GenomeNet

Database: RefSeq
Entry: NC_016475
LinkDB: NC_016475
Original site: NC_016475 
LOCUS       NC_016475            4710208 bp    DNA     linear   CON 27-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 4, complete
            sequence.
ACCESSION   NC_016475
VERSION     NC_016475.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 4710208)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4710208)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4710208)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4710208)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003005.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4710208
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="4"
     gene            <3336..>5022
                     /locus_tag="MYCTH_2064798"
                     /db_xref="GeneID:11506444"
     mRNA            join(<3336..4021,4147..4388,4471..4586,4660..4720,
                     4805..>5022)
                     /locus_tag="MYCTH_2064798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663611.1"
                     /db_xref="GeneID:11506444"
     CDS             join(<3336..4021,4147..4388,4471..4586,4660..4720,
                     4805..5022)
                     /locus_tag="MYCTH_2064798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663659.1"
                     /db_xref="GeneID:11506444"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2064798"
                     /translation="LDQSNINTAYVSGMEEELNIRGNEYSLFGTFYNIGYLIFEIPSM
                     MIISRPKLTRWYLPTMETAWAVLTFAQCRLSSVPQIFGLRFLLGVLETPAATGSMYLL
                     SSWYRTDELFKRAGVWYISSNAGSMFGAYLQAAAHTNLDGVGGMSGWRWLFIIDGVIS
                     LPIALAGYFLFPGLPTSPRIWWLTEREQKLAQARMRADRVRESTKIGKRMLKRVFGHW
                     HFYIAVLTYILFQCTTYVSGQMTLWLKDEDYSVEQINVYSTGVQGTAIAIGIIATNLV
                     MVYPIWVILSIISGTLLFCNVCLLVWNIPLGLHFTVYYLLGSTSAVTPILFPWVNVIM
                     KNDNEARAFTTGAMMTFGWIFFSFYPITVFPRLEAPRWRKGYTVNTVFTCCYWALLIV
                     GQLLWHRDRKKRKYVTQGSDEAEKLRLEDKEKNAASTQHVERTLGATN"
     gene            5367..7402
                     /locus_tag="MYCTH_2305722"
                     /db_xref="GeneID:11509900"
     mRNA            join(5367..5803,5890..6616,6708..7402)
                     /locus_tag="MYCTH_2305722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663612.1"
                     /db_xref="GeneID:11509900"
     CDS             join(5470..5803,5890..6616,6708..7161)
                     /locus_tag="MYCTH_2305722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663660.1"
                     /db_xref="GeneID:11509900"
                     /db_xref="InterPro:IPR006769"
                     /db_xref="JGIDB:Spoth2_2305722"
                     /translation="MNHVSGRLRSQLIRGSTCCSLAARFQRQFPITCRPLRPRVFARQ
                     LQRFAPRAAPSQTDPEAKAKKLDQKVLDEQEQEVRVRQNQVKRPWHREGADDPPTVGV
                     EKEAAPVREGRLLTTPTRLLKLILPLSTTVEKDRDNNSKHDYGRSISPNDTIRPLALL
                     VHPQQPLSYVERLIQAELPPVIEDGKEKIPSVYFRTEDTEHGDNKPTTRTEARRRDEE
                     SASRTAGPTHVESYSGLGHEGPKRQGSDKNWVRWSNSTELGDFIRDAARGREFAIEIE
                     GYNVEMRVSVPSFSDRTYYMRAQLRKLSRQIDEQSQIKRECDMLAYNRANLLAKGGFA
                     LLSGWWGVVYYVTFHTEFGWDLVEPVTYLAGLSTIMGGYLWFLYISKDLSYKAAMNVT
                     VSRRQNALYEARGFDHKRWEQLVQEANALRREIKVIAVEYDVDWDEAKEVGDDVKEVL
                     SEERSKAGHRVRSSEKERDEEFTEQERKKKRRRVHKRGQAEGRASVVAWSTVRP"
     gene            7789..9769
                     /locus_tag="MYCTH_2305724"
                     /db_xref="GeneID:11509901"
     mRNA            join(7789..9358,9425..9769)
                     /locus_tag="MYCTH_2305724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663613.1"
                     /db_xref="GeneID:11509901"
     CDS             join(7914..9358,9425..9542)
                     /locus_tag="MYCTH_2305724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663661.1"
                     /db_xref="GeneID:11509901"
                     /db_xref="JGIDB:Spoth2_2305724"
                     /translation="MGPDIIHLPDGQHFHVTPVFAGLFFKSAELNTPHNPFPIGWTIV
                     IHTEDDTGDVEDAPSTVPGSGGAAGGPASEKRTHLHSFKRPTLQNDSLLISSISNPST
                     SDFRPPASPTRQIALMLWVTLYWYFHQPPPPTTVQTDASKLTPDAGKPRGEWIVRIRR
                     DGMLRGRNLLPKLEHMGLIASLDSTVGTEVGDTGDNWSDMFVTQRMFWQIPGRLFLFT
                     LQPVGKSTRSCPGSHAPSDPGSPMSGEYSSVHPQRAIAEAGDLPGASPPTSLPGAPPV
                     PISPFFSASHLPTYYPPPPLHYVITEHVRHPLRPKPPQMGEVFYTRFIPSVGQYLSFR
                     VASLSPRPVPYMGPVGHRPPVHSHLVSMTDSALLESWHANPRVSNFWGKYSPDMLTNA
                     LKSRHSFPAIGLWDGVPFGYFEIYWVKEDLLGRYAGSVVDDWDRGCHVLVGEEWARGR
                     VQSWLTSLVHWMFCADYRTMNICLEPRVDNVRFIQHLQNAGFTKEKEITFPHKQAWFG
                     RLRRESWEGPAL"
     gene            complement(<9997..>11940)
                     /locus_tag="MYCTH_2127454"
                     /db_xref="GeneID:11509902"
     mRNA            complement(<9997..>11940)
                     /locus_tag="MYCTH_2127454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663614.1"
                     /db_xref="GeneID:11509902"
     CDS             complement(9997..11940)
                     /locus_tag="MYCTH_2127454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663662.1"
                     /db_xref="GeneID:11509902"
                     /db_xref="JGIDB:Spoth2_2127454"
                     /translation="MSSSEESDQLGYLAAPSETDESVSEELDQDSDGEPCDKDEAAKS
                     SQFFDLEAAGSDDETSGSEQSSIWDDNVGLDTWADDFFFPQFRSLPFELRHRIWQFFC
                     PDIAVKSRVYWFEAHTRYRRDGFEKMVVVEGPFLEQQTRPVRSLLAIHRETRELALKA
                     LPDTISFGRRGVIRFNSANDVVFLGSLEVAMLDFEVMPRLRGFSEHIRHLAVDPAVLS
                     DLGSRPSVLFEAFKNLRAVYYLVSPGEHDPRNLRWCTSDKVKRYYVTTFEEEPGLGED
                     GQHLYCWPDIENHVNFAEAEVPLDGLANDLLMRDDPLHIKGVEFNGTPIWPMVQFLWD
                     SDRRRFDDLQAWDGEGTLEWESSEGPDDDDDDDDDELDDYESEGIDDFDISEDDQTSD
                     GEESDVLHDDYSDQDRDVVGQGAIDLAGGESEDMARFSSPEQSSDTLRESEDSAQESD
                     LAGPRARRLKRSRARVVDSDSEEDSEAPIPQKRVRMHGARHSSVVLSSSDEEDARPRK
                     RQNRRTRAVAPSDEEDKEDDDEDDEADSDVGQGQNSRNDRSGTSSSEDDDEEPDNEAT
                     LSRPRSLAEKLQLHRKLKPIAPSSSDDDSSSKEMSEDNHDRRVYYADFQDDEEGEEAS
                     GDGGPHDEYDLEEEDEDQEDDEY"
     gene            12924..14727
                     /locus_tag="MYCTH_2305728"
                     /db_xref="GeneID:11509903"
     mRNA            join(12924..13167,13226..13383,13458..14120,14190..14324,
                     14410..14608,14699..14727)
                     /locus_tag="MYCTH_2305728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663615.1"
                     /db_xref="GeneID:11509903"
     CDS             join(13299..13383,13458..14120,14190..14324,14410..14543)
                     /locus_tag="MYCTH_2305728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663663.1"
                     /db_xref="GeneID:11509903"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2305728"
                     /translation="MTSHPEFGERTPGSEVAKVFADQIRGKTILVTGVSPKSIGASTV
                     LNLASQSPGLLILASRTKSRIQEVADQITTKYPGVRVETVLVDLGSQESIRRAAADVA
                     ALTDKLDILINNAGRVVTSRQATQEGIEQQFGTNHIGPFLLTNLLLPLLRKAAETNPP
                     GATRIVNLSSAGHRLSPVRFSDYNLEGKPVPPEEDHVKPLPGAFANCTPDGYKPIVAY
                     AQSKSANILFTISLQRHLANHGIASYAVHPGSIVTELSREQDDELNAEFHKLIKYWKT
                     PDEGSSTTLVAALDPALNEVKGFYLSDCQYTEPSAHAKDAAAADRLWKLSEELVGEKF
                     SIGG"
     gene            complement(<15143..>17142)
                     /locus_tag="MYCTH_2127456"
                     /db_xref="GeneID:11509904"
     mRNA            complement(join(<15143..15342,15427..16039,16119..16683,
                     16752..16995,17094..>17142))
                     /locus_tag="MYCTH_2127456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663616.1"
                     /db_xref="GeneID:11509904"
     CDS             complement(join(15143..15342,15427..16039,16119..16683,
                     16752..16995,17094..17142))
                     /locus_tag="MYCTH_2127456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663664.1"
                     /db_xref="GeneID:11509904"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2127456"
                     /translation="MSGNGRIYRISALAVLGGALFGFDMSSMSAIISTQPYLCQFNQR
                     GFDKEGRCLGPTSDTQGGVTAAMPGGSLIGALVSGWLSDRCGRKKTIMIGSVFWIAGS
                     VVTCASVNLPMLAVGRFINGFAVGICSAQVPVYITEIAPPTLRGRLVAMQQWAITWGI
                     LIMYFICFGCSYVDGAGAFRIPWGLQMLPAICLCVGLSFEPESPRWLFKKGREMEAKD
                     VLAQLHGGGNANSQFVQRELQDIKATVSQEHKHADASWLELFTPSMMNRTLIGVFTQI
                     WSQLTGMNVMMYYITYVFTMAGLSNAGTNEVLIPSSVSFIINVVMTVPALVWMDRWGR
                     RPPLLIGAALMCLWLTITAIMFGVYARDAEPGEFASASESMVVSGPAARVIIAATCLF
                     VASFAPTWGPVSWTYPPELFPLRLRGKAVALATSANWTFNFALAYFVPPAFENITWKT
                     YVIFAVFCAVMFLHVFFFFPETANKTLEEIEQIFDDKRPGAIKYIGTPAWKTYNDRKA
                     MITHELRDSISDSEDGDKAQTNSTEPGARDGIMTATSNEPMPASGNDA"
     gene            <18741..21110
                     /locus_tag="MYCTH_2093327"
                     /db_xref="GeneID:11509905"
     mRNA            join(<18741..18858,18936..19123,19185..19300,19352..19964,
                     20018..20075,20104..20279,20350..21110)
                     /locus_tag="MYCTH_2093327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663617.1"
                     /db_xref="GeneID:11509905"
     CDS             join(18741..18858,18936..19123,19185..19300,19352..19964,
                     20018..20075,20104..20279,20350..20517)
                     /locus_tag="MYCTH_2093327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663665.1"
                     /db_xref="GeneID:11509905"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="JGIDB:Spoth2_2093327"
                     /translation="MVPPNDTRSPPSGTKRPAPDNDRTISPPPLKRKAQVAISKSAVT
                     NFFTPTSQKAKDRTAWFERRPDDDSPATLLVAKHVPESAAPNGLNTAVKRPKIAAFDL
                     DSTLITTASGKRHSDDPADWKWWHHSVPGRLRQLYNDEGYRVVVFTNQGGLALHPDPK
                     AKAPKSAKNRVPAFKQKCNAVLDQLNIPITLYAATGKDIYRKPRPGMFSEMKDDYDLT
                     DSDIDRENSVFVGDAGGRIADAKGASAAAKDFSCSDRNFAHNIGFKYQTPEEFFLGEE
                     PRDFARDFDLSNFPFSEEGQDGEEHVEKTNDKDIVLFVGPPGAGKSTFYWKYLKPLGY
                     ERVNQDILKRHDKCFKAAAEFLQEGDSVVVVLHSSADLLRADNTNPDVDTRSQWIALA
                     RKHGVPIRCFWFRTPLQLCEHNATVRSMNKKLNPESRQALPRIAFNGFTSRFKEPKIE
                     EGFQDIVPVDFKFRGTKEEYDIWGQYWI"
     gene            22886..25177
                     /locus_tag="MYCTH_2305732"
                     /db_xref="GeneID:11509906"
     mRNA            join(22886..23328,23433..24786,24870..25177)
                     /locus_tag="MYCTH_2305732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663618.1"
                     /db_xref="GeneID:11509906"
     CDS             join(23036..23328,23433..24786,24870..25043)
                     /locus_tag="MYCTH_2305732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663666.1"
                     /db_xref="GeneID:11509906"
                     /db_xref="InterPro:IPR002668"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="InterPro:IPR011657"
                     /db_xref="JGIDB:Spoth2_2305732"
                     /translation="MTSSDGQRPPALGHDAIEPSDPAPPQYALSKQNSSGTDEKKGSV
                     PVEQYGVDAEKQSESVGSLDARPNPERQTRPIVALWQRHWKKVAQLVTFMVFTAWWIY
                     GLVFHRHTKGKGWLIPSLIYIAILVRLITLHIPSKLFLRPVRFVWLNTVVRVYDLIPD
                     KLHQPLAGLGTFAVFLVGSFVPEETGDNTRANRAISIFGFLVMLAVLTVTSRNWRIIP
                     WHTVIGGMLTQFIMAVFVLRTKAGYDIFKFISDMARQLLGFAADGLSFLTDDDFAHRS
                     WFLTGVVPAIIFFIALVQMLYYLGFLQWFIAKFAVFFFWSLKVSGAEAVVAAATPFIG
                     QGESAMLIRPFMDHLTMAEIHQIMTCGFATIAGSVLVAYIGMGLNAQALVSSCIMSIP
                     ATLAVSKMRYPETETPLTAGKVEVPKNEDEEHTVNALHAFTNGSWFGLKIGATIVACL
                     LTIIAFVGLINGLLGWWGGYWGLGTGDKPTLSLELILGYILYPVAWLLGVPKNNLRQV
                     GELIGKKIIINEYAAFNALVSDKRYMEMAPRSKLIATYACCGFGNIGSLGIQIGILSQ
                     ISPKRAGDVVRVSISAFLCGVLSTLTSASIAGMLFNDTML"
     gene            complement(<25889..>27048)
                     /locus_tag="MYCTH_103032"
                     /db_xref="GeneID:11509907"
     mRNA            complement(join(<25889..25993,26104..26694,26779..>27048))
                     /locus_tag="MYCTH_103032"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003663619.1"
                     /db_xref="GeneID:11509907"
     CDS             complement(join(25889..25993,26104..26694,26779..27048))
                     /locus_tag="MYCTH_103032"
                     /note="CAZy_ID 267899"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003663667.1"
                     /db_xref="GeneID:11509907"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_103032"
                     /translation="MKRSGLLGTVALLFPALVSAYALPGECTGVCNNSHDPSIIRRAD
                     GTYFRFSTGGKIAIHTAPSLTGPWTYRGAALPAGSSINLDGNQDLWAPDVAQVGDQYY
                     LYYSVSTFGVQNSAIGIARSSSLDAGTWTDLGSTGVTSSTGSAYNAIDGNLINEPGTS
                     NYFLTFGSFWNGIHRVRMTPTKTNGNVYQVAFDPNDPAMEGPTVFKYGDYYYLFFSKG
                     TCCGYDQNRPPAGQEYRIMVCRSTSPTGPFEDRDGKSCRSGGGTLVLPSHDWVYGPGG
                     QGVYQDPEHGPVLYYHYVDTRIGYADGQKKFGWNRIDFSSGWPVV"
     gene            27829..29545
                     /locus_tag="MYCTH_2305738"
                     /db_xref="GeneID:11509908"
     mRNA            join(27829..28247,28340..28407,28493..28916,29046..29545)
                     /locus_tag="MYCTH_2305738"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003663620.1"
                     /db_xref="GeneID:11509908"
     CDS             join(27964..28247,28340..28407,28493..28916,29046..29232)
                     /locus_tag="MYCTH_2305738"
                     /note="CAZy_ID 268038"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003663668.1"
                     /db_xref="GeneID:11509908"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_2305738"
                     /translation="MKGVSIAGAFSGLLSLASAASFSNPLKPFNGSDPHMTYYDGYYY
                     LMTTTWTDLQITRAKTLEGLKNGETRVVWTDSDPSRCCNVWAPELHKIDNKWYIYYTA
                     GNNQNLDGQRSHVLEGGSDPWGQYSYAGQLTQDWGIDGTILRVQNQNYFVWSCFSDGI
                     QSLCIAPLQSPTSIGSPRVLSQPLLDWERVDTPVNEGPAPLYHDGKIFLAYSASFCWT
                     PSYQLGLLTYNGGDPTAASSWTKTGPFFSSANGNYGPGHNSFVNSPDGTEIWNIYHAT
                     SISTGNCDGNRYTAAKKVTWNLDGSPNFGSPDPLGVVTPGPSGE"
     gene            29843..30849
                     /locus_tag="MYCTH_2305739"
                     /db_xref="GeneID:11509909"
     mRNA            join(29843..30167,30254..30849)
                     /locus_tag="MYCTH_2305739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663621.1"
                     /db_xref="GeneID:11509909"
     CDS             join(29946..30167,30254..30562)
                     /locus_tag="MYCTH_2305739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663669.1"
                     /db_xref="GeneID:11509909"
                     /db_xref="JGIDB:Spoth2_2305739"
                     /translation="MPQISEAVKRDHGLIQRAYRRLRNADPESRNPSEFMWVLNRYLM
                     VEDLVVSPILDNHVARGGERHRRLSDDYDSMNAKLRHMRRFDPSDPSFESALRAVWVD
                     LEPHIREEASGDLDSLEENLSRSESEALGKKYDDIKDLLQRPYGKNGVPDERTLSAIL
                     EMPRQELMVKIGINVA"
     gene            30897..31858
                     /locus_tag="MYCTH_2305741"
                     /db_xref="GeneID:11509910"
     mRNA            30897..31858
                     /locus_tag="MYCTH_2305741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663622.1"
                     /db_xref="GeneID:11509910"
     CDS             31073..31606
                     /locus_tag="MYCTH_2305741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663670.1"
                     /db_xref="GeneID:11509910"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="JGIDB:Spoth2_2305741"
                     /translation="MASGQDQDRPSFASGTNPDYDLTTPIDPHGVGLRQKLTSYGDAH
                     FSLFMRKLFIKAMGYSEDALCRPIVGVINTYSSFNPCHANIPQLIDAVKRGVQLNGGL
                     AIDFPTISLHESFAAPTSMYLRNLMSMDTEEMIQAQPVDSVVLIGGEARPRFLIETRA
                     VSTQFNLNGLLIILTGV"
     gene            31860..33305
                     /locus_tag="MYCTH_2305742"
                     /db_xref="GeneID:11509911"
     mRNA            31860..33305
                     /locus_tag="MYCTH_2305742"
                     /product="dihydroxy-acid dehydratase"
                     /transcript_id="XM_003663623.1"
                     /db_xref="GeneID:11509911"
     CDS             31944..33170
                     /locus_tag="MYCTH_2305742"
                     /codon_start=1
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="XP_003663671.1"
                     /db_xref="GeneID:11509911"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="JGIDB:Spoth2_2305742"
                     /translation="MACLLVALGMMPIQGATAPAVSSARLRIAESTGAHAVQLAKTGL
                     RPQTILTRESFLNAITVLQAVGGSTNAVVHLTAIVNRHPALAGTITPATIDAVGRQTP
                     LLVDLKPSGDNYMTDFHNAGGMPALLHQLKPLLHLGALTVTGRTLGEELERVAFRPLL
                     PPDSPANCIRPLGDPLYPSSALVVFQRGNLAPGGAAVIKASASKDRRLLRHRGRAVVF
                     DGPADLAARIDDPDLDVDRDSVLVLRGVGPVGRRHPGMPEAGLIPIPRKLAAQGVQDM
                     LRISDGRMSGTAGGTIVLHVSPEGADPGSVLGVVRDGDVVFCDVEERTLSLEVDDDEI
                     RARIEQRRRDMAAAAKAGKEEEEEEEEEEQPWAAREHVRGYRGLYMREVNQAEHGADF
                     GFLTARGPHQNEQAQG"
     gene            49214..51298
                     /locus_tag="MYCTH_2305743"
                     /db_xref="GeneID:11509912"
