gene            1677824..1678988
                     /locus_tag="MYCTH_2304003"
                     /db_xref="GeneID:11507500"
     mRNA            join(1677824..1678243,1678299..1678988)
                     /locus_tag="MYCTH_2304003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662826.1"
                     /db_xref="GeneID:11507500"
     CDS             join(1677931..1678243,1678299..1678837)
                     /locus_tag="MYCTH_2304003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662874.1"
                     /db_xref="GeneID:11507500"
                     /db_xref="JGIDB:Spoth2_2304003"
                     /translation="MGNKRARSDTEGQPHEDAARKRMKPNRPHKKKQKKPVDMESLAA
                     IKKRARAIERLLSRDNLKIPADKQNELERELAAHKQRIEEARRKKERSTMIKKYHMVR
                     FFERKKAMRFVKQLERKVAQATDPDEVAQLKADLHVAQVDMDYARYFPFMEPYVSLYA
                     AAAATDRDETNAAAHYLRTPRPPMWELIEKTREEGQAALEKLQNRWPQANARSDTPPR
                     SPAKQAANKQHSARKGKKGAQEPGSKGSRSGSTKVEQKHSRKNKDEDGDGDSDDSSDS
                     GGFFEED"
     gene            1679432..1680777
                     /locus_tag="MYCTH_2304004"
                     /db_xref="GeneID:11507501"
     mRNA            join(1679432..1679837,1679927..1680777)
                     /locus_tag="MYCTH_2304004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662827.1"
                     /db_xref="GeneID:11507501"
     CDS             join(1679624..1679837,1679927..1680720)
                     /locus_tag="MYCTH_2304004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662875.1"
                     /db_xref="GeneID:11507501"
                     /db_xref="JGIDB:Spoth2_2304004"
                     /translation="MVTEETTAATGAAANSSILDEPVIYRDLKAWIEEQERNPKPLSP
                     LQQKAISILLGPQEPDIGSRDWVSLLNLFNQAHGSGSSFTDRPAPGQKWLCQCVFRLN
                     PYSAPMTFPGPEAGFVPDEKGTPAAPSFGRKKDAKQYAAKCCVEWLMKAGYMPSDGVS
                     VESPKNKVRPAAAAAAVAVAAAAATRQASPTKAGTAAQAKPTAGNDGEDDDEPPVTKR
                     VEELCRTLGLIVPQYKITPSAIATTTTPAAAADVDPSQTVGQQQQKQQQNPQHGFFDG
                     YADFGPDSGIKVPEGLGRVTNVYGRKGARNRVAEEVLAWLRAEQGRREVEVEEMLSCA
                     T"
     gene            complement(1680783..1682832)
                     /locus_tag="MYCTH_2304008"
                     /db_xref="GeneID:11507502"
     mRNA            complement(join(1680783..1681790,1682033..1682832))
                     /locus_tag="MYCTH_2304008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662828.1"
                     /db_xref="GeneID:11507502"
     CDS             complement(join(1681059..1681790,1682033..1682524))
                     /locus_tag="MYCTH_2304008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662876.1"
                     /db_xref="GeneID:11507502"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="JGIDB:Spoth2_2304008"
                     /translation="MRNHILTAQRLSSAAVATNSGSCTFLATTRTSRPLSTTVPTWAS
                     KPRPSPESGQKLKRPFPITRNTSVIGRPTSTATSGAYAMDPTSADVVDDAIADQLEDK
                     AVSSASLRHGGRRGRDGGRGGERGRGRREVDLSKALSRLLRHQATNAGIELDREGFAR
                     LDKVLQWPPLRSLAPTFPEILDAVHNSEKKRFAIKPNPATNPDLDETSTEPSHWLIRA
                     NQGHSIKLDSEHLLRPLALPSPGGGGLPEGAVAVPPVVVHGTYFAYWPAIVASGGLRP
                     MGRNHVHFSTGLPEDTDAGVISGMRRDAELLVYVDVAASLRDRDGGGIRWWMSDNGVV
                     LTEGDADGLVPLRYFKEVVGRRQGVGLLWKDGEKVADLPEGLKVRAPQGKRGGSGGGG
                     GGSEAGRRGKGRGRG"
     gene            complement(1683683..1687352)
                     /locus_tag="MYCTH_2304011"
                     /db_xref="GeneID:11507503"
     mRNA            complement(join(1683683..1685890,1685951..1687352))
                     /locus_tag="MYCTH_2304011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662829.1"
                     /db_xref="GeneID:11507503"
     CDS             complement(join(1683854..1685890,1685951..1686997))
                     /locus_tag="MYCTH_2304011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662877.1"
                     /db_xref="GeneID:11507503"
                     /db_xref="JGIDB:Spoth2_2304011"
                     /translation="MASTRFAASSWALSSLDYSSTNPQPLEPTPTNNETHDNNILDAH
                     RQNHNSSKLPAFRFADLRKDRISLPSLHQRTPLAPVLSQTVAVDPPEPTRRIPESSHS
                     NSLHRASSTPSLPDRPAALESNQNGAAAPRTRSFKIRFSSPESASANAPVDSKRPVSF
                     PETQKHPSGTSATQSQPAAVAAPAIKRRLTESAIQQSAQGQWELPLPKNLESVKLDDE
                     KSYPPVSYKLPTTASADSTSSGRAVVPPIIRSSRSSGSRKSVILDMPTRHTSGDSYQG
                     EAPDNNSQRDRALRALEGQRDEDISHLTPAESGEMTTTTDNDNTADIFMKIAGEDPAP
                     RASERQEAHPEPGSTSRIVRVSHRRPFSTSSPGQDTASSPPRLSRRLSDQRESSRSHQ
                     VADNQTPPQSLSRESSYRTPGRESLPPIATSAESSSRSQLGRNSSRPSPITPRQISFK
                     DSFAESSSAYQRRRQSLTENNNVPSPRTAQYRSSNLAVTQPRTYHSSPLVPKSTNVLA
                     DGQQHPSSSEANHAVEGTESSSSTAAQSSVWDELDDLKSRIQRLELTGKMPSSVGGGV
                     SRSSSDERPRTATTNATTVSASPKRDPKAAGSSQAEGNNNLPASREARPLLLSALSKT
                     KSLVSPEVFNAIESAATDALALSSMIGPVGQPGPISSSASAVGGYSGGVTDRQLRKKA
                     ESICRSLTELCLALADSTGPKKQLQPAAAAASEQETVVSPTSHLAVGDTPPSQRRPSA
                     IAETIAKGSTSPRAPSSLEQKRKTMLASISVPVPTTRYVAAPATPLESTAGRKSSLLL
                     SRIRRLATEEPEETQTQMQAQSSQAGRRSSLLLRSRRNGSEEPEENREGRRTSLLLRT
                     RKTTSDTEEEPRARVPSRAVTEVNNFHPISRDTSMPAASVQTAAPEGPATPSALPRRR
                     MIPLAIATRLASAVPSASTPTTPARRYLERTSVQERSTPQERGAYQERGSYLERSAQQ
                     ERAINTLAERLAEERGQQQQRQLSLGHPTMLNRSGSLGRRTRETGIPSLRSGLSG"
     gene            1692051..1695121
                     /locus_tag="MYCTH_2304014"
                     /db_xref="GeneID:11507504"
     mRNA            1692051..1695121
                     /locus_tag="MYCTH_2304014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662830.1"
                     /db_xref="GeneID:11507504"
     CDS             1692417..1694906
                     /locus_tag="MYCTH_2304014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662878.1"
                     /db_xref="GeneID:11507504"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Spoth2_2304014"
                     /translation="MSVYQVDSGIADMDQSNPVTIVNPKLVMEGAKMDGASQPGGMQP
                     GALPSESIHRHNDSTSTQTTESADSSPTTTLSIADSSDLSDPSPSSSPDSPVNLAQLQ
                     SFAPTSIGGLSGMARLTVSDPNRDRPMTSPGPRRLKNMKGLSIQPPSTSSSLISEPAS
                     PSFIKPKIAPMKRKPSQLSLKTNSSDLITRTTLEVPNSPTVAPILQRRALKHSMSTPQ
                     MLSGLRSATFGPAGGMTIPTVLERNETGLSSFFRPSRPADGAGGSSAIREEESPIRTQ
                     IANRIPFDSEPYHEIENNEDQKSPGYPDGPIAIYGDNVYLYLEPTAEEAARFDVVINV
                     AREVSNPFKTASANRQSPETKERSAEESPVPETAATTDSFATAFEYLPDNASGDTPTT
                     PKAQPLKEPEYIHMPWDHNTDISKDLMTLCETIDKRTKEGKKVLVHCQQGASRSASLI
                     IAYGIYQNPELSVNDAYYAAQGKSRWISPNMKLMYCLQDFQKEVAKRRLAPGAGSKVR
                     PGRSPTHRATMSADNIEVASKEPLTAPLPADGPTSNSVSRDKSPNRARGNSTPNRGEP
                     ISPGPSSAPSSFSWSEKEDESDPGKYGRFNLDSLVAPKPTELAPPPSLSISRTPPSPG
                     LGGFTLSKPPPSPGFGSFSLSKPPSSPGLGGFTISPARPPSPKPTSLSLPKPPPSPKL
                     APPELSRPPMSPGFPPSDPFSKPPPSPGFGAHRFGSKQGTLGFTSLNLAAPPKPAVTK
                     EPPAPERPVAVVPSFSDVEALMSPRAEAMTNNPIHQSLSELTGVQFVEIPPTPREGLF
                     SPRETMFPRADPRSPPTKGETPIVRSIDEML"
     gene            complement(1695887..1697575)
                     /locus_tag="MYCTH_2138963"
                     /db_xref="GeneID:11507505"
     mRNA            complement(join(1695887..1696181,1696300..1697102,
                     1697188..1697575))
                     /locus_tag="MYCTH_2138963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662831.1"
                     /db_xref="GeneID:11507505"
     CDS             complement(join(1695961..1696181,1696300..1697102,
                     1697188..1697462))
                     /locus_tag="MYCTH_2138963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662879.1"
                     /db_xref="GeneID:11507505"
                     /db_xref="InterPro:IPR012986"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="JGIDB:Spoth2_2138963"
                     /translation="MARTKQATPLRLEPSSEYYSGKHDRTPQIREASATQTMAKMANG
                     KVNGQAPLKDPAPRAEAKTPAATAATGAKKEAGIVTLIIDVAGIYASFLTWAYLQEKL
                     TTTTYGPASSPERFKFPVFLLTIQSLFAFLAGKLFSVATTPRGQPAPPLIPNRQILFP
                     LLLVAFTNALAAPFGYAALAHIDYITYILAKSCKLLPVMFLHITVFRKRYPLYKYLVV
                     AAVTCGVAVFTLHSGSSRARHGAAPSHSGQTAWGMLLLGINLLFDGLTNSTQDYIFQN
                     WRAYTGPQMMAANNLLGSVLTGGYLLLSPWLVTTPVGEWFGMDLTGGGAGELKAALGF
                     LARHPAVWRDVLGFALCGCVGQVFIFHTLSTFSSVLLVTVTVTRKMFTMILSVIAFGH
                     RLSQMQWLGVALVFGGIGVEAQIARREKLAKEAAKKAKTQ"
     gene            complement(1698763..1700513)
                     /locus_tag="MYCTH_2304021"
                     /db_xref="GeneID:11507506"
     mRNA            complement(join(1698763..1699185,1699261..1699832,
                     1699927..1700513))
                     /locus_tag="MYCTH_2304021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662832.1"
                     /db_xref="GeneID:11507506"
     CDS             complement(join(1699042..1699185,1699261..1699832,
                     1699927..1700335))
                     /locus_tag="MYCTH_2304021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662880.1"
                     /db_xref="GeneID:11507506"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="JGIDB:Spoth2_2304021"
                     /translation="MSAPKDTNPPNGSDLPEGMEQLNLGENEQRLGPDGEPAPKTDEE
                     YAQTQLTLRAIVSSKEAGVIIGKGGKNVADLREETGVKAGVSKVVQGVYDRVLTISGG
                     CEAISRAYSVVARSLLEGAPTMGMGGVIQNNGTHPIKLLISHNQMGTIIGRQGLKIKY
                     IQDVSGVRMVAQKEMLPQSTERIVEVQGTPEGIQRAVWEICKCLVDDWQRGTGTVLYN
                     PVVRTQGVGAPGISGGSSYMQDRAPYGGSRVTRTGNGADFSGGGSRPYTRRSDSDPAA
                     RGPPTHDENGEEIQTQNISIPADMVGCIIGRAGSKISEIRKTSGARISIAKAPHDETG
                     ERMFTIMGSAKANETALFLLYENLEAEKMRRQQQAAQASE"
     gene            complement(1704973..1707347)
                     /locus_tag="MYCTH_2304022"
                     /db_xref="GeneID:11507507"
     mRNA            complement(1704973..1707347)
                     /locus_tag="MYCTH_2304022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662833.1"
                     /db_xref="GeneID:11507507"
     CDS             complement(1704998..1707232)
                     /locus_tag="MYCTH_2304022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662881.1"
                     /db_xref="GeneID:11507507"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2304022"
                     /translation="MADSESIHDVPATPPSTTVSSTTVSDRAPTGEGGVGNRPEPQLK
                     KRDRLLRGLQRMSSSPSLNRSGRSRSASSPYSLSGTLSCASLASTSSPFGQPSVSSYF
                     SQPSGAASSSAQTSIPTSPIAERPGQEAREALESVLAARPVGCATPARPTISLPPNVR
                     KKTTTFNLWADMPRELKIYVLSFLRPKELVRISRVSREFHQMCFDGQLWTCLDASEFY
                     REIPAESLANIIVSAGPFVKDLNLRGCLQMEHYQRAEVMVKACRNLINATLEGCRNFK
                     RSTLHSLLKANAKLAHLNLTGLPAVNNATCKIVANSCPQLETFNVSWCKHMDARGIKF
                     VVEACPKLKDLRAGEIKGFHNPDVAEALFRTNNLERLVLAGCDDLTDTALQIMMHGSD
                     PETDYLTGRPMVPPRKLRHLDLTRCLRLTDAGVKALGYAVPNLEGLQLSGVTNLTDAA
                     LEPILASAPRLTHLELEDIAQLTNSLLTQHLAKSPCTARLQHLSVSYCENLSDVGMLP
                     VIRACTRLRSVYMDNTRVSDLVLAEAAAMVRRRCPRPASKGALPTVSLSLVVYDCPNI
                     TWTGVREVLSRNTEAPCPPAAVVRDDHDGKDEEVLTSSAAVTSTHTLDSDSVVPGDGH
                     HGRPAFAVPEKDRLLPAEIITLKCFHGWQMTVDEHTKRVLRGDGPAARRLERKWADFM
                     QANEEAGAGGAGGWRRRRRAREAQMAHDEEGGDGGMGAAGANDAAAWGGRRRRARTTG
                     CTVM"
     gene            complement(1710585..1711310)
                     /locus_tag="MYCTH_2304023"
                     /db_xref="GeneID:11507508"
     mRNA            complement(1710585..1711310)
                     /locus_tag="MYCTH_2304023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662834.1"
                     /db_xref="GeneID:11507508"
     CDS             complement(1710688..1710915)
                     /locus_tag="MYCTH_2304023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662882.1"
                     /db_xref="GeneID:11507508"
                     /db_xref="JGIDB:Spoth2_2304023"
                     /translation="MVMAPTRNRRLARPAIATLSRKWQFAVEPLVFRAVRIKSIELDE
                     SSRPSSRHPIPATPPKLVEEPRVGRCCAPGA"
     gene            1712835..1717235
                     /locus_tag="MYCTH_2304027"
                     /db_xref="GeneID:11507509"
     mRNA            join(1712835..1713396,1713534..1714980,1715037..1716729,
                     1716802..1717235)
                     /locus_tag="MYCTH_2304027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662835.1"
                     /db_xref="GeneID:11507509"
     CDS             join(1713203..1713396,1713534..1714980,1715037..1716729,
                     1716802..1717076)
                     /locus_tag="MYCTH_2304027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662883.1"
                     /db_xref="GeneID:11507509"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2304027"
                     /translation="MAGGDTQHGAEAPGRERLAPTLQIPKNRSTGNLGTVADDDRAGR
                     PRIRFSFDAGAAAVEHETMTSSIVTDHDLGLGMSGLRRIRQQPNALRTPTMPLAGNRT
                     PSLGDSARSASTSVSLDHSVSLSSYPASPTFADDLSRFPSESLHSFSFAHQSEDLIHS
                     RQNVLKRSMEFMRDRMAWSASLNAGIASAQARATGDVAAQTMLDLLSRAHLVGAGNLP
                     NTDPNLLTGPLTGPATTSNANVFEKGFAPRTSSPEPIDKTPLVSPASSAPPPAVVKDQ
                     GPQRDASAPAAADSQPNPPPGENQGSESSSRTPTNESGTSGTTAKSSPPPSRRPSVLK
                     RTMTDTDTAQVSVQQKLMDVMAQPYHAAEPLPQPQHRSSLPFSPAMNPPPSAVSTLHN
                     HPLRVAPAAQAIFTTTSKPPWTIVTANDLACLLFGVTAAEIRKMGILEVVQEERRAWL
                     VGKLQKGAGEDVGDVSEPEIAQPNPAVQTSKLLGGRSGGITAKLLSKPNSRSQTPKTG
                     RRPATIHNGDPRPPKPGQGHRQNSKSRGVLLCGDVVPIQKRNGATGSASFWVIEKKAG
                     LIWVVEEIHEDVAYVDVDEDGLVLKLSGALGPIWGNENLQPGQDIGLLIPRISRQGID
                     PRFGELDYREIARKKYYTCRTSQGVNIPATIEQVKGSTQLRVSSFPHIAGIVVVCPEK
                     LTIKSTNSVFCGALFGYEKPDGMSINHLVPNFDKILRILTERDGVHLVDGIVVPEHSF
                     RKASAYLALEEGRPDAAAGFLRPESLPARHRDGSQLRIDIQMRVVTSEKQVTTHNDAV
                     SENSDGESSAGEGSDKFVVSQTEMVYALWITYSRHLHASRTSKGVPSPQQPSGTATPL
                     YQPSPGQTPAHTPLEMVSDSEESQKGEPEPRPPSLARQLKEAAATAAGKLTGSQKASE
                     SQPPQPATPAKPAEPPHKKTIDDFIILEDMGQGAYGQVKLARYRSTGKTCVLKYVTKR
                     RILVDTWTRDRRLGTVPLEIHVLDYLRRDGLRHPNIVEMEDFFEDSVNYYIEMAPHGL
                     PGMDLFDYIELRTNMEEQECRSIFVQVARAVHHLHTKALVVHRDIKDENVILDGEGRI
                     KLIDFGSAAYIKSGPFDVFVGTIDYAAPEVLAGKPYGGEEQDVWALGILLYTIIYKEN
                     PFYSIDEIMDRDLRVPYTISDESIDLIRKMLNRDVQERYTIDQVLAHPWCRVETAV"
     gene            complement(1718314..>1720999)
                     /locus_tag="MYCTH_2134022"
                     /db_xref="GeneID:11507510"
     mRNA            complement(join(1718314..1719665,1719744..1720269,
                     1720345..>1720999))
                     /locus_tag="MYCTH_2134022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662836.1"
                     /db_xref="GeneID:11507510"
     CDS             complement(join(1718693..1719665,1719744..1720269,
                     1720345..1720999))
                     /locus_tag="MYCTH_2134022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662884.1"
                     /db_xref="GeneID:11507510"
                     /db_xref="JGIDB:Spoth2_2134022"
                     /translation="MASPNGTGSSNSDNRWAQFGFTTTPDERIGAGAPYTSPALQANL
                     FFRVFLGLVSIFVTWVPARLLWRSGEFGGTVLCVMLLVLNLITVVNALIWRDDNVERW
                     WAGQGWCDILTYTFFAMHTAFNICMFEIMRGLASKVALNRAVKLTRSERRRQRVISAL
                     VIFTVPVIQVVLTYFVTSGRYNVSTLVGCGAVYYPNWVYLVFYILPTPVFAVGAAYMA
                     ALAFYRYRKIEKATRDIARSQGGIAAARQDRVRKKLYFMTLFCIIVVLPLIMVLLFDN
                     IVEGAPWSLPYDFDALHFGPDPFNVYFISFTTSDRMSFTALNIAYIGEVAGIVVFIPF
                     GTTPEALNMYREMLLSLGLGYVFPRLKEEYVPHATRGTGSWFSWSSLSRSLRGKSVLR
                     TSSTSTRHGGLLPTTEQVSLESRSGRGHSSSVAQREPRDFTMCELDPLPYPQGTVAAS
                     STSQHNPWPDLSATEVDTTTAQIEAGLPPPTRDPFHILPMSYAMSPHPRFHTPSLSHC
                     QTKGRRQQPQPQPQPQACGAATMTDFSNPSPSSSSSFLTPSRTTQDRDQYTTTFPIMT
                     PAPTTEMASLPTTTNAATVGTSRTALALAQVDTRVWAADDHHHEHDDDAARDPPEQTG
                     RAERAGKRERRRMWWRRKAGREDREVSEGVVLVETRIARQSAELGPAGEEAEEGEGEV
                     CRPAPTLSLAPAPAPPLPPAPAPAPAPAGTDGDDN"
     gene            1722308..1723486
                     /locus_tag="MYCTH_2304032"
                     /db_xref="GeneID:11507511"
     mRNA            join(1722308..1722893,1722981..1723069,1723205..1723486)
                     /locus_tag="MYCTH_2304032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662837.1"
                     /db_xref="GeneID:11507511"
     CDS             join(1722595..1722893,1722981..1723069,1723205..1723272)
                     /locus_tag="MYCTH_2304032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662885.1"
                     /db_xref="GeneID:11507511"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="JGIDB:Spoth2_2304032"
                     /translation="MSAFLRAASRAAVARPATVAAAAAARPFSSTGARPVARITIVGN
                     LADSPELRASSTGREYLRYAVASNSGSGENRKTSWFNVSCFDEGPRRDFFQSLPKGTL
                     VLLEGDVSISNYVDGEGKPRQGLNITQRNLDVLRRPYNPQVAEGGGAQQ"
     gene            1723737..1726328
                     /locus_tag="MYCTH_2304034"
                     /db_xref="GeneID:11507512"
     mRNA            join(1723737..1724030,1724092..1726328)
                     /locus_tag="MYCTH_2304034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662838.1"
                     /db_xref="GeneID:11507512"
     CDS             join(1723915..1724030,1724092..1726159)
                     /locus_tag="MYCTH_2304034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662886.1"
                     /db_xref="GeneID:11507512"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="JGIDB:Spoth2_2304034"
                     /translation="MTKLWLPRGLSRPLRRPVRRNGTGISKRRTFATVGTDSRPFDVV
                     VIGGGHAGSEACAAAARAGARTALITPSIDNLGVCSCNPSFGGIGKGTILREIDALDG
                     LAGRIIDKAGVQFRVLNRRKGPAVWGPRAQIDRALYKKHMREELEAYPNLSIVLGRVS
                     DIVIADNHDDPAADGAKSKITGVRLESGEVLPTSQVVITTGTFLGGEIHIGLEAYPSG
                     RMGEQATFGLSKSLRDAGFQLGRLKTGTPPRIAKDSIEWDILEEQRGDEPPVPFSYLN
                     DAVAVQDQLLCYATYTSPATHDIVRANLDKTIHIRETVKGPRYCPSLESKVIRFGDRE
                     RHIVWLEPEGFDNDVIYPNGLSMTVPADAQLQLLRTIRGLEKAEMLQPGYGVEYDYVD
                     PRSLKRTLETKAIRGLYLAGQINGTTGYEEAAGQGIIAGINAGRAARSLPGVSLSRAD
                     GYIGVMIDDLVTKGVSEPYRMFTSRSEFRLSARADNADSRLTPLGREWGVVSDARWRR
                     FRDDAQRRADLRRILRDTVLSAEAWRRLGVPVLTNESDGGGGKRRDGCEVLRLPGVLP
                     EHLTSRIPGVNDAEFPARVRERVAIEVVYEPYVRMQAAEAARLRRDEDLRLPGDLDYS
                     AIFGLSIVEKAALSRARPETIAQARRIEGVTPAGLVKLLGHVRRSQRRGPTPPPPPPR
                     SEQQQQQQQREGAGAAAPAAALEGLDLTGAEDLETLDAKSRVADL"
     gene            complement(1726474..1727711)
                     /locus_tag="MYCTH_2304036"
                     /db_xref="GeneID:11507513"
     mRNA            complement(join(1726474..1726896,1726981..1727230,
                     1727303..1727711))
                     /locus_tag="MYCTH_2304036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662839.1"
                     /db_xref="GeneID:11507513"
     CDS             complement(join(1726752..1726896,1726981..1727230,
                     1727303..1727663))
                     /locus_tag="MYCTH_2304036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662887.1"
                     /db_xref="GeneID:11507513"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Spoth2_2304036"
                     /translation="MPLTSFLPSPSPKRDPAAAIRNIIPAVSNANLRENIYTIPNILT
                     ASRLVAAPFIGYCILHDYHAAALSLFAYAGITDALDGWIARRWNLKTVVGTVIDPMAD
                     KTLMTVLTVALAMKGALPLWLAVIILGRDVGLAISAIYYRWISLPPPKTFARYWDFSL
                     PSAEVHPTQISKYNTALQLGLMGLTTLAPVIPAVDMSMPLGILQYVVATTTIWSGASY
                     VYSKDAVRILTPQEVEEKKAEAKRAEDKKTDAR"
     gene            complement(1730493..1731193)
                     /locus_tag="MYCTH_2304038"
                     /db_xref="GeneID:11507514"
     mRNA            complement(1730493..1731193)
                     /locus_tag="MYCTH_2304038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662840.1"
                     /db_xref="GeneID:11507514"
     CDS             complement(1730499..1730876)
                     /locus_tag="MYCTH_2304038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662888.1"
                     /db_xref="GeneID:11507514"
                     /db_xref="JGIDB:Spoth2_2304038"
                     /translation="MALLDPPPPDYLLPGSEQCTDSVEQDAAYLVEAAAVARTLPRLV
                     GCNGDARTLVRSGAVLVHGDEYKRWKDGRKWSDGRNLKNGFNIYRELATDPADCMTRE
                     ELVGFFFFFSLPLLSLSLSLFLS"
     gene            complement(1732259..1735842)
                     /locus_tag="MYCTH_2304039"
                     /db_xref="GeneID:11507515"
     mRNA            complement(join(1732259..1732725,1732975..1733031,
                     1733258..1733460,1733531..1733743,1733829..1733902,
                     1733972..1734009,1734099..1734283,1734341..1734523,
                     1734603..1735842))
                     /locus_tag="MYCTH_2304039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662841.1"
                     /db_xref="GeneID:11507515"
     CDS             complement(join(1732527..1732725,1732975..1733031,
                     1733258..1733460,1733531..1733743,1733829..1733902,
                     1733972..1734009,1734099..1734283,1734341..1734523,
                     1734603..1735391))
                     /locus_tag="MYCTH_2304039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662889.1"
                     /db_xref="GeneID:11507515"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="JGIDB:Spoth2_2304039"
                     /translation="MTGNRAIDINGGEDEDEALRIAIALSLGKEPEPPSSPRGRPGTD
                     QVIDLTHDDDGHAGDSGKGSAGEGDDDVVILAAHGDVGRSGPRQKDETATASTAQQTT
                     SVSVFSALGLDRRKMEEERLARLSKRKASSQVGDDGQPAARPAQRPRIADEEKGEVTS
                     LEGRTSTGHGSSSPSSRPDLPLNPSRSSTCPGLHFPRGVVKKTWAYGQPRRGDDIKIE
                     EVLQKQHLHLAVLSSYQWDEEWMLSKIDIARTKLILVAFAADEAQKEEMRSNVPRDRI
                     RFCFPPMHGIGSMHSKLMLLKYENYLRIVVPTGNLMSFDWGETGTMENMVFILDLPKF
                     ETAEGREAQKLNRFADQLFYFLRAQGLDEKLVDSLRNYDFTEAGRYEFVHTIPGSHTG
                     DDALRTGYCGLGQSVNALVGTRSEPVELDLVCASLGAVNYGLLTSLYYACLGDPLREY
                     EERASGSQRNRDAFTSRAISLVKEHMRIFFPSRETVLRSKGGKDGAGTICLLSKWWQA
                     PTFPRELVRDCKSVRQGVLMHTKALYVRPCSPTSQQSGRCFAYVGSANLSESAWGRLS
                     RDRASGKPKLTCRNWECGVLLCTDRTVEGSSGAGSDNLGVFDGCVPVPMEWPGRAISG
                     EGGEGMAAKDKDARTPWFYAEG"
     gene            complement(1737345..1739111)
                     /locus_tag="MYCTH_2304041"
                     /db_xref="GeneID:11507516"
     mRNA            complement(join(1737345..1738871,1739017..1739111))
                     /locus_tag="MYCTH_2304041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662842.1"
                     /db_xref="GeneID:11507516"
     CDS             complement(1737456..1738754)
                     /locus_tag="MYCTH_2304041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662890.1"
                     /db_xref="GeneID:11507516"
                     /db_xref="JGIDB:Spoth2_2304041"
                     /translation="MEQQTAQLPPKKSTPARRRPMRPVNSPARKTYASENDMPSEATF
                     PLEIAGPFTPRKSASNSSAPPSQPNQGKSKPRNGNKGRVKQVSSPGPGKQGRTTPPHS
                     TTSKPIATAAFAGATFHASPAPSSLPIPSFLSKALDSPSVQETDHASREPSPPATDSE
                     AAPTPQHRLLSANDARQESPLDIFFRADRAEKERARRASSANILGQRPIPLSPPSHVR
                     SPAEPRTVPSGRFGTGTRRPVPQRNSSAGIPASELDGTPETVIGPALSKPYQERIREA
                     ISNKKQGDAAQKPTPLQDQAAIDMSERLKQFLAIPSIRSGQQPSQAPETSPQGPTDAP
                     PHPFSSGPQPPHPSGFLPAFSVGSQPPPSAAYHTPPPFATGTQHPVLAPSAPVSMTSP
                     AVNGSRSADILHMEESLRRMLKLNLSPAPAGPQPTKYQSS"
     gene            1739589..1740687
                     /locus_tag="MYCTH_2304045"
                     /db_xref="GeneID:11507517"
     mRNA            join(1739589..1739739,1739815..1740059,1740112..1740190,
                     1740249..1740319,1740375..1740687)
                     /locus_tag="MYCTH_2304045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662843.1"
                     /db_xref="GeneID:11507517"
     CDS             join(1739949..1740059,1740112..1740190,1740249..1740319,
                     1740375..1740473)
                     /locus_tag="MYCTH_2304045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662891.1"
                     /db_xref="GeneID:11507517"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2304045"
                     /translation="MADVEMTDAPASVAVVKNKGAADGEGKEGKKRFEVKKWNAVALW
                     AWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGICNHAFHFHCISRWLKAR
                     QVCPLDNRDWEFQKYGR"
     gene            complement(<1740731..>1741152)
                     /locus_tag="MYCTH_50532"
                     /db_xref="GeneID:11507518"
     mRNA            complement(join(<1740731..1740928,1740987..1741046,
                     1741102..>1741152))
                     /locus_tag="MYCTH_50532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662844.1"
                     /db_xref="GeneID:11507518"
     CDS             complement(join(1740731..1740928,1740987..1741046,
                     1741102..1741152))
                     /locus_tag="MYCTH_50532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662892.1"
                     /db_xref="GeneID:11507518"
                     /db_xref="InterPro:IPR009542"
                     /db_xref="JGIDB:Spoth2_50532"
                     /translation="MAEQLLDQARDLFEGQIDFEGQKLVEVLVNVALTIVGAIAFLVG
                     YFLQDIKLAVYIGLIGTAAVFVLVVPPWPFYNRNPVKWLPVGGITPPANLVVDDKMFK
                     "
     gene            1742343..1744760
                     /locus_tag="MYCTH_2304051"
                     /db_xref="GeneID:11507519"
     mRNA            join(1742343..1743878,1743932..1744760)
                     /locus_tag="MYCTH_2304051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662845.1"
                     /db_xref="GeneID:11507519"
     CDS             join(1742596..1743878,1743932..1744523)
                     /locus_tag="MYCTH_2304051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662893.1"
                     /db_xref="GeneID:11507519"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="JGIDB:Spoth2_2304051"
                     /translation="MSDQEEVANSSGYSTPVPELDDHRNQTASVQRPDRTRRGTFDSL
                     YGARVMAPGGATSEPRVRDFEEAVVDEDGADQSPTMRRARRPTIESASERSSSPPNSV
                     KAFAEARKRERGLSISESKPERKPEEAELQRTASVASRHSYRSRQHTVGTVDAASLAT
                     NKSAEEDVCFPLQDEQRGEQLHIDFDYLENFIRAENEARQAARRPSAARLFPDLRQEN
                     ADAAAAAPTMTIDGDYLGTPFSSNEGYAEKADRLEAEEQAKVVQPPPVDHNRVSFFSS
                     AWESTIHAADLEGLILPGEDIRGLFTFPKGETDGVWWLNINKPSEEEVRAICRAFGVH
                     PLTVEDITTQESREKIELFPSYYFACFRSFCIERDEDSGEIEFVPFNIYVVVFREGTL
                     SFSYANNSHASHVRKRIAMLKDYVALSSDWICYALIDDIVDSFAPVIGKLEADTDQIE
                     DEVFIARTDDMAKFLRKIGTARKHTMALMRLLGGKADVLRGFTKRCNENYKVTPRMDI
                     GLYLGDIQDHVVTMMNNLAHFEKMMSRAHSNYLAQISIDGITQGTNTNRVLSKITLLA
                     SIIVPLNVVTGLFGMNVQVPWHDSDSLAPFFGILGCLLAFCAFCTYLAYRMENKWFSR
                     "
     gene            1744761..1745731
                     /locus_tag="MYCTH_2304053"
                     /db_xref="GeneID:11507520"
     mRNA            join(1744761..1745114,1745361..1745731)
                     /locus_tag="MYCTH_2304053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662846.1"
                     /db_xref="GeneID:11507520"
     CDS             join(1744997..1745114,1745361..1745530)
                     /locus_tag="MYCTH_2304053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662894.1"
                     /db_xref="GeneID:11507520"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Spoth2_2304053"
                     /translation="MSSSDFSIEQSDLEKLSDKDKTELRQFFANEEQRSRIQSQTHEL
                     TGICWKKCITSTIKSGALDKSEKTCLANCVDRFMDANLATMRHLASMRQQH"
     gene            complement(1745724..1747056)
                     /locus_tag="MYCTH_2304055"
                     /db_xref="GeneID:11507521"
     mRNA            complement(join(1745724..1746275,1746335..1746627,
                     1746683..1746747,1746934..1747056))
                     /locus_tag="MYCTH_2304055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662847.1"
                     /db_xref="GeneID:11507521"
     CDS             complement(join(1746188..1746275,1746335..1746627,
                     1746683..1746747,1746934..1746958))
                     /locus_tag="MYCTH_2304055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662895.1"
                     /db_xref="GeneID:11507521"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="JGIDB:Spoth2_2304055"
                     /translation="MAPKDVKKGGASKAGKGAQAKKAAQAALKGVHSHKKTKVRTSTT
                     FHRPKTLVLSRAPKYPRKSVPHEPRLDEHKVIIHPLNTEGALKKIEEQNTLVFIVDVK
                     ANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIAATKLGLV"
     gene            1747209..1748319
                     /locus_tag="MYCTH_2304056"
                     /db_xref="GeneID:11507522"
     mRNA            1747209..1748319
                     /locus_tag="MYCTH_2304056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662848.1"
                     /db_xref="GeneID:11507522"
     CDS             1747264..1748136
                     /locus_tag="MYCTH_2304056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662896.1"
                     /db_xref="GeneID:11507522"
                     /db_xref="JGIDB:Spoth2_2304056"
                     /translation="MAAKKKKGPLKNLAAGRPPVLHRPKSMSRTATKAIINKHHLLQK
                     RKRQAIAKGDKAEVAIIDAEIEALGGLERYQEASLQGQRHDRGGDSSRVLMQWLKSTF
                     SPQKPDSSRRLRMLEVGALSTQNACSKSGHFDIVRIDLKSQEEGILEQDFMERPLPRD
                     ESERFDIISLSLVLNFVPEAKGRGDMLRRTTQFLRAPGRYIDSPGLAASFPSLFLVLP
                     APCVTNSRYLDEERLVAIMESLGYTMAESKTSQRLVYYLWRRVRVCKGPGTVFPKKEV
                     RSGSSRNNFAVVLS"
     gene            complement(1749411..1751480)
                     /locus_tag="MYCTH_2143695"
                     /db_xref="GeneID:11507523"
     mRNA            complement(join(1749411..1750466,1750888..1750928,
                     1751026..1751480))
                     /locus_tag="MYCTH_2143695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662849.1"
                     /db_xref="GeneID:11507523"
     CDS             complement(join(1749831..1750466,1750888..1750928,
                     1751026..1751068))
                     /locus_tag="MYCTH_2143695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662897.1"
                     /db_xref="GeneID:11507523"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_2143695"
                     /translation="MAAAHKPRVVLLDIEGTVCPISFVKDVLFPYALSALPATLASEW
                     STPQFAPYRDAFPPEHAATPEALLAHVRDLMSRDVKIAYLKSLQGYLWEAGYASGALK
                     APLFPDVAPKIRDWASGGPEGVRVMIYSSGSVAAQKLLFRHTDDGSGGQADLTGLLSD
                     YFDTVNAGPKTERSSYERIAAKYPEVPVGEWLFLSDNVREVEAAKEAGMQSYIVERPG
                     NAPLAEEERARHRVVTSFEEL"
     gene            1756478..1759113
                     /locus_tag="MYCTH_2304063"
                     /db_xref="GeneID:11507524"
     mRNA            1756478..1759113
                     /locus_tag="MYCTH_2304063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662850.1"
                     /db_xref="GeneID:11507524"
     CDS             1756954..1759017
                     /locus_tag="MYCTH_2304063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662898.1"
                     /db_xref="GeneID:11507524"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2304063"
                     /translation="MECLRDNFHDGVLLNGRYRTISPLNHGSFGMVFMAKDTLTDQTV
                     AIKCLTKKSAAPDADFEFAIDDKSEELALHGRLGSHPNIVNLNDSFETDAHVYLVLEF
                     CSRGDLYEAIRSGHGPLETEHVRRFMLELVDAVEYMHSKGVYHRDIKPENIFLTQSGS
                     MKLGDFGLATTDEWSYETTVGSDRYMSPEQYDSAGAGYSPAQADIWAIGICLLNILFS
                     RNPFTTPTEADPLFLDFSRDKQSLFDVFPSMSQDTFEVIVQCMNLDPTKRSLAGARDA
                     LLRVVSFTTLDEVLDDFCSTDRRVVASSNREPLRTPSIQSPQVDNGAFPWAKALQATP
                     PKPIRQLSAIPDDEIYEEDLFSKSGATADWMSATAQTPSMASYMDSNLGTSAQSFALP
                     SDFRPVLPAKATAKSDAPVAGSLPITMSKNRDQSTMSLLFGRKDAVSKSWSDLWDEEF
                     EEEEQARQLQARKEMNSRTWSHESAAAASLAADNDDTPRQGLSPATKTATVANDENKI
                     PSIDGALNHADEDSDVDGLFLYEAPPAKEEPQPQLPRNTALSSRRTDFDKWAALGERR
                     RAHGSSPPRKVVNVSLRTGRPVEPTLPASSSAKGRGPFNNSHADSHHQPFSSVSGNHS
                     THHNNNHYHYHHGRWSNNRDRAKECPRHKGRDRDWNWNFDWRKEKRPGFGYLEWVGNW
                     QAARS"
     gene            complement(1760969..>1764122)
                     /locus_tag="MYCTH_115858"
                     /db_xref="GeneID:11507525"
     mRNA            complement(join(1760969..1761456,1761649..1762061,
                     1762181..1762246,1762315..1762339,1762391..1762526,
                     1762596..1763008,1763066..1763854,1763932..>1764122))
                     /locus_tag="MYCTH_115858"
                     /product="amino acid transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003662851.1"
                     /db_xref="GeneID:11507525"
     CDS             complement(join(1761285..1761456,1761649..1762061,
                     1762181..1762246,1762315..1762339,1762391..1762526,
                     1762596..1763008,1763066..1763854,1763932..1764122))
                     /locus_tag="MYCTH_115858"
                     /codon_start=1
                     /product="amino acid transporter"
                     /protein_id="XP_003662899.1"
                     /db_xref="GeneID:11507525"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Spoth2_115858"
                     /translation="MASPNSRNNPPSWDRYERGGASRTGSVSSFGNKSFQSENEALLG
                     RSVESAHDDGDWTQQLRRRRPSITNRLAALTDIGGVNSIRSFTRSWTRAASFPEVIPQ
                     RPSFIFAPDQVPIAATPDSGVVSPYEPEQQHRRREHDVEAGPSPSLIRQQLEAALQAG
                     RVDHGHRPQQQQLSSRTASPEPAGSTSPLLHRQSSRDSRDGELAPIFRVGSHGTTMSG
                     VGSIFAIPPHLATPPLVGSYRSGASGMLMDYGTVRSDASSLSRGYKAAEDAGPAAAAA
                     ALWREQQEAGGNVPDGELPPILVKEVEQDGKIVLAVEGQSTLPQTVFNSTNVLIGVGL
                     LSLPMGFKYAGWICGMATLLLCALVTAWTARLLAKCMDLDPSLITFSDIAYISFGRNA
                     RIVTSFLFTLELIAASVALIVLFADSLDLLFPGLLSVTGWKMICGLILMPLNFLPLRL
                     LSFTSFIGIFSCFTIVLILILDGLMKPTSPGSLIEPAKTYLFPANWLTLPLSFGLLMS
                     PWGGHGVFPNIYRDMRHPYKYARAVKTTFTFTYLLDATTAVTGLLMFGDSVRDEITSN
                     ILLESSYPRALTALMCLCIGIIPLTKIPLNARPIVSTLELLLGLNRQTVAAEYDYPYS
                     HGLVGRGMGFRGVMKVAVRVAVILMFLGIAVLFPAFDSIMAFMGSALCFTICVTLPIA
                     FYLKLFGHEIPIREKMFAWAVMVISSLLSVVGTVWAFLPKSLIGAEPSTPEL"
     gene            1765098..1767231
                     /locus_tag="MYCTH_2304071"
                     /db_xref="GeneID:11507526"
     mRNA            1765098..1767231
                     /locus_tag="MYCTH_2304071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662852.1"
                     /db_xref="GeneID:11507526"
     CDS             1765273..1767063
                     /locus_tag="MYCTH_2304071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662900.1"
                     /db_xref="GeneID:11507526"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2304071"
                     /translation="MGQRTFATRGDRPSRMVLSDRVARGSRADDASKRSRDRDRPEGP
                     WGGANRTVANIDPARRRGPASNRRDRKADTRDEPGQTRDKDESHFKALKMQRALATIS
                     YRQRTAVKARISDVESFEQFDLLPSLKEAVYNEVLKGMVDVKPTPVQRLAIPALLGKP
                     VGQNADAGRRPKRAEPKREEFLLAAETGSGKTLAYLLPIIQALKIAEADDDAVKAYNE
                     RLEAERERRGGAPVSEWIDKFEPHPNHARPRAVVLVPTAELVDQVLATAKKISHVAKF
                     KVRPVSASYSPVKIQRNMYSHGGIDMVVATPHLLAAMAESDPNILSRVHHLVIDEADS
                     LLDRSFSPETTKIVERAMPSLKQLVLCSATIPLRLDNYLADHFPDIKRIATPNLHAIP
                     RRVQLGVIDVSKDPYRNNKLLACADAIWTIGKDSSLQGDADEVVDIKRIMVFVNERET
                     TQQVADYLVSKGIDAVALHRDTPEHRQSEMLASFTTREPMRATRDEIEAAKQAVLARA
                     GPAAPRRHLPNTKVIVATDLASRGIDTLAVRHVVLYDVPHTTIDFIHRLGRAGRMGRR
                     GRGIVLVGKNDRRDVVAEVKESMFRGQALI"
     gene            complement(1767473..1769965)
                     /locus_tag="MYCTH_2304073"
                     /db_xref="GeneID:11507527"
     mRNA            complement(join(1767473..1767976,1768282..1768898,
                     1769089..1769270,1769405..1769466,1769557..1769640,
                     1769784..1769965))
                     /locus_tag="MYCTH_2304073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662853.1"
                     /db_xref="GeneID:11507527"
     CDS             complement(join(1767485..1767976,1768282..1768898,
                     1769089..1769270,1769405..1769466,1769557..1769640,
                     1769784..1769891))
                     /locus_tag="MYCTH_2304073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662901.1"
                     /db_xref="GeneID:11507527"
                     /db_xref="JGIDB:Spoth2_2304073"
                     /translation="MTDDAGAMDDYMFRSYVTQFKYVHEETSYLEIFNYTDPSFNTCE
                     EHRFRSDELQDEFGNFLHRRGAFAPPKLRPGVELVSGIRLILQQNAQHPETFTPCYLS
                     LTHQAYEDMIRAWHLPFRAIEGSSVVGPFFWSAFDQDDDDPHLQIIFRKSDVRKKGKT
                     RGWELMLSHSFRTHITTGYAKGTPSSDIVESIRHLRACAGQVMHPLLLPVIILSHDLS
                     MKNDQKQRQARQWLRDLEAAVSMRQEVLEEESKYMRGPMIDLDLINMDLVECHSQVLW
                     KRPQAYQEIVSAVRQAMDRFWSRAAADPAYGGRGGTVDKVHRSMLSRLDFYQAKLKGI
                     ENYAHITLERLTIQRAALYNIIAQKESKLGLQMAGEQRRLAHAAKRDSTEMKVLSLLG
                     AIFLPATYLASIFGMAFFNFVPDGGGGNNNNNNNGGPAEGSGDGGSKWNSVSPLLWIY
                     FAITVPLTVVVVVCWCLWDRRRERRFEAEDADIEAGIEKMEAQIMATMRKRTMSKMRT
                     WEVGKH"
     gene            complement(1771585..1774064)
                     /locus_tag="MYCTH_2304075"
                     /db_xref="GeneID:11507528"
     mRNA            complement(join(1771585..1771832,1771950..1772324,
                     1772462..1772715,1772821..1774064))
                     /locus_tag="MYCTH_2304075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662854.1"
                     /db_xref="GeneID:11507528"
     CDS             complement(join(1771805..1771832,1771950..1772324,
                     1772462..1772715,1772821..1773840))
                     /locus_tag="MYCTH_2304075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662902.1"
                     /db_xref="GeneID:11507528"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2304075"
                     /translation="MHALGFLRRKRTRDGAQGHSSSSNPTSPVTPTANGFDQHPVPRG
                     SRSSAGSQSTRHSSATATQQQNRPAEAAAGQQEQEQEQAQEQKQEQEQEQAQEQPMNT
                     LSPQQPPYAVAQQHTPSPGTDPQNVPRIANLINPPHNEGQADYQQLQGAPSAQYTSSN
                     GGVMSSHPHQQQQYHHHLHHFNHHHHQEQQPQQQQTHEEQKQQQQQQQQQQQQQEQQQ
                     QQQQRPTQQVVTTQGEGRVTKGKYSLEDFNILRTLGTGSFGRVHLVQSRHNHRFYAIK
                     VLKKAQVVKMKQVEHTNDERRMLGEVKHPFLVTLWGTFQDARNLYMVMDFVEGGELFS
                     LLRRSGRFPNPVAKFYAAEVTLALEYLHSRNIIYRDLKPENLLLDRHGHLKITDFGFA
                     KRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWDSGSPMK
                     IYENILRGKVKYPAYINPDAQDLLERLITADLTKRLGNLYGGSQDVKNHPWFAEVTWD
                     RLARKDIDAPYSPPVRAGTGDASQFDRYPEEVEQYGAPGNDELGYLFQDF"
     gene            complement(1775502..1777138)
                     /locus_tag="MYCTH_2304079"
                     /db_xref="GeneID:11507529"
     mRNA            complement(join(1775502..1776464,1776534..1776604,
                     1776664..1776687,1776750..1777138))
                     /locus_tag="MYCTH_2304079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662855.1"
                     /db_xref="GeneID:11507529"
     CDS             complement(join(1775702..1776464,1776534..1776604,
                     1776664..1776687,1776750..1776845))
                     /locus_tag="MYCTH_2304079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662903.1"
                     /db_xref="GeneID:11507529"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="JGIDB:Spoth2_2304079"
                     /translation="MLNLKSTLSALWLATLAWGTARAEEDNVKSIPLRTHSLSQPYLD
                     SDMQSRWYDFGGDTIIRTDQYIRLTSDYPSQSGWLFSRVPLTATNWEVEVEFKIHGKN
                     QLYGDGFAMWITKERGKIGPVFGSADRFEGLGIFFDTYKNNRPGVVFPYVMAMVGDGQ
                     KSYDKDTDGKNSEFAGCSARGIRHASVPTKFRLTYFQDKYLKLELQYKSEGEWTLCFE
                     TNQPPAIPQVAYLGFSAETGELSDNHDIISIEAKNLYHAQPTGGKSTPGSGRGKKVAS
                     PKEGGSWTWFFTKIFLFFLVIGGGYVGYTAWRANNKRSHRF"
     gene            <1777961..>1778328
                     /locus_tag="MYCTH_2061176"
                     /db_xref="GeneID:11507530"
     mRNA            join(<1777961..1778044,1778146..>1778328)
                     /locus_tag="MYCTH_2061176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662856.1"
                     /db_xref="GeneID:11507530"
     CDS             join(1777961..1778044,1778146..1778328)
                     /locus_tag="MYCTH_2061176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662904.1"
                     /db_xref="GeneID:11507530"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="JGIDB:Spoth2_2061176"
                     /translation="MDSDTVKKTIIRQALQATNTANARTLIENINEKCFERCVPKPGS
                     SLSSGEQTCLTSCMEKYMAAWNEVNATYIRRIQQEMGNQNISNA"
     gene            complement(1778473..>1779915)
                     /locus_tag="MYCTH_2092294"
                     /db_xref="GeneID:11507531"
     mRNA            complement(1778473..>1779915)
                     /locus_tag="MYCTH_2092294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662857.1"
                     /db_xref="GeneID:11507531"
     CDS             complement(1778641..1779915)
                     /locus_tag="MYCTH_2092294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662905.1"
                     /db_xref="GeneID:11507531"
                     /db_xref="JGIDB:Spoth2_2092294"
                     /translation="MSKPGFSFGLKKAGPAKPAPAPRKPAPFGGGDDDGSGDESGPKN
                     AAQVSELDVFNTSSEPSAPSDTPDRRKKPTSKPLKPPQPPVTAPEANQFTDLSSALTS
                     RKYAAEAAEADPSIYDYDAAYDSFKAAKAAAKKAAENGGEAGGGPEKKPRYFQALLSA
                     ADQRERDRQIAEERRLQRERAAEGDAFADKEKFVTEAYRRQQEENRRLREEEERREEE
                     ERKRNAGRGLADFYKGMLERGEREHAALVRAAQEGVRPPAARDGSGEGGQEEEEEEEK
                     SAADRAREINAKGGNVLINDEGEVVDKRQLLKGGLNVAAKKKAEVQREKERQAQAAAA
                     SARAGAGAQPRGGVYAAGGKRAMRERQSKMLEAQLEESLKRSRQEAEEEAAKVQLASK
                     SRKTEAEISSARERYLARKRAAEEAKKNGEVP"
     gene            complement(1780270..>1783576)
                     /locus_tag="MYCTH_2138981"
                     /db_xref="GeneID:11507532"
     mRNA            complement(join(1780270..1781010,1781120..1781914,
                     1781998..1782581,1782818..1782821,1783522..>1783576))
                     /locus_tag="MYCTH_2138981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662858.1"
                     /db_xref="GeneID:11507532"
     CDS             complement(join(1780490..1781010,1781120..1781914,
                     1781998..1782581,1782818..1782821,1783522..1783576))
                     /locus_tag="MYCTH_2138981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662906.1"
                     /db_xref="GeneID:11507532"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="JGIDB:Spoth2_2138981"
                     /translation="MFELRRINVGFDFDVSMRGIHQAGGGVSGKTQTVRTVNGAVLAH
                     LRQVYASHAGSATEWSPEKKAAFLKDIQHDTEAESAPELASGKAWDFNEFLRYMTSSI
                     TNAVAPPHEEDLSWPLSSYFISSSHNTYLTGNQLSSDSSADAYKNVLLRGCRCIEIDV
                     WDGDDSDDDGETSSSSSSSSSDDEETKEKRKSRFSKVTGKLPKSLTSRFEKTSLEKPG
                     NTAAPTVVPTEAPSTTPPANPLQKVSSGKEPRVLHGYTLTKEVSFREVCVAIRDYAFA
                     VTDTPLIASLEVHCSHEQQETMVAIMRETWGDFLLPEPKEDAKHLPSPAELRGKILVK
                     VKYVPPDAEEEEEEALPGDNQTAKAKKPSKIIQALSKLGIYTRGVSFKSLTQPEATMP
                     THIFSLSENGVMEVHEKSARELFEHNRRYLMRAYPSGLRIRSSNLDPAVFWRKGIQIV
                     ALNWQNWDEGMMLNEGMFAGTSGYVLKPEGYRIDKPLPAPSTPENPQATAVKHYTLDL
                     TVQVLAAQSLPLPPGDDNPSSFRPYVKVELHVEEPGERLDKDALPEDGREKEGEYKAK
                     TKSRKGCDPDFDGQELRFEGVPGVVPELSFVRFLVRDDEVGRDSLAAWACVRVDRLRE
                     GFRFVHLVDAEGVETEGAILVKVGLKLR"
     gene            complement(<1785361..>1785549)
                     /locus_tag="MYCTH_50021"
                     /db_xref="GeneID:11507533"
     mRNA            complement(<1785361..>1785549)
                     /locus_tag="MYCTH_50021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662859.1"
                     /db_xref="GeneID:11507533"
     CDS             complement(1785361..1785549)
                     /locus_tag="MYCTH_50021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662907.1"
                     /db_xref="GeneID:11507533"
                     /db_xref="InterPro:IPR007889"
                     /db_xref="JGIDB:Spoth2_50021"
                     /translation="MATIADRRIERAKREVSIALAINALNAKQVYSIRQAAKLFNVPA
                     STLCDRFTGKRKENKVSK"
     gene            complement(1785962..1786056)
                     /locus_tag="MYCTH_t95"
                     /db_xref="GeneID:11507534"
     tRNA            complement(1785962..1786056)
                     /locus_tag="MYCTH_t95"
                     /product="tRNA-Leu"
                     /note="Anticodon: TAG"
                     /anticodon=(pos:complement(1786021..1786023),aa:Leu,
                     seq:tag)
                     /db_xref="GeneID:11507534"
     gene            complement(1786621..1789327)
                     /locus_tag="MYCTH_2304085"
                     /db_xref="GeneID:11509866"
     mRNA            complement(join(1786621..1788944,1789004..1789082,
                     1789150..1789327))
                     /locus_tag="MYCTH_2304085"
                     /product="ARP8-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662860.1"
                     /db_xref="GeneID:11509866"
     CDS             complement(join(1786802..1788944,1789004..1789082,
                     1789150..1789189))
                     /locus_tag="MYCTH_2304085"
                     /codon_start=1
                     /product="ARP8-like protein"
                     /protein_id="XP_003662908.1"
                     /db_xref="GeneID:11509866"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="JGIDB:Spoth2_2304085"
                     /translation="MVGKVSDRVLLREGLERTDNGMRQTSWPEVAPINQKNYYTDYMK
                     RDDQILSYRLQSEANRDRLVQNSKDRDRAMNAANANGEVPLPLDEAEEGPAPSTGTLD
                     PSKIIVIHPGSQNLRIGFASDALPKTIPMTLATKYPQTESEMYEALPRRHFEGRTMEQ
                     QHGEEWAKKYQKMCNDLKVDMRANKRKVLPNSKDLVINFNRRTEPEVISQHNDPLQIE
                     WTDVNAPRENEPTSAVFIGQQALRVPDDSNPKYKLWWPIQHGRLNEDDYPTRAHLFND
                     LETLLDRAFRWELGLKKKADWKQYSCVIIIPDLYDKRYVELLLHLCIELFEFNRVSFI
                     QESMAATFGAGYTQACVVDVGAQKTSISCVEDGLCIEDSRINLKYGGYDVTETFIKMM
                     LYDNFPYQEINLRRRYDFLLAEELKIKYCTLSQANISVQNFDFHLRAPNQPTRKYQFK
                     FYDEVILSPMGFYDPSIFDNSAKLNGRRKLIDRSYNAYDVDIPDDPASAAQLAILALI
                     RPSVTETTTTSFSGAPGDVATPSKERSQPFSFLSRNGDVTGTPGTSKAPSPAPDGAST
                     PVPAPYIFGSSRDLNGSGSPAPSARNGGGATPAPANGTSQLPSTSFDGPTSQQPQVQE
                     RSAISLAIERDSVLPIAPLDIAIMTSIQNAAKGDDKKVKELLGSIMVVGGGAKIPHFA
                     PFLEEKLKLRRPDLADRILVSRSAREMDEQVVVWKGASVFAKLPTNDSWITGFEYKML
                     GSRVLYHRVLWQY"
     gene            1789961..1791086
                     /locus_tag="MYCTH_2304087"
                     /db_xref="GeneID:11507535"
     mRNA            1789961..1791086
                     /locus_tag="MYCTH_2304087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662861.1"
                     /db_xref="GeneID:11507535"
     CDS             1790207..1790938
                     /locus_tag="MYCTH_2304087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662909.1"
                     /db_xref="GeneID:11507535"
                     /db_xref="JGIDB:Spoth2_2304087"
                     /translation="MPPVQVHTKSPINAAKASGVTPQTAAPGVAGPDVSGDATTTPIT
                     TTTAAAAAASSAFHPSSNPPPTRTTPSLQQPPPPPQPGAVPRLPEATGAPAPPRNSTG
                     DSPGAGGPAPPRAPTATAAPIPGVSYPPQMGRPPPQAGHNQRGTTAAPLGGGAYPGPG
                     PGPGPGGYYYYQQNGSSASSAAAAAAAGYVPPYQGGGGGGSWGTGEDEEEGFFGSALK
                     LAKAAGEKLSAAESEVWRRINGEGN"
     gene            <1797223..>1799552
                     /locus_tag="MYCTH_48564"
                     /db_xref="GeneID:11507536"
     mRNA            join(<1797223..1799004,1799097..>1799552)
                     /locus_tag="MYCTH_48564"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662862.1"
                     /db_xref="GeneID:11507536"
     CDS             join(<1797223..1799004,1799097..1799552)
                     /locus_tag="MYCTH_48564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662910.1"
                     /db_xref="GeneID:11507536"
                     /db_xref="JGIDB:Spoth2_48564"
                     /translation="QQETQIPSFSFNDPGSQYDGNAAQLEPNPFAGMDGNVTLPPRTD
                     SMMASHAAWTVPTPQGLRPRPATIHEGFSFCVGGGFEGLPAWDPSSLGAGATTTATAT
                     ATATATATTTTTTTSDTMSSRPVSVHQDFYPATTMENGECGGRQGAIDDGLTVIGSDA
                     WAQKPCDGNLEMSGLEPDMIGQAYTTDEAIPILDLRSFGPSMDGDSRALDGTNARRMS
                     GSSFTLSTTGGLSEITSYEDFSAALSDAPSLSSDYPPPSNRTSMISSTHLSPVASPRM