     mRNA            join(49214..49772,49866..51298)
                     /locus_tag="MYCTH_2305743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663624.1"
                     /db_xref="GeneID:11509912"
     CDS             join(49379..49772,49866..51136)
                     /locus_tag="MYCTH_2305743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663672.1"
                     /db_xref="GeneID:11509912"
                     /db_xref="JGIDB:Spoth2_2305743"
                     /translation="MSSGLKPLLLPRLVEEKRKLEEQDDGEREPASLYYYTHDSPSSD
                     LTPPSPATSTFSRGHHYRLSGSNSSLELISPPCTDTPASPTQSLHATRPSRSQLPDVE
                     EEPLEREEDEPATPPKHSDRDFGFLNYCLCDSPCSHNGEATQSTPYPYMVADLDYDLG
                     FLSDGDFNASPRQKKRRHGSESGFSSWSARLGSRLPSLPRWRSSSISRRHDLTFAPGS
                     DPSLADSRPSFSLAASSRSSSISRRARATDRAQESVPGTPALSFYESAESVDLASPRE
                     NLPATLGREVERDRVNATTPLLPPLVIEKAPSHHTRPPSLQTSPLQSPSMMSAPVPDL
                     SSAAKSFTTPPLSSKTSVSSLHRGTISGAFSDSPSPIPCLFDHRDSWSDRLGHANFII
                     EPRPYVPDTADLATHQAFRADWDLARKNYAKHLARIGEHYGSTSKTYALTAAKWAEIE
                     QEWQRDEDDLLERLGRQCKDNPSVVSQLRRTAEERVPTSIPLMLSDDGKFPELGDVEI
                     IGPMMRETTMARDGASDEKRSGASGWLKNLAEKVRLRNDRPKSKTQ"
     gene            <53829..>54441
                     /locus_tag="MYCTH_2065222"
                     /db_xref="GeneID:11509913"
     mRNA            join(<53829..54104,54205..>54441)
                     /locus_tag="MYCTH_2065222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663625.1"
                     /db_xref="GeneID:11509913"
     CDS             join(53829..54104,54205..54441)
                     /locus_tag="MYCTH_2065222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663673.1"
                     /db_xref="GeneID:11509913"
                     /db_xref="JGIDB:Spoth2_2065222"
                     /translation="MGAASRVALVILRIWQLICAVIVLGILARFVHFVVDAGMTRDGR
                     IIYGLVVASLSILFAILCIAPFMYSFLAFPADFAFFVMWLILFCLLITRTGTHTCSSP
                     WFTNYWGFYWGGWWLRRPFLGRPGAFIRSGCSSWRTVLAFSFMVMVSFLVTTFLVRPP
                     LHSRVIGPLV"
     gene            complement(55481..56730)
                     /locus_tag="MYCTH_83051"
                     /db_xref="GeneID:11509914"
     mRNA            complement(join(55481..56312,56391..56730))
                     /locus_tag="MYCTH_83051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663626.1"
                     /db_xref="GeneID:11509914"
     CDS             complement(join(55999..56312,56391..56478))
                     /locus_tag="MYCTH_83051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663674.1"
                     /db_xref="GeneID:11509914"
                     /db_xref="JGIDB:Spoth2_83051"
                     /translation="MFATRILRQAAAHAERTPSIKFIGKRTIPASIDHTPKPHPASPT
                     QSLPASFTSGSSHSSFSVYRDHAQQFGPLRKTIKADVGIGGARGSQLGPVNPPEGVFF
                     DRNELPARFRRQPLSAAEIEAIETGGATLFA"
     gene            57760..58820
                     /locus_tag="MYCTH_2305746"
                     /db_xref="GeneID:11509915"
     mRNA            57760..58820
                     /locus_tag="MYCTH_2305746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663627.1"
                     /db_xref="GeneID:11509915"
     CDS             57879..58688
                     /locus_tag="MYCTH_2305746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663675.1"
                     /db_xref="GeneID:11509915"
                     /db_xref="JGIDB:Spoth2_2305746"
                     /translation="MPPPNFLHENREPGCWAVLADRKFFSLPKLFVKRTLRRHEWSDL
                     GDNYILTPSAALPQRFRTDVAVQQYLRERTNIPLPAFASTFEDDGAMYLVMEFVQGVR
                     MDELSEDDQKVVEKELLLHVETLKSLRSDTPGVPGEPLMIAPQRVCDFHWKYHSAWRP
                     RSGIKGDFVFCHNDLGQYNVLVDPKTLKITAIIDWEFGGFWPEWFERPFWSRRGNSYA
                     LEGEEDDTQRCREWLMANCEEVELPHLPTLHDKLNSMPGAPKNSGDKPSGG"
     gene            60430..61496
                     /locus_tag="MYCTH_2305747"
                     /db_xref="GeneID:11509872"
     mRNA            60430..61496
                     /locus_tag="MYCTH_2305747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663628.1"
                     /db_xref="GeneID:11509872"
     CDS             60565..61449
                     /locus_tag="MYCTH_2305747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663676.1"
                     /db_xref="GeneID:11509872"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="JGIDB:Spoth2_2305747"
                     /translation="MKGFFGSNPAREGDGEAAKCPVDHKTRELWLQQAQQARAANSPA
                     VSASPNPQSTERVAAPPAPQAASSWSSWFRLPSFGQQQKSQDAPATQTSTPPPPPPRR
                     RDELQLDETREISSIPRSSNPGPAACPANHEQETGASTTGNWVYPSEKQFFEAMKRKG
                     HQAAAEDMKTVVPIHNAVNERAWAEILKWEAPYVQPAVKGGCGGPRLHSFAGLGSATM
                     SPRARINTLLGYTAPFDRHDWVVDRCGTKVEYVIDFYAGRNDGAGKGKLNFYLDVRPK
                     LNTWEGIKMRALRAVGLS"
     gene            complement(<61927..>63557)
                     /locus_tag="MYCTH_103025"
                     /db_xref="GeneID:11509873"
     mRNA            complement(join(<61927..61991,62112..63306,63471..>63557))
                     /locus_tag="MYCTH_103025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663629.1"
                     /db_xref="GeneID:11509873"
     CDS             complement(join(61927..61991,62112..63306,63471..63557))
                     /locus_tag="MYCTH_103025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663677.1"
                     /db_xref="GeneID:11509873"
                     /db_xref="InterPro:IPR006968"
                     /db_xref="JGIDB:Spoth2_103025"
                     /translation="MSRSFYDIDSAGEVLCTYTDSGEKEKLKSEKTEVPLLKAILYAF
                     LPAGYPHTVTGDYLAYQTFDSLQAFASSITSLLANRAVLEGLGVGDSSSSPTGALILK
                     ITGDTISRIATILFAHRMGQAIEPECKFYRFLADIFNDSAQFLDLLTPALPYLPKLGV
                     IVSAGVLRSLCGVAANASKASLSAHFALTGNLAELNAKEASQETVVSLLGMLVGSLVV
                     RMVEDKQVVWMLMVILAGVHLTMNYRAVRSVKMRSLNRQRATIVFREWLDHGVVLTPE
                     QVAQRESILGNGRGNMSSKTNDYTGFCDFGTYGDLMSWNPRGYHRYDFETSTYFMGIW
                     HRGGHFYIRIALKEGTKHPLSAWFDAVNHAYHFDSALKDGLHSHYENEMPLGYVSDEQ
                     KQTIFAAMTAAGWDLEVNALETRLPVRVRVGDGRKGPHLSEKDPIRHNGLLEAKHD"
     gene            complement(64133..65640)
                     /locus_tag="MYCTH_83048"
                     /db_xref="GeneID:11509874"
     mRNA            complement(join(64133..65367,65527..65640))
                     /locus_tag="MYCTH_83048"
                     /product="diphosphomevalonate decarboxylase"
                     /transcript_id="XM_003663630.1"
                     /db_xref="GeneID:11509874"
     CDS             complement(join(64245..65367,65527..65588))
                     /locus_tag="MYCTH_83048"
                     /EC_number="4.1.1.33"
                     /codon_start=1
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="XP_003663678.1"
                     /db_xref="GeneID:11509874"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="JGIDB:Spoth2_83048"
                     /translation="MAERRVYRATTTAPVNIAVVKYWGKRDPKLNLPTNSSLSVTLSQ
                     ADLRTLTTASCSASYPAEEGDSLVLNGEPSDVSGARTQACFRELRARRAALEAADPSL
                     PKLSTMPLRLVSENNFPTAAGLASSAAGFAALVRAIADLYELPASPSELSLIARQGSG
                     SACRSLFGGYVAWRMGEAADGSDSTAEQVADASHWPDMRALILVVSAAKKGVSSTSGM
                     QQTVATSGLFRERIARVVPQNMAAMEKAIRERDFASFAEVTMRDSNSFHATCADTYPP
                     IFYMNDVSRAAIRAVEQINAAAGRTVAAYTFDAGPNAVIYYLEKDTEAVVGTLYHVLG
                     GDISGWKDAVVKGLKPSLSLDEGVAGILKSGVSRVIMTGVGEGPIKTDEHLIAEDGSR
                     IR"
     gene            66526..66615
                     /locus_tag="MYCTH_t99"
                     /db_xref="GeneID:11509875"
     tRNA            66526..66615
                     /locus_tag="MYCTH_t99"
                     /product="tRNA-Ala"
                     /note="Anticodon: AGC"
                     /anticodon=(pos:66559..66561,aa:Ala,seq:agc)
                     /db_xref="GeneID:11509875"
     gene            69336..74015
                     /locus_tag="MYCTH_2305754"
                     /db_xref="GeneID:11506412"
     mRNA            join(69336..69775,69881..70007,70130..70224,70344..72471,
                     72584..74015)
                     /locus_tag="MYCTH_2305754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663631.1"
                     /db_xref="GeneID:11506412"
     CDS             join(69489..69775,69881..70007,70130..70224,70344..72471,
                     72584..73477)
                     /locus_tag="MYCTH_2305754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663679.1"
                     /db_xref="GeneID:11506412"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2305754"
                     /translation="MGTENELDVEGQTEPPICGLKSSVTCTASPTLVGTVRSDGDATD
                     ADVNADVDADADATVGRGSITSTVDTARVLIPECAHTLTVPDVCALLETNIDNGIDGS
                     EAARRLQHHGPNKVEGAKGLSVWTILLRQVSNSLTLVLVITMVLSFAIADHIEGGVIA
                     AVILLNVVVGFIQDFRAEQTIQALYALSAPTCKVIRGGQADTIKAEALVPGDLVRLGV
                     GDIVPADLRLVHSINLSTDEALLTGESVPVSKHAEMVLKDRDVPLGDRINMVYSGSTV
                     SRGRATGVVVATGMATEVGKIAALLKRNPQSDGRQRLSVAGRAWARFRSGLRVLLGLD
                     GTPMQVALSKFALLLFALAIALAIIVFSVSRWRVTSEVLIYGICVAVAVIPESLIAVL
                     TIATALGTRAMAKGNVVIRKLAALEAVGGVTNICSDKTGTLTQGRMVAKRVWLEDGTE
                     VSVRDTTHPFDPASGNVRVGEDEYSPVLSPAAEKKAARLRALLETVALCNNSSVTTTQ
                     AAAPAAPGAPAAPSGGAGAGAYAAVGEPTEIALQVLAMRFGMGKPELVRLDGGGGGRQ
                     LLAEFPFDSSCKRMTVVYADEAGDGGASAYTKGALEALLPLMDLSDEQKTAVVAKAES
                     LAAEGLRVLCVAKRSVDPGLFSSTTTTTAPSPLTGVDDAEKVVVQEGGTRALPAGHDT
                     TEHLRSAVEKDLRFLGLVGLYDPPRVESAAAVQRCQRAGITVHMLTGDHVKTATAIAY
                     EIGILSRAANHHGGSNDYDKNNNNNNRDTTIMVASAFDGLSDAQIDQMERLPLVLARC
                     SPATKVRMVEAMHRRGAFCVMTGDGVNDSPALKKSDVGIAMGLNGSDVAKEAADMVLT
                     DDNFASIVTAIEEGRRLFDNIQKFLLHLLVSNIAQVFLLLIGLAFKDEDGVSVFPLSP
                     LEILWANLVTSSFLALGLGIEEAQPDIMQRPPHDLSVGVFTRELITDKFVYGTAMGGL
                     CLAAFSSVAYGGGPPGSRGEGGASRALGRDCNESYSDVCRVAFRARATTFATLTFLLL
                     VTAWEAKHFTRSLFAMYPEEEEEKYNNNNNNDNDNDNNNGRHGRRRRRRSGTGPASVL
                     RTVWRNKFLFGAVTAGFVIAFPVIYLPAVNRIVFKHDAITWEWGVVAACVVVYTAIVE
                     SWKAVKRRFRLGTTAAASAASPASRTVGEV"
     gene            <125370..>126279
                     /locus_tag="MYCTH_103022"
                     /db_xref="GeneID:11509876"
     mRNA            join(<125370..125447,125508..125624,125656..125985,
                     126064..>126279)
                     /locus_tag="MYCTH_103022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663632.1"
                     /db_xref="GeneID:11509876"
     CDS             join(125370..125447,125508..125624,125656..125985,
                     126064..126279)
                     /locus_tag="MYCTH_103022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663680.1"
                     /db_xref="GeneID:11509876"
                     /db_xref="JGIDB:Spoth2_103022"
                     /translation="MAPVYADHPFALIPTPGFLARSRNEEPDMFDRVASEMALVHNVI
                     IRGLNSIYLQAPYIRPEDEKAFLDVHHGNKEEFFFPFAEEMTGVKGIMDANIEQHKAF
                     HDGVEELEAYVGAVLADEDKYDGSKVVGTIDRFGTVLMQHLTDEVASILSLRPYGDKL
                     AGLPKLLDEEGGKSMKKMGNFVGVLAFANMDLQYENAMWQDWPSAPAPAKLIMRYVFW
                     WIYADARKFGAVDRAGNLRHLYAVPESA"
     gene            <126844..>127549
                     /locus_tag="MYCTH_2110752"
                     /db_xref="GeneID:11509877"
     mRNA            join(<126844..126963,127140..127291,127366..>127549)
                     /locus_tag="MYCTH_2110752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663633.1"
                     /db_xref="GeneID:11509877"
     CDS             join(126844..126963,127140..127291,127366..127549)
                     /locus_tag="MYCTH_2110752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663681.1"
                     /db_xref="GeneID:11509877"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Spoth2_2110752"
                     /translation="MEPLDGTGAAPGASLDRDPEKTKTRTRVHERIGDQIPHEMYYGE
                     FYDRDLRIDAVMVRYSSPYPGVRAVAEIMDDSSTPTETARAYFLAISSYKTPGFLLLL
                     FFMYWLPRRRLAWWEKYNYVLSAALAADVAVGAVVIFFAVQDNPVELDW"
     gene            128250..129819
                     /locus_tag="MYCTH_2305757"
                     /db_xref="GeneID:11509878"
     mRNA            128250..129819
                     /locus_tag="MYCTH_2305757"
                     /product="glycoside hydrolase family 93 protein"
                     /transcript_id="XM_003663634.1"
                     /db_xref="GeneID:11509878"
     CDS             128577..129653
                     /locus_tag="MYCTH_2305757"
                     /note="CAZy_ID 268039"
                     /codon_start=1
                     /product="glycoside hydrolase family 93 protein"
                     /protein_id="XP_003663682.1"
                     /db_xref="GeneID:11509878"
                     /db_xref="InterPro:IPR002860"
                     /db_xref="JGIDB:Spoth2_2305757"
                     /translation="MNSSIRRLHVAQEEHFVHEVPGTYPRLCRLSDGSILAGFTRFLP
                     RGQRALTVVRSTDGARTFQPHGEVTRSFGDCDNLFLLEVPPRPSAGGEPRPSAPTVLA
                     AFRNHDLDQNGVHTYFRITVCQSTDGGRTWSYLSQAFEKPAPFGLWEPFLRMSADGKE
                     VQLFFSQELAANDQDTMLVRSSDNGATWSARQRVTGAGEALRDGMVGLAEARYCGGHS
                     ALVLVMETTRRGTFSIEAMVSFDDANTFGFRHVVYQAKEGRNAGAPQITAFADGSVAV
                     VFMTDEDGEGPSRWPRGATIKAVFGTFNPDGTLQWSAPQVVRNAVSCWPGIMRIADDA
                     AVAVYESSSSIRGRVLKVATLSAS"
     gene            130331..131579
                     /locus_tag="MYCTH_2305759"
                     /db_xref="GeneID:11509879"
     mRNA            join(130331..131049,131234..131579)
                     /locus_tag="MYCTH_2305759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663635.1"
                     /db_xref="GeneID:11509879"
     CDS             join(130540..131049,131234..131269)
                     /locus_tag="MYCTH_2305759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663683.1"
                     /db_xref="GeneID:11509879"
                     /db_xref="JGIDB:Spoth2_2305759"
                     /translation="MKPILIAALFGTALSSPVIAADDPISTPTPTELQPGAYWIRAVA
                     APNFHKYFQTIPANVPGVAILESHTTAGQFNIEDGQLVNKVSNPPLYMWVEEPADKAD
                     PPRTLATGFNTTKNTFGTFAWQGDALTWSDPSINRQNLAAWLVCAKQELFINTGAYGW
                     QTPEGCADQTIHYYNGQTANE"
     gene            132493..>134210
                     /locus_tag="MYCTH_83041"
                     /db_xref="GeneID:11509880"
     mRNA            join(132493..132838,132901..>134210)
                     /locus_tag="MYCTH_83041"
                     /product="glycoside hydrolase family 76 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003663636.1"
                     /db_xref="GeneID:11509880"
     CDS             join(132724..132838,132901..134210)
                     /locus_tag="MYCTH_83041"
                     /note="CAZy_ID 267930"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003663684.1"
                     /db_xref="GeneID:11509880"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="JGIDB:Spoth2_83041"
                     /translation="MALSPPSNSPARWLLSALLATSSLLPVAQGQGYKVGTPDEIRES
                     ARTLAYDLMLFYKGNQSGEIPGILPGPPTEHKGDYYWWEGGAMMGTYVDYWFLTGDPS
                     YNHVVTEGMLHQVGPNADYMPPNHTASLGNDDQGFWGMSAMLAAENKFPNPPEDKPQW
                     LALAQAVFHTQAAPDRHDGTCNGGLRWQVPPTNAGYNYKNTIANACFFNLGARLARYT
                     ENQTYADWASKTFQWLWDVGYIDHESWKVYDGGHVEHNCTDINKAQFSYNAALLLHGS
                     AFMYNYTNGSEIWRERVDKLLEGILRDFFPDGVAFELPCEGRKGACTADMLSFKGYVH
                     RWMAVVTKLVPDTAGTILPVLRTSAEAAARQCTGGDTGRRCGFYWSEGVFVDPAVDKT
                     SGAGEAMSVLAAVSSLLIDEAPPPATNATGISRGDPNAGSRSRGPSEPLAPITTADRA
                     GAGILTMLILGGFIGTWSWMSIGD"
     gene            <135297..138899
                     /locus_tag="MYCTH_83040"
                     /db_xref="GeneID:11509881"
     mRNA            join(<135297..135490,135731..135900,135997..136291,
                     136931..138899)
                     /locus_tag="MYCTH_83040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663637.1"
                     /db_xref="GeneID:11509881"
     CDS             join(135297..135490,135731..135900,135997..136291,
                     136931..138707)
                     /locus_tag="MYCTH_83040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663685.1"
                     /db_xref="GeneID:11509881"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="JGIDB:Spoth2_83040"
                     /translation="MFKFPNLREGLVYISLLVPAYAMAQSFVGGDLSHQAPYGLPVQD
                     FAAAFSRSSSDATFPIRGYNTAKSDGSCSAVLPDDCIRQLQADSVASKAGRTGSCRNL
                     AIPDSCVGHFNGKNGGTAFEITPIGRSGRADRQSMFFAAGFDPVQKGNKSALEAAARH
                     IWPVVLAWTHFGKTGDVQDSAGWLSCAKTTESKEVTGGGQRMGAENVLSIPGWLFLIW
                     AITISLGKYGSFPSNLIIGRPYHLTFEVLDKAPGENFSRLRVVPTDELYAEVFAEESA
                     PECSTPAAGTNETVISATDGEEFRLVDDDGNVVARSNHEVIDENARQTLTQDEIEELK
                     REGTNAGKDVIAKLLLSHTAIDQKTSFSLAKYKLLKTKKYIRRFQVLPIDVPTFAQWQ
                     LEERDASKIMDLRAEMLGLVGCWGNVHYGGDDVMLPDPKAPTDAGDEARVPVDEKLLR
                     GRWLVVDDTSGLLVAAMAERMGVLYEREETSEETTENGAATEQRPATAQHPQEPQPSA
                     STPGTQQQQKDGDTEMADAPMTSTTTRQSDGRTKQQKAHPSDFAIPYSQTNTITVIHS
                     TSQPNLSLLNYWGFDITSPNHPPHPLLNHLLTLTWLQLLKPELDTSYSTPPLTATPET