                     TPHSRSELVRTQSRGRASPSPRPGVRAVPYSVEGARNKRWSTGSYGTASSNRRPSPFV
                     YHHPHDAFNLHARLSSSSAASPHHSSPTIAQGQLPLSFGNLQAAQQQHPFLYGPAPAF
                     QHIQHNNHMLVPSQLPSNAFPPESSHRNPFENPPPPPVLSHGLFRMLQSNADPHSLGH
                     GHYADLSDPPDLYASLHEEQIPPPPEDMNPEDQDLVPHEQELRFEGDLYTPRWVRGHG
                     NKREGWCGICKPGRWLVLKNSAFWYDKSFTHGISAATGSPFQEPQETRRMDGNPDVWE
                     GLCGSCNEWIALVSSKKKGTTWFRHAYKCHTHPKIKDAPKRKREGGGATTRVLPASTM
                     AKPRTEPLTPQMMTPATSSTAVTPTPATATTAAARPEGQDSLQPSGREQPQAQPQHTP
                     SSSSSPSSSQEVQQQDRQQAQETRLQPPPVPPPRPRALPPRSSSLMNPLVAAVGGVDG
                     FPNMI"
     gene            1803680..1806901
                     /locus_tag="MYCTH_2304098"
                     /db_xref="GeneID:11507537"
     mRNA            join(1803680..1803872,1803959..1806097,1806186..1806901)
                     /locus_tag="MYCTH_2304098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662863.1"
                     /db_xref="GeneID:11507537"
     CDS             join(1803847..1803872,1803959..1806097,1806186..1806393)
                     /locus_tag="MYCTH_2304098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662911.1"
                     /db_xref="GeneID:11507537"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Spoth2_2304098"
                     /translation="MTADPLDSSSGDSAVQPPTPKRTPISPVFPSPVFETPKQNDGRL
                     DESSGWTPRFAEEYSVFNATPGNLRGSRNPFPDFGPPTPYSSSTAQKRALSTDGLGLG
                     VAVHVSESPSDPNLSLPPVEPSKVLRSSPVPRRSQTFDSSGAASENPESVEQAAKKAR
                     RGTVVTEPAGQAVTPPPTARKGERKLAPKPDTAAMQNDQDYGQQAHFMASAQQQGMGS
                     FVTTQGDMFGYPLPASTGPTPYTTQRPFWDADPGLAGMEIDFSSANGAGVFQPPTPQQ
                     VPDPVDWARTNHLLPDQGGMAGHGDVSAGAHQASLGSQPPMSMLATSSADQSMFAASY
                     PTPIDDPFGISDAGGAVNPGLLFSRPQSANMDASFNQPIPVPNPNPAMAHSGQMDSTG
                     PSVSKNAEQRAELRRSASAKDPTPRKTDHRALASSPTKESGRPGLSRSSSENRGKKTL
                     GRPALPPLAPRPRSQLVSNAGVNANKPVVSQPQRPSGRSSPSKSAHHHHHHHRLSSLS
                     SIRETSGPEMRTQATFMIDANGRARVETTVVVVEEPSPSVAKRHGSYSVTSRQQWDSS
                     DDDDSSSTDDEPIIIPSRNTSFALPDPRKPTTIHPFHNSQRSISDRSSTSYTSSHGPS
                     REAGDSDGETVVHELTPTRRASGDALSELRKLRESRQKQSNSRPKRLGSSYYASHPST
                     SPTTMSDSSLPTPTTDTRTRGIRCVCNRTGASRNELMIQCESCEMYVHGQCVSITERT
                     IPSIYICAFCANTPNVRGGRPRENGRLPGTAGPLVSVTSPLAHKSLKSFR"
     gene            1806903..1809144
                     /locus_tag="MYCTH_2304102"
                     /db_xref="GeneID:11507538"
     mRNA            join(1806903..1807108,1807227..1807315,1807466..1807486,
                     1807650..1807721,1807967..1808693,1808832..1809144)
                     /locus_tag="MYCTH_2304102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662864.1"
                     /db_xref="GeneID:11507538"
     CDS             join(1807265..1807315,1807466..1807486,1807650..1807721,
                     1807967..1808693,1808832..1809067)
                     /locus_tag="MYCTH_2304102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662912.1"
                     /db_xref="GeneID:11507538"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="JGIDB:Spoth2_2304102"
                     /translation="MATHNIVVFGGDHCGPEVVAEAVKVIKAIETHSPSAGKFNLQDH
                     LLGGASIKVHNTPLTAEALAAAKSADAVLLGAIGGPEWGPSSPVRPEQGILQLRKELG
                     TYGNLRPCSFASEALVESSPLKAEVCRGTDFVVVRELTGGIYFGDRTEDDGSGFALDT
                     EPYSRAEIERIARLAGFLALAKNPPSKVWSLDKANVLATSRLWRKVVSEVFAKEFPQL
                     ELGHQLIDSAAMLMVKNPRALNGVVITSNLFGDIISDEASVIPGSIGLLPSASLGGIP
                     DGKSKCNGIYEPIHGSAPDISGKGIVNPIGTILSVAMMLRYSLNLPKEAAAVEAAVKL
                     AIDNGTRTKDLGGNAGTAEMGDAVVAELVKLLKA"
     gene            complement(1809534..1811553)
                     /locus_tag="MYCTH_2304104"
                     /db_xref="GeneID:11507539"
     mRNA            complement(join(1809534..1810654,1810786..1811553))
                     /locus_tag="MYCTH_2304104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662865.1"
                     /db_xref="GeneID:11507539"
     CDS             complement(join(1809555..1810654,1810786..1811188))
                     /locus_tag="MYCTH_2304104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662913.1"
                     /db_xref="GeneID:11507539"
                     /db_xref="JGIDB:Spoth2_2304104"
                     /translation="MATCALCSSFSMTVQDFATVLVYLLLQYLAMNLFAYTLKPEDHV
                     ERRPKPNHPVSQPPPPARQDEPQPPISTVTRAACLRYAQRLYPGATILEAEPQGRCSY
                     TLFLPPDDRHSGTILQFRPPRHRIDLCITAAAETIFGNLVPHTEFHSVLTPCQCQCQY
                     RFRGPRSSHCSPPSSSSSSSPSSSLSSSSSSSSSSHPHQHRSRSRSRSHEVSRPSHGP
                     GGRCPHKHQDGASGTVVLYTHSLLPGTPLSTLLTRQQQQRRRREGGGGAQSPGLELVV
                     RALARRYFAPSYRHALAPDSPRLPAAKRAVGWSLRRAVARLAGAAADGLPGAATAAAV
                     AAVTAVGGWLEEVEHGLPWALTHGDLVGGGNLLVSAGGGGGGDDEGEKEEAGYDEDKD
                     DGQEAPELTLTGLVDWAEGEWLPFGVGLYGLEEVLGRTVTDEETGSRRFEYFSDAERL
                     RAAFWDELVREVPALAPGTELRERVEKARLLGLLLWSVTPRLFHSEERPR"
     gene            complement(1811555..1814448)
                     /locus_tag="MYCTH_2304106"
                     /db_xref="GeneID:11507540"
     mRNA            complement(join(1811555..1813890,1813948..1814448))
                     /locus_tag="MYCTH_2304106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662866.1"
                     /db_xref="GeneID:11507540"
     CDS             complement(join(1811808..1813890,1813948..1814243))
                     /locus_tag="MYCTH_2304106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662914.1"
                     /db_xref="GeneID:11507540"
                     /db_xref="JGIDB:Spoth2_2304106"
                     /translation="MAQNLVSTVITYHKPGTQPPLYVAGTFSDPPWQPQEMDHMARQD
                     GEYDFKKEIRAEPRSRIQYKFRVGDGEWVLKDDGPTTTDSFGNTNHVLEVGTQEEAST
                     TQAQDREGTRDRRESRGAGRLSYAKVAAKQFEPPAEQASAGRSRTGTPIFARTAAEVA
                     DSSAELLHEEVPEREKPEGNRNRGEEAGRRNPDAAEPAPKVADASNKPEKRQVYLASL
                     SHSPLGEVSCARQLTTQSTVVILEPPAGEGRPFRVLPQSEEFPDDQEGTIADKPPLFA
                     HECAGMHEMDDELTEEEGGDAAQTPPPFEDIDPNSVDLNDPTLEHFPSSREDIMDRVQ
                     KLKTGLPADHASFSCKPPSPVVNPSRRGTEDITGDFLLVNPQSASPTTRRASKNTPRG
                     SIGSFSATASLHSISENEEAVEDEIDDRPAVVFSNPLKPRPKRLNIPASDEDERIALR
                     ESVSLTALKSPRASVVSSEGSSPPSPKTVWKDGRPADLTSAEVELGKDKDRSIEEVKL
                     HPTPQASDPGPGQTGPETRGEEAKKEDTGMTESPVSYAGVAATKSAGVTTKAEYTPGR
                     KTSEGPGESKKTTSQGPRRLSYAEVAASKPAKAEAPSEGTPKGPKPPRAEHRPESGGG
                     GRGKDRAAPHPSGPRRPSYAEVAASRLSPPPPPPPPPPPPSSDDASKAQPAPPTSSAG
                     AESSASKPATTDTSAADRDQHEGGSTSKDLRKRAGGAGGGTSGPEPTRTSDSGSVGVP
                     AVHPKYGADWVRAMFRLVFVDLVGGAVKRVLRLFGLDRLFGAGRGREGERDA"
     gene            1815349..1817123
                     /locus_tag="MYCTH_2304108"
                     /db_xref="GeneID:11507541"
     mRNA            join(1815349..1815519,1815580..1816647,1816722..1817123)
                     /locus_tag="MYCTH_2304108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662867.1"
                     /db_xref="GeneID:11507541"
     CDS             join(1815444..1815519,1815580..1816647,1816722..1816924)
                     /locus_tag="MYCTH_2304108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662915.1"
                     /db_xref="GeneID:11507541"
                     /db_xref="JGIDB:Spoth2_2304108"
                     /translation="MAGLPPHTIHVKRKRGNDEDAVEFLRLEESKRSRSSEEGGWVYQ
                     LKQTIGTRTGPAVEPSSPGIPVIQTSRAGDENRRPKRPRQQGEPPVKDDATAPGAAPA
                     PSAGPENTAPTTSHPAPDRIRRFHLSKSHSPQPAAGVSKKRAVPAVFVERGAKKHRET
                     LKALIQEHGVAPTGQSKPVDSSRPPEPSEPRNGETPAVQQPSPVKYKRPGTRACTQAA
                     KNKTLPPSMQQREDIDMDELARAMDSWTVEEINKNLDRVKAESTTSKYSPATSRFKPK
                     APKLRYFERHPESVAAKQRGDAVSQAPSGTAAMSVDAAAEDTTDEEDYVLETYERVPA
                     ERLREQAVPSHRVGLLVFDTEPDMVEFFYGTEGDSDDDLPEDEEDENAENYYTADYPE
                     EELDWDDEFDRNPYTYTTQNDSDREEYDLRYFDDEDNWHDDEQYGSFARRSEEWRP"
     gene            complement(<1817170..>1818333)
                     /locus_tag="MYCTH_2126672"
                     /db_xref="GeneID:11507542"
     mRNA            complement(join(<1817170..1817180,1817262..1817450,
                     1817511..1817570,1817640..1817810,1817883..>1818333))
                     /locus_tag="MYCTH_2126672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662868.1"
                     /db_xref="GeneID:11507542"
     CDS             complement(join(1817170..1817180,1817262..1817450,
                     1817511..1817570,1817640..1817810,1817883..1818333))
                     /locus_tag="MYCTH_2126672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662916.1"
                     /db_xref="GeneID:11507542"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2126672"
                     /translation="MAPQQGLTGMEGVRNVLLYRVEMDGDPIPTIPDRFTQALPVKLP
                     ASRPKYSIDDTRYHHVGIPVLLHEAGARVLDSAQYNVKRPDIEGEEEASALPVVFGVP
                     YESGGFLPYWALRCLHMAPAIWQYHDPAGYETSVQRIVEQMPSECISFTSGQASKQAS
                     KHLHKRGTNFNLNPIEIEQRKRAFRIAYMLDKDLCLRSGRPPAQDDNFRPNIMSFLEI
                     WAAVYDTVSVRPNIISFLEIWAAVCDTVSGIAAIISLIPLARPSFARLRAYFRREPVP
                     AQTQQEPEPAYINQTSR"
     gene            complement(1819248..1821453)
                     /locus_tag="MYCTH_2304109"
                     /db_xref="GeneID:11507543"
     mRNA            complement(1819248..1821453)
                     /locus_tag="MYCTH_2304109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662869.1"
                     /db_xref="GeneID:11507543"
     CDS             complement(1819774..1821141)
                     /locus_tag="MYCTH_2304109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662917.1"
                     /db_xref="GeneID:11507543"
                     /db_xref="JGIDB:Spoth2_2304109"
                     /translation="MSSLSIRPAERNVPLRQPMLPHGCQTLGSGDSLVIRTNQRLPPI
                     SDLLRDVPLPPSPPSSQPPSQKQSYPTILPPMFPTPIPCSPTFFPGAFPTWSASPPRS
                     RSASQQYTQFPPLSRPVDLRRASIPCADRDRDRQRRTTKQQARLRRGSTLSDPGPQPR
                     QHHPPPNNSLTRRPEAAAIRQPAPAAPCETAAGPPKPKRNNQPFTFEQEAFVIYHRVE
                     LGLCWAEVRDAFMARWPALKRSVGSLQCAYYRTNLELPVVTPDGLLVLVDPEEEAGEL
                     AQMTPPASPGPISPSSSSFCLSSFSSSSSSPSGGLVDEGAKGGSESGGSSGRPREWYK
                     LYRGVAYRTRMVKCRSARISLTERFPEELLDERNDWVREEHRVAASGAGEYTCIPFSI
                     ISNHPPPPQPSFSPFPTISPPTVLSSFSSFSGIGSRSDRAQLKDGAGRERSGSLPERC
                     GSAGG"
     gene            complement(1823097..1825378)
                     /locus_tag="MYCTH_2304111"
                     /db_xref="GeneID:11507544"
     mRNA            complement(join(1823097..1824080,1824145..1824965,
                     1825059..1825378))
                     /locus_tag="MYCTH_2304111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662870.1"
                     /db_xref="GeneID:11507544"
     CDS             complement(join(1823939..1824080,1824145..1824965,
                     1825059..1825091))
                     /locus_tag="MYCTH_2304111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662918.1"
                     /db_xref="GeneID:11507544"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Spoth2_2304111"
                     /translation="MLEVIYVTRHGFRSNWLVDPSNGNYTNYLRSPTGGAADPALTAH
                     GVDQANELAARLLAVDPPIERVYSSLYYRCLQTVEPFVRKAQEAASSRAGGEPGHLRI
                     RGETGLGEWYGSADFEHPVPASLGKLEELFPGLLDPSYSPAITPNRLGESIEELHDRV
                     AAVMEAVIAECDRDGVRAILLCTHAAVIIALGRVLTGNMPDNFEVDDFKCFTCGLSAY
                     RRRRQDLGAEERGVGSAMEGTAGRDADRRSEDGAVAGWKSGRGVSGGWDCELNSDCTH
                     LRLGEERGWSFHGDESFKDTVTGHGMLDTTTRMPPTSNGERKAHGAQADSPRGKL"
     gene            complement(1826107..1828632)
                     /locus_tag="MYCTH_2304112"
                     /db_xref="GeneID:11507545"
     mRNA            complement(1826107..1828632)
                     /locus_tag="MYCTH_2304112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662871.1"
                     /db_xref="GeneID:11507545"
     CDS             complement(1826498..1828405)
                     /locus_tag="MYCTH_2304112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662919.1"
                     /db_xref="GeneID:11507545"
                     /db_xref="JGIDB:Spoth2_2304112"
                     /translation="MSADLFAVFGDASQASAPQRNQQPPGTTHPISTAKDDPFSFLSP
                     TSPPSQPQGQQLSAQWSPFQQTTTGPPQANNGWGKSIGSLEALGASHQRTDPQDPGQE
                     EEDDDGWGEFEVAQTSFPAQPPAPQSASIPPGAPATRTPAVEMLTNNLVDLGLESLAP
                     EPRGRSPSLEKSAETRQRQKPAHNPDPNVLFDADFEAENVADDDDDDDFGEFETGAPA
                     TTTSQTAPAKSAVDLLSLDPEPATVPAKKQAPGVTLSNGALQAGLTAYPGGLKASHDS
                     MSSRGPEPTRQLKATPTMVPKTPRVANAAPPSPATARSAIEDDGFGNNWEESKDIPET
                     KPTASKSQQTPNPKTTSQNPAVAGTPATDWEWQDWGGTENQVTRGGTATTTTPTTVTL
                     AQPFPSVTTSEQQPPGPPPTNIPPPAILLSLFPSLLDLAQHALLKPLLTLPPSSPAYQ
                     RVLAAEPTYDFLRGYLALAAVAARLITGRKHRWHRDKFLAQSMSVSAACGVGGQRGMK
                     LACVDKAQTAHDDREAAEVAAAWKRGVGRLRAVVAGVNAARGAGGGAGRGVAALRVPE
                     VAVGLAVTTAKGVPTAPRACVVCGLKRDERVAKVDWEVEDSFGEWWVEFWGHRECRNF
                     WLEHEKKLRQR"
     gene            1829286..1832072
                     /locus_tag="MYCTH_2304113"
                     /db_xref="GeneID:11507546"
     mRNA            join(1829286..1829528,1829585..1830374,1830452..1830594,
                     1830652..1832072)
                     /locus_tag="MYCTH_2304113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662872.1"
                     /db_xref="GeneID:11507546"
     CDS             join(1829510..1829528,1829585..1830374,1830452..1830594,
                     1830652..1832009)
                     /locus_tag="MYCTH_2304113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662920.1"
                     /db_xref="GeneID:11507546"
                     /db_xref="JGIDB:Spoth2_2304113"
                     /translation="MRSLADARFRWEQTFKEGSSIAELQRAVKFNGPNSPCALGLRSI
                     CWKAFLLWRNAPSEQWLELARKSRASYIDLCDQHLRFIRHPEQLAALTVDPLADDPDS
                     PWNAVRRDEAVRAEILQDVRRLPDEPFYHEEPVQTMILDILFLYCKLNPGIGGYRQGM
                     HELLAPIVWVVAQDAVDPATSTTDDPVDAMIAEMLDPAFVEHDAFALFSKLMESAGPF
                     YDAESDAASDGQQKSTIIERSKYIHEVALMRVDEELATHLRNIEVLPQIFLIRWIRLL
                     FGREFDFVPLLILWDTLFAYDPTLELIDLICVAMLLRIRWTLLGADYSAALQLMLKYP
                     APAPPHGPHTFVDDAMYLRDHLDAAGGVTLIFKYTGKSPAKTSVTSPAPSRIPTPSFQ
                     KFNSLRQRTLGARTPLSTSARILQQPGGVEALLQGAAKNMIERGEKLGINRAVRDAVG
                     EFRRNIQGFQESRSPSRSSRGLFGENSPPSPDHSLTIKLMEKRNARLAAMLEESVTNL
                     KFLASSGLEGEKEKHLETIEVAAAKIQFVKACLEDATLALPEEDLPAINTLTISSPTE
                     VSPPTVALDTTPVVMTSSAVEETRTALSTPESNKVSIASPPNDSRVVPPVPQADEMDT
                     DRHHDEEEDTLPPLKSEITNSPPPPPSPLPVAEVLPDSPPASTPIQPQSNGAIPTRST
                     LAQSSFAWMLEPDTTASSPRPHSASFSSVRPPKITGGVTQRKRVNSSRERNAFLFGEV
                     TTADGAVIGDGAPLSADHIFGLQPIRKAG"
     gene            1844277..1847265
                     /locus_tag="MYCTH_2304115"
                     /db_xref="GeneID:11507547"
     mRNA            1844277..1847265
                     /locus_tag="MYCTH_2304115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662873.1"
                     /db_xref="GeneID:11507547"
     CDS             1844389..1846947
                     /locus_tag="MYCTH_2304115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662921.1"
                     /db_xref="GeneID:11507547"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="JGIDB:Spoth2_2304115"
                     /translation="MNFYAASNMPVYRAEQDARHKESKSAFGQVSKKSKILGLQSPQR
                     DTAPSPPVRPVTSSEAVQYDTPSIDQLLDPAVQGPPSPESIRELGQRMKRASIHDKHQ
                     SHQTTSSGSSSLRSLTSADRPSWENVLDGKTLSRKSSGRSTSSSMPSKERPESVQIFG
                     KTIFSRRGKGRRESSAQSSSSSLYSTDVVGDALPSTQRSAPSRESTIPALFGLRRNTK
                     QEPAAETQRKLNISGPYNFQHVAHTQREDALVLEHGSRSVFASESAQPHGHGGLKGAR
                     ADEMHFAGFSSDSLPLDEEDALATAAPYEVRQTTSLTRKPSVVKKRSSRRVLSRSQSQ
                     EQLRMGVPPPRPPRSPVDQSAPGGPVVPPRGPSRMFGRHERFDSIDRPQTSASFRSQQ
                     QYADPGSPPATSYGYTPDMDVIHEHASSTTAMGPRDEANWPLPCPSSNASEHTLPHVP
                     EEEEQLPAHSRKRSRASVASNSSLRGSQSVPLLRGLAARQNGEPTRRTSDASDTLGRF
                     EMLAAQQALRKALIENQDALPREDWEDDIDYCYDHEAEANCDYEWSRPSLETCRDGET
                     ATPVDDHGRGGDSSVASPAMLAPGQFDMPALSPASQVSSPTPREAITPTVVNNPKASN
                     FSLPRVDSKNLLHVRKPSDASSFKESHGFTLSPSLLIPMDYQQQMMACEAERDEAPDF
                     SFRHLDEHELSMDPSTLLLRYRTSASTTGTIESSSSAFDKHDSTVSTSTDYTRMTASV
                     SSLEMDNCLPGAEPLQRFPSFESHGMIESKAAMPTLPESEEVIPPPARRPHFKSRGSE
                     SNLGALTTDEPWAAKTKAPIPPRRGRARTTSLSTPPPPNQYALFPQVQLSGNRI"
     gene            complement(1849155..1850130)
                     /locus_tag="MYCTH_67855"
                     /db_xref="GeneID:11507548"
     mRNA            complement(join(1849155..1849573,1849689..1849813,
                     1849904..1850130))
                     /locus_tag="MYCTH_67855"
                     /product="histone H3-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662874.1"
                     /db_xref="GeneID:11507548"
     CDS             complement(join(1849352..1849573,1849689..1849813,
                     1849904..1850036))
                     /locus_tag="MYCTH_67855"
                     /codon_start=1
                     /product="histone H3-like protein"
                     /protein_id="XP_003662922.1"
                     /db_xref="GeneID:11507548"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Spoth2_67855"
                     /translation="MPPKQAKQRPSGGAAAAAAASPRGRPPAAVTAAAARRNRPSDVQ
                     PGDPIPQGKKRRYRPGTLALKEIRRYQSNTDLLMSKLPFARLVREIALQFQPSREELR
                     WQSQAILALQESAEAFLVHLFEDTNLCAIHAKRVTIMQKDIQLARRIRGVWGGAGWI"
     gene            1850660..1852250
                     /locus_tag="MYCTH_2304118"
                     /db_xref="GeneID:11507549"
     mRNA            join(1850660..1851158,1851256..1851724,1851792..1852250)
                     /locus_tag="MYCTH_2304118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662875.1"
                     /db_xref="GeneID:11507549"
     CDS             join(1850979..1851158,1851256..1851724,1851792..1851880)
                     /locus_tag="MYCTH_2304118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662923.1"
                     /db_xref="GeneID:11507549"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="JGIDB:Spoth2_2304118"
                     /translation="MDQLMGGEGAFPLETWFWEMPICTRWWTTATVLTSGLVQCKLVT
                     PFQLFYSYRTVFQKSEYWRLLTTFLYFGPISIDLLFHVYFLQRYARLLEESSGRSPAY
                     FSWLLVYAMTSLLLLSPFVSMPFLGHPLSSTLVYIWSRRNPDTLMSFLGLLVFRAPYL
                     PWVLMGISFVLHGTVPKDEFMGVIIGHIWYFFNDVYPPLHGGSRPLDPPMWWRRLFEG
                     RPREETAEGMENDVAVAGTEVPPPEVR"
     gene            complement(1852251..1853655)
                     /locus_tag="MYCTH_2304122"
                     /db_xref="GeneID:11507550"
     mRNA            complement(join(1852251..1852519,1852577..1852636,
                     1852755..1853072,1853209..1853334,1853439..1853655))
                     /locus_tag="MYCTH_2304122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662876.1"
                     /db_xref="GeneID:11507550"
     CDS             complement(join(1852403..1852519,1852577..1852636,
                     1852755..1853072,1853209..1853238))
                     /locus_tag="MYCTH_2304122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662924.1"
                     /db_xref="GeneID:11507550"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="JGIDB:Spoth2_2304122"
                     /translation="MKAYYYDNLPGDQRLPHEDTSAGPLSPADLETVGVRYYHMPELA
                     GVDALAAERGYKNRDEITVSPEKMGDAYESKVRMFFDEHLHEDEEIRYVRDGRGYFDV
                     RDKADRWVRIALEKDDLIILPPGIYHRFTTDESNYIHAMRLFKEEPKWTPLNRSETVD
                     QNPYRKEYVSQYLA"
     gene            1854199..1856083
                     /locus_tag="MYCTH_2304124"
                     /db_xref="GeneID:11507551"
     mRNA            join(1854199..1854582,1854649..1856083)
                     /locus_tag="MYCTH_2304124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662877.1"
                     /db_xref="GeneID:11507551"
     CDS             join(1854448..1854582,1854649..1855722)
                     /locus_tag="MYCTH_2304124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662925.1"
                     /db_xref="GeneID:11507551"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2304124"
                     /translation="MDVRSVQDTASVAGSDSSSSKMKLQLPPSCDPPQPGASVKPLVW
                     VVFGGTGHMGRSLVKSALSHGDLVTTVGRVLETSPEAMAALNNETCLGQLCDVRDGAS
                     VARVIDRTLERFGRIDCIANCSGYGVIGACEDQDEYDLRNQFETNFMGTLHIVQASLP
                     YFRQQNAGRYLIFSSTSGALGVPGLGPYCATKYAVEGLIEAMLYEVDSFNIKATLVEP
                     GLVRRDEPDSTTNPLPTWGHFLIKPASEPYSHATSPALHAKRMVQWLGDRQPTSAVKC
                     AELVWQLAHCSYPPLRLLLGSYAIESIRDRLRSVTEELEDWKHLNFPPPPDAPGVEKG
                     GDKNDREEKAEKEDREQGGEERREREEREEREEREEREEREEQDEMEQRENDDVMEGI
                     TPDPKEAENT"
     gene            1856709..1858450
                     /locus_tag="MYCTH_2304127"
                     /db_xref="GeneID:11507552"
     mRNA            join(1856709..1857106,1857159..1857249,1857313..1858450)
                     /locus_tag="MYCTH_2304127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662878.1"
                     /db_xref="GeneID:11507552"
     CDS             join(1856831..1857106,1857159..1857249,1857313..1858202)
                     /locus_tag="MYCTH_2304127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662926.1"
                     /db_xref="GeneID:11507552"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="JGIDB:Spoth2_2304127"
                     /translation="MSNKKNEDIEMRAAEGGNDFGGEKDPFLGRRSPVARPRGREPGF
                     SAFLDKLNHSPGASILAYCLSSISMTVVNKYVVSGSEWNLNFFYLAVQSLVCTLAILV
                     SRQTGLIKNLAPFDTNKARKWFPVSLLLVGMIYTGAKALQYLSVPVYTIFKNLTIIVI
                     AYGEVLWFGGSVTPLTLLSFGLMVLSSVIAAWADIQAAIDGVGHSGETSAALATLNAG
                     YAWMGMNVVCTSSYVLGTRKAIKKMNFKDYDSKFSEPASDGDALPGADPSGRLAMFYN
                     NLLTIPVLIVCSLLVEDWSSENLARNFPAESRNKLMVGMVYSGLGAIFISYCSAWCIR
                     VTSSTTYSMVGSLNKLPIAISGLIFFDAPITFGSVTAIFVGFISGLVYAWAKIRAKAQ
                     DAGILPTTNKPTMSASAQSNRDAANS"
     gene            complement(<1859205..>1860537)
                     /locus_tag="MYCTH_49425"
                     /db_xref="GeneID:11507553"
     mRNA            complement(join(<1859205..1859726,1859840..1860302,
                     1860485..>1860537))
                     /locus_tag="MYCTH_49425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662879.1"
                     /db_xref="GeneID:11507553"
     CDS             complement(join(1859205..1859726,1859840..1860302,
                     1860485..1860537))
                     /locus_tag="MYCTH_49425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662927.1"
                     /db_xref="GeneID:11507553"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="JGIDB:Spoth2_49425"
                     /translation="MPAIANALRRLNPWHKGNHLTLEPWNLDGPPPPPRISISAAYGL
                     LVLYALSYFVPFYLSKATRPSPALSRDAPSVIRARIRFVTLSCLACTVVTYQVLTRAG
                     GTTPLEALHLLGLWPVALRDSLRVLFLTALLFAGPLYSCLIVERGWADWVRLQPLVEV
                     WEEWTTWRNIVAGPVTEEVLFRAASIPLVLLARVPPPPTVFLTPVVFGLAHVHHYYEF
                     RLTRPDVPAAASLLRSAFQLAYTTLFGAYATFLFLRTGSLAAVCAVHAFCNCMGLPQL
                     WGRVDPPFDVAAGVPLSRRPRPSILWTVIYYVLLVAGAVLWYRNLWVLSESENALLPS
                     SAFDASVPSSA"
     gene            1863356..1866638
                     /locus_tag="MYCTH_2304130"
                     /db_xref="GeneID:11507554"
     mRNA            join(1863356..1865663,1865721..1866163,1866219..1866638)
                     /locus_tag="MYCTH_2304130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662880.1"
                     /db_xref="GeneID:11507554"
     CDS             join(1863580..1865663,1865721..1866163,1866219..1866481)
                     /locus_tag="MYCTH_2304130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662928.1"
                     /db_xref="GeneID:11507554"
                     /db_xref="JGIDB:Spoth2_2304130"
                     /translation="MSAPPARHGQSTSLHERSNSQTSKPGIRLVPYSPPRLDPEDRAP
                     SQASSRDRTSGSFQDQSSSNVSHTRRPSWRDEVTESRFGGQGSALSSPTVRRSSLVRP
                     GDERVSGVKPLPNPSVFSPAGPTTPRLRSPSDVVSSQVAGHEALAARRTRADSSPSPS
                     ASLGSATSQHRRSHSRRGTLRLAVHPNGTFSLVPEDPQHDASGSVAGSLTSPHSSYAS
                     RSPSAQDRPSIDTWSNRRASTPLTGASTVVLDQSSSELPRSTPSSRRSSTTQLAEDPT