                     LASWKPSRRGNFHRKRRRYARIRHIVDSTRAGNFSGLVCASTMDPISILRYTLPLLAG
                     GAPVAIYSPSVEPLAALADCFSVPRRTAWVSGSVPEIEGLSNEELERWQGNDRFPLNP
                     TLLQGVSIQTSRARRWQVLPGRTHPLMTERGGAEGYVFTAWRAKPAEGKVAAKGKFKR
                     RKVDSETATPAPA"
     gene            complement(<138943..>139742)
                     /locus_tag="MYCTH_2127482"
                     /db_xref="GeneID:11509882"
     mRNA            complement(join(<138943..139119,139186..139581,
                     139737..>139742))
                     /locus_tag="MYCTH_2127482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663638.1"
                     /db_xref="GeneID:11509882"
     CDS             complement(join(138943..139119,139186..139581,
                     139737..139742))
                     /locus_tag="MYCTH_2127482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663686.1"
                     /db_xref="GeneID:11509882"
                     /db_xref="InterPro:IPR007204"
                     /db_xref="JGIDB:Spoth2_2127482"
                     /translation="MPAYNSVFNASEPAPRLIGNFPLFPLRTKVRGPVYPLPFPDPPL
                     PANESPDPSSESYDILDEVLALFRANTFFRNFEIQGPADRLLVYGIWFVSDCLSKIKP
                     NATLREATKDVTNLALDLNFAIPGDPAFPLNQMYEPPRDRQDAEVLRQYMSQVRQELA
                     SRLLARVYDEGDAKPSKWWLSFTKRKFMGKGL"
     gene            140785..142515
                     /locus_tag="MYCTH_2305769"
                     /db_xref="GeneID:11509883"
     mRNA            140785..142515
                     /locus_tag="MYCTH_2305769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663639.1"
                     /db_xref="GeneID:11509883"
     CDS             140949..142349
                     /locus_tag="MYCTH_2305769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663687.1"
                     /db_xref="GeneID:11509883"
                     /db_xref="JGIDB:Spoth2_2305769"
                     /translation="MPTSHEKSGSPERARPSKNGSPTQSTPATRQPSRRRMTRITRAE
                     PGSLYDIMHDHAGTPLYVVPICWTDQHAQLLGARFRKRATITTPVPELVPGVWLEPSK
                     MAQTLTSELHTLAREDATPARAFCKNRAIKHILSTLFPTTLSRPKTGAELNLYFGHRV
                     FKKVVRIPCVWKSPSCTDTSFDSCPALPATSFNGVPSSPRDAGMPMLAYINKSQLAAV
                     RKNLYTVLRGPGGCANEPVSNLQRLRSKMLIPADPDRDRYIIAILLAMAQAHFYHESS
                     SRSSSQSDSQSGRKSFRIMPPSFRDVQVQVITHDEGNDNDPNFVVYTATVTATFLNRF
                     MFPHKAPRGPAGEDGDAGMDISYTPVSFWPILGLKERLAKALGREIAGDAIYDDPNYI
                     GLWGPLIEPQQSPVYHPVSLKRRRTDREPLSQVFNSSFEEEPPSSSDDRPVLSPAAKK
                     RRTARRVNGSSTLEVC"
     gene            145156..147916
                     /locus_tag="MYCTH_2305770"
                     /db_xref="GeneID:11509884"
     mRNA            join(145156..146165,146230..147916)
                     /locus_tag="MYCTH_2305770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663640.1"
                     /db_xref="GeneID:11509884"
     CDS             join(145698..146165,146230..147492)
                     /locus_tag="MYCTH_2305770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663688.1"
                     /db_xref="GeneID:11509884"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2305770"
                     /translation="MKGFTTLVTAALLGRAVAAPPEPPTKIVEKRAAPTVTIASGSIV
                     GVSRQATEAFNGIPFAEPPVGPLRLKPPVRLNSSLGVFDATGIAPACPQFFADSDSND
                     FLSRVIDTVTSLPFFQKALKVSEDCLTINVIRPKGTKAGDNLPVLFWIFGGGFELGWS
                     SMYDGGPLVSNAIDMGKPYVFVAVNYRVGGFGFMPGKEILADGSANLGHLDQRMGLEW
                     VADNIAAFGGDPNKVTIWGESAGAISVFNQMALYNGDNTYKGKPLFRGAIMNSGSIVP
                     ADPVDCPKGQAVYDQVVAKAGCAGASDTLDCLRQAPYDKFLAAANSVPAILSYNSVAL
                     SYLPRPDGKVITKSPDVLVKEGKYAAVPMIIGDQEDEGTLFALFQSNVTSTDKLVEYL
                     GGLFFHGATTEQIEGLVNTYSTSILAGSPFRSGILNEIYPGFKRLAAILGDLVFTLTR
                     RVFLEAATTVNPNVPAWSYLASYDEGTPILGTFHGSDLLQVFYGILPNYASKSIQSYY
                     ANFVYNLDPNDASGGTSAKSKVAESWPRWTGTERKLINFFSNRSGYLNDDFRSESANY
                     ISSNVGALYI"
     gene            complement(149218..152657)
                     /locus_tag="MYCTH_2305771"
                     /db_xref="GeneID:11509885"
     mRNA            complement(join(149218..149657,149723..149829,
                     149968..150833,150981..151198,151271..151391,
                     151470..151747,151817..151923,152031..152187,
                     152258..152657))
                     /locus_tag="MYCTH_2305771"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663641.1"
                     /db_xref="GeneID:11509885"
     gene            149372..149462
                     /locus_tag="MYCTH_t100"
                     /db_xref="GeneID:11509886"
     tRNA            149372..149462
                     /locus_tag="MYCTH_t100"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:149405..149407,aa:Glu,seq:ctc)
                     /db_xref="GeneID:11509886"
     CDS             complement(join(149609..149657,149723..149829,
                     149968..150833,150981..151198,151271..151391,
                     151470..151747,151817..151923,152031..152187,
                     152258..152517))
                     /locus_tag="MYCTH_2305771"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663689.1"
                     /db_xref="GeneID:11509885"
                     /db_xref="InterPro:IPR015366"
                     /db_xref="JGIDB:Spoth2_2305771"
                     /translation="MRIRHALVGIASLCCLLGTASGARISSRDMLSRRVVPPSHTLHE
                     RHEAGNVEGWVKRGLADAESTVPVRIGLKQSNVDAAHDLLMDISDPRSPNYGKHLSRS
                     EVEDLFAPREHSVAKVKRWLASAGVDEGRISQSANKQWIQFDAPVYELEKLLLTRYHI
                     FENLETGVQNIACSEYHVPRDVSHHIDYITPGIKLMAGGREERMVRWRKADRRSLVAG
                     LASQGRKGAHGMGHGGGGGSRSPDDPVVDDSPFRVTGPCSAEITPNCIRAQYQLPNGT
                     RAASGNELGIFQGLGQHYSQEDLDNYWKYVAPWVPRGTHPELRSINGALGPANDTLRA
                     GEEADLDFQIAIPLIWPQRTVLFQTDDEWYQQDQQRADTKYPGFFNTFFDAIDGSYCH
                     MTAFNMTGNCVTPECRDPEYPNPNATPEQGGYAGALMCGRHRPTSVVSVSYSGTEDSW
                     PASYMRRQCLEVLKLALQGVTVVESSGDFGVGGRPFDPRAGCLGPDRAVFSPRVMANC
                     PYVLSVGATALVDPEQEQQQQHADRGGSGKEPRLVEVAARTFASGGGFSNIFGRPKWQ
                     DRHVREYLRKTNLSELGYDNAAGMSFDSLRPPPAGGKLFNRLGRGYPDVAAVGQNFRV
                     VLRGYPNRMHGTSAAAPVWASILTLINEERRAVGKGPVGFVHQVLYQHPEVFTDITVG
                     SNPGCGTDGFPVEEGWDPVTGLGSPIYPKLLKLFMSLP"
     gene            complement(153225..>160880)
                     /locus_tag="MYCTH_108416"
                     /db_xref="GeneID:11506413"
     mRNA            complement(join(153225..154311,154417..154793,
                     154867..160152,160241..160326,160383..160442,
                     160503..>160880))
                     /locus_tag="MYCTH_108416"
                     /product="glycosyltransferase family 5 protein"
                     /transcript_id="XM_003663642.1"
                     /db_xref="GeneID:11506413"
     CDS             complement(join(153386..154311,154417..154793,
                     154867..160152,160241..160326,160383..160442,
                     160503..160880))
                     /locus_tag="MYCTH_108416"
                     /note="CAZy_ID 268040; glycoside hydrolase family 13;
                     CAZy_ID 268040. glycoside hydrolase family 13"
                     /codon_start=1
                     /product="glycosyltransferase family 5 protein"
                     /protein_id="XP_003663690.1"
                     /db_xref="GeneID:11506413"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR013534"
                     /db_xref="JGIDB:Spoth2_108416"
                     /translation="MTRPSVLTGTLLLTVLSLPTFVSGRKFDASLIDYNLNRNRSATS
                     PYDYWGSRQDDEPDFKYAPSPENWRMPFYTIFLDRFVNGDPSNDDIYSTPYETDMMST
                     QLRFGGDLEGLRDSLDYITGMGIKGLYIAGSPFVNLPWGADSYSPIDLTTLDKHFGTI
                     KTWQQVIDEIHARGMLGDLIGFEGYLNESTPFRTEEHKVLWKDPERRYYDFDIGNEYN
                     ETCNYPQFWLEDGTRIDPPGLKGCYDSDFDQYGDIEAFGVYPDWQRQLAKFASVQDRL
                     REWEPSVAARLQRFSCMAIRMLDVDGFRIDKAVQVTVDAQAAFSSAMRKCASEVGKKN
                     FVIFGEITSGNDLGSIYLGRGREPKVAKELEKPDNAIALEPSSSDSSRFFIREAGNSA
                     LDAGAFHYSIYRFLTRFLGLSGNLEAGYDLPLDWVDAWNHMVITNDFFNPNNNKFDPR
                     HLYGVTNQDVFRWPAIKLGVERMLLGYFVTTLLMPGAPLVYYGEEQALYALDGTASNY
                     VYGRQAFAPSPAWQAHGCFQLTIGQYIGWPIEQGRHGCTDPGVSRDHRDPSAPLRNIF
                     RHMFALRDSFPVLEHGWFLQTLSKRTEFITLNGSTTPTEFGIWSVVRDMYHPLQNETE
                     TPVWLVYHNREKSASYTFACDDVNDAFVSPFDEGTEVKDLFSNGKSIRLEASPRKNNF
                     TGTGKSAGCLSSIDLEPFEFRAYVPAGEWVAPGPMITKFAPGHDVSLDSTDANGEIDG
                     IVIEYNVEMDCDSFKDAMTAVVTTDGAHNATKLTFQSPKCSTITPEKRFGYTGEIQSS
                     WRLETSLRNVPDGVIQITIDKALTKGGISTNTTDRFLIRFGRINNPVVFPSLANYSRT
                     LLAGEEGDNVYIQHSAPGATHWRYSTNWASSWSEWFPYDSSDTRPVVPKLKWDGTDLQ
                     KWTGTHIQVQYYSKPLGSSAFIQHADSNDVQWERSLPHIRIHGPYNKWGYDSGLPGSM
                     DLIYHHTWSLHFMYEWPANFQLNVWGINPDKQPDVTAIFGDIDGDGVVDRLPPSSLAK
                     NVINITKPPPMPALAYKLVFDDSAFKFRYEPAGNMGLQIVIFVLLAVLPVIFAVLAGW
                     IYVRSFYQVKVNKSGFTRKGWMPLGLSSISMLDLKSFGKGSVEMKAMTPSPAQSAAAV
                     APVGATGSRRTVLIATMEYNIDDFGIKIKIGGLGVMAQLMGSALSHVDLIWVVPMVGD
                     VDYPTDRMTRAESMFVNVMGQPYEIEVYYYTTKNITYVLLDAPIFRKQTKANPYIARM
                     DDIESAILYSAWNSCIAETIRRFPVDIYHINDYHGAAAPLYLLPRTIPCCLSLHNAEF
                     QGLWPMRTPEEQKEVCDVFNLSPEIVKEYVQYGSVFNLLHAGASYLRIHQRGFGAVGV
                     SKKYGDRSLARYPIFWSLKNIGQLPNPDPSDTAEWDPTKDVSKQSKDIEIDQAFEEKR
                     ADLRRQAQEWAGLEVDPTAELFVFVGRWSLQKGVDLIADIFPSILEKYPKTQLICVGP
                     VIDLYGRFAALKLQKLMEKYPKRVFSKPEFTQLPPYVFSGAEFALIPSRDEPFGLVAV
                     EFGRKGALGVGARVGGLGQMPGFWYTVESMTPSHLLQQFKQAIVSALECKPSKRALMR
                     AWSAKQRFPVAQWVKQLDELYSESIRIHHKEARKKKLEALSPSSPNPSRPPSRLSSRP
                     PSPTSTATYVDHGSSALSPGPETHLMPPHSSASPAPRAMLSPDLPSPSAPWVTGTAPS
                     SPRDSAASSIAGSIYGNATARESTMSVDSFGVRAQKDGMDSPNLTPNFGLAPPRATVG
                     QSHRNSSLLSLPDVVGDRHDLKLQQVDQFFNDSNGEYYAMFEEMLESLTASNSANELC
                     IEAFIKKSEKEWFARYRDAKLGRHSRIGSPANSRPASRQGSGRNESVVSRGRQRHRSI
                     TPSSLARSAFDVSPPPNDVDDEFLLGDGYQPPTGLKKILSIRLGDWPLYSFLLALCQI
                     ISVSSYQIVLLTGETTQTPEKLYMVAATYIGTSLLWWAMERNFKSVYPLSLPWFFFGF
                     AFLLIGVAPFIPDWRVANKIEDAATCFYAAGASSGALSFALNFGDEGGAPTKQWITRA
                     LIVSGFAQVYSIGLWYWGSIVADTDPTATVFVGTSKVPQAVVIGVPICLLCWAIGVVL
                     YLGLPDFYRQTPATIPGFYISLYRRKVVPWFFVMIILQNYWLSAPYGRSWQFLFNTQH
                     VPGWGIFLLALGFYCGLWALVLYAFSYFSDEHTWLLPIFAIGLCAPRWAQEFWGTSGL
                     GWYLPWAGGPVGSTILSRCLWLWLGLLDNIQGVGIGMLLLATLTRHHVLTVLIGAQVV
                     GSVFTMLARATSPNALSPNTTFPDFSQGVMPGIASPFFWVCLIFQLIIPIGFFKFFRK
                     EQVSKP"
     gene            163217..165150
                     /locus_tag="MYCTH_2305783"
                     /db_xref="GeneID:11509887"
     mRNA            join(163217..163598,163673..164500,164556..165150)
                     /locus_tag="MYCTH_2305783"
                     /product="glycoside hydrolase family 13 protein"
                     /transcript_id="XM_003663643.1"
                     /db_xref="GeneID:11509887"
     CDS             join(163379..163598,163673..164500,164556..165103)
                     /locus_tag="MYCTH_2305783"
                     /note="CAZy_ID 267854"
                     /codon_start=1
                     /product="glycoside hydrolase family 13 protein"
                     /protein_id="XP_003663691.1"
                     /db_xref="GeneID:11509887"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR015340"
                     /db_xref="JGIDB:Spoth2_2305783"
                     /translation="MRTSIISTAVATALAFAGLGSAANITEWKSRSIYQVMIDRFART
                     DGSTDASCDVSRFCGGTWKGLLNNLDYIQDMGFTAIQISPIVKNIEEHTSVGDAYHGY
                     WSVDNYALNDRFGTKQDFEDLVAELHKRDMLLMVDVVVNNMAQAFDNVVPPKIDYSKF
                     NPFNDKKYFHPYCNVTQWENATDYQNCWLYPYGVALADLATETKPVSDELGRWVKELV
                     ANYSIDGIRIDAAKHVNDGFLPGFVEASGVFAFGEVLTGLPEDMCRYQSLGLLPGMPN
                     YLEYYQLNEAFNGGSMADVAEMRNEAASSCNDTAALGSFLENHDMPRFANRNDDMALA
                     KNGMTYILLNDGIPTVYQGQEQHFKGNGTPFNREPLWSSEYNKESPLYVLTATLNKVR
                     NNAIKLSSDYISTPSETLWADVNHLCLRKGPDGSQVVFCINNKSSQGESYQISVGGFQ
                     KNEKVVEVLTCKTNTADISGNVTMYMNKGEPKVYVPQAALSGTGLCDKTEEDGPSSGA
                     AALGLTGSVVLTAVIGWAVVLLA"
     gene            <167864..>169588
                     /locus_tag="MYCTH_83025"
                     /db_xref="GeneID:11509888"
     mRNA            <167864..>169588
                     /locus_tag="MYCTH_83025"
                     /product="fumarate reductase/succinate dehydrogenase flavo
                     protein-like protein"
                     /transcript_id="XM_003663644.1"
                     /db_xref="GeneID:11509888"
     CDS             167864..169588
                     /locus_tag="MYCTH_83025"
                     /codon_start=1
                     /product="fumarate reductase/succinate dehydrogenase flavo
                     protein-like protein"
                     /protein_id="XP_003663692.1"
                     /db_xref="GeneID:11509888"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Spoth2_83025"
                     /translation="MASNTDKKPVIIVGAGLAGLVAAFELTQQNVPTIIVDQENAANL
                     GGQAFWSLGGLFCVNSSEQRRMGIKDSRELAMRDWFGSARFDRDKEDYWPRKWAEAFV
                     NFATDEMESYVKARGIGFLMNVGWAERGDGRADGHGNSVPRFHITWGTGPEVVRVFAE
                     PVKAAEKKGLVEFRHRHMVDEIIVDEKTGRAVGVRGRVLEPDDSPRGVKSSRNVVGDF
                     EIYGSAVLVSSGGIGGNVEKVKACWPVERLGPKVPENFVIGVPAHVDGRMIDIAEAAG
                     ANVINRDRMWHYTEGLQNWDPIWPDHGIRVLPAPSSLWLDATGKRLPPFLYPGSDTLA
                     TLKYICSTGYDYTWFITDQTIVAREFALSGSEQNPDLTNKSIWQLLTQRVFGSQGTVP
                     VQKFVKHGVDFVVRDNLEDLVKGMNELVSTVPGAPQLDYAQVVEVVKARDGQFENTYS
                     KDAQAMLIHNARTYWPDKRSRVAVPHRLLDVKNHGPLIAVRMNLLTRKTLGGIETNLD
                     SNVMRPDGTAFPGLYAAGEAAGFGGGGVHGYSSLEGTFLGGCIFSGRAAGRAMAREFL
                     GEGAKGTE"
     gene            170340..172251
                     /locus_tag="MYCTH_2305791"
                     /db_xref="GeneID:11509889"
     mRNA            join(170340..170637,170696..172251)
                     /locus_tag="MYCTH_2305791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663645.1"
                     /db_xref="GeneID:11509889"
     CDS             join(170628..170637,170696..172122)
                     /locus_tag="MYCTH_2305791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663693.1"
                     /db_xref="GeneID:11509889"
                     /db_xref="JGIDB:Spoth2_2305791"
                     /translation="MGQAQPQAIQSPTGGCKRKRPIEDPIESPPDRERRRRITPTRTA
                     GDTISEPGIGGGCPEPTDPISYWVENQCWPEKLKQPEEALEMDYMEYPLARKRSVSSS
                     SRKRPSSTMTRTPTDEKPREEKSTAYRNPQFPLLLKALGSYMEASDLGITDTSEHLIS
                     ALLSGEQSVPRGTLFDDDVFADACRNLKNRNEPRVIQDISRLIVPSAESLALRDRKYK
                     CLVESVNEGWNHSIPLSRITRPQPDYSVGFKDDAFTKEQLTKLSPLVGDIVAGDRSFF
                     MATWYMYFPFLTCEVKAGTAGLEIADRQNAHSMTLAVRGVVELFRTVKRESEVNRQIL
                     AFSVSHDHTSVRIYGHYPVISGKDTNYFRHLIHEFSIATFNGRDKWTAYRFTKNVYDI
                     WMPKHFENICSAINQLPSDLDFNVPPLSRGTGLSQELGTVIESEAETGSASAHAERAS
                     GSTSGVGQQDVTPDTSFIPSRAGKRRKE"
     gene            173181..174933
                     /locus_tag="MYCTH_2305792"
                     /db_xref="GeneID:11509890"
     mRNA            join(173181..173396,173552..174933)
                     /locus_tag="MYCTH_2305792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663646.1"
                     /db_xref="GeneID:11509890"
     CDS             join(173352..173396,173552..174913)
                     /locus_tag="MYCTH_2305792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663694.1"
                     /db_xref="GeneID:11509890"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="JGIDB:Spoth2_2305792"
                     /translation="MDSRSFSSRLRELVKFLSTVKGDLANVTGPPSLLAPLSVVEVGR
                     FWAERPSVLAAPAREPKPEKRALLVLRWFLIALRGQLYVGVDLNNNHNHDHNHNHNQN
                     NNNNGKKTPTSSTSIRKPLNAFLGELFLASWTDETKGTTTTTTRLVAEQVSHHPPITA
                     MHVSCDDDSEGGGEGLVRADGYARVEMVFGGVSAGLQIRQVGHATVRVDRYGEDYLIP
                     LPDVRVRGFLAGCLYPEIAGVYHIVGSNGFRVEMKFWGEGFIRGKRNSFEARVYRDEE
                     EEEEEEEEEEGEDEDESQNKENNNNKKKNKEKKRIRVVYYEVAGCWSEGWTVKDGRTG
                     ELVEVYRVDGPENGPARMEMEPVEKQDPWESRRAWAGVLRGLAAGDMRSVVAEKTKIE
                     QAQRQMRATEAARGLVWEPLFFNSYPSDDHPVFHRLSQGLGWQLHADKTKGVWKLDDG
                     RLKRIQRPFRGDITPFGY"
     gene            174934..175664
                     /locus_tag="MYCTH_2305794"
                     /db_xref="GeneID:11509891"
     mRNA            174934..175664
                     /locus_tag="MYCTH_2305794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663647.1"
                     /db_xref="GeneID:11509891"
     CDS             175137..175535
                     /locus_tag="MYCTH_2305794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663695.1"
                     /db_xref="GeneID:11509891"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="JGIDB:Spoth2_2305794"
                     /translation="MTSMRPDGHVLWSTDVAVPVSRLADTVDWSKAECSRLGLFASVV
                     GHVGDGNFHVAMIYDPRDPAQAAAVARCVRRMTDRALEMDGTVSGEHAIGIGKKACPR
                     DELGDETIGLMRALKRALDPKMDHEPGQGV"
     gene            complement(175664..177896)
                     /locus_tag="MYCTH_2305795"
                     /db_xref="GeneID:11509892"
     mRNA            complement(join(175664..177054,177165..177490,
                     177658..177896))
                     /locus_tag="MYCTH_2305795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663648.1"
                     /db_xref="GeneID:11509892"
     CDS             complement(join(176015..177054,177165..177490,
                     177658..177806))
                     /locus_tag="MYCTH_2305795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663696.1"
                     /db_xref="GeneID:11509892"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2305795"
                     /translation="MVLSPKWYQFLVGVFASLGSLLYGYDLGVIAQVIASQSFKSRFS
                     PSDNEEAAVVSVFTGGAFFGAMAAGPMGDKLGRRWTILCGALVFCLGGALQTGAQALS
                     YLYAGRSIAGLGVGVLCMIVPMYQAELAHPSIRGRITALQQFMLGIGALAAAWISYGT
                     YVGFAPTNDGQWRTSLGIQVIPAVFLAALILLFPESPRWLIDHGRSEEGLRTLAQLHS
                     HGDVDDAWVQAEYQQIRESVEFVRENEAKSYAELFRDRSCFRRLFLACAIQGSVQMTG
                     VSAIQYYSVTIYGLMGIEGDDTLKYQAISSIIALVAQALCILLIDRLGRRWTLIGGNL
                     GNCVTFIIATVMLARYPPGTSSNKAAAWGFIVVTWVYNFSFSATCGPLSWIIPAEIFD
                     TKTRSKGVSIATMTSFALNTMIGQVTGPAMKTVGYRFYLLFVVCNFTNALFFWAFLPE
                     TAKRPLEEMNRLFTDAPLFVPTMNRSDWALNDLELRVEEVKAKQESVAAHADRR"
     gene            178906..181205
                     /locus_tag="MYCTH_83019"
                     /db_xref="GeneID:11509893"
     mRNA            join(178906..179196,179286..179480,179577..179704,
                     179787..179875,180020..181205)
                     /locus_tag="MYCTH_83019"
                     /product="glycoside hydrolase family 51 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663649.1"
                     /db_xref="GeneID:11509893"
     CDS             join(179090..179196,179286..179480,179577..179704,
                     179787..179875,180020..181039)
                     /locus_tag="MYCTH_83019"
                     /EC_number="3.2.1.55"
                     /note="CAZy_ID 267815"
                     /codon_start=1
                     /product="glycoside hydrolase family 51 protein"
                     /protein_id="XP_003663697.1"
                     /db_xref="GeneID:11509893"
                     /db_xref="InterPro:IPR010720"
                     /db_xref="JGIDB:Spoth2_83019"
                     /translation="MATFTRIEDGESPSITIHPSHKIAKISDNIYGGFTEHMGRCIYG
                     GIYDPGNPLSDENGFRKDVIEALKELRVPVVRYPGGNFVATYNWLDGVGPKEKRPKRP
                     ELAWIGVETNEFGTDEFMKWCEVVGAEPYLCLNMGTGTLSDALAWLEYCNSDRDTYYA
                     NLRRKNGREKPYNVKYWALGNECWGPWQVEQMTKEDYAKKAYQWAKALKLLDPSITLI
                     LCGETGYSSWDHHVLKECVRWDVHGLGDQNQTKSLIDMHSIHVYTADREHLPNATAPR
                     SAERAIQMASALIDLARIENEVPATVPKQKICFDEWNVWDPVRAPGEQGAEERYTLSD
                     ALAVAVWLNAFVRQARDLGMANIAQSVNVISPLMTTRDGLVKQTIWWPLLLFSRYMRG
                     HTLALHVRGPEYTGRTRPAWIRAAIETPYLDCSAALGDDGFVNLAVANLHEQNDYPVD
                     LDGLRIAHGDRVAVFLVTGDHVGVANTADEQKVGIAESSWDGKGKFTFVKHSFTLLRW
                     KPAE"
     gene            complement(<182034..>183967)
                     /locus_tag="MYCTH_95427"
                     /db_xref="GeneID:11509894"
     mRNA            complement(join(<182034..182670,182816..182949,
                     183047..183785,183903..>183967))
                     /locus_tag="MYCTH_95427"
                     /product="sugar transporter-like protein"
                     /transcript_id="XM_003663650.1"
                     /db_xref="GeneID:11509894"
     CDS             complement(join(182034..182670,182816..182949,
                     183047..183785,183903..183967))
                     /locus_tag="MYCTH_95427"
                     /codon_start=1
                     /product="sugar transporter-like protein"
                     /protein_id="XP_003663698.1"
                     /db_xref="GeneID:11509894"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_95427"
                     /translation="MKLPTIYNVQLVAIIATLGGMLFGFDISSMSAIVVTDQYIEYFN
                     NPTGVIQGAIGSALAAGSVVGSAVAGPLSDWMGRRDSIMFACLFWLVGTAVQVATQNV
                     GQLIAGRVLNGFTVGITSSQVPVYLAEIAKAEKRGSIVIIQQLAVEFGILIMYFIGYG
                     CASIEGTGSFRTAWGTQFIPCVFLMLGLPFLPRSPRWLAKVGRDKEAIETLANIQADG
                     NTQDSRVIAEWEEIQTVMQAEREAGRGWRKFLLNGMWKRTLAGMSVQAWQQLAGANVI
                     VYYLTYIAQMAGLTGDVAMVTSGIQYAVFIVFTGIMWLFIDKTGRRTLLIWGALGMGF
                     CHFVVGGVMGAHSTYHPEGVGNPPNGNIVIAVNKGAPANTVITFSYLLIVVYALTLAP
                     VCWIYAAEVWSLGTRATGMSLAAMSNWVFNFALGMFTPPGFVNITWKLFIIFGVLCVT
                     AAAWFFLLCPETCGKTLEEIELLFSGPDAPHPWNTRKGDSRLAAEIAAVEARRREKTE
                     AGEVEAVPSVGEQEKV"
     gene            complement(185816..187074)
                     /locus_tag="MYCTH_2305804"
                     /db_xref="GeneID:11509895"
     mRNA            complement(join(185816..186584,186675..187074))
                     /locus_tag="MYCTH_2305804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663651.1"
                     /db_xref="GeneID:11509895"
     CDS             complement(join(185907..186584,186675..186947))
                     /locus_tag="MYCTH_2305804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663699.1"
                     /db_xref="GeneID:11509895"
                     /db_xref="JGIDB:Spoth2_2305804"
                     /translation="MSSDYVEVRVALQRRVRRRRPWLEAAQTPFRDDAPMVGPPKTTA
                     ADFEMPRLRRCPFDLDSMVWEARMGGGLDGYVWKVRFGTQGPFVLKVFWDAQPVDFPT
                     YYAPQRECQNAALLQMMQTAVEQAAAASRPILVNPKPTTWDDAIANLAAFSDEARLKQ
                     PSPADQGSGPPQEGFCQISTMPRVKKCYGWLTIPGTIFRELHWTLRPPPVQVDRIKRY
                     LTPDQEYIAIVYEYVEEGENDPETMQKAMDFFWLAGFSCAFSPLLRNWKSGVLVDLSD
                     IVPPRGYGWQEKLYKDGPESAHVLLKQPLPAGPVRARACT"
     gene            complement(<188041..>189524)
                     /locus_tag="MYCTH_52068"
                     /db_xref="GeneID:11509896"
     mRNA            complement(join(<188041..188101,188188..188528,
                     188627..188868,188948..189005,189069..189135,
                     189207..189253,189327..>189524))
                     /locus_tag="MYCTH_52068"
                     /product="glycoside hydrolase family 5 protein"
                     /transcript_id="XM_003663652.1"
                     /db_xref="GeneID:11509896"
     CDS             complement(join(188041..188101,188188..188528,
                     188627..188868,188948..189005,189069..189135,
                     189207..189253,189327..189524))
                     /locus_tag="MYCTH_52068"
                     /EC_number="3.2.1.4"
                     /note="CAZy_ID 267986"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003663700.1"
                     /db_xref="GeneID:11509896"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_52068"
                     /translation="MKFLDVLLGAAAASSALAAPTCTTKTKRAGKFKFVGVNQSCAEF
                     GQDTLPGQLNKHYTWPAKSSIDTLLATGMNTIRIPFMMERLIPNQLTGTVNETYSAGL
                     IDTVSYVTSKGAYAVIDPHNFGRYYTQVITDVEGFKAWWTTTAGLFADNDKVIFDTNN
                     EYHDMDQSLVVNLNQAAIDGIRAAGATSQYIFIEGNSWTGAWTWVSSGNGESLLNLSD
                     PEGDDKLIYEMHQYLDEDGSGTHEQCVSGTIGRERLQAATEWLKANGKKAILGETAGG
                     ANDQCISALTGMLSFMEENSDVWQGWLWWAAGPWWADYMYSIEPPSGTAYTKVLPSLQ
                     PYI"
     gene            complement(191246..192615)
                     /locus_tag="MYCTH_2305805"
                     /db_xref="GeneID:11509897"
     mRNA            complement(191246..192615)
                     /locus_tag="MYCTH_2305805"
                     /product="glycosyltransferase family 31 protein"
                     /transcript_id="XM_003663653.1"
                     /db_xref="GeneID:11509897"
     CDS             complement(191591..192184)
                     /locus_tag="MYCTH_2305805"
                     /note="CAZy_ID 270085"
                     /codon_start=1
                     /product="glycosyltransferase family 31 protein"
                     /protein_id="XP_003663701.1"
                     /db_xref="GeneID:11509897"
                     /db_xref="JGIDB:Spoth2_2305805"
                     /translation="MITRLKPFVTPALTAVSILLIFVYFSKIWLLPCSNSRREAYFYQ
                     RPHNYPFPQCVTLEVAHPTPDPTPPLPPPHRSGLLPSARDPECERFPDTSKVLLVMKT
                     GASEAFARVPTQLLTVLRCLPDFLIFSDMDQNIAGQQIHDSLSTMLPGVKEGNQWCVV
                     GQGECDKLGDPAREGWRLDRCKNVHIAKKAYQMRPGY"
     gene            192617..194430
                     /locus_tag="MYCTH_2305806"
                     /db_xref="GeneID:11509898"
     mRNA            192617..194430
                     /locus_tag="MYCTH_2305806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663654.1"
                     /db_xref="GeneID:11509898"
     CDS             192971..194119
                     /locus_tag="MYCTH_2305806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663702.1"
                     /db_xref="GeneID:11509898"
                     /db_xref="JGIDB:Spoth2_2305806"
                     /translation="MHVLADGSQRQGRQPRRRNASTNSNMVIWGRPVDHQASPHPLSR
                     RGANAEDSQREYLWNTPDGDKPDFAEAYTYGDEILISWNALNNSIYDLWLTSWQVGPD
                     PVVLCLASKSETKPNPPTSLFQGADLLTTADKGAVNLTQDGSLKLVTSDPPAAEFARE
                     TKYVFRFKPPTSQGEFVASDPDLSSPGFLLVEPSFHQNNFVPSTTGTTQSPSATPAPI
                     PTQFPATPSLDVATPPAGSEDTKPNMSPIAAAGLTIGLILAVVLLVAVEVGYLMWRRR
                     RRRRRGHGDESDEKTPAPARRRWWKRRSKDESDRGLFIQVGKAERIVDDKVWMSPELP
                     GDSTWGQSVLHELQGSRLGRGNPPKRSLTINSSVVELEAGRGVSEPRV"
     gene            complement(194605..194904)
                     /locus_tag="MYCTH_2305807"
                     /db_xref="GeneID:11509899"
     mRNA            complement(194605..194904)
                     /locus_tag="MYCTH_2305807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663655.1"
                     /db_xref="GeneID:11509899"
     CDS             complement(194707..194889)
                     /locus_tag="MYCTH_2305807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663703.1"
                     /db_xref="GeneID:11509899"
                     /db_xref="JGIDB:Spoth2_2305807"
                     /translation="MDLEMQTGQIDKPLADRTAQDGGRDDPVTGALAGRRNRMVSVLW
                     VGREISLEVKSVGEEE"
     gene            194905..198178
                     /locus_tag="MYCTH_2305808"
                     /db_xref="GeneID:11509916"
     mRNA            194905..198178
                     /locus_tag="MYCTH_2305808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663656.1"
                     /db_xref="GeneID:11509916"
     CDS             195012..198095
                     /locus_tag="MYCTH_2305808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663704.1"
                     /db_xref="GeneID:11509916"
                     /db_xref="JGIDB:Spoth2_2305808"
                     /translation="MRRSSLDLTEPARNIEESNGQPSADMTDATADNILSPPAEEMEL
                     IGDDSEATARVYTPPPHIAARLFYRPTNQTRRKDSAASSRRNSISSATSRSSHGGVRN
                     GGPQSKYIAQHLRRASILEDRKARLADRAAHAEKVRLRAALAKARTRNASVSEERALA
                     AAQARERNLAEIAAACAEEVRRAKAVAESMKEKREQEIRKMKLQMEERLAEAERRREE
                     LRSRNAAKAKGRERGQSLGTRKPPAADVVPGAQEAKHWARAPLTKEVAASKILWFWRA
                     SKRKQYVAEFSALGLSLDAVREASFDEVTMLLSQERVLVLTSRILRICGLNEGDPGSV
                     EEMAAVRSFLSAFLILGHPSQVLSNKDTEMAEEAELGQAHPIPKDSLANPQSQELVSK
                     ARDLLVLFENVLGRLTAFNHYTPPLALLAAFPEVYATFYNALIAWKARDSSSLVDLMV
                     MQFVELDAIWESVKDTTDGSVDQVYKESIRNNQLLLLVRIKRLAGAAKGKQLVADAVK
                     AARKARAKKPVGDTKPRMAEQTVTETAMGVLGVEESSAQPQTQTPTPPATPSRKPEPF
                     RISVVIPSGKSLLPDNRIVVHELAINKEFRTEPHEYHEQQEHLLAPLFREMRSTMQSQ
                     NREAHFFLLLKVADLIREKLQRLVKPGNSMHTFIGELLDTEIAQRQFAMGSFSYEKFF
                     QAMGSLLPKLCAPVRDDEVKVLVEEKLSHGSYVDRLEALNGFIDVMLSDYANYLLQLA
                     APRLIEQAPAYEARAFAADLEAGRHDLAVATKCWRAARQKLFTEASRRDPEGINHPGS
                     RPTANRIYAQLLVDLFTQLSPVPREEVPEMLLLDHKRIIEAGRLTRHIITTGAILLQC
                     KNLLKRDVRAPWRSEAQRILAVLEKSDDPRATDMTPDVAAEGINAALEAGRCMPAATK
                     QHLRGLVNKLLAASAEAATIKPREVELQEPVLRLLLARLRGHVLARLTASSASEKVKA
                     TSTAGEKLAGLGLAEFVDKVRDMVDMMGRVSAVDRDAHGVWWDRVAELVEGENTQ"
     gene            198782..202467
                     /locus_tag="MYCTH_2305811"
                     /db_xref="GeneID:11509917"
     mRNA            join(198782..199403,199494..201434,201563..202467)
                     /locus_tag="MYCTH_2305811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663657.1"
                     /db_xref="GeneID:11509917"
     CDS             join(199300..199403,199494..201434,201563..202184)
                     /locus_tag="MYCTH_2305811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663705.1"
                     /db_xref="GeneID:11509917"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="JGIDB:Spoth2_2305811"
                     /translation="MTDRDILPDTFKPVHYDLLITDLNFNNWSYKGSVRIDGELTKPT
                     TEIVLNTLELKLLRSKIVVSQGKSDETWEATAFAEDTKSQRSTITFPHELPVSAKASL
                     SIDFIGELNHDMAGFHRSQYKPAAPAAASVHRDDEFHYMLSTQFEACDARRAFPCFDE
                     PNLKATFDFSIEIPEDQVALSNMPVKESTPVGEGKKLVSFERTPVMSTYLLAWAVGDF
                     EYVEAFTDREYNGKKLPVRVYTTRGLKEQGRYALEHAPKIIDYFSEQFEMDYPLPKSD
                     ILAVHEITHNAMENWGLVTYRMTAILFDEQLSEAKFRNKIAYVVAHELAHQWFGNLVT
                     MDWWDELWLNEGFATWAGWLAVDYLHPDWEVWPQFINEGMDQAFSLDSVRSSHPIHVE
                     VRDALDVNQIFDRISYLKGCSIIRMLASNLGIQTFLKGIAIYLKRHAYGNAKTEALWD
                     ALSEASGVDVNSMMKPWIEKVGFPVLTVTEGKQQISVKQSRFLSTGDVKPEDDQTIWW
                     VPLAVKGKVGSQGIEPLALTSKELTIDGVCDEFYQLNANATGFYRVNYPESRLRLLGT
                     QLDHLTTEDKIFITGSAADLAFSGYATTGALLSFIQGLKSETHYRVLSQALDSIGTLK
                     SMFGDDEQINKGLEKLTLELIDKALKQVGWEGPTNEDFNTSLLRKRLLLAAVTNSHEE
                     VTAAALERWSAYEADSAKSPIAADLRAPVYRAAILKNPAAAVLGLKNEWFTTPAIDGK
                     EICLQALGHTADESLVENVILPFLFNRSPPAAAADSVPTADMHILAGVLAGNRVARPL
                     LWAYLRDHWDQLDAKLGGNPILVDRMVKVSLPKFSDLETLAEIERFFAGVDTKGFDRT
                     LEQVKDKIRARAAYKARDTEGVRGWLVANGYA"
     gene            207076..210118
                     /locus_tag="MYCTH_2305813"
                     /db_xref="GeneID:11509918"
     mRNA            207076..210118
                     /locus_tag="MYCTH_2305813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663658.1"
                     /db_xref="GeneID:11509918"
     CDS             208010..209965
                     /locus_tag="MYCTH_2305813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663706.1"
                     /db_xref="GeneID:11509918"
                     /db_xref="InterPro:IPR010856"
                     /db_xref="JGIDB:Spoth2_2305813"
                     /translation="MDPPVLSFYGKEPVPLPSRFGQIKRSLVAGHEAELEASWARLIT
                     ALREHVDDIASRGSSLTPSIDFADIHNPEARAAFSRDLKRYGLGVVRGVVPRADAQVS
                     IDETVKYLEKQTEFKRPPPQDPTCFDFFWTPAQVRTRAHPRVLEAQRFVMSLWDNNAD
                     DRMAIRFPIAYGDRLRIHGANIGNVGPDAAAAAAANDNDSKADDDQEASGSLPDAELD
                     DDLEAQQAAAELLGDFTSSTIIAQVDNGSLERWEPDGYGRGGTYDAVFKGEWEKYDPW
                     DPTHRVTATSDLYNGYGACSIFRMYQGMVALSTIEPGLIRLLPSPKLATAYFLLRPFF
                     SPKTKPPERRDGPEWDAFLDPSNWALDKEQSTIIHGAVPGHAQRLTELWHPHLHLRRT
                     LQTIPTLQTGDYIVWHPDLAYHITSNPNVMASRAPTPPPATAAGEEPAGRNGRPVSIL
                     VYVPAAPLTQTNALYLARQRKTFQRGHPGPDFDSTGSGLGSEATHIGRPTETDIAEVG
                     GPAALQAMGLAPFDVAPTPPQSAGSLSSSPPSASAPAGEKAGNGGEDVEMADSGSGPG
                     SGVGPSASGASSMTRAEAEVARMANIILFPDRYDFYMAKRNSSGTKRSKVRVERLLNP
                     VDPPSPPKVSKDKGTTTTAVAAADGKN"
     gene            210639..212776
                     /locus_tag="MYCTH_2305814"
                     /db_xref="GeneID:11509997"
     mRNA            210639..212776
                     /locus_tag="MYCTH_2305814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663659.1"
                     /db_xref="GeneID:11509997"
     CDS             210947..212599
                     /locus_tag="MYCTH_2305814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663707.1"
                     /db_xref="GeneID:11509997"
                     /db_xref="JGIDB:Spoth2_2305814"
                     /translation="MKVAFIEHNAPETPRGGRQGGPVSGDGQSTLDKGQHFARLSDNP
                     ATPSYLFRGHQSMFKPENSVSKAARRREKHKNRISFTETSEGVWVRVQHHGPPVEFQV
                     SPLRWKAARLVYHTKHFVSRLRSPGKVSIPSLPPTSTDRIPAAAAAASRRTTPSSPSS
                     TSEASFLDLAAAGPPSFLIAAVSHALPRPADRLAPSSSSSSSAAAAAFPLARIFPTLD
                     EMTSILLLPLHNSVGGSGRASGSRRSGGGGSSSSSSSYRTAIAYLIVAATLNHIRRTT
                     LCPPTVGGYQYPWCVMMGGVGANPLEDLRLALSNPDVFVGAALAGYGTRWALVARVVG
                     GGVLATWVVELAVGALLRRILLLFVTAAAAGAQEKKGVGWSSAGKGTWEVGGSAALKV
                     GYMLWLLMGVECAFARGMNAAAWLVAGYKLLLVAGEEGVGRVALRKAIQGKLLQGCFV
                     ACHLVYYLMGGIGPVVWRSSVSAARGQPGSLLTLTGIVWGVWMLLRYRSTFFIALEVS
                     GFFIFLGYVVFGLGVLAWEFIDDPLGLKVHTALDTLNGIKGE"
     gene            complement(<212954..>214678)
                     /locus_tag="MYCTH_51742"
                     /db_xref="GeneID:11509998"
     mRNA            complement(join(<212954..213902,213958..214164,
                     214233..>214678))
                     /locus_tag="MYCTH_51742"
                     /product="general substrate transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003663660.1"