                     SSSPWNYRLVGGLRKVPATPDNKGKQPLYGASSTSSSETQLAPLAEKTAPANDEKGDE
                     SPTRSVVPKASFTTSVTAQTVETISEATNYKVYGPASAAQESSDSLAFNSETPPNWEI
                     LGQSPAPASQSSSAAASQGGNENYVLHGPPSLSPSSSLATVARKPRPVYSQESLVVPP
                     LRPKKRTSYEGFGYYKQRSRETLRSRTGSVQSLKSLSSIITGQDPTQVFLKTPAVLGL
                     GASSTQRFSWSVPQTSESGASTSQAAHTLQAQTPMLQSQPHQWSSQLSTVMSESEPGS
                     DPARSVSPLSEGSGGHHRRGSSTGWVSSMHSRQMASVSSSIAGQLDEAAATPGSDSLE
                     RPQPSVARAGPSQIRMIRDQDEHGDGLADLEERPSRTGLSALFANGSGWNLHSNSSSR
                     ANSFTSSIPAWARVYYGSGERRFLGRRPSFLTISESGDSRPPSSGFLGGSESPNTDNF
                     PQTIFSPRKRPREVQPNVDQQPAPEQAPMETSPAPQTHEFNVFRSLRQKTSSIWSPHL
                     QTDRRANRYSVWDPPSVSWSADSGIFGRRNAQVVLFILGFVLPLAWMVAALLPLPPNP
                     DLESAQAENGKSKYSPTHPASRKQRYVLDEARYQSARWWRNLNRVMSIIGLLIIGAVI
                     ALAVVGVRQGWGQPR"
     gene            complement(1867473..1869948)
                     /locus_tag="MYCTH_2304133"
                     /db_xref="GeneID:11507555"
     mRNA            complement(join(1867473..1868246,1868303..1869324,
                     1869404..1869503,1869607..1869651,1869728..1869948))
                     /locus_tag="MYCTH_2304133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662881.1"
                     /db_xref="GeneID:11507555"
     CDS             complement(join(1867792..1868246,1868303..1869324,
                     1869404..1869503,1869607..1869651,1869728..1869749))
                     /locus_tag="MYCTH_2304133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662929.1"
                     /db_xref="GeneID:11507555"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="JGIDB:Spoth2_2304133"
                     /translation="MITFIHRPFVYLADKLGAGPDELKLIFSLLLSYPLAGVLKRVPD
                     ARPAYKNLFSLSISIFILVGLFDLWDGLRTMLISAGGTYAIAKFLRGSRYMPWVGFVF
                     LMGHMSINHIARQAANSPRSVDITGAQMVLVMKLSAFCWNVADGLLPEAELSDFQKDR
                     RLTELPDLLDYAGFVFFFPSMLIGPAFDFAEYRRWLDTSMFEVPANVDPAKKPPTRRK
                     RKIPRSGTPAMLKLVTGLAWIFAFLKLSAYFDPSVLVQDKFLSYSLPYRVLILHMVGF
                     TARTKYYGVWTMSEGACILAGLGYNGVDPLTGKVSWDRLKNIDPWGVEFAQNTRGYLE
                     AWNINTNKWLRNYVYLRVTPRGKKPGFRASLATFTTSAFWHGFYPGYYLSFVLASFIQ
                     TVAKNMRRNFRPFFLDPKTGADLPSKKYYDVASWLTTQLTFSFAVVPFLILSFSDSLL
                     AWSRLYFYAIIGTAGLMVFFASPAKTTLKKKIEQRNAKAGVSGPGTVSNGGDGKLSRS
                     TSSDSLASRTPVMGITQDLGKEFDDAMSEIRSSEALKRK"
     gene            complement(1870260..1871248)
                     /locus_tag="MYCTH_2304135"
                     /db_xref="GeneID:11507556"
     mRNA            complement(1870260..1871248)
                     /locus_tag="MYCTH_2304135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662882.1"
                     /db_xref="GeneID:11507556"
     CDS             complement(1870304..1870912)
                     /locus_tag="MYCTH_2304135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662930.1"
                     /db_xref="GeneID:11507556"
                     /db_xref="JGIDB:Spoth2_2304135"
                     /translation="MPIISQAPPPQPALKRSRPSEPQSPTPSSSSQRHKKRRSSPSST
                     GQRRDKRRREVKAVIDGVPNNPRVIEEDGDGGVTCETLLPQPKLIDRATLDWGFLSMQ
                     APRSYSALTMGQGGMDLSEASTLLGSWDTPKPASTAVFSDAIMFNDCPSPSTMLPPVS
                     PLENRSAQQETFGTMGNAGEGGAVDPPQYNPETEEENWDLVY"
     gene            complement(1872004..1873623)
                     /locus_tag="MYCTH_2304137"
                     /db_xref="GeneID:11507557"
     mRNA            complement(join(1872004..1873457,1873523..1873623))
                     /locus_tag="MYCTH_2304137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662883.1"
                     /db_xref="GeneID:11507557"
     CDS             complement(join(1872231..1873457,1873523..1873558))
                     /locus_tag="MYCTH_2304137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662931.1"
                     /db_xref="GeneID:11507557"
                     /db_xref="JGIDB:Spoth2_2304137"
                     /translation="MAQDVCPAGSEPSLSFTQGFILGQLSIVLLLAAFIKFFIFGESP
                     SPEITASIRANERRSRTLAHKKSLLSLKESSTRQAAQQPTLNRKKSSILRPSPPTLTI
                     GSILDKTYYKVDSHQPESLDWFNVLVAQTIAQFRSDAQHDDAILTSLTKALNGASRPD
                     FVDEIRITELSLGEDFPIFSNCRIIPVDENGLSYPSGKAFDASKATREGARLQARMDV
                     DLSDMITLGVETKLLLNYPKRLSAVLPVALAVSVVRFSGTLSISFIPSNPSENTPTKM
                     TFTFLDDYRLDFSIRSLMGSRSRLQDVPKIAQLVESRLHRWFDERCVEPRFQEIALPS
                     LWPRKRNTRGGDEAIADAERSLSKTKGMEVAKDLRMEARGEVEAEADVRVDRGHESLR
                     YRRRPRPEDMFSVSGPMPGAMPDLETPT"
     gene            1873787..1875946
                     /locus_tag="MYCTH_2304140"
                     /db_xref="GeneID:11507558"
     mRNA            join(1873787..1875177,1875254..1875946)
                     /locus_tag="MYCTH_2304140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662884.1"
                     /db_xref="GeneID:11507558"
     CDS             join(1874038..1875177,1875254..1875871)
                     /locus_tag="MYCTH_2304140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662932.1"
                     /db_xref="GeneID:11507558"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="JGIDB:Spoth2_2304140"
                     /translation="MDVVQAASGYVTKMVTAGESATGAPSAKMKILLLDRETLPFVST
                     AVTQSALLNHEVYLMDRLDNPNREKMRHLRCLCFVRPHPDSIGLLIDELREPKYGEYH
                     LFFSNVIKKSTLERLAEADDHEVVKLVQEYFLDYVVINQDFFSLNMSLPMHRLWGGNP
                     DTWNTDALQRATDGVISVLLSLKKKPLIRYQKTSPLAKKLASEVRYYINQENQLFDFR
                     KVDTPPILLILDRREDPITPLLMQWTYQAMVHHLLGIKNGRVDLSSVPDIRPELREIV
                     LSQDQDPFFKKNMYLNFGDLGSNIKDYVEQYQAKTQNNAGIESIDDMKRFIEQYPEFR
                     KLSGNVSKHVTLVSELSRRISAENLMEISELEQSIACNDNHAADLKKLQSQIQNPSIP
                     ADNKVSLVALYALRYARHPSNALSMLTDLLVAAGGVPARKAALISQLLTYHNSLQQQS
                     ASAASGITELFESAGLFSSASSRFKGLKGVENVYTQHSPLLETTLHQLIKGKLRETQY
                     PFVEGGGTTRDKPQDVVVFIVGGATYEEAKTVAGINASSPGVRVVLGGTTVHNAATFL
                     EEVEDAVGGWPEVGAGRRR"
     gene            complement(1876069..1877976)
                     /locus_tag="MYCTH_2304142"
                     /db_xref="GeneID:11507559"
     mRNA            complement(join(1876069..1877191,1877241..1877377,
                     1877436..1877511,1877571..1877976))
                     /locus_tag="MYCTH_2304142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662885.1"
                     /db_xref="GeneID:11507559"
     CDS             complement(join(1876153..1877191,1877241..1877377,
                     1877436..1877511,1877571..1877869))
                     /locus_tag="MYCTH_2304142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662933.1"
                     /db_xref="GeneID:11507559"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="JGIDB:Spoth2_2304142"
                     /translation="MSSLIGGIYPPTLDDGVERDQLVQTIKDWTIANGLAVRPPPAFA
                     DGEFEGALAISAPVTLFPSPFPKACFEEARAIQTKYNELYARISQDEEYLGSLVQEVA
                     GGDDFIANLWKVHLRVKEEGYVQNLSLGLFRSDYMVHQDGDNLQIKQVEFNTIASSFG
                     GLSTQTSLLHKHLAKTEYPLLKEPVSLPPADLPPNPSAEGLAAGLAAAFHAYGKSALG
                     HQTCVLFLVQDEERNVFDQRHLEYALRSSGAEPIPVFRLPFSQILTHTTIPPSSPGRQ
                     LLYHPPQNPARTFEVAVVYLRAGYGPADYPSQSAWEARYQIERSAAIACPSVLTQLAG
                     MKKVQQVLATPEAVTSGPGALRRFVPDSDGDATYQALWKTFANIYPLDTSPAGLEARR
                     LATDPEECKRFVMKPQREGGGNNFYRTAIPRRLSEIPESHWGSYILMELITPPPLVNT
                     ILRNGKLEHGGVICELGIYGTCLWDQKTGAVLRNEESGYLLRTKGDQSEEGGVAAGYG
                     CMDSCRLV"
     gene            1878877..1885473
                     /locus_tag="MYCTH_2304143"
                     /db_xref="GeneID:11507560"
     mRNA            join(1878877..1879033,1879357..1885473)
                     /locus_tag="MYCTH_2304143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662886.1"
                     /db_xref="GeneID:11507560"
     CDS             1879387..1884873
                     /locus_tag="MYCTH_2304143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662934.1"
                     /db_xref="GeneID:11507560"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_2304143"
                     /translation="MAGDDQSDPFLWEEDRVVQELCTANRSWKAPAAKRLPDPVALEA
                     KLRECGVDGQSLLTYEDEFGFDQLWAALGVKKLPHQLSLKDAITQLRRRSKKYREWKA
                     QQLAASQLLDEEEHDSAVKSHPYEPADLEHVGQAAPVSQPDHDNATPHPGAPVPGLAI
                     PFQGVLSPTLSASVDRDLPTSQVLQTAQENTEEPPSKKRRIAPTNISNNTTGNSAFAI
                     IPTEGDVVLRADLLSRDPVETILQEDESSGFLGPGILRPAQLFEPELLDAADLAEQDF
                     VLLPRQLPAGRRIQVSAAMKRFLRASLADRLRMSAHGREEESEYGPSDDESVDSETWR
                     EYQQEEAERAAMEAGKDADNERLLSKEEVAEAVRTAIQELETRWLIEKKPKYDLKALK
                     TWQDARRNPNRVAFIESAKRELDHFASRIALYSKHIVDQPWTVKNDVQRKASGILEAS
                     VFDKKRQAWLIDVVESPVRPPKPSTLPRPTPKRAEPSVVVDDEEVLTSDSDDLGSFIE
                     NDDDIAPIIHEEMDIDSEPPEQQVPATASSDSTATGSPGSRAGARSSAARVLSSEQQA
                     NNDLTSTVPAPRKAKSEPLSVPATPHRTRISAPEIIEIESSPSPTKQLLEVPGLDDLD
                     SLEKIGEIGIEYWQKNEDPKRLVVAVLCDWSDTKRKMVYEVIKDHDHPEIWAKYIAPV
                     LDTREDLSSAAAGLETFLICRLFDAYVSKSAKRSFSSVLRTITCNRIKREGNLFASFC
                     ALLRRILPIFLRLVPQTPTQGVPQTPRNREQRSQTPAEAQESPDNPSASEESSSDDHT
                     VPSTKKRRRVKRRDAQAAKVRSDVLKRNEELARRTRELRERLAQQGPDSNKHTRLIVN
                     ETKESDDQALIYINDHIGSKIKDHQIEGVRFMWNQLVVESSVRQGCLLAHTMGLGKTM
                     QVITLLVVIAESSASPDESVRSQIPEDLRESKTLILCPPSLLDNWHEEIHMWAPNGIL
                     GPVYKMDSVIPASERMEMIQAWASSGGILILGYSMFTTLVKGTEGAGKLLLETPNIVV
                     GDEAHYMKNPGSQRHQATANFRTMSRIAMTGSPLTNNVMDYYAMINWVAPNYLADIAE
                     FRERYSNPIKEGLYADSEPSKKRKARKMLHVLKATVDPKVHRRDIEVLLNELPKKKEF
                     IITLPLTKAQKRLYRRYIECVMEPNKQLMTGQAKAWSLVAKLGLVLAHPIIFKTVAES
                     QKAEARKATAGGYKAQSPSSSSTTSATEQDDEDNIELPQDVLSQLLTTVALRDIEDYA
                     LSNKILVLLRILDECKKVGDKVLVFSQSIPTLNYIETIFKRQRVVYQRLDGATPMSKR
                     QDLVKKFNTDSETRVYLISTRAGGVGLNMYGANRVVIFDFRYTPAEEQQAIGRAYRLG
                     QTKPVYVYWLTIGGTFEDTIHNNAVFKTQLASRVVDKKNPDPWSSRFSEYFMMPREVE
                     QEDLSGSLGQDKVLDALVQCEQTGKLIRKITSTETFEREETYELTPEEQQEAEKDIEM
                     ERLRLQNPEEFRRREQERLLQSRGMLGMQSQPPPDSYQPRPTDGESPSMSSDTDSRSN
                     RIVKIKVPEHLRKTRNSEPPVTNVVSDVMSAQAQRNPSSCQKVDSHHQQQVLTLASAA
                     TVNRPIPTTTQQASHVAIASEQTVSVHENPPSTHPTSAASTTAPDTVLTQDSKAAPQP
                     ILAAGSHFKVQQAPPPPVPTSEPPLVGNLGTPSPTPTAVSEVDFPDLLTVHSTLCQEG
                     RHVRHHPSDVISRVQAVWVREKIEKLPMMDKIQNVKRFSRNPRFAEAMLSGYMDPEQL
                     ASMTRLEMDEISTTLNSLSEAEFRQRVWTTKADLNVCNTDTKSA"
     gene            1886248..1888545
                     /locus_tag="MYCTH_2304147"
                     /db_xref="GeneID:11507561"
     mRNA            join(1886248..1886688,1886779..1888545)
                     /locus_tag="MYCTH_2304147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662887.1"
                     /db_xref="GeneID:11507561"
     CDS             join(1886463..1886688,1886779..1888334)
                     /locus_tag="MYCTH_2304147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662935.1"
                     /db_xref="GeneID:11507561"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2304147"
                     /translation="MSKLQVLARRCPVMGKAMAIQSARIGHAAGFSTVAAKSGVSTFH
                     GHEKTSKAKLHTSRSQEAQAVDASVFTGHEKVQLPPRLPNKQHVGASPAVATRPSASS
                     TRAGKFDYEGFYSRELEKKHKDKSYRYFNNINRLAKEFPRAHMASKDEKVTVWCANDY
                     LGMGRNPHVLKAMHETLDEYGAGAGGTRNISGHNQHAVDLERTIAKLHAQEAALVFSS
                     CYVANDATLATLGSKMPDCVILSDSLNHASMIQGIRHSGARKIIFKHNDVQDLEEKLA
                     SLPLHIPKIIAFESVYSMCGSVGPIEEICDLADKYGAITFLDEVHAVGMYGPHGAGVA
                     EHLDYEAHLQGRPAGTIMERIDIITGTLGKAYGCVGGYIAGSAKLVDTVRSLAPGFIF
                     TTSLPPAVMAGARVAIEYQMQHQGDRRLQQLHTRAVKEALQERDIPVIPNPSHIIPIL
                     VGNAELAKQASDKLLHEHGIYVQSINYPTVPVGQERLRITPTPGHTKEFREELVNAIE
                     TIWSELGIKRTSDWAAEGGFIGVGVPGAAPPEPLWTDEQLGIAEAARTLLQTAEAEQK
                     ASPLTGGFTERLLEREMQSLRSASVSA"
     gene            1889405..1892814
                     /locus_tag="MYCTH_2304154"
                     /db_xref="GeneID:11507562"
     mRNA            join(1889405..1890013,1890286..1891083,1891158..1891331,
                     1891400..1891686,1891746..1892102,1892177..1892349,
                     1892417..1892814)
                     /locus_tag="MYCTH_2304154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662888.1"
                     /db_xref="GeneID:11507562"
     CDS             join(1889883..1890013,1890286..1891083,1891158..1891331,
                     1891400..1891686,1891746..1892102,1892177..1892349,
                     1892417..1892650)
                     /locus_tag="MYCTH_2304154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662936.1"
                     /db_xref="GeneID:11507562"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2304154"
                     /translation="MALWVDAPVAGTAKAPRGPRACTTCAKAKSRCIAGPKGQEKCER
                     CHRLGKPCSSQTPAPARKRKRPRTTRVAELERRLEDLTALIESVQRQGPAAPSPPDLD
                     QHSAPSRSPNRWADRVHHLRPLDLAETGDSIRTFRQNCWENPLGHIFPNHSIFGDDLE
                     HQQSPASGVVPPAAAAVLPRPSSGYPSAQTTAASSIGSSTHQQPHPRSSEQHRSCPWP
                     QDDEAEAFLRVYREHLNHLFPFVIVPPHLSSAELWKQRPFLWKVVMMGACRSDGRRQA
                     ALGNELLREVTETAFMRPRKNLDLLQGLQMLIAWYHYNLDSFQMMNLLFLTMSITTSL
                     GAVETKEIPDKEGYSSESLEQMRAFAGTYYLVTVTFTTNKRPDALMNNANAAYLATCC
                     RALLSQMEYPTDELVVHLVRAQKLLQGISQGFAQRKAAPNEKRVPQVHFIHGLRERIR
                     GVASALPPHIRANPTLRGHFLVAEILIYENSLEELYHCPFLRQSREAGPIPFSPARRT
                     EDVSERVAMLWDCAHLVHAFLENRLPDEKTNKFPRVVCPTSPDLTYVFLTMIKLATVQ
                     VPGWDLARARKEMQVDEFMARLLKRMEHAAENRKSETKGGLADGQPEHGQGDDESEDP
                     FAKLARKVRNVRDLLRVLEYHDDYATSQVVRVYDPAPMTLVDATQDLMQDLGGGLWPD
                     PTSGTPDWDTSAVGEAIDWVAIFNNYTMTESFNMA"
     gene            1893039..1896060
                     /locus_tag="MYCTH_2304164"
                     /db_xref="GeneID:11507563"
     mRNA            join(1893039..1893350,1893482..1893700,1893780..1893815,
                     1893915..1893950,1894041..1894056,1894141..1894283,
                     1894346..1894364,1894430..1894596,1894648..1894713,
                     1894766..1894888,1894938..1894961,1895015..1895118,
                     1895174..1895184,1895283..1895314,1895368..1895473,
                     1895537..1895616,1895671..1895754,1895818..1896060)
                     /locus_tag="MYCTH_2304164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662889.1"
                     /db_xref="GeneID:11507563"
     CDS             join(1893327..1893350,1893482..1893700,1893780..1893815,
                     1893915..1893950,1894041..1894056,1894141..1894283,
                     1894346..1894364,1894430..1894596,1894648..1894713,
                     1894766..1894888,1894938..1894961,1895015..1895118,
                     1895174..1895184,1895283..1895314,1895368..1895473,
                     1895537..1895616,1895671..1895754,1895818..1895976)
                     /locus_tag="MYCTH_2304164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662937.1"
                     /db_xref="GeneID:11507563"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="JGIDB:Spoth2_2304164"
                     /translation="MSTYDKYQTPLSTRYASQEMMTIFSARERASTWRQLWVWLAEAE
                     KELGLPIPDEAIEQMRANVIVSDKAFAVARDYEAKFRHDVMAHVHAFGEDAPAAAGHI
                     HLGATSCYVTDNADLIFIKRALDLILPKLAKVIQNLQEFALKYKDMPTLGFTHYQPAQ
                     LITVGKRAAQWIQELMMDLEDIETVRERLQFRGAQGTTGSQATFLELFNGDASKIVKL
                     NEILCKKAGFPSTFAISTQTYTRKVDLRVANAVCALGATAERICSDIRHLANLKEMEE
                     PFEKSQIGSSAMAYKRNPMRSERITALGRKLARLPANFTATFETQWFERTLDDSAIRR
                     MDIPEMFLLADSILLALDNVTNGLVIYPNVIRSRIDQELPFMATESILMKLAQHGVSR
                     QEAHEEIRVLSHQASDVVKQQGGRNDLLERIKKTEFFKPVWDEIDSLVDPKLFIGNSP
                     KIVEDYCNGEVAAKLAKYKESLATASTAQLSI"
     gene            <1896964..>1898453
                     /locus_tag="MYCTH_101800"
                     /db_xref="GeneID:11507564"
     mRNA            join(<1896964..1897366,1897441..>1898453)
                     /locus_tag="MYCTH_101800"
                     /product="glycoside hydrolase family 30 protein"
                     /transcript_id="XM_003662890.1"
                     /db_xref="GeneID:11507564"
     CDS             join(1896964..1897366,1897441..1898453)
                     /locus_tag="MYCTH_101800"
                     /note="CAZy_ID 267782"
                     /codon_start=1
                     /product="glycoside hydrolase family 30 protein"
                     /protein_id="XP_003662938.1"
                     /db_xref="GeneID:11507564"
                     /db_xref="InterPro:IPR001139"
                     /db_xref="JGIDB:Spoth2_101800"
                     /translation="MSGAAAAPSERPIEARQANTITVDLSQTYQRMDGFGFSLAFQRA
                     NLITNMSDKTKQRELLDLLFNRTTGAGFSILRNGIGSSPNSNSDFMNTIAPNNPGSPN
                     AEPQYMWDGKDSGQLWVSQQAVNLYGVKNIYADAWSAPGYMKTNGRDTNGGTLCGVPG
                     AQCASGDWRQAYANYLVAYIGFYAEEGVNITHLGFLNEPDYSASYASMQSNGNQAADF
                     IKILHPTLEAVGLGDRVRIVCCDSMGWNNQVSMVSQIRSAGAEDLLGTVTSHTYSGGP
                     GGPMSSRAPVWLSEQCDLNGAWTTAWYSYGGAGEGLTWASNIYNAVVNANISGYLYWE
                     GVQWPNPNTNEKLIRVDNTTNTYEVSSRLWAFANWSRYVRPGAVRVGVSGGGNGLRTA
                     AFRNEDGTIAVIAISSGGSAANVSIKISGGPGAAAVQAFVSDNTRKCESTPATVAGDG
                     TISGSVAARSITTFFILPESS"
     gene            1898713..1900845
                     /locus_tag="MYCTH_2304176"
                     /db_xref="GeneID:11507565"
     mRNA            join(1898713..1899140,1899261..1899396,1899486..1899867,
                     1899918..1900129,1900182..1900845)
                     /locus_tag="MYCTH_2304176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662891.1"
                     /db_xref="GeneID:11507565"
     CDS             join(1898855..1899140,1899261..1899396,1899486..1899867,
                     1899918..1900129,1900182..1900731)
                     /locus_tag="MYCTH_2304176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662939.1"
                     /db_xref="GeneID:11507565"
                     /db_xref="InterPro:IPR000417"
                     /db_xref="InterPro:IPR003733"
                     /db_xref="JGIDB:Spoth2_2304176"
                     /translation="MGKPQVDYRLYLVTDSTPAILGDRDLNEVVEASLKGGVTIVQLR
                     EKKGDTAEIIAKAQKMQQVTRKYNVPLLINDRVDVALAVDCEGVHIGQDDMELSTARN
                     LLGPDKIIGVTVSTVEEALKACEGGADYLGIGTVYATATKTNTKDIIGTAGVREILRR
                     IAEAGYNTPAVCIGGINASNLQRVLYQCAAPNKVLNGVAIVSAIMAAADPEAATKNLA
                     ALSRGPPAFTLDTSRDLSADADGKAVIALAAPVIRRIHDTTPLSHNMTNLVVQNFAAN
                     VALAVGASPIMAGYGEEAADLCKLGGALVINMGSVDPSGLANYVKALKAYNLEGRPVV
                     FDPVGAGATSLRREAVKMIMANGYLDVIKGNEGEIKTVFGNSKEQQRGVDSTSTLDAS
                     QKAKLVRELASREKNVVLMTGKTDFVSDGVRTYAIDNGHEYLGMVTGTGCTLGTAISA
                     AIASRQTDRLAAVVAAILHFEIAAELAAERPEVRGPGTFVPAFLDELYLIRQATARND
                     LAWLARAKVRGVE"
     gene            1901041..1902296
                     /locus_tag="MYCTH_2304177"
                     /db_xref="GeneID:11507566"
     mRNA            join(1901041..1901093,1901162..1901177,1901251..1901304,
                     1901482..1902296)
                     /locus_tag="MYCTH_2304177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662892.1"
                     /db_xref="GeneID:11507566"
     CDS             join(1901063..1901093,1901162..1901177,1901251..1901304,
                     1901482..1902031)
                     /locus_tag="MYCTH_2304177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662940.1"
                     /db_xref="GeneID:11507566"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="JGIDB:Spoth2_2304177"
                     /translation="MTTPPPERRFQRPAVFVCDIQEKFRPTIYEFDKVILTARKLLIA
                     ATALKIPIFVTTQNRPRLGDTVAELQPFLAAAGALVQADVDKTRFSMWLDPISSHPHF
                     ASSSPSSPSPSGCEVAIVGIESHICVTQTALDLLAAGHKVYILADGVSSSNREEVGIA
                     LDRLRQAGAVVTTSESWIYECMGDAKIPEFKQIVGVVKDTVGDTRAALKGLLGSKM"
     gene            complement(<1902390..1904880)
                     /locus_tag="MYCTH_2092357"
                     /db_xref="GeneID:11507567"
     mRNA            complement(join(<1902390..1904038,1904100..1904880))
                     /locus_tag="MYCTH_2092357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662893.1"
                     /db_xref="GeneID:11507567"
     CDS             complement(join(1902390..1904038,1904100..1904292))
                     /locus_tag="MYCTH_2092357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662941.1"
                     /db_xref="GeneID:11507567"
                     /db_xref="JGIDB:Spoth2_2092357"
                     /translation="MDPVFVVTREELHDVQMELKRIHHVQLVHGERLRSLEKRQADDA
                     ALKSVWNSPFPSVLGGTPQHGPVHMPATELIDDLDDEDQNLLGRLHLETDDEPIRRGA
                     ASRANSVRFDESALHGANFGHGGRHSGDFGPSRPGSGFGGHQMERTYSHKSDGRHSSA
                     GHSVHSMHSGISGRTSSLGLDSNFMIGGHEDDSALDMPEPPPVLYILGSPPSIIRCWL
                     TTNFTSAGLLYAVVCTGSQKSTVEYSLLRELDLTNNIHRDVDGAHRITLPVFLAEARV
                     TQSNSRSTSPGPHLPSITASFEVTGMDQQETPESRKAIRIFIGSHTLRLHGADILLSR
                     NLMTLYGSDRDKLSIPFVRPEDDAVFKNLATTNLVSSKPKLNAAAPEFIAGEKSVNGS
                     VPKSKEQNTSASKSAESGSEEVLSPTSPSNQPTKTGATSAASESGGEADKRAPEPGAP
                     PLSSGKEPSGSTEPSRRESNPALRTPWRQTAAALADSSTPLSGYQPAARSRNMKVLKP
                     TKSSSGSSTRTGSTHDPTPGTRPSADQRRKTQAEGGSGAVNRGSSKRAVSVSALPGLG
                     EAKQAANGQEPTAKGPLVAPSKDNPLGSASAFSWIAPTKPKGPPAAD"
     gene            complement(1905458..1906819)
                     /locus_tag="MYCTH_2304184"
                     /db_xref="GeneID:11507568"
     mRNA            complement(join(1905458..1906130,1906194..1906318,
                     1906387..1906503,1906567..1906819))
                     /locus_tag="MYCTH_2304184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662894.1"
                     /db_xref="GeneID:11507568"
     CDS             complement(join(1905543..1906130,1906194..1906318,
                     1906387..1906501))
                     /locus_tag="MYCTH_2304184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662942.1"
                     /db_xref="GeneID:11507568"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Spoth2_2304184"
                     /translation="MLPPSQNSYPQIVLFGDSLFQGTADVSGGFSFQAALQTQVLRRF
                     DVINRGFSGYNTSNALSILPQVFSPPTPGGPELKYLFILFGANDAAVPLPTNFQHVPL
                     DKYKENLARIINHPIITAHKPKIFLVTPPPLDEIRVTVLDRANGHPSAARRTKVSAAY
                     SEAVRQVAAEHPGVTLIDLHKALMDRAIEMTPGFDPKGPALGDPEGGVRGYLEHLLPD
                     GLHLSTESYRIFYDLVRPHIGSEWAGTKDEDRVGYVLPDWRNAPWLEEDQHLRGKSL"
     gene            1907421..1908933
                     /locus_tag="MYCTH_2304187"
                     /db_xref="GeneID:11507569"
     mRNA            join(1907421..1907877,1907943..1908857,1908908..1908933)
                     /locus_tag="MYCTH_2304187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662895.1"
                     /db_xref="GeneID:11507569"
     CDS             join(1907734..1907877,1907943..1908842)
                     /locus_tag="MYCTH_2304187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662943.1"
                     /db_xref="GeneID:11507569"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Spoth2_2304187"
                     /translation="MFQPTCCTCASLLPAVPRVSSSSPSEKPVPDGRRLSCCGRIICG
                     VCIHNNPRFSSYCPYCQTSGAPLPLSDRFEVRPRRSEAEAELQSESDHPPPYSAIAQT
                     IKVKLNTTEPADPPPPYSPSSSSSSSPTISSSTPRPSSPKQPPAIDEKATAPAGYAIH
                     HLRHPPHPHPDTLASISLRYGIPLPVLRRHNNLPSDADYLLAARNTVLIPAAYIIAAA
                     GGGSAPDGTPASGEASLSPHPVEDAAERGRKKMIRRFMVACKEADYDAAVVYLEQSGY
                     DFEEAVARHREDAEWERRNPLQAGQKKGMGRYRSSRSLLSRDSEGSRGGGRGSLLGWL
                     KGRERASKDWNRG"
     gene            complement(1908951..1913275)
                     /locus_tag="MYCTH_2304190"
                     /db_xref="GeneID:11507570"
     mRNA            complement(join(1908951..1909086,1909151..1910438,
                     1910625..1912701,1912879..1913275))
                     /locus_tag="MYCTH_2304190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662896.1"
                     /db_xref="GeneID:11507570"
     CDS             complement(join(1909060..1909086,1909151..1910438,
                     1910625..1912701,1912879..1913122))
                     /locus_tag="MYCTH_2304190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662944.1"