                     /db_xref="GeneID:11509998"
     CDS             complement(join(212954..213902,213958..214164,
                     214233..214678))
                     /locus_tag="MYCTH_51742"
                     /codon_start=1
                     /product="general substrate transporter"
                     /protein_id="XP_003663708.1"
                     /db_xref="GeneID:11509998"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_51742"
                     /translation="MNSHERDSIEGEPLLAGEERDKVDIDNRETPSDPDHGDSFRTGD
                     GKLGRRGLASRFRDRKRTTVLGLLAVLTFVVTTSGMLFLVPIFRLMEDAVCHLHYEKP
                     KSEPVEERMCKVDAVQKELAFLGGIGAMINSVVGLIATLPYGVLADRIGRKPTFTLAY
                     VGIVLCFSWGPLILSIGEFPHVHLSVFGPLFFLIGGGIPVALNTLHAMASDISSDGDK
                     ATGFLCLSFGAVSGGLIGPVSAGLLMEHLGPWAPVRLVFCLTPFVFMLVIFLPETLPI
                     SLRETTTEEERRPPAKRVREEIKELGISFSLLKNRNIALSLPAFLVQPALFAAYSSTM
                     AQHISTYFGWTLAQTNYLLAPLGALQLVVIALLPLISGFLTKQSGRFRLSVFSKDLLL
                     AEISFIFLVLGAILEGCSREIVLFLIGLTIGTLGSSQGPLCRAIATSYVEPQQTSRLY
                     ALISMLETGGAFLGGPVLAWCFNIGLSRKGLWTGLPWFYVAGLVLLAFLSLLFLRAPR
                     NKTIAVGPESESNEEFGYQSAEEPV"
     gene            215368..216933
                     /locus_tag="MYCTH_2305819"
                     /db_xref="GeneID:11509999"
     mRNA            215368..216933
                     /locus_tag="MYCTH_2305819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663661.1"
                     /db_xref="GeneID:11509999"
     CDS             215566..216849
                     /locus_tag="MYCTH_2305819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663709.1"
                     /db_xref="GeneID:11509999"
                     /db_xref="JGIDB:Spoth2_2305819"
                     /translation="MPPAIEAQPAAESANRPDADKEQPSVPHQMQLQPYTPLELAVGD
                     GAEHEQESNAGLTRTSFADGARFLPAPTDFLSWASFGEVTLRPRKNARRSRLDRIISP
                     LKSVGAGLPGNVSVEGLGGLIESAHGIFHSVRRLDFMESERTMYMYSPPTPGGPRVPA
                     PDKLPRRELERYEDELFDLSKYNGASDYLTAMAWTEEAMSGSLTLYRVLSGIAGEATG
                     VRPVAAMRDVPSQVLARMRTDGRVRRKAVVTLIEDDDRTFDWKANPGRGPRYVRLASS
                     GVRSPGRSSSNSSRYRGPGMADADGVCATLPQFFALLHSRRSLLENVGSSWVTQTRTD
                     DGEAHPMVFLTKSPQSSPHEGNRVHVAVLVPNDALWAEDEFIWTDQTGLAEFRQRQYW
                     DLIEPPSRRARGRSRSRRRERDDAGPTRSPIRGRS"
     gene            complement(<217005..>219069)
                     /locus_tag="MYCTH_2118844"
                     /db_xref="GeneID:11510000"
     mRNA            complement(join(<217005..217242,217346..217566,
                     217672..217930,218059..218718,218825..>219069))
                     /locus_tag="MYCTH_2118844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663662.1"
                     /db_xref="GeneID:11510000"
     CDS             complement(join(217005..217242,217346..217566,
                     217672..217930,218059..218718,218825..219069))
                     /locus_tag="MYCTH_2118844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663710.1"
                     /db_xref="GeneID:11510000"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2118844"
                     /translation="MARDRSGDPSGGDEITPAPEPAGVRRKELRDKATDFLASHGAGD
                     SSFTYEEERRVLRRIDFRILPLLLGAYFFQQLDKSSLSYVSVFGISRDAHLVGKQYSW
                     LGSILYLAQLVMQPLAAFLLVKLPTGKVIGSAILLWGSALAIMSACTDFRSLLGLRFL
                     LGAFEAMIAPSCVAVTQMWWRRGEQTMRTSYWNAMNGITAIVGSLFTYGLGHIESRVL
                     FKYQIIFLFCGLLTVCYALVVLLLMPDSPMEAKYLAEREKVIAVERVRANQMGVASRA
                     WRWDHVWETLWDLKTWCWFIAIVSISGGISTFGSLIVKDFGYTNFDAILFNIPFGAIQ
                     FFVIIGSGWAATHWQRKGLTIAAVSVLPLVGTILMLTVPRNDHNKGVLLFGYYLVSCL
                     AAITPLIYAWQAQNTGGDTKKKCTSAVVFIGMCTGNVIGPLLYDESQAPLYRPGLISN
                     LVMFALVGSISALIPFYLMFLNRRHAKRREQLGKNAVLVDESMIAKIQIIEDSKAVEV
                     EDANNRRQRALEEDNALRDMTDLQNEDFIYVY"
     gene            <220508..>221803
                     /locus_tag="MYCTH_2118845"
                     /db_xref="GeneID:11510001"
     mRNA            <220508..>221803
                     /locus_tag="MYCTH_2118845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663663.1"
                     /db_xref="GeneID:11510001"
     CDS             220508..221803
                     /locus_tag="MYCTH_2118845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663711.1"
                     /db_xref="GeneID:11510001"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="JGIDB:Spoth2_2118845"
                     /translation="MATTRKRYAIVGTGARSSFFFNAIGQDYRATACVVALCDTNQTR
                     MNQRNKRLEAIGHGSVPTYPAADFDRMIAETRPDEVIVTTIDRTHHTYIIRALELGCN
                     VVTEKPMTIDAPRCLDILSAVDRTGGRVRVAFNYRYAPHNTKIYELLRSGAVGTVTSV
                     HFEWLLDTSHGADYFRRWHRDKRNSGGLLVHKSTHHFDLVNFWLRTRPLSVYAQGDLR
                     FYGRENAEARGVTRFYSRARGSEAARDDPFALHLDRVPALKELYWDAEHEDGYYRDQS
                     VFGDGISIEDTMSVLVRYRNGAVMTYSLTAYAPWEGFRVSFNGTGGRLEVEVAENSYV
                     NAAGEQGPEGAAERRSILLRPLFGKPREVEIPAADGAHGGGDKILLRDLFGEPQTDEY
                     MRAAGHLDGAASILTGIAANKSMATGQVVYVDDILKLPD"
     gene            complement(221996..224381)
                     /locus_tag="MYCTH_2315428"
                     /db_xref="GeneID:11510002"
     mRNA            complement(221996..224381)
                     /locus_tag="MYCTH_2315428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663664.1"
                     /db_xref="GeneID:11510002"
     CDS             complement(223084..223524)
                     /locus_tag="MYCTH_2315428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663712.1"
                     /db_xref="GeneID:11510002"
                     /db_xref="JGIDB:Spoth2_2315428"
                     /translation="MSSESSTPNCTPQPPMVVHNLYIPDPSADEIDLSTNQPWMVATV
                     INDDDLMFGGKPLCAWYEEDRRRFGCATVDEEETRGRPRERARADAHYERSQKQPQHH
                     HHQARQQHPQHPLQAQPQHQHHHQQQRQHHLHRSGDRSPDVKEE"
     gene            complement(<224764..>225432)
                     /locus_tag="MYCTH_95413"
                     /db_xref="GeneID:11510003"
     mRNA            complement(<224764..>225432)
                     /locus_tag="MYCTH_95413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663665.1"
                     /db_xref="GeneID:11510003"
     CDS             complement(224764..225432)
                     /locus_tag="MYCTH_95413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663713.1"
                     /db_xref="GeneID:11510003"
                     /db_xref="JGIDB:Spoth2_95413"
                     /translation="MPPTTAEPPLITAKSGQRNLVRDGARHLPGVVASWWPCETESGN
                     HWHSIESAHNKIQSGVSYILAGTCGAKVLGQREAWWHALRVNCSISLLRIALSDHRCS
                     CISGSHVKQPAHRKSLEWFFGSMYVSQEDFRSCAFVLCRNLVTTAKETDPARGYVITI
                     TRDLANSVQSLDGDSHSQRTEPAFGDGNGISDRTPIAFFNPRYNLQISDHPTRTGAIA
                     ITAS"
     gene            complement(<227455..>228285)
                     /locus_tag="MYCTH_95412"
                     /db_xref="GeneID:11510004"
     mRNA            complement(join(<227455..227564,227636..227966,
                     228259..>228285))
                     /locus_tag="MYCTH_95412"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663666.1"
                     /db_xref="GeneID:11510004"
     CDS             complement(join(227455..227564,227636..227966,
                     228259..228285))
                     /locus_tag="MYCTH_95412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663714.1"
                     /db_xref="GeneID:11510004"
                     /db_xref="JGIDB:Spoth2_95412"
                     /translation="MDGTTALLRADQLPARVWREAGRSWVHERNLPDRGWRESVDEQV
                     KLVRVKRRRRPQVETRRGRLLCFTSEVGFSQGAFELLYGREANLSARALPHPQTMAAP
                     VQVPCRVTAGCPRLNSLWTGIRDNLKENMEEAGARQQTGKLTNVEHNLYATPS"
     gene            complement(<228580..>231108)
                     /locus_tag="MYCTH_102997"
                     /db_xref="GeneID:11510005"
     mRNA            complement(join(<228580..228752,228865..228949,
                     229057..229173,229242..229328,229424..229539,
                     229617..229742,229838..230065,230186..230358,
                     230473..230659,230772..230989,231062..>231108))
                     /locus_tag="MYCTH_102997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663667.1"
                     /db_xref="GeneID:11510005"
     CDS             complement(join(228580..228752,228865..228949,
                     229057..229173,229242..229328,229424..229539,
                     229617..229742,229838..230065,230186..230358,
                     230473..230659,230772..230989,231062..231108))
                     /locus_tag="MYCTH_102997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663715.1"
                     /db_xref="GeneID:11510005"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_102997"
                     /translation="MAHSTKDGGDKDTPEADDPPVKSWKRYVWDTWDLPRAERRMLFK
                     VDAFILTFASIGYFLKNLDQTNVNNAFLSGMKEDLNMYGNELVTSTSVWTVGYVIGQI
                     PFNLLLTRVSPRWVIPSLELLWGVATISTAPIKNYHSLYALRFFVGFFESGFYPGIHY
                     MLGSWYTPRELGKRAMIFWLAGSVGQMFSGFLQAAAYTNLSGVHGYAGWRWLFIIDGV
                     ITMPLAVLGYVFFPNLPQGGKKTWWITQEEHELSVRRMAAINRAGKQQWSRAKLRRIF
                     LSWHAYLLPMLYILWNNAAMQDAMGYWLKSFNEDPPPVPGRHFSVAEINNLPLPTTGI
                     FVVMSIAWGWLSDGFCHGARWPFMYIGAVIGIVFAVVLREMPLYENITGRMVVYWLSR
                     IGSGAGPLILSWINEICSDDTEKRAILVAAANDFAYVVQAVAPNFVWKTTDFPRATKG
                     YTWSIILQCLLVLATAIVQYLLWRDKKRAREKEAAIPQSASSESTAGALEAQPREGEV
                     ARKDESVDDK"
     gene            <235208..>236644
                     /locus_tag="MYCTH_108407"
                     /db_xref="GeneID:11510006"
     mRNA            <235208..>236644
                     /locus_tag="MYCTH_108407"
                     /product="monooxygenase"
                     /note="Has EST support"
                     /transcript_id="XM_003663668.1"
                     /db_xref="GeneID:11510006"
     CDS             235208..236644
                     /locus_tag="MYCTH_108407"
                     /codon_start=1
                     /product="monooxygenase"
                     /protein_id="XP_003663716.1"
                     /db_xref="GeneID:11510006"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Spoth2_108407"
                     /translation="MAISPPPPLRVLISGAGIAGPALALNLSKLRAPLQCSITIVERH
                     PSLRAAGQQVDLRGPGIQAMRRLGIEREVRAAVVDEPGVRILDWRRGAPQAFFGRNDS
                     GKGRQTFSAEWELMRGDLCRLLYDATRDLPGIQYRFGTTVDSWEHVRGGRAVRARLSD
                     GTEAEYDLLVGADGLGSRVRRLMFADKKRQSNGESSNGESNGSGSRTANGLFPIGISC
                     AFYTVPPEPGDTSVATFCHYPGRRWIMTRRDRPDCLRVYMGYAGAGAADERFSRVVRH
                     GTPAEQKDAWADVFGRDLADAWGVRRFVDGLRSPQADDFYTQEFAQVRIDRWSDGRVV
                     LLGDAAFCPAPITGQGTTLALVGAYVLAGEIARACSSSSSGSGSGGGAAANDDDDGGS
                     PWDNLPAGLAAYETTLRPLVKGVQDVPVKTIVSLMCPEKPWLIKLFHWIMWFIATLRI
                     DLLAARFRSEEDSWWKLPDYPELVSPKA"
     gene            complement(<237245..>238129)
                     /locus_tag="MYCTH_2036724"
                     /db_xref="GeneID:11510007"
     mRNA            complement(<237245..>238129)
                     /locus_tag="MYCTH_2036724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663669.1"
                     /db_xref="GeneID:11510007"
     CDS             complement(<237245..>238129)
                     /locus_tag="MYCTH_2036724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663717.1"
                     /db_xref="GeneID:11510007"
                     /db_xref="JGIDB:Spoth2_2036724"
                     /translation="SPLSEPGPHGYPKRFAVRMAGLRGFKIYGADRRRPCHYVELHAR
                     QQVLRGSGRRRDKSRALVTVQENWPSWSLFPLDDEPATFTVTIHHHHLIPDPHHDGGD
                     DDGGLVRADETTIDVDHVRCRPVTFRFQLAVPTTPADATGSGSGGGSTSRTTLETFEW
                     RRAPPACWETRGIRKKTLPAMATGDERPPEEKFVCSPSGSVLVRLGGGGGGGGGGQRC
                     APGGRDRPMGFTRAGEEILASYARARGCGGVRCYFQFWGSAAAGTLGEAFTHVAVMTG
                     LAVYQDEEDETAGRRGRRK"
     gene            complement(238840..240433)
                     /locus_tag="MYCTH_116603"
                     /db_xref="GeneID:11510008"
     mRNA            complement(join(238840..239983,240065..240433))
                     /locus_tag="MYCTH_116603"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663670.1"
                     /db_xref="GeneID:11510008"
     CDS             complement(join(239078..239983,240065..240421))
                     /locus_tag="MYCTH_116603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663718.1"
                     /db_xref="GeneID:11510008"
                     /db_xref="JGIDB:Spoth2_116603"
                     /translation="MIPAPLRASPVLRTIRPRTLAATGLVRSSASFTRRPVPILHPSA
                     CQNVPSVLRAVMSTKPPLRPNKIDKEFEKQVAKKKLEPRPEEVSRASSVRQVFKKSQA
                     PPPSEEPDLMAGLRGDLNTVKETFALATVPRVPFALGLAGTLPYLATSLSTLVLAWNL
                     NNEWPTRSRFANAFLFNHEQAAHWLHILEPIQVGYGAVIISFLGAIHWGLEFAEKQTV
                     ENRARLRYGIGVLAPAVAWPTIFMPIQWALTAQFAAFCVLYYVDSQATVKGWTPTWYA
                     SYRFVLTGVVGIALVISLIGRAKVGEGRLHLSSGELAGRIRAKPTAGSDRDWAKEEED
                     ERKRIKEQRKQEEEKKKEEEEEKVRKEEEEKKKQAEKDGAADSRKKGEEQKEERDSQA
                     DGAAFDSNKDSGGNESGKGGGSQKDEQK"
     gene            241710..251731
                     /locus_tag="MYCTH_2305828"
                     /db_xref="GeneID:11510009"
     mRNA            join(241710..248316,248380..251731)
                     /locus_tag="MYCTH_2305828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663671.1"
                     /db_xref="GeneID:11510009"
     CDS             join(241832..248316,248380..251527)
                     /locus_tag="MYCTH_2305828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663719.1"
                     /db_xref="GeneID:11510009"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="JGIDB:Spoth2_2305828"
                     /translation="MLEGLVAGLLNRFLGMYVKNFDPTQLKVGIWSGDVKLSNLQLRR
                     EALDQLKLPINVVEGHLGELTLIIPWSNLRGAPVKVFIEDVFLLASPKEEAEYNEEEE
                     ARRKQRIKMEKLDSAELLKERSQEGLSQEEQKRTQSFTESLVTKIVDNLQVTVKNIHV
                     RYEDAISAPGHPFALGFTLEEFSAVSTDGEWAPTFIQDSTTTTHKLATLESLAVYWNT
                     DTKLMGPGREAHTPGAEVMPHDDMLKNFKTMIVRSDNDLSANHQFILKPVSGQAKIEL
                     DKTGNPQAPKFKANLLFDEIGLVLDDQQYRDALMMVDLFHYFIRHQEYKKYQPKGVTP
                     KEDPRAWLRFAGDAVLSKIHERNRRWSWDYFRERRDDRRRYIELFKKRKQNQQLTPDE
                     ADDMNKLEWKLSYEDLRFWRSLARNQLKKENAEALKNRPPAQEQQQQGWLSWVWGAKP
                     QQTEKQDEMENTEITEEQRKELYEVIDWDEKAALATEVDVPRDIVKLQIETSLSTGSF
                     TLKQNPHGNTRDLVSLHFDVFKARGLKRPDSFLIDLSLGGLRVNDGTTEKSLYKEIVR
                     VKDAPTRNAQKRLSIAELEQAGDEAFFHFQLEQNPLDGRGDVAVTAKLKPLEIVWNPN
                     VVVGVADFFRPPERHMESITALMETAGATVEGIREQTRAGLQFALEEHKTVNAKLDLQ
                     APLIIIPETVTSQNTACVILDAGHISVTSELVDRETSKEVQSKQSEAYAEQDLGRLET
                     LMYDRFLVKLTSTQVLIGPSVEETKQQLVAKDDQRMLHIVDKINVDFVVETSILPKAP
                     NLTKLKVSGHMPMLQVSASDAKYKALMRIIDVAIPRLGGDQTQPPQGHITAPGRPRAE
                     STTSLQSRRRSDRRLSQLGLPFATQQQEAIVIDDDELDDEDDKFEDAKDGFPDEQLRV
                     QQRIFEFNFTVDKLRGSLYRSDPGRQRPDQLLVELVAERFGVEFRLRPFDMGAEVSLG
                     SVTVDDFVENPPAEFKSIVSSGDVEDRQQARDLVHVRFVRVQKESPEFMTVYDGVETN
                     VDVAISTINLVVTRKTLLTLLDFILVTFTNNQSANGPSASQKTITDQDLATDAELEPL
                     SPVEQPEGGAIRVKVDLKSIRLILNNDGIRLATLSFNHADAAVFLLGRCMRVSTKLGD
                     LSLVDDVNLGTSEDSSLRQLVAIQGDELADFRYETFDLSKPERYPGYDSSIFLRAGSV
                     KVNFVEEPFRKIVNFLVKFGKMQAIYNAARQAAANQANQLQQSQGRIKFDVVVKTPIV
                     VFPRIVVSERPKRDLITAYLGEIYAQNKFAPLDDSKDSEIAMKLSAGIRNIRLTSSFH
                     YSHDREEELELIDHVDLGFKITYAEHKDGVMRPDLEVQGSMTDFNLRITPYQLRSLLE
                     ISQSVPAAFSGDVEQHTADAERDVGGATLERARTTPGYGGGNTNEQLIDMNPELETHG
                     EAWTKLDLVFTVNEIGLELINASEDSPVGDLDAASLSKFSLNSTRLKTRMDSNGSVEA
                     EFVVQALTIYDTRQHGANKFRKIMTSGNTGVEQLMASITMAGGKDRNVIAMVAIDSPR
                     FIFALDYLFAVQKFITIGTQTPPEPDVPEKSPLETPEEMSDVESVQANFSGEGSESSS
                     SRVAQPRLQGEPKKDEPQLRLAYRVNIVDAQVILIANPLSASSEAIVLGTKQVILSQQ
                     HALTFQVSQCGMYLCRMDRFADSRLRIIDDFSLQLSMDNSQPSTTKIHADIEPLILRL
                     SLRDILLVMQTIARASELSGGTATDETIHSEQKARQLRAPNLKQRPTSGRASSSLATR
                     TGRASKSVGSISHGAAVPPPHDIVKPPQRQEELTVTFDGIRVVLLGDVHELPILDMSV
                     KDFTASAANWTSDLRAETALEMYTNIYNFAKSAWEPLIEPWQVGFGVARDQRNGVMSV
                     EMSSKRTFDITITTASIALLSKSFAFFSQDQDVLGKPRGVEAPYRIRNYTGFDVIVHA
                     KRQSSEEVTTLRLTDGQEVPWSFEDWEKSRENLLRTEGAGANSVSVQLDGSGFDMVKN
                     IRLSREGEFLYALKPRTDGVLHKLLVDVKLGTDNVKYVTLRSPLLVENETDLPVELGV
                     YDAHDGHLLKIEKIAPGESRPAPVGAAYLKSLLVRPDPGFGYNWSTDTLWWRDLLRRP
                     IKTLVCKGEHGDPFYFQMCARWDKSNPVTRNYPYLRLKLSAPVTLENLLPYDFKYRIY
                     DKNTKRDWSNFLRKGGVSPVHVVELSHLLLLSVDMQDTLFKPSEFAIINAGSAEDFKK
                     ETHLVCRDDAGMSLNLKLHYFRVPDSGGAFKVTVYSPYVILNKTGLGVSIRSKGFMQQ
                     AKAAAGQPLIDLSDGTERKTPPIMFSFNNDDHRNRATIKVGESEWSKPQSFDAIGSTT
                     EVVLHSAGKNAEIHLGVTVESGLGKYKLVKTVTLAPRYVIQNKLGEDINIREPSSSTL
                     IPLKAGSLKPLHYLHRGGVKQLCLCYPGFDNQWTAPFNISDLGITHIKIARAGQRQRL
                     IRIETLMEDATIFLNLSMEQRSWPFSMRNESDTEFTFYQANPNIDDDGTEDRSGWRPV
                     RYRLPPRSIMPYAWDFPAVKVKELCISAYNKERHVKLAEIGNLMPMKFVGANGQAKII
                     DINVTADGPTQTLILSNFKQSKSLYRQRSNAGSGSSREGFEAKALDINTTFSAQLRLS