                     /db_xref="GeneID:11507570"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="JGIDB:Spoth2_2304190"
                     /translation="MATTSNMFLYSLTIQPPTTITQALLGQFSGTREQQIIIASGSRL
                     SLLQPDPRQGKVNTLLSHDVFGIIRAIASFRLAGSHKDYIILATDSGRIAIIEYQPKT
                     NRFSRIHLETFGKSGVRRVVPGQYLAADPKGRACLIASIEKNKLVYVLNRNAQAELTI
                     SSPLEAHKPGVLVLSLVALDVGYANPVFAALEIDYTEADQDPTGEAAKETEAQLVYYE
                     LDLGLNHVVRKWSDVVDPTSSLLFQVPGGNDGPSGVLVCGEENITYRHSNQEAFRVPI
                     PRRRGATEDPQRKRTIVSGVMHKLKGSAGAFFFLVQTEDGDLMKVTLDMVEDNDGNPT
                     GEVRRLKIKYFDTIPIAKSLCILKSGFLFAASEFGNHHFYQFEKLGDDDDEQEFTSDD
                     FPTDPRASYNPVYFRPRPLENLVLVESIDSMNPLVDCKVANLTGEDAPQIYAVCGNRA
                     RSTFRMLKHGLEVSEIVASELPGTPAAVWTTKLTKYDEYDGYIVLSFTNATLVLSIGE
                     TVEEVTESGFLTSVPTLAVQQMGEEGLIQVHPKGIRHIVQGRVNEWPAPQHRSIVAAA
                     TNENQVVIALSSGEIVYFEMDADGSLAEYDEKKEMSGTVTSLSIGKVPEGLRRSSFLA
                     VGCDDCTVRILSLDPESTLEMKSIQALTSAPSSLSIMSMEDSTGGMTLYLHIGLHSGV
                     YLRTVLDEVTGELTDTRQKFLGPKPTKLFQVSVQNQACVLALSSRPWLGYTDPITKNF
                     VMTPLNYSELEYGWNFNSEQCLEGMVGIHANFLRIFTIDKLGETMIQKSIPLTYTPKR
                     LVKHPEQPYFYTIESDNNTIPPELRAQLLAQSGAVNGDATVLPPEDFGYPRATGRWAS
                     CISIVDPLGDEPKVLQRIDLEGNEAAVSAAVVPFASQEGESFLVVGTGKDMVLNPRKF
                     TEGYIHVYRFHEDGRELEFIHKTKVEEPPLALIPFQGRLLAGIGKMLRVYDLGLRQLL
                     RKAQGEVAPQLIVTLQTQGSRIIVGDVQQGVTYVVYKPESNKLLVFADDTINRWTTCT
                     TMVDYESVAGGDKFGNVWILRCPERASQESDEPGSEIQLLHARKYLHGAPNRLDLMVH
                     FYTQDLPTSIVKTNLVVGGQDVLVWSGIQGTVGVLIPFVSREDVDFFQSLESHMRAED
                     PPLAGRDHLIYRGYYVPVKGVIDGDLCERFSLLPNDKKQMIAGELDRSVREIERKISD
                     IRTRSAF"
     gene            1913489..1915255
                     /locus_tag="MYCTH_2304195"
                     /db_xref="GeneID:11507571"
     mRNA            join(1913489..1914371,1914427..1915084,1915142..1915255)
                     /locus_tag="MYCTH_2304195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662897.1"
                     /db_xref="GeneID:11507571"
     CDS             join(1913561..1914371,1914427..1915084,1915142..1915175)
                     /locus_tag="MYCTH_2304195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662945.1"
                     /db_xref="GeneID:11507571"
                     /db_xref="JGIDB:Spoth2_2304195"
                     /translation="MALPAELAARSALSRICTRCSVSLQSRNGLAIGFHRVSRQQRRP
                     LSGRSSGTKQVGGIPASVAGRSFNTAPGRFSSGVARAESSSTVPRSPFQSKPVLAPDE
                     LFHSFTNSPIPDIRRRAAFMRQHARCPHHDHQPGGGMAPAHVDFECPDCGIPVYCSKE
                     HWADDYEAHLQICDTLRQVNEDDHDLRSGRHFPEFEYAGAQLEEALVNMSNWDTFLYT
                     RQFNAINDDRSMRQATRLLTYPVTIGSILHELSPYNIKPGGRLTPEGIKSLSALRYTL
                     HPPLTGAGTDVKKLRVEAPAVRIFVLGARAESSLPRDVWIQLAHLFPRTRIHLIFIGP
                     ESMLNRDDEFPLPPRTPTNPFGAIVEDRVWPTLKISTIVDYYHTIHKTGYFYPYDPYF
                     DCFVMFHPGLGHPASSHEWEESLPMLLETKAPIIVTGYTQEDMERDINWVNKTAAGEF
                     DVLLEPGENRFRSLRWDLNDLDPQDVSAGNWGVWAFRGKRYETTRKSADD"
     gene            1915943..1917635
                     /locus_tag="MYCTH_2304197"
                     /db_xref="GeneID:11507572"
     mRNA            join(1915943..1916626,1916700..1917635)
                     /locus_tag="MYCTH_2304197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662898.1"
                     /db_xref="GeneID:11507572"
     CDS             join(1916068..1916626,1916700..1917487)
                     /locus_tag="MYCTH_2304197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662946.1"
                     /db_xref="GeneID:11507572"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="JGIDB:Spoth2_2304197"
                     /translation="MTTTAAQPPPDQAPPARDPTPRPKASRTSSLVSESAPATKSRPS
                     QQPHAPNEGAAKSQQPGLPRRGGRPASADPLSDKATAFLVRRILCPQQADKGKGSPDS
                     IEGLLPPLTSRNDVDLQLYALIAIILREFVQSWYAKITADETFVAEIVHIIAHITRAL
                     EQRVRTIDLESLLFDELPDLLDKHVTAYRIAHDPMAQAPVATDPREVYHSLCPLPALS
                     PVPRPEDSKSVTAQAENEAAYRQLLVDGFLAVLLPTEDLQNDCLTALVGQILSELILG
                     NAVADRLSQPWFIWELLIIAARVAGAGKGAEQQERSRRRSNTSSDVRTRLRQSVHALF
                     YTCLQWCFFAVSFIRTVFTILMTSGSLPSRVSHGESAKGAAQRGTTHEAADPASPANL
                     HPPSTPVLAFRCWSALSNLAELDIRMPWLRGAISLLQWIAVMRPGRVAGFDSALDR"
     gene            <1918931..>1919737
                     /locus_tag="MYCTH_49020"
                     /db_xref="GeneID:11507573"
     mRNA            <1918931..>1919737
                     /locus_tag="MYCTH_49020"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662899.1"
                     /db_xref="GeneID:11507573"
     CDS             1918931..1919737
                     /locus_tag="MYCTH_49020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662947.1"
                     /db_xref="GeneID:11507573"
                     /db_xref="JGIDB:Spoth2_49020"
                     /translation="MPAGNPTLVPPSSDVELRALRRRCASALWALVPKGVGRLYFGGG
                     LLRANPVLTMSRVKTEGSADSKTAAVGKLDNNGKDTDRGKGRPSFSLSSKEDVAKEKA
                     SAVETVPIQTTQAREQERSRSGSQPRSRRSAPVPRPKTGGQGSAAASADPPRPSPPLP
                     PSKTSSASEEARTGMAPQDDENMSRQDRDHDHDDVHNDDNDDEEDDNNNNDDDEEILT
                     EIEQCILDVFSDAYCNKHLVYGVLELILVRLLPELTEKVTLELWKERISV"
     gene            complement(1920781..1923006)
                     /locus_tag="MYCTH_2304200"
                     /db_xref="GeneID:11507574"
     mRNA            complement(join(1920781..1922096,1922157..1923006))
                     /locus_tag="MYCTH_2304200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662900.1"
                     /db_xref="GeneID:11507574"
     CDS             complement(join(1920902..1922096,1922157..1922677))
                     /locus_tag="MYCTH_2304200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662948.1"
                     /db_xref="GeneID:11507574"
                     /db_xref="InterPro:IPR006695"
                     /db_xref="InterPro:IPR015175"
                     /db_xref="JGIDB:Spoth2_2304200"
                     /translation="MHNHITPSVGVDQESHLSPNNTYAPENWVDMSSFQNQTTMPDYG
                     TGYGFMPPITHGLPSESLGRMPPPPPPPQPLHQQSPATHTQLPMLMMPHPTWPSMLTN
                     PNNYGPPHSAPPVPIPSITAPLKTSKLPAIQTTSQPRKTLTDEDRRAMCQYAEDHPTA
                     KQTDIGARFGVERSTVSKVLRNKEKYLNSEERSSSPVKRSSKGKGANVEKALINYVQK
                     AKKNGIAVTSEALKERALAFTSLASGDSLMEFTSSAWLEKFMSKHGIGSGKLTRRASE
                     TNIPDSVRVSGSPALAPSQPQSAISPASPAGHLSPSPLSASKSDEEKENMNHLMGFAA
                     DSTYRHSNSQSTTSLSSSFTDAATPAFSGSAISPTASFNFSPDPNVGAFLPADQGRQV
                     PPHGAGFQRPRSQTFPTLDLEYLNQAQPTEPETPKYHVPSTAPSSALESSSSGPIFGF
                     EQAVSPPQLRRSSSNSSIAGRSSATPVTSSAIGSSPGSPTQEDARRAADTLLSFITNA
                     SGLVDQNEYMAVVRLTEKLRLHQSQVTKAAAHGMGGLSRIPEGDSEMPNAPPVMMKME
                     STMSA"
     gene            complement(<1923047..>1923960)
                     /locus_tag="MYCTH_2126704"
                     /db_xref="GeneID:11507575"
     mRNA            complement(join(<1923047..1923146,1923232..1923292,
                     1923364..1923470,1923656..>1923960))
                     /locus_tag="MYCTH_2126704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662901.1"
                     /db_xref="GeneID:11507575"
     CDS             complement(join(1923047..1923146,1923232..1923292,
                     1923364..1923470,1923656..1923960))
                     /locus_tag="MYCTH_2126704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662949.1"
                     /db_xref="GeneID:11507575"
                     /db_xref="JGIDB:Spoth2_2126704"
                     /translation="MPVNSPAHGHGAFAAPIPECSSCSTQAVWAIRAAAASLSFQLPL
                     RSLFNSHHTGQPLSRPASRPLEFSPWAPPLASYILPCSCPGILSSPVPVLVVSVACLR
                     FLPFCHWLIVFCLLPAAPSLLSLHVAGVDRPHRSPHSEAFRTEEEGWGHQQSGDLGRG
                     PFLLRRPGFADTLQLALPVERATCRTANPH"
     gene            1926307..1927526
                     /locus_tag="MYCTH_2304202"
                     /db_xref="GeneID:11507576"
     mRNA            1926307..1927526
                     /locus_tag="MYCTH_2304202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662902.1"
                     /db_xref="GeneID:11507576"
     CDS             1926616..1927437
                     /locus_tag="MYCTH_2304202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662950.1"
                     /db_xref="GeneID:11507576"
                     /db_xref="JGIDB:Spoth2_2304202"
                     /translation="MGKRSLSNYTVQYRVCICLYAVLRRAARAHVPTFSSPPGSVLSA
                     QKTGKEYLVYDVASRKGRQGDHVQEGRSVTSHSKADSTLYYGYNGLTPGPVRRRQLDM
                     GNKPGTNRYRVTHATTRRRASQLAVCQKTIQQLAAVVASATGMARSGAHVWPDFLASD
                     LQLLSCRPTHTYIQDRTSCSGEEYYSVPWCFLATVLPVDAYTECSATGDIYPLTPALP
                     SWGIIWGDKGKFGRKASTDTSIDLGWHAAEKSGTNGAALKTISIRQPATVVAWAI"
     gene            complement(1929046..1930928)
                     /locus_tag="MYCTH_2304203"
                     /db_xref="GeneID:11507577"
     mRNA            complement(join(1929046..1929274,1929348..1929468,
                     1929529..1929637,1929701..1929925,1930020..1930609,
                     1930690..1930710,1930783..1930928))
                     /locus_tag="MYCTH_2304203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662903.1"
                     /db_xref="GeneID:11507577"
     CDS             complement(join(1929255..1929274,1929348..1929468,
                     1929529..1929637,1929701..1929925,1930020..1930609,
                     1930690..1930710,1930783..1930803))
                     /locus_tag="MYCTH_2304203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662951.1"
                     /db_xref="GeneID:11507577"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="JGIDB:Spoth2_2304203"
                     /translation="MATTIDKIKEIEAEMARTQKNKATSYHLGQLKAKLAKLKRELLT
                     PSGGGGGGGGVGFDVARTGVASIGFIGFPSVGKSTLMSLLTGQHSEAAAYEFTTLTSV
                     PGQVVYNGAPLQIIDLPGIIEGAKDGRGRGRQVIAVAKTCHLIFIVLDVNKPLHDKRI
                     IENELEGFGIRLNKQPPNITFRKKDKGGLNISSTVPLTHIDHDEIRAVMSEYKISSAD
                     ISIRCDATIDDLIDVLEAKSRSYIPAIYVLNKIDSISIEELDLLYRIPNSVPISSEHG
                     WNIDELLEVMWEKLNLVRVYTKPKGKMPDYSAPVVLRANKCTVEDFCNQIHKSIVEQF
                     KVAIVYGKSVKHQPQRVGLAHELADEDVVTIIKR"
     gene            complement(1931061..>1933365)
                     /locus_tag="MYCTH_2079758"
                     /db_xref="GeneID:11507578"
     mRNA            complement(join(1931061..1932144,1932205..1932431,
                     1932513..>1933365))
                     /locus_tag="MYCTH_2079758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662904.1"
                     /db_xref="GeneID:11507578"
     CDS             complement(join(1931572..1932144,1932205..1932431,
                     1932513..1933365))
                     /locus_tag="MYCTH_2079758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662952.1"
                     /db_xref="GeneID:11507578"
                     /db_xref="JGIDB:Spoth2_2079758"
                     /translation="MADADPSVTDASEHKPLPSKEKEEDEKRKQAEHEARARDAKRKE
                     EEKRRLEEEAREKERLQREEESKKLAEAEARKREEEQRRKEEEERKRKRKEEEERQRR
                     EEEERKAREEAQRRRLLEEQKKKREEEERRRKEEEEKRLKEEEERKRRQEEERLRREK
                     LEREAAEEARRKREEEERKEQERRERALREEMERRRAAKEADQRRIRLEQERARLAKL
                     PPVLRWLDGAVNPKLAEVAEKFSIMQGVRYDCIKPEANGTRDGREQWLLNTQVALLLG
                     EKDLDLSRYTGWARIPASPVAKRAIWRLESDRYALTTPSLFELGEQLQGYYQGNDPRR
                     LGYRTLESLRAEAWEKFAAMDMFFVKASDFLFIIPTIQHLRNVRLTMAYCELPENEMQ
                     CASWTPRQKWRHDPDADGLGGFAPSNKHYINGELVSEDKPSLAEASPSPFRRQRLSRR
                     GFGAVSRENSTSTRLSKEQGLDSPMVDAESPIMPNGVHASPSGAPSDAETTAVNGRRW
                     PTLVTPTTNGAGNHPISPTSEAEATQARPLVNGTHDTVHNTD"
     gene            1937390..1937857
                     /locus_tag="MYCTH_2304213"
                     /db_xref="GeneID:11507579"
     mRNA            1937390..1937857
                     /locus_tag="MYCTH_2304213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662905.1"
                     /db_xref="GeneID:11507579"
     CDS             1937544..1937726
                     /locus_tag="MYCTH_2304213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662953.1"
                     /db_xref="GeneID:11507579"
                     /db_xref="JGIDB:Spoth2_2304213"
                     /translation="MDSSYASFHLPASLEACRIGSLPPAAYYIADFISEQEAETILRK
                     VAQRPGTLHPRAPSTF"
     gene            complement(1938141..1939447)
                     /locus_tag="MYCTH_2079764"
                     /db_xref="GeneID:11507580"
     mRNA            complement(join(1938141..1938766,1938853..1939447))
                     /locus_tag="MYCTH_2079764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662906.1"
                     /db_xref="GeneID:11507580"
     CDS             complement(join(1938408..1938766,1938853..1939423))
                     /locus_tag="MYCTH_2079764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662954.1"
                     /db_xref="GeneID:11507580"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="JGIDB:Spoth2_2079764"
                     /translation="MGWDGHWQYLLTTLSHATPAECCQAVFLLSAAGVLAVAVLPHDA
                     KTLLVDYGARKARKPSADGRPQEVPNRGWLLSLIDTVTCWSQVPHSWFSSFYVVSLAC
                     SVFWLVQYLCDGAVLRCVADSQAAASQRSATLGQVALGWFMMFLQSARREFEHWTIIK
                     PSKSTMWVVHWLLGFLFYFTINLSVWVEGSHDAQSLLKMAAATPVFLFAWINQYWCHK
                     HLAELKKYSLPTAGMFRHYICPHYTCECLLYLSIAIATAPRGVWLNRTMVCALLFVAT
                     NLGVTAAGTRKWYGETFGIGSVANKWNMIPFIF"
     gene            complement(1940124..1941621)
                     /locus_tag="MYCTH_2079768"
                     /db_xref="GeneID:11507581"
     mRNA            complement(join(1940124..1940787,1940839..1941017,
                     1941081..1941231,1941371..1941400,1941476..1941621))
                     /locus_tag="MYCTH_2079768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662907.1"
                     /db_xref="GeneID:11507581"
     CDS             complement(join(1940755..1940787,1940839..1941017,
                     1941081..1941231,1941371..1941400,1941476..1941577))
                     /locus_tag="MYCTH_2079768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662955.1"
                     /db_xref="GeneID:11507581"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="JGIDB:Spoth2_2079768"
                     /translation="MNSLRIARAALRARPAAIRAPLQRRGYAEAVSDKIKLSLSLPHQ
                     SIYKSQDAVQVNIPAVSGDMGVLAHHVPSIEQLKPGIVEVIEESGTKRFFLSGGFAVV
                     QPNSALSINAVEGYPLEDFSPEAVRAQIAEAQKVANGNGSEQDIAEAKIELEVLETLQ
                     AHLK"
     gene            1945123..1947754
                     /locus_tag="MYCTH_2304224"
                     /db_xref="GeneID:11507582"
     mRNA            1945123..1947754
                     /locus_tag="MYCTH_2304224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662908.1"
                     /db_xref="GeneID:11507582"
     CDS             1945429..1947651
                     /locus_tag="MYCTH_2304224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662956.1"
                     /db_xref="GeneID:11507582"
                     /db_xref="JGIDB:Spoth2_2304224"
                     /translation="MDHHLSHDRATSNVLAWNITHSANVEPSVEEEAGADADEPPDCL
                     TPMTSISTQFHRTPIRRGSEQHESLLTKALQSQSDEDAYESESLRRPRRRRSLTSNTS
                     LASTVDLTCGTAITTPARTNSPSPRMPVVGFAPLAAATTTDASQNKTSDAAAPVKKRC
                     ISFACAAKPRPDEKTPTRNVAQTDAAPKKTSIKFACPSQIVRATNVQQPDSRPRTPVP
                     RETPSTPTGSCQENLRSSSTVRPLRSPTPRKTPGSPVSTRNKKWLTADSGDLQSECAR
                     FHEFASDEPQEDDWIRRDHSSMQPKLTIDDTLKMENAIRKLGKEAEEEAELEEELDEE
                     EDEEVDEADLIDDDDEEDDDDDDEDDLQDEDDDEDGDDEDDQGLDDVADTEDALASGA
                     SDGYKTDNETGFAASDDEDDDLVLWTTRIGHYQSLSGTLSMTRRLSHSEKSDSSASSG
                     RKSPQSRKKKRSKTRPVPFRSETPELPDSTDFVCGTLDEDKPLEEAYISCVAARRRDR
                     HQPIPQDIDPSFPTSEPEDEVEELYKKGYGESDDHIWLHGELEDLDHDRDRRGRKKKG
                     GVPSPKRCRSPPPKRRPSPAPKARGRSPRKLTDQRSPRLRSPAPSRGAFKSPIMSPLH
                     EAEGVEFKSPAFRPGLTHTKSLPRAPGMFPHLKTRKSRTGNSTRETHVRGAIDIVKGL
                     EQKRQRRREKYYQKYCNRARKEKTQTKRPPPGEGASRMRELGLIMAGKAAHGNYVLSI
                     "
     gene            1948328..1949685
                     /locus_tag="MYCTH_2079774"
                     /db_xref="GeneID:11507583"
     mRNA            join(1948328..1948516,1948633..1948776,1948887..1948952,
                     1949042..1949685)
                     /locus_tag="MYCTH_2079774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662909.1"
                     /db_xref="GeneID:11507583"
     CDS             join(1948498..1948516,1948633..1948776,1948887..1948952,
                     1949042..1949382)
                     /locus_tag="MYCTH_2079774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662957.1"
                     /db_xref="GeneID:11507583"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="JGIDB:Spoth2_2079774"
                     /translation="MWIINWFYDILSSLGLVNKHAKLLFLGLDNAGKTTLLHMLKNDR
                     VAILQPTLHPTSEELSIGNVRFTTFDLGGHQQARRLWKDYFPEVNGVVFLVDAKDHER
                     FPEAKAELDALLSMEELAKVPFVILGNKIDHPDAVSEDDLRHHLGLYQTTGKGKVPLE
                     GIRPIEVFMCSVVMRQGYGDGIRWLSQYV"
     gene            1950298..1953056
                     /locus_tag="MYCTH_2304227"
                     /db_xref="GeneID:11507584"
     mRNA            join(1950298..1951478,1951571..1953056)
                     /locus_tag="MYCTH_2304227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662910.1"
                     /db_xref="GeneID:11507584"
     CDS             join(1950392..1951478,1951571..1953036)
                     /locus_tag="MYCTH_2304227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662958.1"
                     /db_xref="GeneID:11507584"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Spoth2_2304227"
                     /translation="MAGPNRDSVNGGSRDSPGISVPSETYSFPPEAFDWSRLPDVDTD
                     FLPPEHLEAFIQALSAPDPIPQTPDDFAATSTYPLNSPGPHRDSTASFDIDATRRATR
                     SSLSFHDEDRGSRDAARAAAAAAAAVADVAAPGPASSRQPTVGNRRPSSSSLFISARN
                     DWAPVHERVRRDRKDAPPSTRKKKKKTRRKARTKDETREGYFYNLLKWPLLFIVGAWL
                     LGLSVMYLATRMYISLYEQLISWRGQRERLRRAMRSTTRYQDWAAAAQRMDDFFGNGR
                     WKEQDEFAYYDSKTVKRVLEEMKRCRRRAERARDGGEPDECRQTTEDLKVLIEACVKN
                     NFVGIENPRLYSQTYYGTKNLVQNYIDEVERSIKFLIDTDQLSKEEKRVMFKRICANY
                     GRTALCLSGGATFAYYHFGVVKALLEEDYLPDIITGTSGGALVAALVATRTNEELKEL
                     LVPALAHRITACREPIAVWFRRWWKTGARFDSVDWARQCAWWTRGSMTFREAYERTGR
                     ILNVSCVPSDPYSPTILCNYLTSPDCVIWSAVLASAAVPGILNPVVLMMKTRSGQLVP
                     YSFGHKWKDGSLRTDIPVQALNLHFNVNFTIVSQVNPHINLFFFSSRGSVGQPVIHRR
                     GRGWRGGYVGSALEQYLKLDLTKWLRVLRQLELLPRPLGQDWSMLWLQTFGGTVTIWP
                     KVVMSDFPRILTDPDPARLARMIYEGQQSAFPKMKFVANRLRIERLVEKGRRESRLGS
                     AGARPVVATAAAAGEPGAEAGAGREVRRLSMESILSEDDLRSLLRVRERKRDGGVGAA
                     TETEEDETTDYEEEGGMVFDGDDAERQLRAAARMREEPKIATPMGLAGAEVH"
     gene            complement(1955535..1956776)
                     /locus_tag="MYCTH_2304231"
                     /db_xref="GeneID:11507585"
     mRNA            complement(1955535..1956776)
                     /locus_tag="MYCTH_2304231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662911.1"
                     /db_xref="GeneID:11507585"
     CDS             complement(1955698..1956348)
                     /locus_tag="MYCTH_2304231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662959.1"
                     /db_xref="GeneID:11507585"
                     /db_xref="JGIDB:Spoth2_2304231"
                     /translation="MRFALATVALAGAALANAVEEAQSTFTSYEYVTITSCGPEVTNC
                     PARSTSTSAADLTTSTIYSTTVRTVSDVVVTETTAYTTVCPVTASESVSVPQESEAPA
                     PTEEPSSSGSFVPAPPAESTTLVTVAPAPACPTTSVKTIKTSITTVIPTIIYETVEVP
                     CATSAPSNPLPPSAGLPPSSSQPATTSTPPIPTAGAASFGAPAALAAAAGIFALLA"
     gene            1960029..1963034
                     /locus_tag="MYCTH_2304236"
                     /db_xref="GeneID:11507586"
     mRNA            join(1960029..1961483,1961561..1961626,1961685..1963034)
                     /locus_tag="MYCTH_2304236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662912.1"
                     /db_xref="GeneID:11507586"
     CDS             join(1960681..1961483,1961561..1961626,1961685..1962948)
                     /locus_tag="MYCTH_2304236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662960.1"
                     /db_xref="GeneID:11507586"
                     /db_xref="JGIDB:Spoth2_2304236"
                     /translation="MEKVHNWEYVKSKSRGRRSAAQRKAADGARASENCAVAVDADHS
                     RPALATSHRPATAPTTGGDFLLFDDQEDAVGEDDDPHCLQYGGTDNAESYLPWTSPTT
                     RLRDNELLIERFSQTYNGAQGNANAIPSTLGAGMDPVLPDLVLPGARYYPQGDDGNAN
                     AVAIKVESPVKSLDTASPTKRKYQLFKDRSPQQNSTPASTQAREPNRGREAGAGQGPS
                     ISLGYRPSVKRGDGSDGNGSRPKRAKLDPARDFTDTTMPDIFRHAHPDIYDRNRSDKY
                     SPCHTVHREISTLIRHLSRPAHRLSVTGRAISSFDIEDPDFKHPRVGVCRNCWQTFHE
                     RSDFDSHLSSPCQRVSKGKKEKWRVLYESFTPLAAGPNTQTGGELCGRPAEHPNDALS
                     PAGIGNQEAARTPSTSVPSPVSPQLANPTPVGSGVERFVSADEHDRLQREHEALRERH
                     QQLERMAQALLIKQLFQESMNLTTAAGPAVKPPLPIASSEKDCPATSAAASDRDNLVQ
                     HMNSHSTDVDVHAFMEEMEDARQSLSRMNSGLSTASRSTIHRVPPSPPSRHADLPGFP
                     SGDGETGRHAPLPSIPDSGYGTENRRGSLGDLAAAGAGQQPATPGSLIPPCTAESAAG
                     GDGNNKDKAGGEAVLWGESPLQQTPRGYNGTLSPPHHGQPSFMTEHDMADMADYADDF
                     YNIFYQDNMLHSRSSPPGFTFENPSQVE"
     gene            complement(1963265..1964885)
                     /locus_tag="MYCTH_2304239"
                     /db_xref="GeneID:11507587"
     mRNA            complement(join(1963265..1963688,1963822..1964644,
                     1964705..1964800,1964863..1964885))
                     /locus_tag="MYCTH_2304239"
                     /product="carbohydrate esterase family 4 protein"
                     /transcript_id="XM_003662913.1"
                     /db_xref="GeneID:11507587"
     CDS             complement(join(1963474..1963688,1963822..1964641))
                     /locus_tag="MYCTH_2304239"
                     /note="CAZy_ID 270091"
                     /codon_start=1
                     /product="carbohydrate esterase family 4 protein"
                     /protein_id="XP_003662961.1"
                     /db_xref="GeneID:11507587"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="JGIDB:Spoth2_2304239"
                     /translation="MHAEGHQIASHTWSHQNASQLTTTQFTNQMIWNEIALNSILGFF
                     PTYMRPPYSICEKNCQDILSTLGYHVVYFDLDTEGYLHDDATEIQTSKDIWDDAIDGS
                     DPSSDNFLQIEHDIHYQTVYNLTDYILTSLFANGYRAVTVGKCLGDPVENWYRQGPNG
                     SITVPTTSVAPPESTSTMPTDPTRTTISVAPTHSGPSIDGTCGNGVTCAGTEFGSCCS
                     VFGWCGDSYDHCSSEKGCQPEWGSCDGTPSTTTIPSSQTTFSTKTKTSSTKTGDPSTS
                     SAEPTQTGLPVSTDGRCGPEVKQTCTGSEFGQCCSLSSKCTDNALSCIPLLGCQEDYG
                     TCSSTLHDRV"
     gene            <1966466..>1966690
                     /locus_tag="MYCTH_50125"
                     /db_xref="GeneID:11507588"
     mRNA            <1966466..>1966690
                     /locus_tag="MYCTH_50125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662914.1"
                     /db_xref="GeneID:11507588"
     CDS             <1966466..1966690
                     /locus_tag="MYCTH_50125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662962.1"
                     /db_xref="GeneID:11507588"
                     /db_xref="JGIDB:Spoth2_50125"
                     /translation="CNHGQDVGPDCNDQPHVLGADSGRSGARGIAASKAWYSRIKDDA
                     AKYPKFVKAAHRSPLCIPAEVDLERICGAA"
     gene            complement(1967943..1970431)
                     /locus_tag="MYCTH_2304243"
                     /db_xref="GeneID:11507589"
     mRNA            complement(1967943..1970431)
                     /locus_tag="MYCTH_2304243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662915.1"
                     /db_xref="GeneID:11507589"
     CDS             complement(1968208..1970151)
                     /locus_tag="MYCTH_2304243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662963.1"
                     /db_xref="GeneID:11507589"
                     /db_xref="JGIDB:Spoth2_2304243"
                     /translation="MAPPIPRTEVRLSYPLYALDFDPEDANRLIVGGGGGAARSGVGN
                     KISVLDASHDAAPQIVSEIELGRDEDSVNTLVVGSRRNNALLLYAGINSAEEDLKKGK
                     NEHFRVFAADLPSGAKEQPNPKIAEISRSALFSTTDTDAYQRLLRISGPVGAAATGSI
                     GRSNDPQIAVFDMPAATSNSPAPQLRGKVELPKEAQDMDMMQVSDDEHQLVYCDNYDI