                     GIGISLINSQLKELAYLTFRDVQLRYSDSPMYQTVSLAVKWIQVDNQLYGGIFPMILY
                     PSVVPKRAQEIEAHPSLHAMVTRVKDDSYGVEYIKYATVLVQEMTVELDEDFIYAVLE
                     FSKIPGASWSSTEEQDKLCDDNIDIPQPKQQQAGRDIYFEVLNIQPMQLDLSFVRTER
                     VNVEDKTSSKNPVMFFFNVMTMALGNINDAPVRFNALMLENVRVSVPVLMQNISNHYS
                     QEALYQIHKILGSADFLGNPVGLFNNISSGFADIFYEPYQGLIMSDKPEDFGLGLARG
                     AGSFFKKSVYGFSDSFSKVTGSFAKGLAAATMDKQFQDRRRITRARNRPKHALFGVTA
                     GANSFLTSVASGVGGLARKPLEGAEQEGALGFFKGIGKGVVGLATKPAIGVLDFASNV
                     SEGVRNTTTVFDGSELERVRLPRHIPADGVVRPYSQREALGQSWLKQVDNGKYFNEAY
                     IAHLELPTEDMVVMVTYGRILLIRSRRLQTEWDVPLKDVQTIAKERTGLSLTLRGGTN
                     GPFIPIGQESGRTFIYRMVGVAVEEYNRRFKGLE"
     gene            253297..256125
                     /locus_tag="MYCTH_2315429"
                     /db_xref="GeneID:11510010"
     mRNA            join(253297..253865,254062..254195,254332..254373,
                     254490..254587,254655..254667,254740..255172,
                     255268..255352,255490..256125)
                     /locus_tag="MYCTH_2315429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663672.1"
                     /db_xref="GeneID:11510010"
     CDS             join(253596..253865,254062..254195,254332..254373,
                     254490..254587,254655..254667,254740..255172,
                     255268..255352,255490..255638)
                     /locus_tag="MYCTH_2315429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663720.1"
                     /db_xref="GeneID:11510010"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2315429"
                     /translation="MSSPAKNESNSPAPAEEKPAETKPAETKQAEEKPAEEKPAETKK
                     AESTPAAAASPAAASPAEASSSAQAQTSAESGAQGGILPGQHWTQQPINDADSSYDSD
                     IASSTNSLTSSILAYRTISGRTFHSDRTPAEYWGPNDEKQTECMDIQHHAFTLLLDGA
                     LYRAPLEVDKIQKVLDVGTGTGIWAIDFADEHPNVEVIGTDISPIQPGWVPPNVFFEM
                     EDATQAWTFAENSFDFVHMRYLYGSIVDWNQLFREAYRVLKPGGYIETFEADSAIYSD
                     DGTIKEGSPMDQWGKVFEEGGRKFGRTFMPVSENVQRTGLEAAGFVNLVQEDFKVPLT
                     AWPADKKLAEIGAYCHLSIEQDVEGLILYTFQHIMGWSSVEVHAYVAHLRRQMRDKTV
                     HPIGKLRLIYAQKPL"
     gene            <257185..>257457
                     /locus_tag="MYCTH_2064545"
                     /db_xref="GeneID:11510011"
     mRNA            <257185..>257457
                     /locus_tag="MYCTH_2064545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663673.1"
                     /db_xref="GeneID:11510011"
     CDS             257185..257457
                     /locus_tag="MYCTH_2064545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663721.1"
                     /db_xref="GeneID:11510011"
                     /db_xref="JGIDB:Spoth2_2064545"
                     /translation="MGQNLSLSEPFADTSGAVLSPTDRANDIILAAIWGLSLYGIGMI
                     WCAVGLLRRWAGPNNDRGVTMLSVLAAFLMSTGWPVILAYFAFSNQ"
     gene            complement(<258545..>260212)
                     /locus_tag="MYCTH_2045079"
                     /db_xref="GeneID:11510012"
     mRNA            complement(join(<258545..258952,259061..>260212))
                     /locus_tag="MYCTH_2045079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663674.1"
                     /db_xref="GeneID:11510012"
     CDS             complement(join(<258545..258952,259061..>260212))
                     /locus_tag="MYCTH_2045079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663722.1"
                     /db_xref="GeneID:11510012"
                     /db_xref="JGIDB:Spoth2_2045079"
                     /translation="GYVFHDSCWRLLQEASRPAPFSLQRLLDVCRSLPVLPHSHAPSW
                     GHDYGGAAVVDKTYSFPWEEEGRYDARDFSGPDPVFSADPYQVPGVDRLIAEDPQEPP
                     PAFTHIARPSRILLGRDCFASLPAELCAAIAMLLPTADALRARLASWAFFPLFYSQQF
                     WASRFGASGDRSWLFETRDHSPKDWRWLYRHTHKDVHLNHGLRNRRRIWRLLEGVVNI
                     MTLVWNNLPPALPLLWSLDSVLQATDQRIEATGLLWSAEQPGGADYFRYGCRRFRTQR
                     VAIPDTLARLSVSTAAFPDDGYIVGMSLSTLAGDHIRLGYCSPSEHSVELSHLWGFRL
                     AIGSRGLQGLQCITGPAGSGSPWLGYLDEVPQTDRLLVAGRILGLEAGFDGCKMVSLA
                     VYVRSTPLRGALPHQSRFRDAAVWYPTIPPPNLCLNEDSFPQLDSYMVGYNPLFWCHF
                     GGPGGKYLRHLTSISATSSDGLLRIHFSYNKEVPPEHRVLGRLSIVEEHDYVLGFSID
                     GPGGERIEGIKM"
     gene            <261917..>262195
                     /locus_tag="MYCTH_2041611"
                     /db_xref="GeneID:11510013"
     mRNA            <261917..>262195
                     /locus_tag="MYCTH_2041611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663675.1"
                     /db_xref="GeneID:11510013"
     CDS             261917..>262195
                     /locus_tag="MYCTH_2041611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663723.1"
                     /db_xref="GeneID:11510013"
                     /db_xref="JGIDB:Spoth2_2041611"
                     /translation="MSNMLASRKVPLVLAAGIGSGLLYMTYGANQQPRPRQQQGEGGG
                     VGVSETLQAAAGQGGARARQYDPKDTRLHSADPAAQSKRNPDKTRGDDL"
     gene            complement(<262740..>264583)
                     /locus_tag="MYCTH_2127519"
                     /db_xref="GeneID:11510014"
     mRNA            complement(join(<262740..263041,263161..263552,
                     263676..>264583))
                     /locus_tag="MYCTH_2127519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663676.1"
                     /db_xref="GeneID:11510014"
     CDS             complement(join(262740..263041,263161..263552,
                     263676..264583))
                     /locus_tag="MYCTH_2127519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663724.1"
                     /db_xref="GeneID:11510014"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2127519"
                     /translation="MPGGAAPPAGTADVSRVEAPVTVKAYLMCVFAAFGGIFFGYDSG
                     YISGVMGMDYFIRVMEGGGDGVVLAAWKKSLITSILSAGTFFGALMAGDLADWLGRRV
                     TVILGCAVFIVGVALQTASAGLGLIVAGRLVAGFGVGFVSAIIILYMSEIAPRKVRGA
                     VVSGYQFCICLGLLLASAVDYATQDRTDSGSYRIPIGLQMAWSLILAAGLFFLPESPR
                     FFVKKGDLARAASTLARLRDQPVESAYIRDELAEIVANHEYEMTVVPHGSYFQSWAMC
                     FRGSLWESSSYLRRTALGTSMQMMQQWTGINFVFYFGTTFFQQLGVIQNPFLISLITT
                     LVNTCSTPISFYTMERLGRRTLLIWGALGMLVCEFIVAIIGTVRPDDDTCVKVMIAFI
                     CIYIFFFATTWGPGAWVVIGEIFPLPMRAKGVALSTASNWLWNCIIAVITPYMVDTDR
                     GNLGPKVFYIWGALCTCCFVYAYLLIPETKGLTLEQVDQMLAETTPRNSAKWVPHSTF
                     AGGDPKPDEKEVGHVEKLDGYSSSA"
     gene            268860..271811
                     /locus_tag="MYCTH_2305838"
                     /db_xref="GeneID:11510015"
     mRNA            268860..271811
                     /locus_tag="MYCTH_2305838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663677.1"
                     /db_xref="GeneID:11510015"
     CDS             269101..271605
                     /locus_tag="MYCTH_2305838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663725.1"
                     /db_xref="GeneID:11510015"
                     /db_xref="JGIDB:Spoth2_2305838"
                     /translation="MATSALPGSYPDSIPPTPDETMMQQQQKQPSQLDQQRRQSSNLH
                     KPSDPRGHKHTDSGVAIPESGPIRSSHHDDKSHWYGPNEAIGGGTYVRGHHTTLFTGP
                     MKSPIGIELGTTTKPTAARETKNSAVSSKDENRTSTAAMIGTSAVEGGAGKTEPKALQ
                     QQQQQQQQSLEPSRPLSDEPASHLGDADGAVYNTVTGHGSAADDHEEHHHLPPKSAPN
                     SSSPGTAVVEGDVTNYPRGTGVYNTVTGHGSQDDDLRRRSRAIAPGFLPETAVRDDVL
                     HLAEANSRDGGHVDAQAKRETAPQQRAFPLATGPSEGRNDGRASESPSRQGAAAAAAA
                     AAAVADRNQEGVGALTNGKGERSQAVAAGGAAKGNERRSSQPTSPIEKASSHEEGWHK
                     GNNRNRKHGIFGIFHRRKSDAKEVTRRKSAGDQDEPANQDATVVGNPPSRPRKPSRGE
                     STTERRRSRSSAKTEDETSAGGAAAAAAGTAAAGAGAFGLFHRAKRKSTGEETQEKTQ
                     DAANSNRAPMSAGAGGAGPAGGTMHQTEEVPTPFEHPREPPVRPEGVGHGLAAAGAEN
                     QSGATQGTQQKKAGATTTNEPGGNYYNTLASGTPSGLKKQARGTTSRHEEYDGDGGDG
                     GDEDDNRLEYNVLSSGTPSGVKVKPKSRRRSAHADTATATTGTDGGGLPAADNDTNTS
                     CTAAVVGRVGYGSAAAAGAPTIPSTRTQQQQNQHELLPPIPPSSHGPERDGERAAGAR
                     HAPAPGISNASQESLPGVTTYGPRAAEHDMSPEVMPAAYYVASSSSSRSALAPAGATR
                     DRGGRVMHVCRHCGLENDITEYLQRAGRAGDGPVSH"
     gene            <272503..>273717
                     /locus_tag="MYCTH_52839"
                     /db_xref="GeneID:11510016"
     mRNA            join(<272503..272669,272734..273008,273075..273298,
                     273361..>273717)
                     /locus_tag="MYCTH_52839"
                     /product="kinase-like protein"
                     /transcript_id="XM_003663678.1"
                     /db_xref="GeneID:11510016"
     CDS             join(272503..272669,272734..273008,273075..273298,
                     273361..273717)
                     /locus_tag="MYCTH_52839"
                     /codon_start=1
                     /product="kinase-like protein"
                     /protein_id="XP_003663726.1"
                     /db_xref="GeneID:11510016"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_52839"
                     /translation="MYFNRLAHTAYLSRLGSRNSLRMASTILGASGREYIQGEVLQRD
                     PKDNKARIFKAGCGNESFVFKHVSQPFYDLSQHLALEFAGSSRLRVHVDANQDERILV
                     YPYFRNTLLALIKEDPDFPPAERVKVLRVVAEAIQELHSKDWIHNDVKPDNILVDWAC
                     DEDGNKTVTKAALGDFDIALKLEGAKPLYGPHAVGNAMWRSPEAQTGRGVTKASDVFS
                     FGLVCIYALGGGDFLLPHNYEELVERGISPEQEILTRHFAYFGPVTEGLLKQIDSEVW
                     SRALKAASRTGQLAVEDDPLLRFERWGEGLGPAAVDMISGMTRLDPAARMTMEQVLEH
                     PWWTEE"
     gene            275507..277120
                     /locus_tag="MYCTH_2305841"
                     /db_xref="GeneID:11510017"
     mRNA            275507..277120
                     /locus_tag="MYCTH_2305841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663679.1"
                     /db_xref="GeneID:11510017"
     CDS             275681..276754
                     /locus_tag="MYCTH_2305841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663727.1"
                     /db_xref="GeneID:11510017"
                     /db_xref="JGIDB:Spoth2_2305841"
                     /translation="MDGCLPRPDDPNDPKWRWPWWKFRLPPDALFTTLHDRFNTRSCP
                     IQEPYAFLLDVRECADQSAGVDEFYTKLAERRDQRRSELERAWDETKRRMEEFLRDEP
                     ICGFRDCKSRDEDWFDEHSQNDTRADRWINFCRSCSHMSFDRLVSFFDGFVRDKRKDV
                     EERVREFYTCLGSHRRRKLAPDYSNPLVPPRSTRTDTMKKDPAEASDSAENPPHLCPP
                     LSASSSTPPKQTPIQNERAEDGQTQASAIPRSSGKRSRSGLGAEENKEEADAESGHVP
                     PPKRRRRSPPPPRRRPLRHRRLINAHAYTFADASIIAVTYTNTDILSRVQRSSCSSSA
                     HHLGGGESSAEHPPHLASRDWGE"
     gene            complement(281188..283733)
                     /locus_tag="MYCTH_69999"
                     /db_xref="GeneID:11510018"
     mRNA            complement(join(281188..281399,281454..283125,
                     283144..283733))
                     /locus_tag="MYCTH_69999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663680.1"
                     /db_xref="GeneID:11510018"
     CDS             complement(282183..282398)
                     /locus_tag="MYCTH_69999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663728.1"
                     /db_xref="GeneID:11510018"
                     /db_xref="JGIDB:Spoth2_69999"
                     /translation="MPTETTKVTPFFANYRYKVDLRQGLEVIVPRAVVKAEQIYTLYK
                     KLKKELEFVRTRIKSYYNKHRLEKPCL"
     gene            complement(<287255..>287722)
                     /locus_tag="MYCTH_2127524"
                     /db_xref="GeneID:11510019"
     mRNA            complement(join(<287255..287575,287672..>287722))
                     /locus_tag="MYCTH_2127524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663681.1"
                     /db_xref="GeneID:11510019"
     CDS             complement(join(287255..287575,287672..287722))
                     /locus_tag="MYCTH_2127524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663729.1"
                     /db_xref="GeneID:11510019"
                     /db_xref="JGIDB:Spoth2_2127524"
                     /translation="MVQNGGNFDLDTDMATDELENREKYSQKLVNEAYAKIKALEGAK
                     VKRIKIELPGKYGGTKEDLVGFLTNLRSYFRLNDDKFLDEKAKVLYVATRLEGKALRW
                     FELTWNDYLTKEDEDDRDAFM"
     gene            <289615..>289809
                     /locus_tag="MYCTH_2064311"
                     /db_xref="GeneID:11510020"
     mRNA            <289615..>289809
                     /locus_tag="MYCTH_2064311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663682.1"
                     /db_xref="GeneID:11510020"
     CDS             <289615..289809
                     /locus_tag="MYCTH_2064311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663730.1"
                     /db_xref="GeneID:11510020"
                     /db_xref="JGIDB:Spoth2_2064311"
                     /translation="GLPIVIVVNRGSKFKGEVKAILEELGVKCIIISPYNSRANGISK
                     ARYIPITATLVKITIGTRKN"
     gene            <323576..>324436
                     /locus_tag="MYCTH_82995"
                     /db_xref="GeneID:11510021"
     mRNA            join(<323576..323795,323843..324192,324311..>324436)
                     /locus_tag="MYCTH_82995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663683.1"
                     /db_xref="GeneID:11510021"
     CDS             join(323576..323795,323843..324192,324311..324436)
                     /locus_tag="MYCTH_82995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663731.1"
                     /db_xref="GeneID:11510021"
                     /db_xref="JGIDB:Spoth2_82995"
                     /translation="MSRVAKRSTKRSVKTKERIALAAAINELGFEVMPCSHCFSRGLC
                     CRMIESSSRCGECVRRGRSCDGSGVPVLSLSCIVDESKRLDRLEQDAEEALRADRDLL
                     AKAQCRLDESLARLDRIRRQKRSLLSRGSEMVCRGLTSLDELEEVEQQESGAVLGVQL
                     NGGVDVVDWGAVFDSVPVLPLVDPGSAGGTNFFDVPFFLFVLCFDVHGNLGVFRCWFK
                     KRNMKNIRLWAHR"
     gene            complement(<328165..>329305)
                     /locus_tag="MYCTH_95399"
                     /db_xref="GeneID:11510022"
     mRNA            complement(join(<328165..328454,328495..328586,
                     328755..329059,329270..>329305))
                     /locus_tag="MYCTH_95399"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663684.1"
                     /db_xref="GeneID:11510022"
     CDS             complement(join(328165..328454,328495..328586,
                     328755..329059,329270..329305))
                     /locus_tag="MYCTH_95399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663732.1"
                     /db_xref="GeneID:11510022"
                     /db_xref="JGIDB:Spoth2_95399"
                     /translation="MVKANDKKKRAYDVIEVAATSYEDKGSDTDSLGHDGNGEDEQAP
                     YSELVTVDPETGLAEWDTAGEYVPPISILPALSQWGFTVTQRRDGSWTTDTQGIERPG
                     PNALFLQERIECYAEHLDDQQLSNDVRNPEYQFMRANHGKDEPLEYLRSTYSGKDSGK
                     NSNTSQATPRGCTLDTRHMRKCPGSSVWHTNADTTSATNSKTITGRPDKKMRTEAYAL
                     WNGSTMQETERPNCSRRSKPAI"
     gene            <334056..>334223
                     /locus_tag="MYCTH_2065250"
                     /db_xref="GeneID:11510023"
     mRNA            <334056..>334223
                     /locus_tag="MYCTH_2065250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663685.1"
                     /db_xref="GeneID:11510023"
     CDS             <334056..334223
                     /locus_tag="MYCTH_2065250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663733.1"
                     /db_xref="GeneID:11510023"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="JGIDB:Spoth2_2065250"
                     /translation="YLNDILIFSKTIDEHQKYVKAVLDVLYVYKLLVNKEKSKFYVRK
                     TVFLGYKISLG"
     gene            341356..342061
                     /locus_tag="MYCTH_69995"
                     /db_xref="GeneID:11510024"
     mRNA            join(341356..341571,341758..342061)
                     /locus_tag="MYCTH_69995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663686.1"
                     /db_xref="GeneID:11510024"
     CDS             join(341440..341571,341758..341919)
                     /locus_tag="MYCTH_69995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663734.1"
                     /db_xref="GeneID:11510024"
                     /db_xref="JGIDB:Spoth2_69995"
                     /translation="MPCSWYMSQGLVCKMIVYTKRYKAYVRRDRSYDSSSILLSSYKL
                     LWRLRQQKEFLIEKGTNMVAYSLSTLDELEEVERQETPAMPSLQINDAVDAID"
     gene            complement(<351333..>352928)
                     /locus_tag="MYCTH_95398"
                     /db_xref="GeneID:11510025"
     mRNA            complement(join(<351333..351383,351462..351482,
                     351674..351687,351733..351822,351900..351932,
                     352370..352378,352437..352464,352545..352581,
                     352812..352875,352907..>352928))
                     /locus_tag="MYCTH_95398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663687.1"
                     /db_xref="GeneID:11510025"
     CDS             complement(join(351333..351383,351462..351482,
                     351674..351687,351733..351822,351900..351932,
                     352370..352378,352437..352464,352545..352581,
                     352812..352875,352907..352928))
                     /locus_tag="MYCTH_95398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663735.1"
                     /db_xref="GeneID:11510025"