                     YTLVVTKTATSGPHAVWSMPLDAATGAKDRPSLRCIRFLTPTFVLAVANIKSGGAVLQ
                     GFRLPNRSDLGKEEKEGKARLAISAKLPKSIRRATSMAVRNLSPPASPFAKQDETQFV
                     IAVTGQDSSITLYTLDHQSIGDINLISNLYPVTTFKEVHAGPISGLAFSSITPSATAG
                     KQQPQQPPHIKLASIGSMANTCVVHSLPLRPRREQEQQQQQQRRRQQQQEKQQGAPGY
                     TLALKPRRPSPASLLLTSALVFALLALLLQGVLEVKGLSRPVIGARSVTPVRWHSPGR
                     FYGVAVEARAEAAAPSPLPVAGVLAEYHEAKKALQGKKTGAGAGAGEKKEDGEEGEEE
                     EKTVVVVLHHVAEEEVVIRVEGHDAARHGEAKSWEELAEEQKQKWKAALKRAGQWGEE
                     MGEAAFKGILFAEIPAAVGAMVA"
     gene            complement(1970525..1972637)
                     /locus_tag="MYCTH_2304244"
                     /db_xref="GeneID:11507590"
     mRNA            complement(join(1970525..1972161,1972219..1972637))
                     /locus_tag="MYCTH_2304244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662916.1"
                     /db_xref="GeneID:11507590"
     CDS             complement(join(1970793..1972161,1972219..1972337))
                     /locus_tag="MYCTH_2304244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662964.1"
                     /db_xref="GeneID:11507590"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Spoth2_2304244"
                     /translation="MEIELAAPNGRKWTQPLGLFINNEFVKSSNEQKIASINPTTEEE
                     ICSVFAATADDVDKAVAAARKAFKDPSWRSLSGTERGALMVKLADLVAQHAETLATIE
                     CLDNGKPYSVALKENVPEVINVLKYYAGYADKNFGQVIDVGPAKFAYTLKEPLGVCGQ
                     IIPWNYPLDMAAWKLGPALCCGNTVVLKLAEQTPLSMLYVARLIKEAGFPPGVVNIIN
                     GHGREAGAALVQHPGVDKIAFTGSTATGKEIMKMASATMKNITLETGGKSPLIVFEDA
                     DLDLAAQWSHIGIMSNQGQICTATSRILVHEKVYDEFVGRFKAKVEEISVVGDPFEET
                     TFQGPQVTRAQYDRVLSYIKSGQEEGATIVLGGEPLPQKGKGFFIAPTVFTNVRPEMK
                     IFREEIFGPCVAIVKFDTEEEAIQLSNDTTYGLGAALFTKDLVRAHRVAREIEAGMVW
                     INSSNDSDFRIPFGGVKQSGIGRELGEAGLAPYCNIKAVHVNMAA"
     gene            1973092..1975719
                     /locus_tag="MYCTH_2304247"
                     /db_xref="GeneID:11507591"
     mRNA            join(1973092..1973529,1973592..1975719)
                     /locus_tag="MYCTH_2304247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662917.1"
                     /db_xref="GeneID:11507591"
     CDS             join(1973219..1973529,1973592..1975461)
                     /locus_tag="MYCTH_2304247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662965.1"
                     /db_xref="GeneID:11507591"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="JGIDB:Spoth2_2304247"
                     /translation="MIEPTASPSQAPSLGVALVALFCISVVVLLILRHYLPLRTTPAF
                     LLVPVFFALWLPASMVLLVPIDLASSAMTDNIDARGIWLDERTLRVSWRITYWLTFAL
                     TWFILPILGEYSDSGYREPKAKLLDSLRANAQYYGIVFGSGALGLIYVLISYGHFSES
                     LKSTVMALAYCWGLILVIYLMGHGLVSIPRRLFRNANISGRLRRIQAQAPKIYEKMED
                     SIVDVEDLELQVAELSRRKGGSASLFQDWIEELADMTNLPESPPGRASILRGSGNPSP
                     LPNVITAKYLAELTRRLVRAKHARSRYVSEWNRLLEDAVKTQAILDSAASKKLDFGRA
                     SPHAGFWDRHTIFTPYTRYLFHYHFVPYLQIALAAVLSLASVCIVWSELVKGLFPQLS
                     VIRYSVVHHQVAGKGQVGFAGQVIAALWMVYMCAAALISITEVKVWRGRALVRRNTAH
                     ESAFWYASQVARLSVPLTYNFMTFLGVIYRDTVFYDFLGQLINLTPLGKWFDYLFPAF
                     ILLPVCATLFGLYGRVKRVVSFGVVDALDNEEEEDDVADRGSSAAFGAWREGRDLIER
                     ELNGTLAAVRARRADVVNSSGGGNGRTGRSAPVLSIPRAGQTPTPFGTSPAAGSAATP
                     SRSRRAQANTSTRTVGRAEPLPADEGDDENFFEALGHRVKNTIDTLDTPKWLQDLGQG
                     IKKPKWMGGHEGQSGSGSHNVGRGGGADIRRWFGGGNDEGRIRL"
     gene            complement(1975950..1978203)
                     /locus_tag="MYCTH_2304250"
                     /db_xref="GeneID:11507592"
     mRNA            complement(join(1975950..1976984,1977061..1977334,
                     1977394..1977910,1977973..1978203))
                     /locus_tag="MYCTH_2304250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662918.1"
                     /db_xref="GeneID:11507592"
     CDS             complement(join(1976390..1976984,1977061..1977334,
                     1977394..1977910,1977973..1978080))
                     /locus_tag="MYCTH_2304250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662966.1"
                     /db_xref="GeneID:11507592"
                     /db_xref="JGIDB:Spoth2_2304250"
                     /translation="MMTWTRSSAAAMRSIRLLSLLKPAPSSRRRGRAGPILRFPNVSA
                     PAPAQSTQNDAPAVQQSAFPGSPREPQLSLPQLSLPAVPDPLDAFLSLLDGHTSGDSV
                     VSTQHSVCSASASGSAARSPEEDPDDAALEAELTDLWEAATSSEPPVNAQAEDRDGDT
                     IRNEMEISPADMPGFRYAKSQTNSFIRLPRRIDHDLKLAHELGYYITLNRKTKVEVLY
                     GHLELTLDEGKRLGQDIKKILQDSKLFPLVSEPTGTATATKKVLIKIALYLLIFKDWG
                     RIWFGDKRNNAATRKYLWPRDSSILLAGFVMVLYRMYTNTKQKYLAMKRIQAAMKNAD
                     SGDQTPLSPSSPAPSAESPKSAPGGAEPTAQGQSFFAALVSGAVAGKKRKLSEAILGL
                     DDHHADAAEVPANARLKYHVYVKDKADGVDIAPPTTYRHTDYMIAHGAFSSIKAAFEA
                     AGQDPVYEIMTPSGKRKIHSEADWDAAVLAIYNARRAGGVVEVEIFV"
     gene            complement(1980037..1982119)
                     /locus_tag="MYCTH_81013"
                     /db_xref="GeneID:11507593"
     mRNA            complement(join(1980037..1980905,1981403..1982119))
                     /locus_tag="MYCTH_81013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662919.1"
                     /db_xref="GeneID:11507593"
     CDS             complement(join(1980412..1980905,1981403..1981832))
                     /locus_tag="MYCTH_81013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662967.1"
                     /db_xref="GeneID:11507593"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="JGIDB:Spoth2_81013"
                     /translation="MAAGQEFQQWQVSEPYLETHCSLGEGPYYEPATNTLRFVDIIKK
                     QLHTVSLAEGPSSLQTLQFDEPVTVTADIEGRDPQEALLVGAKQGLAVLDRKTGKYEY
                     VTRFGDEKAERIRSNDGVVDPNGRFWLGTMTDFGQGPFQPEGSLYRFTAGAPAARTLS
                     DLTIPNSVGFSPSGRTMYFTHSTAREVLAWDYDPSTGAHSNQRVFYRHDGPGEPDGFR
                     VDTDGNLWHAVYGEARVLKISPDGRLVGEVRIPTRNATCCELVGAGELVITTAADDDG
                     EADGESRRLGGAVFKVHVGAEGTPRFAYKLY"
     gene            <1988953..>1991628
                     /locus_tag="MYCTH_49142"
                     /db_xref="GeneID:11507594"
     mRNA            join(<1988953..1989039,1989610..>1991628)
                     /locus_tag="MYCTH_49142"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662920.1"
                     /db_xref="GeneID:11507594"
     CDS             join(<1988953..1989039,1989610..1991628)
                     /locus_tag="MYCTH_49142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662968.1"
                     /db_xref="GeneID:11507594"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Spoth2_49142"
                     /translation="PKSECPRPLMLGDHLNVEKPLSVLRRRGPLSSTVDCSRGERILS
                     NRTAGVGSEKEPTGESVIERSCRSQCQRHQDQKREREKAAMSQGSSASHRASRHSPRS
                     ATTRPANTTSSPSIQRGHHTHEHDARAQPPRDSSGFPQTQAEGENRAPGTRGILERAG
                     PQEPSAALTHPSMTGGTPQPGMGVRQYGTEGSPVHPYAYQAPGVTTPRPTSQSVPAST
                     SPGGPPVPADQGSPQPAHPYPMAARRILTPKSPRTTSLSRAAMRTVEAQHLSGSMPSP
                     IPRGAVLGYDPQAHGHGLPPIGSGPVAPAPTRPISGLSRSVSYPSLSYGLPPMSSAEQ
                     PHPGSLKREHSGRPVLTGLPFPAPVQTTQPFGAPEVVGEGRWGPGLFSSISAARNISI
                     TDGQPHLTIMPRDGEEIVVPVDVHQGSKQADQKRQRNAGASARFRQRKKEREREQQEE
                     LHKLDNENRELQRRIEELAKRCQDLEADLDFYRNGRNRLREILSQMPGGKEWLGREPP
                     SPAPRATAGGGAPPSEGSRVHSQQQPPPPPQDHSQAGYHHQTSFYQPLAHPLAHTHPR
                     SSSYGGASAALEPPARRRRTDSEPQLPTSSYSLVGTSTTLPPITAPAPLGHPSPFGMP
                     PSPHVTPPLGAARLPPLRFDQSRTPSTTPPPVLTAAPPPPSTMPPQRSGSPYVTTRRL
                     PYETGWAVEPRPETEGGAR"
     gene            1994844..1996764
                     /locus_tag="MYCTH_2304255"
                     /db_xref="GeneID:11507595"
     mRNA            1994844..1996764
                     /locus_tag="MYCTH_2304255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662921.1"
                     /db_xref="GeneID:11507595"
     CDS             1995009..1996463
                     /locus_tag="MYCTH_2304255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662969.1"
                     /db_xref="GeneID:11507595"
                     /db_xref="JGIDB:Spoth2_2304255"
                     /translation="MESPRSPKRRRILASINPPEPRTEDGAPKVAKRDCTMARAGSTP
                     LPDESRAKVDETGNSPPELRDDGAHLPRPTKLRFKSKASRSRRREEQQQEEDDDYDDE
                     DADEDHDNHHHHHHRSDHHHRSDHHHHHHRHRHRPRSRTRSRARDRERRDRHEDRDDR
                     SRAHGDDYEDDNHTREERREQQQQHHHHHHHHGRQHRRRRHHRHKHRSAEREQEEDDP
                     FQDPPLSPNTAFRESLFDAMADDEGAAYWEAVYGQPIHIYGPPPGSGSGGGSGGGMLE
                     RMTDDEYAAYVRRKMWEKTHEGLLEARARRERERRRAREEEEAARAVEREMERCLRRG
                     EERRRRRGWRGRWERYLRRWREWEMGKEGKEEEGGGGGEGGEQFPGARRPAIPCWPVA
                     VTDDDDAADAAEEGGEIRGEAVREFFVEGIGLDEVGEREFAARLKEERVRWHPDKVQQ
                     RLGGQVDDRIMRNVTAVFQAIDALWNDTRKQHSG"
     gene            complement(1997212..1998381)
                     /locus_tag="MYCTH_2304256"
                     /db_xref="GeneID:11507596"
     mRNA            complement(join(1997212..1997910,1997999..1998381))
                     /locus_tag="MYCTH_2304256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662922.1"
                     /db_xref="GeneID:11507596"
     CDS             complement(join(1997494..1997910,1997999..1998043))
                     /locus_tag="MYCTH_2304256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662970.1"
                     /db_xref="GeneID:11507596"
                     /db_xref="JGIDB:Spoth2_2304256"
                     /translation="MRSAAFFLALASLALAQDTTTLTGVETTVTETTLTATSTSGGAS
                     ASSLSSSISSALSSINSEASSRVSSITSGAGSAIESLSSELATATGSAASSLSSRIES
                     LTSSVGSAVSSVTSSAAAETSSVTTTNAGPMQTAAVGMGALFGGAAVLANL"
     gene            complement(1999292..2002223)
                     /locus_tag="MYCTH_2304257"
                     /db_xref="GeneID:11507597"
     mRNA            complement(join(1999292..2001753,2001814..2002223))
                     /locus_tag="MYCTH_2304257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662923.1"
                     /db_xref="GeneID:11507597"
     CDS             complement(join(1999362..2001753,2001814..2001836))
                     /locus_tag="MYCTH_2304257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662971.1"
                     /db_xref="GeneID:11507597"
                     /db_xref="InterPro:IPR008828"
                     /db_xref="JGIDB:Spoth2_2304257"
                     /translation="MSVIQLEDLVLYQLRTSYLSDVADGVGERLFNLNEGFLNSAPFK
                     AAGWRPNPGLIKRTHSPPIPTAVASEYFQAPRRAGLTLEDEGEEGGMFSGSVAETVGP
                     GMATKRRRRREHMEEDDSSELSDESDEEPEQRGAQQIKFAKMPVRHRAGSSPIQSSNL
                     RQTTSASSPRPAARRGSQSALEAVKERARRDTVTSSEVSSENEFDASAYHKHREAARA
                     AAARAAKLSVKSNTEPAEVAERRKSDLLEEEDDDSDASDMSSALIESIDSASILDAVK
                     NPLNTSPRHQVVGTPPREFTRRSTIRKSAMPAPLHIPVGELPPPRPMSTIRPLSMVQP
                     KSLLSAALKAKKTKPALPFDSFASLSGQGDPNPIMLRIYAPFSNAPSRPFEVLIRRTV
                     HQGEGGDRPVTVADLIGLSLWRYNEEKREPPLPSDKLNVNWWTLRMVEEDGEIDDDFP
                     PLERKKPLTSFTTANNKANRARSNSRVYDIFGLVPASPEEFEENKRSTPQFEQEEAGE
                     EEEDKDLTPRNTPRPDAGMHPPPDRPRENPLLDTAYRANTTMFADVPQSTQPTNVSSR
                     GEKRLLRIHIHSSDVAPGQMITLDVSTDTWLAEVLDIACRKRQLDKANHVLKLPNSGT
                     VVLLDRTVASLGNVTDLDLYRRRFATDGPLMTGSLSSSSPRPHLFSDNSSWTKGKKPK
                     LMGTHPLAKEVAKQEELGVATNYKKYTVWRKQPMRLLSEKLFAIDGEYVHIMPASGGK
                     LAEGDGKSTTVHFSNVVGCKVSRKHPTNFKVCANSSSLRTPSAGWLTGRGTTAGGVQI
                     DREQEI"
     gene            2002604..2004326
                     /locus_tag="MYCTH_2304258"
                     /db_xref="GeneID:11507598"
     mRNA            2002604..2004326
                     /locus_tag="MYCTH_2304258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662924.1"
                     /db_xref="GeneID:11507598"
     CDS             2002713..2003996
                     /locus_tag="MYCTH_2304258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662972.1"
                     /db_xref="GeneID:11507598"
                     /db_xref="JGIDB:Spoth2_2304258"
                     /translation="MGLVDYSDSESETETVQQKPTPTFAAPPTKKPFQKLLDRSSGTG
                     KIVVNLPAAGAATDADADDDQPPAKRAKVTGGSRFSSLGSFLPPPKKTGATAAPKKTG
                     SAPAPGVHLRTGAEPAFVRGGGEEEGTVELDGDGAAPSGVNVNVPATNSKAQPGPSIP
                     EGQKPEEEVKLVGKPLMFKPLSVARKKAPAKNKKKDAAAAGASPSPGGAAAPSNGPTT
                     STPAATSNTAPPQKKKISLFSIGDDDDESASAAPTTTDSTGTYEPLFTSAENGGEGEE
                     DPESDVTAAYPTYQHHHYQQQQQQRQRQPPPQQPAQDDALSSLASSLSPAARRELFGR
                     SSFSSSSNNNNNHHHNNAKVISFDMEREYAHNEELRQSGAGAQLAYNPVRSIAPGKHN
                     LRQVVNMAQSNREALEESFARAKANQRDAAGRYGW"
     gene            complement(2004331..2006745)
                     /locus_tag="MYCTH_2304259"
                     /db_xref="GeneID:11507599"
     mRNA            complement(join(2004331..2005820,2005890..2006745))
                     /locus_tag="MYCTH_2304259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662925.1"
                     /db_xref="GeneID:11507599"
     CDS             complement(join(2004425..2005820,2005890..2006596))
                     /locus_tag="MYCTH_2304259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662973.1"
                     /db_xref="GeneID:11507599"
                     /db_xref="JGIDB:Spoth2_2304259"
                     /translation="MTVPTYLRGRISSPLEAGPSIVDDHHLPSQVNQALEYASKRLGR
                     KASHITLLVVRRDYQLPTSPTPSLIYTPPGSLPVSTTAASTPSKPSFPASSRIEALKQ
                     LVRSHSSVEGQIRERTVHVRLDRFRNGTASPAFSEASAFSASTVSSSTDSTFSHRIRQ
                     PGSPTPYGSVPVTPATPFTVMSSLSGTDGTSPLSRAGTQTSTQFGLRLAYAHPLSPRE
                     EKALAGALEKAAKKFKLAPNWLPQAVPPSTLGLPADLVLNSTAQNETLFESDQLTLLS
                     LDHLYTFRTALQAYARTRLACRLEDAVDELRRLFLANGRRALRKSALLAAYRWLDPLD
                     DAALADVCRMYERAYGGVERESGVENDDVDPAPGWPLPEITRGPGAIEQRTAARGPDR
                     VTSPPRRREPEPEPEPETRTRTLDLAEALDKEVLLSTADLHPDDESELDEVEAWYREI
                     QLQQQNADRPPTVEIHPLRSNPPRTTTTPAVVEVRPPPPSTPPPPPPTSATYRDRPWH
                     EPEEPSLSEMLRTTPKLRPAPPGRSLALKLQTTFDKPAKGGGGVVGGKRQQQPHAEKG
                     GGEQGQVAGEGGQQQRREEEEEEEELTARPRSAIKSFASARWTTMTTTTTTTDANNCA
                     NGGMSIDEMLHGAVGGYCGTGERPPSSSSSSSSSLSPVERIGPMTPNGYDDISPITRG
                     EWGFLMFGKGKTARVETC"
     gene            complement(2009191..2018435)
                     /locus_tag="MYCTH_2304264"
                     /db_xref="GeneID:11507600"
     mRNA            complement(join(2009191..2009346,2009407..2011580,
                     2011640..2011691,2011749..2012318,2012375..2012586,
                     2012647..2012759,2012817..2013045,2013104..2013410,
                     2013465..2013822,2013877..2016592,2016649..2016802,
                     2016878..2017691,2018280..2018435))
                     /locus_tag="MYCTH_2304264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662926.1"
                     /db_xref="GeneID:11507600"
     CDS             complement(join(2009234..2009346,2009407..2011580,
                     2011640..2011691,2011749..2012318,2012375..2012586,
                     2012647..2012759,2012817..2013045,2013104..2013410,
                     2013465..2013822,2013877..2016592,2016649..2016802,
                     2016878..2017601))
                     /locus_tag="MYCTH_2304264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662974.1"
                     /db_xref="GeneID:11507600"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2304264"
                     /translation="MAQASTADSSRERAVSSEPCSTRPNPFDEDDDNLSARKRRRTSL
                     TSDSRSRSAETFESTPSSPAAGMSAPEQRSDSAMKIDPDPAIPTTPERQQLTAEPGTE
                     PRSSRVTINVRTPSQQPLEALPPSPPSPSHRARSVTPPSATSRPDAARKSVEELGTDL
                     PANGMLSETPLSSSSGSGSPPIEVISVTGEDDADFDDDESITMLDDSGRSLEYDPTAT
                     FPFHDATESYLETVIRLLQYLPTHEQVSRAFVEWIDKYLSFVKAASSAAVEDSYFLYR
                     DMWQAVPHLVLHMVNRKSPYPRSKDLRQEIFAFYRSFSQLTAFFVELDLRTIRNPSLS
                     DQARIQALASPPYLHALGSLTRREEVTMHSSSPHLRNGEEDWSYLAEMSAVIDTFQNF
                     PASQGGSLANIRQLASFELRHVSQFPRVVTDHLGNLCLVAGNIMKCVYHRPQYLGQQI
                     SESAKRLVSRMYSVFTAMASMLSDIVEKNLNQLSPEGAGNLIEGATEIYQTCLATPGV
                     VPSEVVNNHLQDRPPVAPHLAPEAMAYHWKFSHFVKLIKSSQMQLRVMAVSTMCSNLV
                     ALYRKTAEPPGDEAPFGLLQYIADFLLSTGLVNYVLGPTCHPEITLESSNIIGFLVVS
                     HTYSRAHTDTFWQTVTSTQDPRVSDALIRMIGRIANLFPLDALMCFLEKLNTVPVENF
                     GSTMREFCDQVLKQILTRFMDSLVTESIPFDLFIRLIRQSSVFGSQSPVAYPDIQQFA
                     IQKLDSILGHGPGQDGRWNIFRDCLSDIANPSPSTIGSLWVLKMTSRFQYGRDLHELT
                     SEHDLTRLLIDELAAAVPATKSAGFSTTISGPQNAPRKELLMSIIYQEPASLTKDLGP
                     KLWSLLVGPEAACQEDRDAAWQILTLAMKRSAGENPFTSTCFSEYLPALHPKYFCHGT
                     LDFVREGVMPLVNDPTSIVLDDDENPNHSGIEMLWRLALTAPTGTVEQRAIHTLVNDV
                     YIESRSIQSFSHYRARKVHLALVDRCLRQLSSAAAKLRAFANGVAGGGDDSMEIVATD
                     EQVQEQELLFVRSLAVLREFHQLHQSRPEFSAPDMRSLLLESPKDIEGEPAELKYQSF
                     DGDKQTTVMPLKIGKRNTAASLLASLREATGFNSYRIYYRGRPFVPQESDICKSLEDL
                     QIHNGIILVKKEPEAPASPRVPQGASPVEIEILSHFDELWEYLSMEEKLAREIYGFLV
                     KLPADDKLLETIGDPSVSYKDTFSLGQPFKSLYAVNALQEYLDSCRPGSPASDERRSH
                     ERDEASGLRSAPLLRSLSLVVRAISDPEIVSHCSNRELQIELSSALVSLLASLLRDPE
                     LPASAAQFLDAPLLDRLLAILSMATPADSPKSATKHIALCLQSILESCCTSSDFMTAF
                     STHSDVPRIIGDLLLNDPRETVRQTTAMLLREKSGTAAEGERYSNKESATIAKFRDFF
                     WPLVSQLVGPAISKTDNSTEILELCFDMLQTLEETHPGSPNLEQLSHHWLNLLLNYTT
                     SEDLTRPAEPDVVAAGLVRLLHTIICRRGEQVGRGVLSRRGLARRIFWKHLFPPREEY
                     EKEFGPGRPIACPQTRGWLMEIIFTMVKDDPTEFMWLLEDMDDLVPVFPNQEGDVYAY
                     ELPQQFERSKAIRAPCGYPGVRNLSNTCYFNSLLTQLFMNVDFREFMLGATVQDREYS
                     QNLLFQTQKLFAFLQDSVRPFINPEECVGSIKTYEDTQIDVVIQMDVDEFYNLLFDRW
                     EGQFLTSDEKNRFRSFYGGQLVQQVRSQECEHVSERLEPFSAIQCDIKGKSSLQESLQ
                     AYVDGEIMEGDNKYKCSTCDRHVDAVKRACLKDVPDNLIFHLKRFDFNLRTMQRSKIN
                     DYFSFPDKIDMRPYTIEHLSNPNQEQLEDIFELVGVLVHTGTAESGHYYSYIRERPTL
                     GDTQTWVEFNDETVTPWDPASMANSCFGGPDYQSQFQSGNTVFEKQYSAYMLFYQRSS
                     SLAKRQESLPRLGRPAPFRVKMPEDIEEFIHDENAWLLRRHCLFDPSQIQFVCLALFQ
                     LKSLYPNGCSPDHALETQAIAMALSHLDQVASRTKDVPDFYNLLTRIQVMCDSCAHCS
                     VAVHDYFSRYTFAFRMLVQRNVDEEVRQATANFMIQVLQLIKERVPAQYGIPSPEEDG
                     ESDAEEVDGRQSVIAGVLRIIEHLWQGFHMNLRSWHEVFDFMLSFVKLGRHELAAFLE
                     HPHFLKWLIWIVWADTQAEPFLSPQFVKMVAVVSRRMPNRPPSYETIIALLDYILANT
                     RLPTNIEGNLPTAGAVEPGEASTDSDQLFEIGLDEASIIYRMGPRTVPVNVFVDRLIT
                     IAQNPASTNSIVANLMKQNRQMENAIYRTLLFRISGQLGHPVSPYLRVAGMVFCRNAS
                     DAAMINNLIKHVSQQCMSLQNAEGRAFLDFMRETFDGPRPRSGETRHQIIMTSLDRLP
                     DWAPGLLGYFDTSVIDGTEIFLQDKLFQYRTFRPPTGEETGQAGELAERMRVTARALG
                     FRCLHYLHENYVLRNAEVTERAVAGLQRVIKNCSRYFNLKEPAEDDEAAEFVQLNQSI
                     FDSLAGLLVVDELEEDGSGMYYSDDSSVASSNTAG"
     gene            <2020050..>2020887
                     /locus_tag="MYCTH_50281"
                     /db_xref="GeneID:11507601"
     mRNA            join(<2020050..2020105,2020167..2020217,2020278..>2020887)
                     /locus_tag="MYCTH_50281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662927.1"
                     /db_xref="GeneID:11507601"
     CDS             join(2020050..2020105,2020167..2020217,2020278..2020887)
                     /locus_tag="MYCTH_50281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662975.1"
                     /db_xref="GeneID:11507601"
                     /db_xref="InterPro:IPR013241"
                     /db_xref="JGIDB:Spoth2_50281"
                     /translation="MDRKRVVHTLDTPYSAVEWPHISQEDQDAILELLCHRLLSPLGA
                     YRRSFITPSKGKRKRSKKARGSETPSNAAPASTVPPPPELAAHVDVGLSTISRTLQAM
                     SGRETPNREEAEPKGCSRPYSVVFVARAGQSSAFHCHFPQMVALAAQSQPPDKAVRLV
                     GLSKACEDRLSTALGIPRVSSIGLREDAPQAKGLVEYVREHVAPVEIAWLREAQGGRF
                     LETKIDAVPTKIGVKKQRVS"
     gene            complement(2021208..2023261)
                     /locus_tag="MYCTH_2304268"
                     /db_xref="GeneID:11507602"
     mRNA            complement(join(2021208..2022929,2022986..2023261))
                     /locus_tag="MYCTH_2304268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662928.1"
                     /db_xref="GeneID:11507602"
     CDS             complement(join(2021425..2022929,2022986..2023052))
                     /locus_tag="MYCTH_2304268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662976.1"
                     /db_xref="GeneID:11507602"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2304268"
                     /translation="MTWCRQLVGRTNAPRRCFSIAKNNGTHKERVVILGSGWAGYGFA
                     RTLDPAKYERIIISPRSYFVFTPLLASTSVGTLEFRTILEPVRRIPGKIGFYQGWADD
                     IDFERKIISVETNAAEEAASKTVIPAPSPSSSSETGGPGKAPKGDLIEIPYDKLVIAC
                     GAYSQTFGIEGVREYAHFLRDIGDARRIRLRVLSLFEQCAYPRGSDHLSDDDKRQLLH
                     FAIVGGGPTGIEFAAELHDLIRDDLAPIYPELAPLVSITVYDVAPKVLPMFDRALAKY
                     AMDTFSRQNIKVKTEHHLERLRLADGELGRRRGVLKIKIKEYGDEEVGAGLVVWSTGL
                     MPNPLIAKLAAKRLPLPGANPLSTSPPTTRHLLRDARTGGILTDAYLRARTTTSTSEP
                     GSAPEPDGVLEDVYVIGDCAVMENDRTLPKTAQVASQQATYLAKALNRAAAAGGGGGA
                     EDKPFRFRNWGTLTYLGSWKAIHQSQADELKGWVAWVVWRGAYLTKSMSWRNKLLVPI
                     YWVVSWIFGRGISRF"
     gene            <2025611..2030739
                     /locus_tag="MYCTH_81000"
                     /db_xref="GeneID:11507603"
     mRNA            join(<2025611..2025715,2025787..2028123,2028265..2028619,
                     2028707..2030739)
                     /locus_tag="MYCTH_81000"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662929.1"
                     /db_xref="GeneID:11507603"
     CDS             join(2025611..2025715,2025787..2028123,2028265..2028619,
                     2028707..2029959)
                     /locus_tag="MYCTH_81000"
                     /note="Contains conserved domain: pfam08174, DUF1709, This
                     is a conserved domain in the anillin family of proteins
                     which are involved in cell division."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662977.1"
                     /db_xref="GeneID:11507603"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="JGIDB:Spoth2_81000"
                     /translation="MPSPAKVSSAIPRPLSEVSPTEKRRNSPSWNQTTKKMTFTDSSP
                     FQSSPLDGTTTSPRMFWQNRSFNSENSYNSSTGSPSPCRRSSIERLQKASRVKNSNIL
                     ALEHKNEYDPTRVPHVERPLAKVQRKAFGGTGTTTGPRPENRPFGHQRSESKTGVTAS
                     SPSKASPGPMSQPVRPTTPSKDQPSPMKSSLSSRFKSSFDPETGTWTDTSGDERTLPE
                     GKSLHRHQKSVTFDAAPPQVNEYEMATPDISSIGSNSREGSYDSEEEEDDDDHYMYHG
                     GVDPDDSFDASLEDTDKTPVMGPDEWRQDSHDDSFERSSPMPEEHPHMRNPLHHHRRT
                     NSSNSNSESRPLPPLPGMGSAARSLPSPPPASSASPESHSIGNGRMPLEERLRLMMLS
                     DDGKTAAEQQRERRMRRAGARERAGSQTPERESRSPSAQPHSDYEEENTVGELSGLEE
                     YQLPPRISRESILRRVNGNKALDREPDYQSSSPAGASGAEQVLQYDPDVPIPSTEDSM
                     MDELSDGGSVIIKRDPEGMDSEVDSIADLYQRSESLDDHDENDHEQRPYDDDSESQYS
                     NDEEPQSGEKQESYDSDHVPTPRGTTPTEEPPTVAQDREVCSSLELSHRNKESDFSKG
                     VDSCVLAKPEEQQLAAEPEKASMADAQAEEERPITPEQQLTRSLTKPEYDGSGWGEPE
                     EGSDEPGTPESVIHHPVPNSEDEAARQSPAIPEQLATIKSASGSKLKTRPSATPSDIA
                     AMREARRQVSREVPPIPDRHRNRISRDMEPEAGEATGEDFLERHPSFKNRSLTLDLDL
                     GLSLDQDFDRVIEAQKRGYLMRQNTKMVTASDKDTDDRGYRSAGNSPVKAARPQSWTV
                     EPWGSGQRKRSYRKRHPVTGGPVPPLPGQESNAAAPGHAHEDDMASIELATEESGERG
                     RLFVKVMGVKDLDLPLPKNERTWFSLTLDNGVHCVTTAWLELARNAPIGQEFELVVPN
                     DLEFQLTLNVKLEKPKPAPVSKKALPSPTKTSKPKTSAFSRVFASPKKRREMEQRQKQ
                     QEEEERLAAQREAQARQMMLKASQQPTAWDLLSPLAAEDGSFARAYVCLKEHESRCFG
                     RPYQVEVAAFNEWATEDATFASSVKSKRNNTNSNNPSGNGPVRRAPYKIGKLELQLLF
                     VPRPKGATDDDMPKSMNACIREMKAAEERLSRGWEGHLSQQGGDCPYWRRRYFKLVGT
                     KLTAYHEATRQPRATINLANAKRLIDDRRTLMEKETTGKGGRRRRSAFAEEEEGYMFV
                     EEGFRIRFNNGEVIDFYADSTADKEGWMKVLGEVIGRDSSADGEDENGGGGRGMKGKW
                     CELVLKREEALKKRAEGRRVHSRTKSMYV"
     gene            <2030095..>2030310
                     /locus_tag="MYCTH_2126733"
                     /db_xref="GeneID:11507604"
     mRNA            join(<2030095..2030151,2030209..>2030310)
                     /locus_tag="MYCTH_2126733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662930.1"