                     /db_xref="JGIDB:Spoth2_95398"
                     /translation="MNRSQLLRRPAVRLVIKRGSTITKAFLSRHGPSSYYGLAIGLYS
                     GCLFGSKWIVLLGPLDKLPPVNLIIIIWSAYKVISALKLDIANSKDLFIFTITFKPKF
                     NTSIYLLLPYPELINEGYIT"
     gene            complement(353947..354539)
                     /locus_tag="MYCTH_2305843"
                     /db_xref="GeneID:11510026"
     mRNA            complement(353947..354539)
                     /locus_tag="MYCTH_2305843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663688.1"
                     /db_xref="GeneID:11510026"
     CDS             complement(354089..354436)
                     /locus_tag="MYCTH_2305843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663736.1"
                     /db_xref="GeneID:11510026"
                     /db_xref="JGIDB:Spoth2_2305843"
                     /translation="MRKDWARRMSELLAPSGVLVCLEFPLYKDLSLPGPPWGLREGIY
                     WNVLAAGGDGMIQDEAAARNATHENSGRGAFKRLAYIKPERTYEVGKGTDMLSIWGLK
                     ERACCTSSPHFDA"
     gene            complement(355076..357606)
                     /locus_tag="MYCTH_2305846"
                     /db_xref="GeneID:11510027"
     mRNA            complement(join(355076..357160,357233..357401,
                     357471..357606))
                     /locus_tag="MYCTH_2305846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663689.1"
                     /db_xref="GeneID:11510027"
     CDS             complement(join(355982..357160,357233..357401,
                     357471..357508))
                     /locus_tag="MYCTH_2305846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663737.1"
                     /db_xref="GeneID:11510027"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2305846"
                     /translation="MAQLLTPRQAEELHRALIAYLTSNNLTSTAAALRAELGLGEDVF
                     DAATAKKYEGLLEKKWTSVVRLQKKIMDLEARNAALQSELDNSTPTSRQNKDPVNWLP
                     KSPARHTLQSHRSPITCVAFHPVFSSLASGSEDQTIKIWDWELGELERTIKGHTKAVL
                     DVDFGGPRGNTLLASCSSDLTIKLWDPSDDYKNIRTLPGHDHSVSAVRFIPSGVAGGA
                     GNLLVSASRDKTLRIWDVSTGYCVKTLRGHAEWVRDVCPSIDGRFILSTSDDYTSRLW
                     DVSIANPEPKTTLIGHEHVVLCCAIAPAASYPHLAAIAGVKKPPATSAVEFMATGSRD
                     KTIRLWDARGTCIKILVGHDNWVRGLVFHPGGKYLLSVSDDYTLRCWDLTQEGRCVKT
                     ISDAHGHFVQCIRWAPSVVKDVPVVNGGDGQGAETNGTPKKSSGAVEAQQIRCVIATG
                     SVDLNVRIFAN"
     gene            358641..362008
                     /locus_tag="MYCTH_2305849"
                     /db_xref="GeneID:11510028"
     mRNA            join(358641..358694,358870..359042,359111..361795,
                     361852..362008)
                     /locus_tag="MYCTH_2305849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663690.1"
                     /db_xref="GeneID:11510028"
     CDS             join(358986..359042,359111..361795,361852..361878)
                     /locus_tag="MYCTH_2305849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663738.1"
                     /db_xref="GeneID:11510028"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Spoth2_2305849"
                     /translation="MAEEEDYSSLPLTDRWVHKVWKVRKQAYEEAAQQFEKTPDEYDP
                     AFHPFTQDPSLWKSAAADSNVAAQQEGLAALCAFLKFASSDAGLRARHHAVTPIAEKC
                     LTSTRAATKASALEALLLFIEIDVPGPVIEELLPVLSSKQPKVVAAALSALTQIYHNY
                     GCKIADPKPVLKILPKVFGHADKNVRAEATNLAVEFYRWLRDAMKPMFWNDLKPTQQS
                     DLEAQFEKVKAEGAPKQERLLRSQQAEKERAPAGDGGGDYEEDGGEAEEPVEVDAFDL
                     AEPQDVLSKVPKDFFDNLGSSKWKERKEALDALYALVNVPRIKEGDFNEINRALAKCM
                     KDANIAVVTQAAQCIELLAKGLRAGYAKYHSMVMQPIMERLKEKKQSVADALGAALDA
                     VFLTTSLTECLEDITTFLVHKNPQVKEGTMKFLVRCLRTTKEVPSKQEIAAMVESAKK
                     LLAESSEGLRSGGAEILGTIMKIIGERAMNPHLEGLDDIRKTKVKEFYETAEVKAKDK
                     PKPPPPAARPPPGGPKKATGGVGVKKGPAGVKKPAPAPAAAPPADPTPAPAPRPGPGS
                     KLGMPKPAGLGGLKAPQKRTLSGPAPAPASPKRPAPAQSPPPAEDEEEPPMSPPPAKP
                     APRIGLGRGGLAGRSLAKPAAPAAPAAPPSPTPASGLTAIERAELEELRDANERLLKA
                     LEDARHDRSKLLSEIQELKNQNASLIEDHTRDVLSIKAKETQLVRARSDAEAAEQTNE
                     RLRRELERLKRALSKAEALNAAAGSGSPGSPGSLGFRAMSPTHDDFYRDASNASRNRM
                     SMASTLSEEKENGDGMPHPCTKLSPELRYGGRNASSGRGSPARGFRREVSVEEKEPRS
                     VDMGYGGYNDRAGSRASSRTGGRDTPSSMNTSATSGMESWKRAAEVTSQLKARIEQMR
                     ARQASRPQ"
     gene            362519..362604
                     /locus_tag="MYCTH_t101"
                     /db_xref="GeneID:11510029"
     tRNA            362519..362604
                     /locus_tag="MYCTH_t101"
                     /product="tRNA-Gly"
                     /note="Anticodon: CCC"
                     /anticodon=(pos:362552..362554,aa:Gly,seq:ccc)
                     /db_xref="GeneID:11510029"
     gene            <365223..>373869
                     /locus_tag="MYCTH_102985"
                     /db_xref="GeneID:11506414"
     mRNA            join(<365223..368147,368203..369350,369408..>373869)
                     /locus_tag="MYCTH_102985"
                     /product="non-ribosomal peptide synthetase"
                     /transcript_id="XM_003663691.1"
                     /db_xref="GeneID:11506414"
     CDS             join(365223..368147,368203..369350,369408..373869)
                     /locus_tag="MYCTH_102985"
                     /codon_start=1
                     /product="non-ribosomal peptide synthetase"
                     /protein_id="XP_003663739.1"
                     /db_xref="GeneID:11506414"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="JGIDB:Spoth2_102985"
                     /translation="MAAGPRPAPPIDASTSWLLLEEETTEARLLVLVSKVLGISTDKV
                     LPHESFRDLGGNEQLAVALRKACMAAGMDVKVKDILRCSTLAELQTCITPCAPQNRPS
                     ATDAVEPVMIAPLEIHRASRMSIMPEPKDGQLPKPGRANRTDIERALGTEAEVGRIVT
                     IRPKAGPLDGKLVALLTLSSAQTTPRNPAAINLIPQSHALFAGTQVAHLKRAAETLLA
                     PEAIPDVWIVLDGMPLTEAGDIDLRRLRTWAQNMNENVYHQALSLEHQECLQSPETEM
                     EKSIQRLVSKVLDIPQGQIGVNFSFTQLGGDEMTAMELAARCKHESIYINTSEALGSM
                     TLAELAAIAASRGGLAHKWDEETTGCFDLSPMQHLYFDTAMGGDLKRRPVLDGSYRFN
                     QSLLLRLKKLFSFSDISAAVEAVVAHHPMLRSRFGRGLNGWVQRILPEVAGSYTLSHS
                     AVQSERELENIIERTQMSINVETGPVFAVDYLTTNDGQQLVYLVAHHLAVDLPSWRTI
                     IHDLDELLEHGSLLSQRSMPFNKWVDLQKAEALGPDPGSLLPFALQPGDYAYWGLQDT
                     PNTYGDAAEIGFSLSNELTTILQSSCNQVFKTDSVDIYLAALVLSFAQTFHDRPVPVV
                     WNQEHGRDPMNPDMDISETVGWFTSLCPVSIKAEPADDFINVLRHLKDTRRSIPARGA
                     QYFASRFYHYDREDLVAKDWPFEIIFSYAGTLQHLERDNGVLEQLTIPGSTLASPTSD
                     IGPNVGRIALFEISAMVDQGSAKVKFLYNRFSKDQARIKQWVQNYEHVLLEAIGRLRY
                     HPQELTQADVPHLDVTYEGLDKFNKDRVATLQLASVRDVETIYPVTAVQQSILISQAQ
                     RPDTCYLHAVYEFASPNGDPIDISRICTAWTQVTMRHAALRTVFTESVTETGLWDMVI
                     LRRTSPEMLFIDTAPAEDPVYELSNLPNLRPTPSKPLHRLTVCKAPTRTLVKLDISTA
                     LCDSLSIHLLLHDLRRAYATERAIIEPDQFSYPHYLYFLKMVRQESSLAFWREKLKGV
                     PPCLFPRLTVLPGELGFVNTGVELDITSYQLSGFARTHKSTVDAILRLAWALVLRCFT
                     GSNLVCFGFQTLGRDDSILGMRHAVGSFSNTVACNYELATYSTIAAALHMVEEHLVTC
                     LPHQHFTLAELQHAMGMKGGERLFNSCLTFTEEPAGLNSKFTTRTSFELKPISLQQTF
                     DVDVVVNTRFTAGKLIVDIGQRVMSPEQSVNVANTFGKAIRAILSSPNTAIGLVDLFS
                     DRDYAQILAWEAESPPQFKEPVQSVVHDLISRQAKMQPSSQAICSWDGSFTYLELEEE
                     ATRLAHHLVDVGVGPHSVVPVVMDKCKLAPVAMIAVLKSGAAFVPVDSLELGMIQPIF
                     ERLNSRVAISSERAAPVLGNLFDRVVILIDELMNVLPRGQGPLTSMATPGDPACIFFV
                     PASSTEAKGITFSHAALSTALEGQGHAARISPLSRVMQLSSFNVDICITEIFTTLSHG
                     GCVCIPSAVERLQDFSAAVNRMQVNWSYMTPLLSRKVDPMLLPSLQVVCFRTRGLDED
                     TYNIWHGKVNVILAYGPQEVCPLGIAFVEALGPHHFKSIGWPFAGNLLIVNPEDHKKR
                     VPVGAVGELVVEGPTIGVPYPNRESTMTPLSPLGPAAEGKARYFKTGHRVRYTERGLM
                     EFISGSRDDDGKDGRVVNLTEIEQYLRRCLGQGIDVVVENVIFRGKAKNDTVLTAFIE
                     LGDRLGNEETLSSLSPTTKEQLALAKQLVELGLKNRFPQSMIPSAFVPVKHLPITPSL
                     KVNRRRLLKMIAGLTKEDLVGLAKVPNTANFQHLKPLPLTQSEEKMRAIWARVLGVEE
                     AKISTFDSFFTLGGDDIVAAQLVAVCRQQGISVSIADILRNVTLAELSQAVTTVDSPH
                     APQEQGTSPAPPATTPSPIPLPPNAIKEVFIEKVIAPGVGVDASVIADAAEASSAQIR
                     YIETGMLGGRTNINYLVFNFTGTVDSKKLEDACKTLVSIHPILRTAFVPHNRRVYQAV
                     IRSNSIEFTRQHCQTRRLANMLDKEIKKDQSTPIRFENPVTKFIFLDGGKQSILILRL
                     SKAQYDDLSVALLVKDLKRLYDGSQKPPRRPTYCDFVRTTQAANSLGAEEYWRALLEG
                     SAVTQVVAHPQPYPMSTNVQTISNPAISLGSLSSLGISFETVLKGAWAMVLANLSASS
                     DVVFGELVDGRHIRLPDGHSVAGVMGPTVNATPVRVQFPDTPLTPLNLLQYIHAQRVS
                     GIPFENLGTLTIVEKCTPWPYWTRFSTLVQHQYQDTAINPSEPKSFHLGSASCKFTIH
                     ESNAQDVPDMFVRSLVRPPDRVEISITFCADRIPEKFAEHALRMLCSTVSLLTSVSIM
                     QPVIPCGYQYRNMIKRIPLPPKAAHAEDVELAESVMNSLSNEQVEAVQTIIQDTWTSI
                     LNPRALGVPESQIHNAAFFDLWGSLIPAAQITEQLNTELPKLQHPGADASLQVTMEEI
                     VENPTMLKQFELIATKLKALSAKESQKGKETERGAWTAKPPSHQSHKRKPSGSISIPT
                     PSFSSRIRRFASTVARTASPPTNNSNHNTAAVIRHPAQSQPPPTPTSPVAIGLASAMV
                     ADLSPLSPKIIGSVSPNNSSGTGTPRTTPSTSNSSPGLQVPSVAPQLPSLPAFEPIAE
                     ETESLDGMHGDISSAAPPAAASQPVFRQSNPPTQHGIGIVFGEPDSMTEGSTASSANA
                     STDATLATTLVGNGGGVANAGGTMAGAPPVRSEIKNGEMEWDGQKDGDRDTLGPLPGA
                     INAAYLAKAPGNMRAALPNTPLMRGAAGGGSIGTPSSVGEEGLEDLVSPLSAVTLTPA
                     SAGGAGRYHAQQQQQQ"
     gene            complement(<374252..>374596)
                     /locus_tag="MYCTH_2065457"
                     /db_xref="GeneID:11510030"
     mRNA            complement(<374252..>374596)
                     /locus_tag="MYCTH_2065457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663692.1"
                     /db_xref="GeneID:11510030"
     CDS             complement(374252..374596)
                     /locus_tag="MYCTH_2065457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663740.1"
                     /db_xref="GeneID:11510030"
                     /db_xref="JGIDB:Spoth2_2065457"
                     /translation="MCSFILQRSICKDCRTPLEVDRVDHLSCGKPPKRCPGTKKRGVS
                     VRHVDAAECSKCVLEVMEAEELARQEEEEEEEEEEEEEEEGDLLGSGSPPLRPMKLGD
                     WMIDISELAQDV"
     gene            complement(<375387..>377832)
                     /gene="lcc1"
                     /locus_tag="MYCTH_51627"
                     /db_xref="GeneID:11510031"
     mRNA            complement(join(<375387..375800,375894..375962,
                     376110..377082,377155..377224,377423..377501,
                     377587..>377832))
                     /gene="lcc1"
                     /locus_tag="MYCTH_51627"
                     /product="extracellular laccase, lcc1"
                     /transcript_id="XM_003663693.1"
                     /db_xref="GeneID:11510031"
     CDS             complement(join(375387..375800,375894..375962,
                     376110..377082,377155..377224,377423..377501,
                     377587..377832))
                     /gene="lcc1"
                     /locus_tag="MYCTH_51627"
                     /note="Matches the lcc1 gene product encoding an
                     extracellular laccase of Myceliophthora thermophila
                     (Berka, R.M. et al. 1997. Appl. Environ. Microbiol. 63:
                     3151 3157). Laccasesare multicopper enzymes that catalyze
                     the oxidation of a variety of phenolic compounds, with
                     concomitant reduction of O2 to H2O"
                     /codon_start=1
                     /product="extracellular laccase, lcc1"
                     /protein_id="XP_003663741.1"
                     /db_xref="GeneID:11510031"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="JGIDB:Spoth2_51627"
                     /translation="MKSFISAATLLVGILTPSVAAAPPSTPEQRDLLVPITEREEAAV
                     KARQQSCNTPSNRACWTDGYDINTDYEVDSPDTGVVRPYTLTLTEVDNWTGPDGVVKE
                     KVMLVNRPTIFADWGDTIQVTVINNLETNGTSIHWHGLHQKGTNLHDGANGITECPIP
                     PKGGRKVYRFKAQQYGTSWYHSHFSAQYGNGVVGAIQINGPASLPYDTDLGVFPISDY
                     YYSSADELVELTKNSGAPFSDNVLFNGTAKHPETGEGEYANVTLTPGRRHRLRLINTS
                     VENHFQVSLVNHTMTIIAADMVPVNAMTVDSLFLGVGQRYDVVIEASRTPGNYWFNVT
                     FGGGLLCGGSRNPYPAAIFHYAGAPGGPPTDEGKAPVDHNCLDLPNLKPVVARDVPLS
                     GFAKRPDNTLDVTLDTTGTPLFVWKVNGSAINIDWGRPVVDYVLTQNTSFPPGYNIVE
                     VNGADQWSYWLIENDPGAPFTLPHPMHLHGHDFYVLGRSPDESPASNERHVFDPARDA
                     GLLSGANPVRRDVTMLPAFGWVVLAFRADNPGAWLFHCHIAWHVSGGLGVVYLERADD
                     LRGAVSDADADDLDRLCADWRHYWPTNPYPKSDSGLKHRWVEEGEWLVKA"
     gene            complement(<378623..>380708)
                     /locus_tag="MYCTH_95391"
                     /db_xref="GeneID:11510032"
     mRNA            complement(join(<378623..378773,379007..379076,
                     379567..379684,379976..380038,380110..380241,
                     380279..380474,380563..>380708))
                     /locus_tag="MYCTH_95391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663694.1"
                     /db_xref="GeneID:11510032"
     CDS             complement(join(378623..378773,379007..379076,
                     379567..379684,379976..380038,380110..380241,
                     380279..380474,380563..>380708))
                     /locus_tag="MYCTH_95391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663742.1"
                     /db_xref="GeneID:11510032"
                     /db_xref="JGIDB:Spoth2_95391"
                     /translation="RCRLPNASALSSVAVPALDNSLIEYTGAVSHRRAPSHQRRALER
                     LDMAKLDTKRGPGVPSQTCFPGHVAVVSTTLMLLLPRSHWSDYSKPRGRYDLALGAHG
                     TSPIGTANPSFLGYATQPQPSRSRPGVVVPEAGAELCPTQVCRTVRDYRRTRPNPTIP
                     GCLDTGSLVHLLRVLHEPTSTTEKVPLSERMVPYRDIFPGKQYHGNVPTLSWCLPDSV
                     GTCFSVPAKEGLADYGNIGRPRSVVALLTEGGQRATISSIATSWVGSVTNKPSTIAHT
                     SPAAASKTIDSGYGS"
     gene            384299..386874
                     /locus_tag="MYCTH_2134461"
                     /db_xref="GeneID:11510033"
     mRNA            join(384299..384961,385031..386874)
                     /locus_tag="MYCTH_2134461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663695.1"
                     /db_xref="GeneID:11510033"
     CDS             join(384538..384961,385031..386469)
                     /locus_tag="MYCTH_2134461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663743.1"
                     /db_xref="GeneID:11510033"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="JGIDB:Spoth2_2134461"
                     /translation="MSSNEKKSAEQQYFPPPPPGPPPVQTTQTSPPKHPDETPLPDYP
                     VPEFAPPPAAAEEDIYNASPVDEHPPKWGHGHGHHGEEGEGEAKKKSNRLSAFGHAIT
                     SKVAGPVNALANKFGSEGFMPESLDKECEKAARILRSFCKEGIYTDDAVPPAATTPAE
                     TAGTQQTSSKPPASPSSKAKKSHALLTIPSKVIARAQGLAIFTAVRLGFQATGSSGSG
                     ILIARLDDGSWSPPSGIQITSIGAGFVAGVDIYDCVLVINTREALDMFIKIRVSLGSD
                     LAVTAGPFGAGGALDWGLPAGGDRQRGKEAKGSANPSSGAATLAPSPLSADNTQFQTP
                     PVTEDLDEDDYDDGGKGKHPARRPSPFRDALKKPVYSYIKSRGFYAGVQIDGTIIAPR
                     DRANAEVYGKGVSVGRILRGEVPARSLANLAQQQHGGALSTWPGGAKVLYDVLRGAEQ
                     GWKGHGQQQQQQQQQQQEAAGQQAPPYSAHSGTVSPGYGGPSPAFGAPPGTGGAPTSA
                     WVPPPPPPGPPPAAASGSTAAQGVYGVTAGMKDLGIGSSSGAAPPPAVGTSSAAAAKA
                     AEAAAEAARAQQEEEAYPPPPSYSDPPAEDDLPPAYEEDERYKHFAGDSKTGLH"
     gene            complement(386945..389004)
                     /locus_tag="MYCTH_2305857"
                     /db_xref="GeneID:11510034"
     mRNA            complement(386945..389004)
                     /locus_tag="MYCTH_2305857"
                     /product="glycosyltransferase family 31 protein"
                     /transcript_id="XM_003663696.1"
                     /db_xref="GeneID:11510034"
     CDS             complement(387173..388882)
                     /locus_tag="MYCTH_2305857"
                     /note="CAZy_ID 268041"
                     /codon_start=1
                     /product="glycosyltransferase family 31 protein"
                     /protein_id="XP_003663744.1"
                     /db_xref="GeneID:11510034"
                     /db_xref="JGIDB:Spoth2_2305857"
                     /translation="MMGLGVAKHRNRCFSMRNTFTRAVVLTIAMLAVGGVVLRSDVDV
                     QSAIAKTAASAREAMSLQKPLGHPESAGWGGPVDHPPKQEEQDEKNVTAEDSKPTPSS
                     SSRVMTCDYDMDRLRRWQQQFGLQETFEYTKRYIQASRQDIPRRSITRLQQDFLVDAV
                     KVVDVNKEYEAETCPEPLLAPVTKSPYPATANGSDFMFGVSTTYQRFTDPRTSPINEW
                     SYWLTDGKGNSNGGKLVLLLVDAQPEELEDAYNKLSSVGIDVDVYRSSSSLIMAVRYL
                     ALAPTLYNHPERPRRKWLVVCDDDTFFPSFHALADRFAQYDHERPMYIGTFSEDVNNI
                     ERHGPQAFGGAGVFLSRPMAKIIAENFENCSSEQKIQESNTGWGPQGDIMLRNCIYQN
                     SEVKLTLLNDLWQLDIMGDPSGFYESGIKPLSLHHYRGGIWHLARPFQYTKVAHACGE
                     DCTFQRFQTADGFIISNGYSVAYYPRGIDFDLNQFERTFRAAPEDKGWNLDFRMGPQR
                     PSLHNTGRKIAWELLEATVNPDGSVSQVYVGKHNDSRWTNPDGTPMNNRDGIIEIVWL
                     PEA"
     gene            complement(<391204..394083)
                     /locus_tag="MYCTH_2305858"
                     /db_xref="GeneID:11510035"
     mRNA            complement(<391204..394083)
                     /locus_tag="MYCTH_2305858"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663697.1"
                     /db_xref="GeneID:11510035"
     CDS             complement(<391335..393366)