                     /db_xref="GeneID:11507604"
     CDS             join(2030095..2030151,2030209..2030310)
                     /locus_tag="MYCTH_2126733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662978.1"
                     /db_xref="GeneID:11507604"
                     /db_xref="JGIDB:Spoth2_2126733"
                     /translation="MDNDALMLMLLVLEERPDMEDDDAFEGEDGTGWGENDEVQAETR
                     DGHTTRLG"
     gene            complement(2030846..2032128)
                     /locus_tag="MYCTH_2304273"
                     /db_xref="GeneID:11507605"
     mRNA            complement(join(2030846..2031281,2031412..2031604,
                     2031711..2032128))
                     /locus_tag="MYCTH_2304273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662931.1"
                     /db_xref="GeneID:11507605"
     CDS             complement(join(2030980..2031281,2031412..2031604,
                     2031711..2032010))
                     /locus_tag="MYCTH_2304273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662979.1"
                     /db_xref="GeneID:11507605"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="JGIDB:Spoth2_2304273"
                     /translation="MTRFRPCIDLHAGQVKQIVGGTLDSKTSSLQTNFVSPHPPAHFA
                     RLYRDNALTGAHVIMLGPGNQDAAREALAAWPGGLQVGGGINDSNAKEWIDAGAEKVI
                     ITSFLFPGGTFSQGRLDSVLEALGGDKNKLVIDLSCRRHGGEDRWFVAMDKWQTITDV
                     EVNQDSIRRLEPYCSEFLIHAADNEGLQRGIDEKLVEKLAQWCSIPVTYAGGGRNLED
                     LERVKQLSGGKVDLTIGSALDCFGGKGVTLAECIEWNRQQESPERS"
     gene            <2032444..>2033716
                     /locus_tag="MYCTH_101762"
                     /db_xref="GeneID:11507606"
     mRNA            join(<2032444..2032720,2032897..2032991,2033126..>2033716)
                     /locus_tag="MYCTH_101762"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662932.1"
                     /db_xref="GeneID:11507606"
     CDS             join(2032444..2032720,2032897..2032991,2033126..2033716)
                     /locus_tag="MYCTH_101762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662980.1"
                     /db_xref="GeneID:11507606"
                     /db_xref="JGIDB:Spoth2_101762"
                     /translation="MPGLLGKRKSRSTEEEPDAIVNAQELLRRHFEARFKPLDIAARA
                     APAKPTAHNDSRGDDSDVGHDARDGEADLDESDSEWDGISDDDSSGGEETEAPAVEVV
                     DHTSTVSTTSAKMSKQELKTYLSSRPPDPSRTAAQPTVKKTKTQTDEDQPEDSAALLA
                     NDLALQRLIAESHILSAAGANPSHWQSQHAAGTATNLRPFAAGRTARKTTDMRIQALG
                     AKESILTQAKMPMSMRKGIVSAAAAKEEKRRREARENGIILEREVKKTKTTKKKGRGE
                     RPVDLPAVGRMRGAELRVSAREARAIAESVRGPAGKGKGKRRRR"
     gene            complement(2035172..2039203)
                     /locus_tag="MYCTH_115802"
                     /db_xref="GeneID:11507607"
     mRNA            complement(join(2035172..2036252,2036476..2036559,
                     2036635..2038267,2038346..2039203))
                     /locus_tag="MYCTH_115802"
                     /product="STE like transcription factor"
                     /note="Has EST support"
                     /transcript_id="XM_003662933.1"
                     /db_xref="GeneID:11507607"
     CDS             complement(join(2035835..2036252,2036476..2036559,
                     2036635..2038267,2038346..2038466))
                     /locus_tag="MYCTH_115802"
                     /note="1| transcription factor Fst12 [Metarhizium
                     anisopliae ARSEF 23]. and 2 of zf-C2H2[pfam00096], Zinc
                     finger, C2H2 type"
                     /codon_start=1
                     /product="STE like transcription factor"
                     /protein_id="XP_003662981.1"
                     /db_xref="GeneID:11507607"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_115802"
                     /translation="MYTQNATMAGQQIPETFMLSAEAQQSLPHDAQVALQQVDNLKYF
                     LLSAPVDWSPDQYIRRFLLPTGEYVSCVLWNNLFHISGTDIVRCLSFRFQAFGRPVKN
                     SKKFEEGIFSDLRNLKSGTDATLEEPKSPFLDFLYKNNCIRTQKKQKVFYWYSVPHDR
                     LFLDALERDLKREKMGQEATTVAVSEPALSFQFDSSQSLYEQLTKAQQANSSSFNPQP
                     LSFSQQQDTSSVVAPVDSMPPPQMMPQQIPQSLPQSMPPISQAMTPMSDALDSMTPYG
                     SMAMTPNVSQSQAVIKREPEYSRVQYNQNGVPMAHTHQRHTSMPAFGLEYSPAPSFVS
                     SHYEDYSQRGLSFEPLTPPQQALAISGEPAYIANEETGLYSAIPDLNPVGALNGMIHL
                     PPSNLAGPSFPRSYGSNNVYSSVIEGSPTYKQRRRRSSIPPSLSATSGSMTAASTATH
                     RPSDLRRSVSVSVGPVAEGEESGDASPQGMTYNNNSMAQHKEVVELSRHGTPLSTVEG
                     SPALNPMALHQHDYSPLPVDELTPLNEQRPMMHGGPNVVRRARSATVMELGPYPQKSH
                     TCPIPSCGRLFKRLEHLKRHVRTHTQERPYICPYCSKAFSRSDNLAQHKRTHDRNDGA
                     EGSLHSGEEEQYSGEDQLSSVDDASPTSENGYVTTSLDAAVSGNNGGSSNNSTNSSTN
                     SNTNSNTSSSNSNSSSSSNNNNNNDATSSNAAPTNSQSLGQIQTFNSLQTLSMPMTLS
                     QPQAINAGGLA"
     gene            <2043298..>2044479
                     /locus_tag="MYCTH_2110132"
                     /db_xref="GeneID:11507608"
     mRNA            join(<2043298..2043365,2043531,2043617..2043707,
                     2043764..2044100,2044161..>2044479)
                     /locus_tag="MYCTH_2110132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662934.1"
                     /db_xref="GeneID:11507608"
     CDS             join(2043298..2043365,2043531,2043617..2043707,
                     2043764..2044100,2044161..2044479)
                     /locus_tag="MYCTH_2110132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662982.1"
                     /db_xref="GeneID:11507608"
                     /db_xref="JGIDB:Spoth2_2110132"
                     /translation="MPLCPARLVCSDAANSYLVLSVVDAPFPVDQRDSFPAILQGGTK
                     CLLRERELMSSVPNAKGIGSLGVLKSKRVDKGFCYWQISKHAWTCFGFTTEEFEATAG
                     GRRSGIVLCTSFRPCSAASIGVPGGPWQLPCISAALLHAHCDFCAETTHTELLRYDEV
                     ATTRMVMADELSLAMQPDVLHYSVSQAAVGQSLGLILESGADRASGDLLEVELPTTDF
                     SLARAAAECETSAFVLPAMELRGSGKEMKLEGLVTAFSRTTVRTLNNGNGFHH"
     gene            complement(2046502..2048874)
                     /locus_tag="MYCTH_2304280"
                     /db_xref="GeneID:11507609"
     mRNA            complement(2046502..2048874)
                     /locus_tag="MYCTH_2304280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662935.1"
                     /db_xref="GeneID:11507609"
     CDS             complement(2046747..2048801)
                     /locus_tag="MYCTH_2304280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662983.1"
                     /db_xref="GeneID:11507609"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="JGIDB:Spoth2_2304280"
                     /translation="MSSRPSKRRRVTPPLEDGQESRENDNKIQKAFFKSAANWDLEQE
                     YELKSRKAKKKEAKKNGSEAGGRLPVKTPQGTWKIQDDVESIAGDADWFESDEDDGAV
                     DEQPEEAAPEVPKISEREQIRKAQEELAKIATQLNEDPEEHPGAFKALARIGESPILA
                     IQKLCIVTQMTVYKDVIPGYRIRPASEDIAGEKLSKEVKRLRTYEQALVSGYQNYIKT
                     LAKHASSPATESRKGGQPISSVAFTCACTLVTAVPHFNFRGELLRILVRKLSRRKVDD
                     DFTKCRETLETLFREDEEGNASMEAVSLLTKMMKARDYRIDESVLNTFLQLRLLSEFS
                     GKASQDKVSRPGDQPSVKKPKAKKEFRTKRERKLLKQQKEVDKVMALADATVSHEERE
                     RIQSEILKMVFATYFRILKARTPHLMGAVLEGLAKYAHLINQDFFGDLLEALKDLVRD
                     SEKLEEHPNGESNSNEGDDELSVVRDTSREALLCTVTAFALLEGQDAHNARSDLHLDL
                     SFFITNLYRSLLSLSVNPDIELGAKSLHLSDPDDTSAGNPANRRNNKVNLQTTTVLLM
                     RCLSSVLLPPWNIRSVPPLRLAAFTKQLMTVALQTPEKSCQAVLGMVHDVLHTHGRKV
                     NALWNTEERKGDGTYKPLAETVEGSNPFTATVWEGELLRKHYCPKVREELKAMEKELR
                     NL"
     gene            2049059..2055000
                     /locus_tag="MYCTH_2304281"
                     /db_xref="GeneID:11507610"
     mRNA            join(2049059..2049686,2049737..2053832,2053894..2055000)
                     /locus_tag="MYCTH_2304281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662936.1"
                     /db_xref="GeneID:11507610"
     CDS             join(2049310..2049686,2049737..2053832,2053894..2054799)
                     /locus_tag="MYCTH_2304281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662984.1"
                     /db_xref="GeneID:11507610"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR012954"
                     /db_xref="JGIDB:Spoth2_2304281"
                     /translation="MASSLAAQLAQIAANSRTSYNAKALKATHSKSLIWEPRVAAGQT
                     FAEIFQACHEGFEELCNLDARFAHYGTTLFSEQSQEADRTQMNAEENAALDRRVDSFL
                     HLVGSRLRLMPAIKAIEWLIRRFRIHEFNTAALITTFLPYHTIPAFVTLLSILPAKIP
                     LEYRFLDPYIRSLTSPPRAAIVQQATNRPEFLSIISQYTLESCWAKQEYPGLVSFWGG
                     VMAEAVNGMLDKMRSGRRSIQLENDHILLQQIGPVLSEAMVMKDVPGFQIASYMITAI
                     LAAKGSLNDAALAAFMDQLVLGWTVDTYRPGLVCLCILAQHRSAKQVSSRVAKALIKS
                     QDLVPTLVEISRQHRVDKLANGLALAFIDRLSKKGDVRSLPAVNSLLLANLLQEKQMK
                     VIYKALLLAAHRVTDDVDGDGHIRKEIGSSLVSLSQAGGDAGNAIRSAIEEVDFNIEE
                     LELKLGAAIRPKLAIEQSPGDAEETTESETTGKQPSLDSTFEDLAKLPVSSASCLSRE
                     SGNLFNDLCAIFLFAAAAERDLERFDTTPVLSRALAPSTSSYLSFYLRVWSGPYPTLA
                     KVAALERVKLRLKESDCADKDFQAIIPYCVVALSDPAKKVRRAAADLVAVLGSLLEGQ
                     SRQLWGAKDLYGKVGAPNTLDRDTVKTLVNLILVPSLEESVLHDGHILAAIVSALESS
                     KGSSGKEGEKRHFSHGTRLSVLKFLCGHVTETPLLAVKLRLLRPINQIRSISGTSRTD
                     LLLPLLRWWAALSREEAAELASRESLEDATIDEAFVDIVIANHPAGLETFFQLVNDPK
                     TAVRPNLVRAIFSRIIKMWPSMKSDTKFSTARSIFNITQTLSPSEQGSVIAEAVEVLR
                     KVELTTNILLDFVGSLQDEVKLATEKPANKRRRVSTTEQSRSMALQSTPEMKAALNKA
                     TFVLELVQESNPGNHPELLPSLFTTLSDLHQLSTLIGSELGYLQNLVLSSLLAMMPAY
                     KDNKNLTIDASVGHGDILATCIQKSSSPAVINAALLLVASLARTAPDVVLQSVMPIFT
                     FMGSSVLKQADDYSAHVVNQTIKEVIPPLIETFRKRGRNVVASTKDLLASFVTAYEHI
                     PSHRKHDLFISLAENLGPEDFLFAVLAMFVDRYAATDNMISFTTQMMSSFSVEVQLQT
                     LIKLLDLISDIFKPKPALSSVLLGSDGVGEHDAQKLATKQLNLLPHLLANKRLKREIT
                     QLAERDDMETGKVRDLYATLLEGILTLATTLKTKKALYNRCGDALSNLLNLLSIAEFI
                     KSVEALLDRPNVGLRQKVLRALELRVDSESTTDPKSREALLAFLPQLTAVIRESDDMN
                     YKHTAVTCVDRISEKYGKKDLDAVAAAATTIASDHCLGQSTQSLQVMALLCLASLVDV
                     LQDGIVPVLPAAIPKALAYLEQSLDGEGANAELHNAAYAFMAALAQHIPYMITGSYLD
                     RLLVCSNASAAARLDDESSSNRTHCLQFLAKLVDPKVLYNALNKNWPSAASRGASAVT
                     EYLHILGLALDKHSKAVVSKNVSSLSTIFLGCMDLRRLVSSGQVKAPISASELYEIEA
                     KIAEDALKMIYKLNDATFRPVFSKLMEWAAAGLPKSDTSGRTLRLFAVYGFLDTFFGN
                     LKSIVTSYASYIVESAVKVLSSTDFKDANEKELWKRVLRTLAKCFEHDQDSFWQAPAH
                     FGAVAPVLIEQFLNAGAINATEELIPAVVELAAAADSQEHHKELNSALLKHLRNGQAA
                     VRLAVVKCQQALTSRLGEEWLQALPEMLPYISELQDDDDEVVERENRRWIVGIEEKLG
                     ESLDSMLQ"
     gene            <2055835..2057642
                     /locus_tag="MYCTH_80987"
                     /db_xref="GeneID:11507611"
     mRNA            join(<2055835..2056313,2056410..2057642)
                     /locus_tag="MYCTH_80987"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662937.1"
                     /db_xref="GeneID:11507611"
     CDS             join(2055835..2056313,2056410..2057433)
                     /locus_tag="MYCTH_80987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662985.1"
                     /db_xref="GeneID:11507611"
                     /db_xref="JGIDB:Spoth2_80987"
                     /translation="MEANRTSYMAAESLSQARGLSASISSLSSSASGRSGTASHISKT
                     YRQASTLFLTRRLPEALSTVLPLVSPPQSDDKDGPTEPAPVIRASRSSRIKVWSLYLT
                     VLNAIAELHPDDGKDAFGAQEWRALCYKVRSGEIWEEVVRNGYHGVEGDVDAEVVINL
                     ATLLLAHAKTQTLNQKRLENYLAAARTPNLDISEDRFSQSSRRHHHHRSPSRSHSRRR
                     PPGPSGADTPRDLEARVKILELYTLHVLPRNGEWEYAREFISVSPVLDDERREAFLQA
                     LDTLREEQAAAERRAEEERAKREEAIRRDIEEARRLRAENEARERRRLEEERAKREEA
                     EKEKERERERERERERAKATERDFGVDEGSPVAAISPTPSAPKTGKPSADTRTPAGGA
                     GSVARRGGGGGGGPLPRRGGAGGGNSVASPTLMSRASTVLNNLRVLVDEIAQAFQTNP
                     YVLLRMLAFVIGLLLLLSRKRVRERMARIIGVSWNKVKATIGMGTKVSYI"
     gene            complement(2057640..2058640)
                     /locus_tag="MYCTH_2092438"
                     /db_xref="GeneID:11507612"
     mRNA            complement(join(2057640..2057893,2057964..2058237,
                     2058377..2058640))
                     /locus_tag="MYCTH_2092438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662938.1"
                     /db_xref="GeneID:11507612"
     CDS             complement(join(2057855..2057893,2057964..2058237,
                     2058377..2058393))
                     /locus_tag="MYCTH_2092438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662986.1"
                     /db_xref="GeneID:11507612"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="JGIDB:Spoth2_2092438"
                     /translation="MSRHHPDLVMCRKQAGIAIGRLCDKCDGKCPVCDSYVRPTTLVR
                     ICDECSFGNYQNKCVVCGGEGISDAFYCFECTRLEKDRDGCPKIINLGSSRTDLFYQK
                     KTNRTTF"
     gene            2059087..2060409
                     /locus_tag="MYCTH_2304287"
                     /db_xref="GeneID:11507613"
     mRNA            join(2059087..2059728,2059787..2059855,2059908..2060409)
                     /locus_tag="MYCTH_2304287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662939.1"
                     /db_xref="GeneID:11507613"
     CDS             join(2059198..2059728,2059787..2059855,2059908..2060306)
                     /locus_tag="MYCTH_2304287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662987.1"
                     /db_xref="GeneID:11507613"
                     /db_xref="InterPro:IPR006786"
                     /db_xref="JGIDB:Spoth2_2304287"
                     /translation="MAETEDYSNKRKASPESTAEDGVGKRARLEDGGAMVSRSDEVDN
                     EVKEVSNKPASSRGAQDDARARESPRETPRTNPDAEPRRSPEAQRPSAASGPPTRRNI
                     SLEEKKRGQRLFGGLVNTLSRTTSATQQQRRLEIERRQHEKAQQRRAEDEKRRIEKLE
                     RLKKTREIEQVKLDERAMKTRHETMLAKARSLHTRSEPRLYYLPWELTREQEDIINDQ
                     VRAAEETVERERREFRIRKEQRLRALGVTPPPRSPSPAPQQPKHPHESEPSSEPKSGS
                     RSEEATVGEPKLPPQDTNPDAAAPPESAKARDSHNHKDHDEHGDEIMQDEEDVVIY"
     gene            2061306..2063255
                     /locus_tag="MYCTH_2304288"
                     /db_xref="GeneID:11507614"
     mRNA            join(2061306..2063062,2063139..2063255)
                     /locus_tag="MYCTH_2304288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662940.1"
                     /db_xref="GeneID:11507614"
     CDS             2061660..2062751
                     /locus_tag="MYCTH_2304288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662988.1"
                     /db_xref="GeneID:11507614"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2304288"
                     /translation="MATNKVDKLAPTDSRVQHHTYTIPGSPHNTTYHYLVAEPSSGAA
                     PVATALLIHGFPDLAFGWRYQVPYLASLGLRVIVPDLPGYGRTDAPAELSAYSYKRVI
                     DDLVAIVRRVQGKNEPLKEGEVPAEEDKIVLGGHDWGGAVAWRFALWYPQLLRCVFSV
                     CTPFWTVGDTFHTKEQIVQRLPNFGYQLQFERTEVEDAVQGRDKIRTFLRVMYGGRRA
                     DGQPVFGVAKGVNLDLLEEDNKIGESPLMSREELDFYADEYVKNGMRGPLCWYKTAKV
                     NFDEERPLFREGRTKITVPSMMVTATRDAALPPAMSADMDKHFTAPLVRREVNASHWA
                     LWETPAETNKHIGDFLEGILKNQPLKASI"
     gene            complement(2063247..2063994)
                     /locus_tag="MYCTH_2304289"
                     /db_xref="GeneID:11507615"
     mRNA            complement(join(2063247..2063398,2063526..2063994))
                     /locus_tag="MYCTH_2304289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662941.1"
                     /db_xref="GeneID:11507615"
     CDS             complement(join(2063319..2063398,2063526..2063829))
                     /locus_tag="MYCTH_2304289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662989.1"
                     /db_xref="GeneID:11507615"
                     /db_xref="JGIDB:Spoth2_2304289"
                     /translation="MVCAKCQKLNKTVLATPGVKKKSEMYYGSPASSTSTSTSSSSQA
                     GAAKKSATLGQTGVSKSKLLSKAAKNPYAQYSSSCTRCKAKISQGHTYCNQCAYRADA
                     CHICGKPNKPKTAVPTVDGQKRTLK"
     gene            2064762..2069411
                     /locus_tag="MYCTH_2304292"
                     /db_xref="GeneID:11507616"
     mRNA            join(2064762..2068097,2068209..2068876,2069036..2069411)
                     /locus_tag="MYCTH_2304292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662942.1"
                     /db_xref="GeneID:11507616"
     CDS             join(2064876..2068097,2068209..2068876,2069036..2069210)
                     /locus_tag="MYCTH_2304292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662990.1"
                     /db_xref="GeneID:11507616"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_2304292"
                     /translation="MPGRPPPGGSSASRNDLLLDLDNDQPIYSTGQRSALTDDDLLHS
                     YAYDQDGAPSRPSVSYDDFVGSGRSGATAGRPPPATSSSSAPRPLGPYGPEIQRQYSQ
                     TSDLGNYQRYADDFDDYPDDGGYYQHGGAVAGDSSSSARGNARKRNSVLSLGGGFLGR
                     VKNRLGMGEGYSEMDLPLTDPRAGAGPGGRTDTAEVVPPGEKKFDMGNFRFGFGRSKP
                     DPSTLGPRIIHLNNPPANAANKYVDNHVSTAKYNVATFLFKFLFEQFSKFANIFFLFT
                     AALQQIPGLSPTNQYTTIGPLIVVLLVSAGKELVEDYRRKQADKTLNNSKARVLRGSS
                     FTETKWVNVAVGDIVRVESEEPFPADLVLLASSEPEGLCYIETANLDGETNLKIKQAL
                     PETASMVSSTELSRLGGRLRSEQPNSSLYTYEATLTIQAGGGEKELPLTPEQLLLRGA
                     TLRNTPWIHGVVVFTGHETKLMRNATAAPIKRTKVERQLNKLVLALVGMLLALSVIST
                     AGDLILRRVSGDSFRYLDLDGLGGVGDVLRIFIKDMVTYWVLFSALVPISLFVTLEMI
                     KYWHGILINDDLDIYHDVTDTPANCRTSSLVEELGMVEYVFSDKTGTLTCNQMEFKAC
                     SIAGIMYAETVPEDRVATIEDGVEVGIHEFKQLKQNLRDHPTAQAIDHFLTLLATCHT
                     VIPEQTDSGRIKYQAASPDEGALVEGAAKLGYKFYARKPRAVVIEVNGEQVEYELLAV
                     CEFNSTRKRMSTIYRCPDGKIRCYTKGADTVILERLNDNNPHVEVTLRHLEEYASEGL
                     RTLCLAMREIPEHEFQEWYQVYDKAQTTVGGNRAEELDKAAELIEKDFFLLGATAIED
                     RLQDGVPETIHTLQEAGIKVWVLTGDRQETAINIGMSCKLLSEDMMLLIVNEENAEAT
                     RDNLQKKLDAIHSQGDGTIEIGTLALIIDGKSLTYALERDMEKLFLDLAVKCKAVICC
                     RVSPLQKAMVVKLVKKYQKESILLAIGDGANDVSMIQAAHIGVGISGMEGLQAARSAD
                     VSIAQFRFLRKLLLVHGAWSYHRVAKAILFSFYKNITLYLTQFWYVFQNVFSGEVIYE
                     SWTLSFYNVFYTVLPPLALGILDQFVSARLLDRYPQLYNFGQRNHFFKGSVFASWIIN
                     AVYHSIILYLGTSAFYLNDGVESDGFPAGKWVWGTAMYGAVLLTVLGKAALVTSNWTK
                     YHVVAIPGSMAIWIVFVAVYGTVAPKLGFSKEYFGVIPRLFSSPAFWLQMPTLAILCL
                     LRDFAWKFSKRLWRPEAYHHVQEIQKYNIQDYRPRMEQFQKAIRKVRQVQRMRKQRGY
                     AFSQADESQTRVLQAYDTTQHRGRYGEMASSRLQ"
     gene            complement(<2072984..2074878)
                     /locus_tag="MYCTH_2139043"
                     /db_xref="GeneID:11507617"
     mRNA            complement(join(<2072984..2073443,2073531..2073590,
                     2073940..2074878))
                     /locus_tag="MYCTH_2139043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662943.1"
                     /db_xref="GeneID:11507617"
     CDS             complement(join(2072984..2073443,2073531..2073590,
                     2073940..2074178))
                     /locus_tag="MYCTH_2139043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662991.1"
                     /db_xref="GeneID:11507617"
                     /db_xref="JGIDB:Spoth2_2139043"
                     /translation="MHHQRRRSGHASGNTSLTDVRKAATATDTSSKKHSSRPSMSRRV
                     TPQSAPKLGKSPRDREKELDEQRWWDEERESFPEYCMTCEKQFIPLDDQSLYCSEDSS
                     ISAALPSRYTSSHPATQYPFYSGPPEPRDIIPRASPSRPSPTHISQPVTPASAMAALK
                     SLSIRPSSPTSPVGTYHQGIWPFARSTTTATSPSSSYSKQTTGLFSSTYDGAYYSAAG
                     DYYGTSSDRPLPSRRPAAYSRPKSIELVTPMLGR"
     gene            <2077015..>2078721
                     /locus_tag="MYCTH_94026"
                     /db_xref="GeneID:11507618"
     mRNA            join(<2077015..2077021,2077072..2077232,2077395..2077523,
                     2077647..2077784,2077842..2077874,2077948..2078182,
                     2078240..2078263,2078395..2078640,2078702..>2078721)
                     /locus_tag="MYCTH_94026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662944.1"
                     /db_xref="GeneID:11507618"
     CDS             join(2077015..2077021,2077072..2077232,2077395..2077523,
                     2077647..2077784,2077842..2077874,2077948..2078182,
                     2078240..2078263,2078395..2078640,2078702..2078721)
                     /locus_tag="MYCTH_94026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662992.1"
                     /db_xref="GeneID:11507618"
                     /db_xref="JGIDB:Spoth2_94026"
                     /translation="MQASRAELKQRALPHRAFWARHPIPPAYELLVVTLPSWSPDWLG
                     WGRALLAQVDQITTCSTPDSPGSLDLPSLWSHGPTLPSRGDMGTGRNGAFLQHFPANK
                     GARQLQGEVRAEAMGRSYNAARVAAVGFGKDDASTELSVDGSVWTAYCTPARGINVVT
                     PYRPRLPPVLMTGPGFVSYGLIDSHTTRKRSTRWLVYSVCTEEKLGQPPKHRRGAKVG
                     VQTDPRAPVYCLPHPLFGACPYLLVRIEFCALIAARHVPPPGDSGLIRGHNTSASGNV
                     LGRRIDPQSASARLWATSSGLIEHFQLGHTAAATVELPVERFRTYLTYCNTLAR"
     gene            complement(<2080535..>2081438)
                     /locus_tag="MYCTH_94025"
                     /db_xref="GeneID:11507619"
     mRNA            complement(join(<2080535..2080956,2080988..>2081438))
                     /locus_tag="MYCTH_94025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662945.1"
                     /db_xref="GeneID:11507619"
     CDS             complement(join(2080535..2080956,2080988..2081438))
                     /locus_tag="MYCTH_94025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662993.1"
                     /db_xref="GeneID:11507619"
                     /db_xref="JGIDB:Spoth2_94025"
                     /translation="MPRSSGTLWADNVNKRFYLFAGEYYQEPPSPQFTLWSYDTIYDT
                     WQSFGSPPEDDIAAVPYGAGVSMSETGEGYYYGGWKSHNTVPGWSGPPRAVSGLVKYD
                     MDANTWSTEPGPDSIGRAEGAMVFIPIGDGGMLVYLGWSHPVRHPRPHRATNTAPADG
                     FSNPDLRVLMTRKASIATRTPTRAVSSATGVPGANDDPLSAGAIAGIAVGGAVALLAL
                     LASLFLLIRRCRRHKYGTTTTTTTTTLLQPHFSPAGRPRGGGDDGLLGVGRASSSRRD
                     AAAAARTGAATAER"
     gene            <2084656..>2086726
                     /locus_tag="MYCTH_2118236"
                     /db_xref="GeneID:11507620"
     mRNA            join(<2084656..2085094,2085162..2085344,2085635..2085639,
                     2085800..>2086726)
                     /locus_tag="MYCTH_2118236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662946.1"
                     /db_xref="GeneID:11507620"
     CDS             join(2084656..2085094,2085162..2085344,2085635..2085639,
                     2085800..2086726)
                     /locus_tag="MYCTH_2118236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662994.1"
                     /db_xref="GeneID:11507620"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2118236"
                     /translation="MAEPQSSSSSITVKEAAVNSGADVEAQRQGRNNPPHWFLVLHPD
                     GVTDAVLNYRYPGEGTAESPYVVDFLPQDASNPMQFSRGKKWAITLLQAVATLAVAFV
                     STAYTGGISEVIRYFRVANIVAILGVSLFVLGFAVGPLLWAPLSEFKGRQIVFFFTYF
                     GLAAFSAGAAGAQNIQTLIILRFFAGAFGASPLTNSGGVIADMFNARGRMELHVTTPR
                     SQQVRTTLIRPWVLLFREPIVFLTAIYMAIVYGTLYLLFAAFPIVFQINRGWSPGIGG
                     LAFIGVAVGMLFAVAYSMIDNRRYGRVAAASPGGMAPPEARLPPAIVGSVLLPVGLFW
                     FAWTNGAGVHWVVPIVASGFFAAGLVLVFLSLLSYMIDSYTVFAASVLAANSVLRSLF
                     GAAFPLFTPYMYDDLGIHWASTIPAFLALACMPFPFLFYRYGARIRRSCKYAAEAAAV
                     LEKMLKQAAQGQQQQQQQQQGVPAAAAGGGGGGASRAGSSGDERLAVLSEDEGTVVGD
                     GDESKEKKN"
     gene            complement(2087779..2091747)
                     /locus_tag="MYCTH_2304300"
                     /db_xref="GeneID:11507621"
     mRNA            complement(join(2087779..2089200,2089268..2091015,
                     2091115..2091180,2091250..2091268,2091361..2091419,
                     2091515..2091580,2091643..2091747))
                     /locus_tag="MYCTH_2304300"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003662947.1"
                     /db_xref="GeneID:11507621"
     CDS             complement(join(2087892..2089200,2089268..2091015,
                     2091115..2091180,2091250..2091268,2091361..2091419,
                     2091515..2091580,2091643..2091645))
                     /locus_tag="MYCTH_2304300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662995.1"
                     /db_xref="GeneID:11507621"
                     /db_xref="InterPro:IPR004022"
                     /db_xref="JGIDB:Spoth2_2304300"
                     /translation="MVLFKRKPVQFLPVPEIEDEDREVWHIPQTGEIFLTYEDYLHRM
                     DFYKQKRFICTISGHSGLTFFDALESELAGAAEVDQAFPEALKGPILRRVQFQTVSRI
                     DTLVDQLYDEFKNDYYPGEAVTVHILGGERLQGVVRDKTRFGSKVLPDGTLTPPFSRY
                     FVSLDERPDEEAVVDDSHIFRDRKVFTKAVLRSFIKKTVTREAWNGAPWLVKHDVAEK
                     YHIDTRIPPHLRYDNKLLERKQLQLQKKASQFDPTMVTPTPVSPTGLKLPELKPAPKS
                     HKSKAQQALQAQQHAIKGKHSTFGGHEPGSFVHLPLPGNPFQFPMSFRGQVPPPVVRQ
                     REPTPPPPPPKYPIEDLQVEPRKLVRPQLKYLCRDTPVEVQPDSKSPQSDKIRMKSVG
                     PLLETWDTLNVYCEIFKLDSFTFDDFVETMLVASAETPVQLFDEIHCAVLKILVDSEA
                     EGGKVQIQLPELEEEEEEEEEEGEEDEEDEQEENAAPTPEPEPQPSGRATRRSLARAE
                     AERLAAEAAAAERELREAENAPKHRAEELLRDYDWIEHLRKRDFKDGGWQMIMVGLLH
                     HLSRNERLHVSCEELLQQLVPTDIEPSQETVRQRYSVLDVNYRVQALQIICMLTSETK
                     AVRGYMEDCSETMTAYRKEKIEWQRKRKQLIEDLKALNDQRKILLPDNLPPSPPLEPV
                     KTNGDVKMSDVEDLPANTSDEVPDTDEDGPTRKLRRANDRAAERKRKAEKEQERKEKA
                     EAAAKMPKQSKQFQRVLKDIQKKEDEIAECEREIAVIDNDLREADCPRTRVLGKDRFW
                     NRYYWFERNGMPYGGLPDSSTAWAGYANGCIWVQGPDELEREGYIDMAPEYQDEYKAK
                     FGMTVPERKKMEEGTTSVFNAFQWGYYADPEDVDALLAWLDPRGFNELKLRKELVNYR
                     DKIVTNMENRKKYLAESEQQLKEKNAQNDAESAAGPASSANATTTTTTTTTKRMSTRA
                     RGVTTISAPRLQDQADESEQAAAAAASSSSSSSPSEKTTKPKYYRCMNWQNTMALDEI
                     GHLHSVEPLPARPRKATKKKEAAMAAAAAKEAAAKEAANADSGEMMVTRKRGKQSAGG
                     R"
     gene            complement(2093098..2095003)
                     /locus_tag="MYCTH_2304301"
                     /db_xref="GeneID:11507622"
     mRNA            complement(join(2093098..2094351,2094416..2094688,
                     2094776..2095003))
                     /locus_tag="MYCTH_2304301"
                     /product="glycosyltransferase family 57 protein"
                     /transcript_id="XM_003662948.1"
                     /db_xref="GeneID:11507622"
     CDS             complement(join(2093190..2094351,2094416..2094688,
                     2094776..2094852))
                     /locus_tag="MYCTH_2304301"
                     /note="CAZy_ID 267915"
                     /codon_start=1
                     /product="glycosyltransferase family 57 protein"
                     /protein_id="XP_003662996.1"
                     /db_xref="GeneID:11507622"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="JGIDB:Spoth2_2304301"
                     /translation="MTEIYPSLAQCAIVAAALKVLLFPAYKSTDFEVHRNWLAITHSL
                     PLWDWYYEKSSQWTLDYPPFFAYFEWIMSQVAKLVDPAMLKVYNLEYDSWQTVYFQRF
                     TVIITELLLVYSLQLFVDSSHGVSKRAAQAAAISILLSPGLFIIDHIHFQYNGVMYGI
                     LIASLVLARKKETLLWSGLLFAALLCMKHIYLYLAPAYFVFLLRAYCLSPKSIFRIQF
                     LNCVKLGAGIAAIFGAAFGPFALKGQIRQIASRLFPFSRGLCHAYWAPNVWAMYSFVD
                     RVLIVLAPRLGLSVREEALQSVTRGLVGDTSFAVLPEITPRTCFALTLLFQAIPLLKL
                     FAQSTPSWDNFVGAVTLCGYASFLFGWHVHEKAILLVIIPFSLIALKDRRHLGAFRPL
                     AVAGHVSLFPLLFTPAEFPLKTVYTVFWLILFLVAFDRLAPASSRARFFLFDRFSTLY
                     ITVSIPLIVYCSLVHGVVFGKSYEFLPLMFTSSYSAIGVVGSWVGFMVVYFTS"
     gene            2095621..2097252
                     /locus_tag="MYCTH_2304302"
                     /db_xref="GeneID:11507623"
     mRNA            join(2095621..2095838,2095916..2097252)
                     /locus_tag="MYCTH_2304302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662949.1"
                     /db_xref="GeneID:11507623"
     CDS             join(2095743..2095838,2095916..2097142)
                     /locus_tag="MYCTH_2304302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662997.1"
                     /db_xref="GeneID:11507623"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="JGIDB:Spoth2_2304302"
                     /translation="MRLPSSYAVLAAGLAQVQAQYLISELSFGTNKRISAEGSRSIPN
                     FSLQGRPNVPELLSDRVILTPVAPGNQRGAVWADRPLPEQSWIADVEFRANGPERAGG
                     NLNIWLVKDGAHTVGSDSVYSAGRFEGLGLLVDQHSGSGGMLRGFLNDGTTDYAHHPN
                     VDGLAFGQCKFTYRNLGRPTQIKLRHTEEKFVVEVAGRTCFQSDKIRIPSGYHFGITA
                     ASADNPDSFEVFKLAVLTEQAPGSSRSSSSSNNNNNNNNNNNNNVKRPRMNFGRSGQV
                     SVEDPYDNAIPDQDADTITSSRAQFADLHNRLQSVNHHLSTIFRSVAQNAGVDEQRHA
                     ELSAMLGELKGQLARLDKVDALEQWLRDIQTEMRGMRQEMAGRLRDSERAIKYHVDDK
                     HQTLAEDVKGHAKSGHTRLILVVVGSQLLLAGAYAYFKRKQTSPKKYL"
     gene            complement(2097330..2100066)
                     /locus_tag="MYCTH_2304303"
                     /db_xref="GeneID:11507624"
     mRNA            complement(join(2097330..2097746,2097835..2098522,
                     2098649..2098820,2098886..2099267,2099362..2099488,
                     2099606..2099736,2099887..2100066))
                     /locus_tag="MYCTH_2304303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662950.1"
                     /db_xref="GeneID:11507624"
     CDS             complement(join(2097518..2097746,2097835..2098522,
                     2098649..2098820,2098886..2099267,2099362..2099488,
                     2099606..2099663))
                     /locus_tag="MYCTH_2304303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662998.1"
                     /db_xref="GeneID:11507624"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="JGIDB:Spoth2_2304303"
                     /translation="MPGNRLDKAWLEADLGKFPAKTHARKVANELGATNGIIYIPGQE
                     EQFYENSDMGPRFRQRRHFYYITGADFPGCAVTYDIACDHLTLWIPRVEPRKVLWFGR
                     TPTIEQCKAASDLDDVRYIDDLEQTLARVLHPGCTIYALHPSLVPEVGRAKVTVVIDT
                     TKLQPAIDEARVVKTDHEIALIRRANAVSSGAHRAVLAALRRCNNERDIEAIFKAYCI
                     SHGAPTQAYPVIAASGINASTLHYEDNNQPFGDRQLLVLDAGAEWRCYASDITRTIPI
                     PRSPASSPTGSGGGGGGGRGFFRSREAAAIYSLVERMQEECIARVRPGVRFFELHVHA
                     CAVAARGLADLGILRDAPEALRWGTVTAFFPHGLGHHVGLEVHDVAGRESLLLGVSAE
                     RMARALNRTKTASSETTAATAAAAAAAAAPVPGIGRRAFPKRDLVSQHANACMVTMAR
                     ADPSPATSKPLQKLREGMVVTIEPGIYFCREYIEGFFLNKPIHSRLINKEELAKYWDV
                     GGVRIEDDILVTKDGYENLTCAPKGKEMWDIINNGASSEAGDL"
     gene            complement(2101309..2103797)
                     /locus_tag="MYCTH_2304309"
                     /db_xref="GeneID:11507625"
     mRNA            complement(join(2101309..2102287,2102358..2102742,
                     2102814..2103403,2103512..2103797))
                     /locus_tag="MYCTH_2304309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662951.1"
                     /db_xref="GeneID:11507625"
     CDS             complement(join(2101355..2102287,2102358..2102742,
                     2102814..2103385))
                     /locus_tag="MYCTH_2304309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003662999.1"
                     /db_xref="GeneID:11507625"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2304309"
                     /translation="MTSLQALVYMILFLQATSNISDCYAFLGIALRSCLRMGLHRHIA
                     HHKITPIEDETRRRVFHVIRQMDFYVSAILGFPLLLHDEDVDQPLPTEVDDEYITKEA
                     IQMPPPGTPSFFQAFNAHNRLMRILARVVKDIYPLRGMENDVKGQRKDNKTFMISYSR
                     IRAIEAELQEWQSQLPDYWRPSHDGPIEVIRVRTLLRFGYAHVQMMLYRPFLHYISPR
                     LTAGKQIDNRYYNCAAAGITVSRNIVHIGIEIQKQAALIGPYWFILYTKFFAILSLLF
                     FVLENPDKPGSAEILADAKAGREVIATLAKRSLAADRITAALNPLFDQLPDRLKNPIA
                     RPTPTKKRSAPAPNLAQGSRAGSATPPSRPDLQDSMPQRRSEEMARPAIGLLRRDSRA
                     PPQRTASFDTIAFQHGSLGGQTFTSFQDMLPLNMPLSGPGSDSGSTQGTMHSHAQGFQ
                     QVQHTGGPVGSLYKMDAMMFPSEDPFAYPHQPPMDPASQHPAGQTPQSNAGQPHDAMQ
                     FYIPNMYDGIEGQLLDPIPGYLIPQGQRQARHGLDGTAQMYNPPSMLNMQPGHAHQQL
                     QHHHHQQMAVQQQLAQGRRQQQQQQQHQQQQQQQSSGGMVDEMLTGPGFRGEWEDMMG
                     NPGYQ"
     gene            complement(<2106469..>2107565)
                     /locus_tag="MYCTH_94018"
                     /db_xref="GeneID:11507626"
     mRNA            complement(join(<2106469..2106730,2106815..2106843,
                     2106898..2107054,2107192..>2107565))
                     /locus_tag="MYCTH_94018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662952.1"
                     /db_xref="GeneID:11507626"
     CDS             complement(join(2106469..2106730,2106815..2106843,
                     2106898..2107054,2107192..2107565))
                     /locus_tag="MYCTH_94018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663000.1"
                     /db_xref="GeneID:11507626"
                     /db_xref="JGIDB:Spoth2_94018"
                     /translation="MVRESQKRKQRKRGPWAQVTEHESDLPDQRCPDTLPTTTWGRIS
                     SFPPIPGAELRNIPTIDRAKAVEKVCSLDPVILAQCGSCKRWSDLDPVPLAWGSCMPS
                     LHTDVSQAPSAPMFFSTLSRSPIVHYRTPVLPAGSPFGATAFAFSQFPAPSSNERSCV
                     SITYTQCRVTAYCMHDGTFQRANSPSRVGSTVPTRVLPVSACVPLSEPFLFLARQPHS
                     DSGIRPEKRARPGNASRFNTHTSTGTETRERQHRMPDPDNAGTRLSSHTMKLAAG"
     gene            2107731..2109970
                     /locus_tag="MYCTH_2304313"
                     /db_xref="GeneID:11507627"
     mRNA            join(2107731..2107946,2108150..2108285,2108388..2108432,
                     2108489..2108769,2108835..2109596,2109660..2109970)
                     /locus_tag="MYCTH_2304313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662953.1"
                     /db_xref="GeneID:11507627"
     CDS             join(2108222..2108285,2108388..2108432,2108489..2108769,
                     2108835..2109596,2109660..2109860)
                     /locus_tag="MYCTH_2304313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663001.1"
                     /db_xref="GeneID:11507627"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2304313"
                     /translation="MADSLLAFFTLMDNQDGVIVREPPKFDLDLYIQNYKGRTRFDRL
                     FLIGRSSVPLCVDALKAAIAEAKRGKDTNRYREAVECLRIAAPSEPEATYDQAWLETQ
                     EAANKAETNRLLTELKGYKNNLIKESIRMGNEDLGKHLESIGDLNAAAETYAKMRPDV
                     STPKQFLDVGKHLVRVSVQRREWGMVSAHLSKMGGAHHAEEEKAVQPYLKIAHGIALL
                     GQEKYREAAFSFLSADSSISGSTYSELASQSDVAVYGGLLALASMDRNELQSNVLDNA
                     QFRTFLEQAPHIRRAVAQFVSGRYSACIGILESYRPDYLLDIYLQKHIPNIYSQIRSK
                     CIIQYLLPFSCVSLETMEKAFGRPDQRIEDELADMIQSGALSARINMVDRLVTTKAAK
                     PRAQMQDTALQAAEEYERQALERLRRMGLAAADLELRGSKKTSLFPSEGELMVEETLG
                     "
     gene            complement(<2110203..>2111354)
                     /locus_tag="MYCTH_2126754"
                     /db_xref="GeneID:11507628"
     mRNA            complement(<2110203..>2111354)
                     /locus_tag="MYCTH_2126754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662954.1"
                     /db_xref="GeneID:11507628"
     CDS             complement(2110203..2111354)
                     /locus_tag="MYCTH_2126754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663002.1"
                     /db_xref="GeneID:11507628"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR014906"
                     /db_xref="JGIDB:Spoth2_2126754"
                     /translation="MDFASLMSQEISKAKGGSGSGSGSGSSTGGGEQKKYISRREAEE
                     ARRAAYLAEQKRLEEERAAKAAAKRRREEEAAQEARAREEKRRRLAEEARLRREAKEA
                     EEERARRRRLGLPEVPLVKQGEEEGGEGDKKKAEEGGDEDDLDGDGEDAGDIAEEELV
                     KKLRELGEPAILFGENHAARLMRYRKVSRGGALAAAAGPIATTLVPVEEKDMKVPDKV
                     PPASDKKARRFLYRQLASYFNMVLREWEAALARENNADTFAGQAARNAMTSSKDSMRP
                     LFRKFEQGNLDESILEAIVEIVKAAQERRYVDANDGYLRLSIGKAAWPIGVTMVGIHE
                     RSAREKLHGGERGHIMGSEVTRKYLQSIKRCLTFAQVRWPPEDIRQLMG"
     gene            2111788..2113243
                     /locus_tag="MYCTH_2079848"
                     /db_xref="GeneID:11507629"
     mRNA            join(2111788..2112018,2112090..2113243)
                     /locus_tag="MYCTH_2079848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662955.1"
                     /db_xref="GeneID:11507629"
     CDS             join(2111939..2112018,2112090..2112891)
                     /locus_tag="MYCTH_2079848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663003.1"
                     /db_xref="GeneID:11507629"
                     /db_xref="InterPro:IPR010516"
                     /db_xref="JGIDB:Spoth2_2079848"
                     /translation="MSPRELNRAETPPFLVKLFYRTGAFHRPEEFNTPSSLPPHLQIH
                     TWPDCTLLELSYHIADASPPVLPDPAVGTRLCFSLVYADTRGRTDTPPRYVSKFLGSV
                     VLGRGGPGASRDPPRRPGDELDGGAGSGDGGGDDDNNNNNDDDDDNHSAGSSEDESLT
                     LADARFITGDFISCAILPPDELTGDVVPASSARMGRGAGVGEARGGYVDDEDAPPPPY
                     SRSRRGSYGGPPPPGGGRMRGGYRSGGPRGYGGGGGRYRDRDEPFGRGGVRIPDGEWR
                     RGDRLPDEPPEIGRWGR"
     gene            complement(2113681..2114164)
                     /locus_tag="MYCTH_2079850"
                     /db_xref="GeneID:11507630"
     mRNA            complement(join(2113681..2113823,2113917..2114032,
                     2114131..2114164))
                     /locus_tag="MYCTH_2079850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662956.1"
                     /db_xref="GeneID:11507630"
     CDS             complement(join(2113770..2113823,2113917..2114032,
                     2114131..2114158))
                     /locus_tag="MYCTH_2079850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663004.1"
                     /db_xref="GeneID:11507630"
                     /db_xref="JGIDB:Spoth2_2079850"
                     /translation="MDPALVRLGSMVQNRYKYFRWTKRTARITFVYAAVIPAIIGYLG
                     YQNDGLWDLRAKRRGDIISER"
     gene            2114913..2116129
                     /locus_tag="MYCTH_2304323"
                     /db_xref="GeneID:11507631"
     mRNA            join(2114913..2115167,2115258..2115640,2115698..2116129)
                     /locus_tag="MYCTH_2304323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662957.1"
                     /db_xref="GeneID:11507631"
     CDS             join(2115139..2115167,2115258..2115640,2115698..2116104)
                     /locus_tag="MYCTH_2304323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663005.1"
                     /db_xref="GeneID:11507631"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="JGIDB:Spoth2_2304323"
                     /translation="MGEVKVKLHWLNGSRAQSILFLLEELEIPYELEIYRRQKDMLAP
                     PELKKIHPLGKSPAVTITAPGASEPIILAESGFITQYLCDHFRRGKTLVPQRWKDGQE
                     GKVGGETEEWMRYQYLLHYIEGSFMFTMVMNFILSAGLKGSSVPFFVRPITTFIANQM
                     ISMVVAPNMKRHFGMMEQLLETSPGGGSYMCGRTLTGADIMLSYPLIAGKDGAFDSIG
                     QWDKGSFKETYPKLHAYIERLAEEPAWKRSVERIKQIEGRFSLLPTPGEPSARI"
     gene            2117000..2119686
                     /locus_tag="MYCTH_2304324"
                     /db_xref="GeneID:11507632"
     mRNA            join(2117000..2118028,2118088..2119686)
                     /locus_tag="MYCTH_2304324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662958.1"
                     /db_xref="GeneID:11507632"
     CDS             join(2117140..2118028,2118088..2119667)
                     /locus_tag="MYCTH_2304324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663006.1"
                     /db_xref="GeneID:11507632"
                     /db_xref="JGIDB:Spoth2_2304324"
                     /translation="MDGMANSASSTVMPPTQAPAPPAEEGGSPQLDSVEEDDLDVDHD
                     DAQSFLQPAISPLATLLTSPRAPTADKVAALGRQPGLFETPPGEEISQSGQAVAASDN
                     MATISESSPNQRPSPLTLPSPWQAGPKQFMISEPGRFRSSMAAAFQSHSRQHRSQSAG
                     ESALKRLSKVLPNISIPSSLIPNISTPTFFSSSSSAQQKDPGHASEARPPRVLVSPPA
                     PFPGPSSPQEVSIRSDTAPLRPLRHSASDDSLLYHTLSHVSSLGDDERFAHVREQVNV
                     RIKAIKDSFEGPSFKLPQMPSLLNTPLKKAATEPLPGASRSGSAHNSQRANQDPLDAV
                     LESLTGDVVIMGGYRGSILRSAKPPHRRLWVPVKVQLGVRKVNLEVGLDPEDEENMEK
                     HIIADGMLKNVGPVDISKRLFKKLRECENARTGKLRVHDYGYDWRLSPHLLSRKLVGF
                     LEKLPSNQPGVPKERRGALVIAHSLGGVITRHAVNQRPELFSGVLYAGVPQRCINILG
                     PLRNGDAVLLNEKILTAQVNFSLRTTFVFLPEDGFGFVDKVTKEEYRIDFYNVQDWIK
                     YRLCPCVSGPPLPALSRSSTFGSLLSLSDSLPSLPLRSRSGTQGKKHHSAAASEAKDA
                     ALLKDRTLAPQMNSSSFSSSPSSSSSTATTTKPPGSSLDPPPSTSKNRVPNGDSNGKN
                     DDGSSATRARNIAYLTRTLAETKRFRAELAHNPAHQEANAYPPLAVLYAKDIPTTYAA
                     GVAGREAIARADAYDDLLFASGDGVVLAREAMLPPGYELVRGGRVCTDRGHITMLGDL
                     AAVGKGLAALVRGRSKGIGLGKRG"
     gene            2120676..2121260
                     /locus_tag="MYCTH_2304326"
                     /db_xref="GeneID:11507633"
     mRNA            2120676..2121260
                     /locus_tag="MYCTH_2304326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662959.1"
                     /db_xref="GeneID:11507633"
     CDS             2120840..2121205
                     /locus_tag="MYCTH_2304326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663007.1"
                     /db_xref="GeneID:11507633"
                     /db_xref="JGIDB:Spoth2_2304326"
                     /translation="MAAVPTKSTPTKSIPTESIPTESIPTESIPTESIPTESSVPTKS
                     SRKYTTLAQRVQALTLHARGAKTSEIEAITGMKERAFYTMLNRAKERGYIPGGPVKDE
                     HVANAPKSGRPKRVTKPVA"
     gene            2121930..2123286
                     /locus_tag="MYCTH_2143764"
                     /db_xref="GeneID:11507634"
     mRNA            join(2121930..2122668,2122745..2123286)
                     /locus_tag="MYCTH_2143764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662960.1"
                     /db_xref="GeneID:11507634"
     CDS             join(2122339..2122668,2122745..2123098)
                     /locus_tag="MYCTH_2143764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663008.1"
                     /db_xref="GeneID:11507634"
                     /db_xref="JGIDB:Spoth2_2143764"
                     /translation="MEKSSRSQGSASSIEADLQDQHLQSKLRTIRMTDAARAGTTLLA
                     LLTGLTILGVSANTLRVYQGTHVSRDFMLPLWPDEFDLRPTLSLVAGSAVVVLANLVA
                     LGFGQVGALRAPRAAAAAVATRTATAFLAPLAGLAGTLVAVAFFYAVNASDAADTFLS
                     WTCRWEAVPMWRAPRWAPLCRQARAALYLAVLLIPVELAALALAAFQLKVERYTERYL
                     GARKTPVLS"
     gene            <2124606..>2126053
                     /locus_tag="MYCTH_2018629"
                     /db_xref="GeneID:11507635"
     mRNA            join(<2124606..2124935,2125115..2125551,2125843..>2126053)
                     /locus_tag="MYCTH_2018629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662961.1"
                     /db_xref="GeneID:11507635"
     CDS             join(2124606..2124935,2125115..2125551,2125843..>2126053)
                     /locus_tag="MYCTH_2018629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663009.1"
                     /db_xref="GeneID:11507635"
                     /db_xref="InterPro:IPR001398"
                     /db_xref="JGIDB:Spoth2_2018629"
                     /translation="MSRAAPQVRASKSAPSSPMQRSSSRRKAAQAAGSRPASPLVGGD
                     QHMRHIDGAPPGDIVRRAREVRPSADLAGQKSKRNFFEDAFSVNPTSPARERVRGDAI
                     VLAEVKTNVRDEFAFITDLACQLSARYQRPVSSVVVTLHHGACLLFGGSFDPAYAMAV
                     RALPSQLQPTTNKRNAALLQRHMEEALGVPPSRGVLRFVPIPEEHLACGGKTVAGEIE
                     ELEMGGGYCHVGVGQSGSRGSGGSGGSFFGAAGWSLSSMAAHELTPPGSADGEPPSMP
                     GSYSRTAPKIEQIDSGKKAAQRRKSFVATIFGRSGSKSSDRSSLPAIADD"
     gene            2127782..2130007
                     /locus_tag="MYCTH_2079857"
                     /db_xref="GeneID:11507636"
     mRNA            join(2127782..2128572,2128631..2128732,2128798..2130007)
                     /locus_tag="MYCTH_2079857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662962.1"
                     /db_xref="GeneID:11507636"
     CDS             join(2128349..2128572,2128631..2128732,2128798..2129704)
                     /locus_tag="MYCTH_2079857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663010.1"
                     /db_xref="GeneID:11507636"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="JGIDB:Spoth2_2079857"
                     /translation="MSSSSIEDGAAPADTSSGLSRPYPIRYISPAALNLHRVYEQNRQ
                     RLQKKDGAKVPDPTAPQTKGKPRLLLMGQRRSGKSSISSVVFHKLPPSETLFLESTAR
                     IQKDSLNSFMEFQVWDFPGQIDIFDNPNFTFDMDAIFGEIGALIWVIDAQDDYLEAVA
                     RLNATIIHLHRSYPHINIEVFIHKVDGLSDDYRLDIQRDVTIRIQDELSDQGIENAPV
                     NFHLTSIYNHSIFEAFSKVIQKLIPRLGQLEAMLTNLCRTCHFEKAYLFDVNTKIYIA
                     TDNTPEDMASYEICSDYVDVIIDFTEVYGSWPRSEQWRARLEGEPWSQPLEDQVACEW
                     AESGMVLAEARRPIMLREVDRFLALVAIMKEGSYEKMPQINMNVDVVVRGLTEFFEIT
                     KSKEVSAGARGLSSPALG"
     gene            2131443..2132802
                     /locus_tag="MYCTH_2304336"
                     /db_xref="GeneID:11507637"
     mRNA            join(2131443..2132636,2132694..2132802)
                     /locus_tag="MYCTH_2304336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662963.1"
                     /db_xref="GeneID:11507637"
     CDS             2131612..2132349
                     /locus_tag="MYCTH_2304336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663011.1"
                     /db_xref="GeneID:11507637"
                     /db_xref="JGIDB:Spoth2_2304336"
                     /translation="MTSIATTTTAFPPRAQRGQRLYFAYGSNLWMEQMARRCPSSYLV
                     GRAVLPDYQWQINERGYANVVPRAGYAVHGLVYELDGDAGAGGTDEARLDRSEGVHTG
                     AYSKEWRDVVLYEAAPALRLPTRAFADAGGATPMLREMLGEMLGETGGGAAASSLFTE
                     QRPTRIERDVLVYLSSTYTMPSEPRNEYIDRMNRGIADAIAIGVPGDFFETVVRRFIP
                     DRPPPALSPPQPYYYRPGRSRAQQQRR"
     gene            complement(2134293..2136367)
                     /locus_tag="MYCTH_2304338"
                     /db_xref="GeneID:11507638"
     mRNA            complement(join(2134293..2134336,2135037..2136367))
                     /locus_tag="MYCTH_2304338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662964.1"
                     /db_xref="GeneID:11507638"
     CDS             complement(2135134..2136180)
                     /locus_tag="MYCTH_2304338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663012.1"
                     /db_xref="GeneID:11507638"
                     /db_xref="JGIDB:Spoth2_2304338"
                     /translation="MPPQLLPASAAAFAPRASSVNVVLGSKVEPWLTQTLKRINKIKR
                     PLNSVPQHQRCLTETLSSPNAIWTLASLQLPKAPQAELKKDPNPLIEAIFNYQDLHLE
                     AYIVHVDMVLRNEVAYKLTPETIDSLIEYHKDVYCVDAKANTYDWSEKEQQCKKLHEE
                     FVQAVNKFVYRTHASALEGLEEDGAGELLGGRSEEVKNIILGLLKPLLPPPPKVVDVV
                     RQPPLLPSSPAGTAIWSQSSTPATLSAPVESWKILPSSPSVPSTSADSGASIWPTMGV
                     SEVQLPSPPPAFSQPYSQPYSTAGLYYSSPVVSAPVPQLPLPSMLAPQCGISMGYNSF
                     GGWDTRYQEYATTM"
     gene            complement(<2142142..>2147103)
                     /locus_tag="MYCTH_48976"
                     /db_xref="GeneID:11507639"
     mRNA            complement(join(<2142142..2142885,2142949..2143640,
                     2143704..2144206,2144256..2144560,2144610..2144856,
                     2144906..2145136,2145207..2146170,2146221..2146520,
                     2146632..>2147103))
                     /locus_tag="MYCTH_48976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003662965.1"
                     /db_xref="GeneID:11507639"
     CDS             complement(join(2142142..2142885,2142949..2143640,
                     2143704..2144206,2144256..2144560,2144610..2144856,
                     2144906..2145136,2145207..2146170,2146221..2146520,
                     2146632..2147103))
                     /locus_tag="MYCTH_48976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663013.1"
                     /db_xref="GeneID:11507639"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Spoth2_48976"
                     /translation="MKLRRSRLAQAIFGKLLQEASQSRQYHGNGHACVKLCSFVQQCA
                     KSSDEALKRWAFTESLSKELFHFYLEWYEHDPHRALRLVLDVLVVSSASNPCPETGRV
                     VKGHILETLISIIARKSTQQLTKSGLQCLDHFMNKRVLKLADIAAEYKKVEPVVASLI
                     TTSLDGDAAEPVGFTLGVWRQWLQDALARNPEILEDIKNYVLAPMFKTERDASLRLLE
                     VFNRSQPLTTLGGDLIDQGLLLQLAALELGKKNGMVEEPSKSSDVSPSAANRVVLQET
                     LLDRLLAYPSVSVRSSAFSLLVSSQATTKPFSEAAFDLLKKHLAAFHMDYDAKVRNEV
                     LGHTKNLIKRAKNVITVAQRSLVAHKSAGDGKHPPPKKKFGPEVALKDASEAKEVLDR
                     HEEFLRWYMMFLRNELLPTTSYQRHITAIKAALLLLKVGKHAGDTDDTVDKDIAQGIS
                     SDSTWIRLLLDLLLDPFDDVRDGAAAILALLPSGTAGSGIASSESFLKILRVFCARAS
                     ALADRTGRADHGDGAARSQGLLCSWINKPDLQIALLSEILERLEAKISKAEDDLGHAA
                     IESPVHADFAAISYVWQVIAKQTFNDKQLELIHHLQRRVFFCAQQIWFVVKHVLCDDS
                     PEGHLPEEFEDIEGLDTKDLLSYSFRAVHESSNLLRLLVGTLRLKNTAGAPLPPIDVF
                     RETGYLAFEQLASLRHRGAFSTVSYTFSTCCQLTQQLREVYPEIDEAENLLREWYQGA
                     IGCIMTQASTTRRSAGIPSLIAAVLTANAASPSFDEVYGTLEKIGRKPVRVSQTDGSN
                     LPQVHALNSLREIFRSSLLSRKAEGYLARTLHLAATSLRSEVWAIRNCGLLLLRSLID
                     CLLGTGESKAAIESGWDGHSVRISYNKYPTLPGVILNLLRSADKTLDQASQSGAAEAV
                     FPALDIIRRAGPPEEHRLELRKHIEGYLGSSLWHVREIAARTLCSFLLQEDWAREIGR
                     LLEESGGATNRLHGTLLTAKFVIERKVDLGVDLNSDSASVQALLQHLSDNQEAFTHCP