                     /locus_tag="MYCTH_2305858"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663745.1"
                     /db_xref="GeneID:11510035"
                     /db_xref="JGIDB:Spoth2_2305858"
                     /translation="MDEDYIPTGPGPMPKVPKLLKGSKKRPKKRHPPPVATDAAPGLF
                     TLLDPAFANSSYHISPGSETGPAQPPPPPPPPAPDHTPEADPRIWDLGIDPPPLYYSI
                     HRAPARPGNVYCEACFRDEVARWVRVRDGVVRILHLLGGGAALRELRRLSSEAEQAEQ
                     HATEAYLEKRSASRARLRSPPPAASGCLHRHGPGSEGQGGEHGGDGNACAAAGGSVTA
                     KKMIIMAHSGRSWEAPHFSEYMSEVVGIVLLRILAERPTAGLAETQKGEVHKLLEGLR
                     QEVGIEPRFFDAMTTACRGMLVQWRMAVTIPPDESHPSGVDAESRWWWEFDNALQDAS
                     DKVQLSTHMPSLFASTLATKARDAAIATLTGREAATAQNQITVLENDLQPRPSLAQME
                     RILGMSTPRSLFLRSISDKLAAAKRRLEQQQRSAPSQAAAAAPDTGSGSGLPSDDALL
                     PPAKRRKLSNGHAPPRDPEEPAPLACIYCSESDASRRYTARRASSYYDGDAAGQARPW
                     TKTLRWAFPGLSPGAAARVRRAEDWFRLVASSRPVEVVDIFGWGHHRGGEGSGPRWEE
                     QGLLQHHEVENKKGEEDGEEEEGVIEFMMDVTGARTRVVLVRMKGVFEILLGGRDGSS
                     GGLAGGGGGGRGSRVRFAPPPVLVCDTGVVVEACRTVGRWEDWRAGELKGFRL"
     gene            395323..396475
                     /locus_tag="MYCTH_2305861"
                     /db_xref="GeneID:11510036"
     mRNA            join(395323..395699,395783..396475)
                     /locus_tag="MYCTH_2305861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663698.1"
                     /db_xref="GeneID:11510036"
     CDS             join(395341..395699,395783..396266)
                     /locus_tag="MYCTH_2305861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663746.1"
                     /db_xref="GeneID:11510036"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="JGIDB:Spoth2_2305861"
                     /translation="MSHSSEETPLLSPELSSPERPPPSTSSRVRPKVVNRMTSSAPQP
                     ERPHVEAHMGQYDSIMRDVIIGFSDGLTVPFALTAGLSSLGDSRIVIMGGLAELCSGM
                     ISMGLGAYLAADTERQHWEAELERESAEVDACPAVERTEIYDILARYGVGREAAAPLV
                     AELTASKDRWVRFMMDFELRLPEPDVGRAWASAATMGLSYFVGGLIPMLPYFFLSRTD
                     RALLVSVAITVVILLIFGFLKNWLAIRTRKAGLWGSVQTLIVGALAAGTSYAIVRALD
                     HGNV"
     gene            complement(396598..399747)
                     /locus_tag="MYCTH_2305865"
                     /db_xref="GeneID:11510037"
     mRNA            complement(join(396598..397080,397137..398388,
                     398461..399169,399252..399492,399561..399747))
                     /locus_tag="MYCTH_2305865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663699.1"
                     /db_xref="GeneID:11510037"
     CDS             complement(join(396684..397080,397137..398388,
                     398461..399169,399252..399492,399561..399568))
                     /locus_tag="MYCTH_2305865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663747.1"
                     /db_xref="GeneID:11510037"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="JGIDB:Spoth2_2305865"
                     /translation="MTASNILSIPFRKSTQISLAPSIRQYISKKYDQHPDMFRHDLET
                     IDALRRDAVNSRDAHPSGIKRLQTYAGQLVWMSGKFPIDIGVDFTWYPALGYHTEHPL
                     VQNNLKYELMNILFNLAALYSQLAVASNRSNTEGLKTAASYFSQAAGVLNHMKTEILP
                     ELRMPNPPDDMDEATLESLIQLFLAQSQECFWQKAVMDGYKDASIAKLAARVSDLYNL
                     AGDAAMRSEAISSAWIHHMSAKHHHFAAAAQYRAACDCLEKKRYGEEVARLADAIACV
                     NEGLRECKGGYINKAVVEDLQGLKKRLENDLKRAEKDNDVIYLQVVPPKPELKILERA
                     NMAVARVPPQVAKPYEYLGDHAEFGPALFTKLVPFSVHVAVSIYDERRDRLVNNNIVA
                     ELESMTDKLHEILSSLNLPGSLQALEKPLGLPGTLVQHADEIRQADAINRLQRGLTDI
                     EKLCASDKMIFEEGKALLAAEEEEDKKLRLKHGTQRWTRPESRLDPSRDGGARLWNQA
                     AEIDGYFASSTSSDAVVREKFAAVKDTLAILAGPDRGIMDYIPNSRKTEIPEALKPAI
                     GRLRGVYNDILRLESRRRKRVESLRARSRADDIKTDILEEAARLERTYPNTPIVPAHF
                     EDFFDKRLDRLYEPELEVVEKERADQEKLVADLQRANREFEAQKRSIGEKGNHEREKA
                     LQRLDSAYYKYKEIVSNVEVGRKFYNDLSRIVEAFRNQARHWVNERRKEARALEDEIS
                     MPPLASLSLGPPQSPQANSYQSPNPASYYTQTQPPEPRQNSAHAHQSPPPVEAQIQSW
                     ADNVQQQQPRPKPPVAPVAAMQGAWTPEMGIRFSGPPAAGVNSAPAAGRQGSGNPPVR
                     GTWDPNSGIRFG"
     gene            402776..404425
                     /locus_tag="MYCTH_2305868"
                     /db_xref="GeneID:11510038"
     mRNA            join(402776..403513,403644..403725,403893..404425)
                     /locus_tag="MYCTH_2305868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663700.1"
                     /db_xref="GeneID:11510038"
     CDS             join(402826..403513,403644..403725,403893..404301)
                     /locus_tag="MYCTH_2305868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663748.1"
                     /db_xref="GeneID:11510038"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2305868"
                     /translation="MAEAYKQHFYGHVERETRRYLGLLLLDPARFLDYTREYCGRVMS
                     RLAWDDATQGRANGESADTTLHCMSVSGPITNTATPLWHLPAFANPWYRFEIRREREQ
                     RAWWLSNFRLAKDRMRRGDLPGDTWAYRYFEQVGREGNGDLDQTEDQEVFASCMIGFL
                     NLVGVITISGPLKFFLMAMALHPDCQIKAQAEIDRVCGDRMPTMQDFADLPTVRACMK
                     ETVRWRSSVPLGVPHQAERDDEYRGVKIKKGTVVLACEWALNRVPSRYPDGDSFRPER
                     WLEPGWPTYQEPLTRYPNFREGQAMHTFGWGRRTCLGQHLVDDETFVFAAAVLWAFDL
                     RPKACPRTGEPVPIDSQATNSHVILEPRPYQLSIRVRSAERGKRVLEGYREVMGELRL
                     "
     gene            432755..434314
                     /locus_tag="MYCTH_2305870"
                     /db_xref="GeneID:11510039"
     mRNA            join(432755..433015,433176..434314)
                     /locus_tag="MYCTH_2305870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663701.1"
                     /db_xref="GeneID:11510039"
     CDS             join(432878..433015,433176..434072)
                     /locus_tag="MYCTH_2305870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663749.1"
                     /db_xref="GeneID:11510039"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2305870"
                     /translation="MQLPLETEALVVHAPGADFAMTPIVIQDLRPDELLVEIKYSGIC
                     HTDIWLQSGAAGPLVEFPAIPGHEGAGIIRAIGSEVKDKTLRVGDRVLLSFTACGECT
                     PCREEQFSRCADFARLNLTGLRRPDGTTPAALRDDGRPVRSQFFGQSSFSRFSAVHEH
                     CVVRYPFPKEEEEEEEEEDTLAIYAPMGCGYQTGAGTILNIMRPRPDQTVAVFGAGSV
                     GFAAIMAAAAVSVKQVIAVDLVERKLELAKEMGATDAINTAALQKGTVVDEIRRLTGG
                     RGVDFAIDTTGVPSVVEKMLDCLAYGGTAASIGATPMEARISVDVGAFFANKKTWIGV
                     AEGDSHPPKV"
     gene            complement(<434557..>436178)
                     /locus_tag="MYCTH_102977"
                     /db_xref="GeneID:11510040"
     mRNA            complement(join(<434557..435551,435644..435861,
                     435946..>436178))
                     /locus_tag="MYCTH_102977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663702.1"
                     /db_xref="GeneID:11510040"
     CDS             complement(join(434557..435551,435644..435861,
                     435946..436178))
                     /locus_tag="MYCTH_102977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663750.1"
                     /db_xref="GeneID:11510040"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_102977"
                     /translation="MLSSGFWKRRSLRVPDNQRTKAAELTLRESLYPLSLVTILFFLW
                     GFSYGLLDTLNKHFQNTLGITKTRSSGLQAAYFGAYPLASLGHAAWILRHYGYRAVFI
                     WGLFLYGLGALLAIPSIMHHSFAGFCVCIFIIGNGLGSLETAANPYITVCGPPKFSEI
                     RINVAQAFNGIGTVVAPVLGSYVFFTFDDQTALRNVQWVYLAIACFVFLLAGVFFLSV
                     IPEITDADMAFQAAETHAGADDRPFHTQYRLFHAAFAQFCYTGAQVAIAGYFINYATE
                     TRPNTDSSLGSKFLAGSQAGFAVGRFGGAAMMQFIKPRKVFALFMTMCIVFSAPAITQ
                     RGNAGLSMLYLVMFFESICFPTIIALGMRGLGRHTKRGSGWIVAGVLGGACVPPLMGA
                     AADARGTGFSMLVPLCFFVAAWTYALAVNFAPPYRSVVDAFSTTDVGLREKQREDVGA
                     EKGGEAGGKGGVTGPEDASEDKPDVVNSEKV"
     gene            complement(439601..440690)
                     /locus_tag="MYCTH_82981"
                     /db_xref="GeneID:11510041"
     mRNA            complement(join(439601..440092,440185..440472,
                     440552..440690))
                     /locus_tag="MYCTH_82981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663703.1"
                     /db_xref="GeneID:11510041"
     CDS             complement(join(439995..440092,440185..440472,
                     440552..440639))
                     /locus_tag="MYCTH_82981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663751.1"
                     /db_xref="GeneID:11510041"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Spoth2_82981"
                     /translation="MFASRRLPGVVARLGMNQPARLMSTRQGQARVPSSIISTISTAR
                     QATGRNGLLLNGGRSTFASTIIRGAMQSRGVVVESTAAALVTAAKVGGAGAATIGLAG
                     AGVGIGNVFAALINGVARNPALRGQLFSYAVLGFALSEATGLFAIMIAFLLLYAY"
     gene            complement(442833..>444957)
                     /locus_tag="MYCTH_69975"
                     /db_xref="GeneID:11510042"
     mRNA            complement(join(442833..443090,443204..443712,
                     443973..444348,444434..>444957))
                     /locus_tag="MYCTH_69975"
                     /product="glycoside hydrolase family 13 protein"
                     /transcript_id="XM_003663704.1"
                     /db_xref="GeneID:11510042"
     CDS             complement(join(443084..443090,443204..443712,
                     443973..444348,444434..444957))
                     /locus_tag="MYCTH_69975"
                     /note="CAZy_ID 267872"
                     /codon_start=1
                     /product="glycoside hydrolase family 13 protein"
                     /protein_id="XP_003663752.1"
                     /db_xref="GeneID:11510042"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="JGIDB:Spoth2_69975"
                     /translation="MPALAALGVTKLWIPPACKAAAGPEGNGYDAYDLWDLGEFEQKG
                     SRRTKWGTKEELVRMAEAARREGVAVLFDAVLNHKMGADRRERAVATRVEDRDRRVEV
                     EAEVEGEEKREIGAWTGFEFPGRKGKYSGMRWSKEHFTGVDYDDLKGEKGVWKFEGKE
                     WAEDVDEELGNYDFLLAADIDHRHPEVRADLFRWIEWLPSQVQLGGLRLDAIKHYSFS
                     FLRDFVAHVRQRVGQGWFIVGEYWREDSEYLAKFIEFMDHQISLFDVQLVSNFSKVSV
                     LEEKGDLREILDDTLALWKPENAVTPIAPFFIPFAYAIILLRANCGLPCVFFADLFGS
                     VRQDAQSDFASFVPPTSGGAILPKMMLARRFWAYGSQYDYFDDPHCVGFTRVGHSSQC
                     GGHGLAVVMTNAWEYASKRMFVGKQHAGEIWTDLLKWCPGRIIIDEDGWGVFPVGHRS
                     VAVWVNTRAVGREVADTFALH"
     gene            complement(446120..447267)
                     /locus_tag="MYCTH_2305878"
                     /db_xref="GeneID:11510043"
     mRNA            complement(join(446120..446466,446520..446606,
                     446666..446818,446885..447267))
                     /locus_tag="MYCTH_2305878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663705.1"
                     /db_xref="GeneID:11510043"
     CDS             complement(join(446336..446466,446520..446606,
                     446666..446818,446885..447158))
                     /locus_tag="MYCTH_2305878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663753.1"
                     /db_xref="GeneID:11510043"
                     /db_xref="JGIDB:Spoth2_2305878"
                     /translation="MFVLAAPRTLVGQRIARARVAPLARLPLLHRQFRAKAIYSAFPA
                     TLHYYSPRRVSSLFDIKEKDSRPDDLPDEGVNVAPDGLVYPGTQDRFTSAQSVSNGAE
                     FRPNTFHMQELTRMFYDQYYLELRDEGKEVEEPQIYTVAKGTQVPGHLMLIHEFEDLF
                     SLQPLRGMPLNDLNRALDEFYEKHAVKESAHDWFENHPLAKAMDGAKEEVWMAK"
     gene            448711..450318
                     /locus_tag="MYCTH_2305882"
                     /db_xref="GeneID:11510044"
     mRNA            join(448711..449050,449233..450318)
                     /locus_tag="MYCTH_2305882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663706.1"
                     /db_xref="GeneID:11510044"
     CDS             join(448811..449050,449233..449622)
                     /locus_tag="MYCTH_2305882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663754.1"
                     /db_xref="GeneID:11510044"
                     /db_xref="JGIDB:Spoth2_2305882"
                     /translation="MRSFSIAAAAATLAGFAVAADNSTSSGNSVELFIDDALGGQGLY
                     AASILNACKDHTVYAIQCTSARNDIVDDTICGDSAPTLTLTEGPSLYSVAYSTATSTL
                     GHKAEVSVGESCNLNIESREAFCVATVSVSLDGTSTVTSTSTSVTGSDFHRYQVPITA
                     GAQKTASATGACTAGGDGDDANAAAGTGANVVRAIGAALAVGLAGVIAL"
     gene            complement(450318..452827)
                     /locus_tag="MYCTH_2305886"
                     /db_xref="GeneID:11510045"
     mRNA            complement(join(450318..451847,451988..452009,
                     452076..452541,452609..452827))
                     /locus_tag="MYCTH_2305886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663707.1"
                     /db_xref="GeneID:11510045"
     CDS             complement(join(450870..451847,451988..452009,
                     452076..452541,452609..452675))
                     /locus_tag="MYCTH_2305886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663755.1"
                     /db_xref="GeneID:11510045"
                     /db_xref="JGIDB:Spoth2_2305886"
                     /translation="MASYRIAAPDEYLAITGMGIKNVKITKAAWVWPFQRCVRFSVQP
                     HDYAMNLQAMTKEKLQFLLPVVFTIGPDVNQRGANTRRFGSSVGAGGEEEPGDDYRSE
                     DQGDALMKYAMLLADSGNTGKDANGHQFVENIIKGIIEGETRVLVSSMTMEEIFTERE
                     VFKRRIFRNIQTELDQFGCKIYNANVKELKDAPNSVYFESLSRKAHEGATNQARIDVA
                     EAQLRGNVGEAKRKGEQEREIAKIHAETAVQKTERDIERASAEAVLATRKTELNRDVE
                     IARIAATRKTEAQDEELKREVQIKRAAAEMERLRATEVVKATIERESQQQAADAKAYQ
                     IEAEARANYEKQKQDAEAAAYKTKQEAEAWSAAAIQKAEADLQRRLKEAEGLAAMADA
                     YARLGQALGGPAGLLQYMMIEKGTYVELAKANAEAIRGLQPKISVWNTGAEPAAADAA
                     HHPPTTSSIATMRNIYQMLPPLMTTINEQTGITLPEWQFGRLAGQMSQLERSENQPNG
                     KK"
     gene            454582..455964
                     /locus_tag="MYCTH_2305890"
                     /db_xref="GeneID:11510046"
     mRNA            454582..455964
                     /locus_tag="MYCTH_2305890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663708.1"
                     /db_xref="GeneID:11510046"
     CDS             454671..455882
                     /locus_tag="MYCTH_2305890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663756.1"
                     /db_xref="GeneID:11510046"
                     /db_xref="JGIDB:Spoth2_2305890"
                     /translation="MGLPTEDLPPPTYTEATTTSLSSSSPSLGRYYGTSSPLSPDATG
                     TTAAATRTITTSGAGGRLVSSPLTHHLRTLPARLRASHLARQTARAALELDLAAVLAA
                     RVEGFLARDDVVLRLGSSSSFSSSSVAELTLVPASAVPRGAGLSGAVERRREGEIVRA
                     ARVDVVRRLRVLRGFADEKGGDDDDDDDDDEDEDDDGGMLDGANRHRRRRRRRRRFSG
                     APDPGGNGGDKKGGGGGGGGGSLRQEIVTEFGDWGRFDSSEGVEGGGGGGESWWFGDE
                     DMARRLAAYLRPEPDLERKRVQASVAENRTAAPSKEEKPSGWARWGLGVGGGRKKAAE
                     RASSGPLPSPVSPVNPASGPGPAAAAVGEDDAITMAVRAEEVTFRWENDFGLWESKTG
                     WGIVVTLTMQP"
     gene            complement(<456601..457653)
                     /locus_tag="MYCTH_2305891"
                     /db_xref="GeneID:11510047"
     mRNA            complement(<456601..457653)
                     /locus_tag="MYCTH_2305891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663709.1"
                     /db_xref="GeneID:11510047"
     CDS             complement(<456676..457052)
                     /locus_tag="MYCTH_2305891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663757.1"
                     /db_xref="GeneID:11510047"
                     /db_xref="JGIDB:Spoth2_2305891"
                     /translation="MASPGANNSGSGPGPAPAPDAHLSPDAMPSPRDAVAHQDAYYSS
                     SFWSHQNVSFPSPSATNGFGAAQRQHSLTDATLPPQAEYNEQHQHLQAGAQYPASASS
                     TTGPPYVCGIEGCTRSYPRHGEL"
     gene            complement(<458655..>460362)
                     /locus_tag="MYCTH_102971"
                     /db_xref="GeneID:11510048"
     mRNA            complement(join(<458655..459134,459271..459814,
                     459893..>460362))
                     /locus_tag="MYCTH_102971"
                     /product="FAD linked oxidase-like protein"
                     /transcript_id="XM_003663710.1"
                     /db_xref="GeneID:11510048"
     CDS             complement(join(458655..459134,459271..459814,
                     459893..460362))
                     /locus_tag="MYCTH_102971"
                     /codon_start=1
                     /product="FAD linked oxidase-like protein"
                     /protein_id="XP_003663758.1"
                     /db_xref="GeneID:11510048"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR012951"
                     /db_xref="JGIDB:Spoth2_102971"
                     /translation="MHLLPLTVSATAVVSAASSPHAKRAAIDECLKNAKVPVTARNST
                     EWKTDASPFNDRLPYTPAAIAKPATVEHIQAAVLCAAEVGVKANPKSGGHSYASFGLG
                     GEDGHLVVELDRMYNVTLDPETHIATVQPGARLGHIATVLYEEGKRAFSHGTCPGVGV
                     GGHSLHGGFGFSSHSHGLAVDWITSADVVLANGSLVTASETENPDLFWALRGAGSNFG
                     IVASFRFKTFAAPPNVTSYEINLPWTNSSNVVKGWGALQEWLLNGGMPEEMNMRVLGN
                     AFQTQLQGLYHGNASALKTAIQPLLALLDANLSSVQEHDWMEGFRHYAYSGEIDITDP
                     GYDQSETFYSKSLVTSALPPDVLERVAEYWIETANKVRRSWYIIIDMYGGPNSAVTRV
                     PPGAGSYAFRDPERHLFLYELYDRSFGPYPDDGFAFLDGWVHAFTGGLDSSDWGMYIN
                     YADPGLDRAEAQEVYYRQNLDRLRRIKQQLDPTELFYYPQAVEPAEV"
     gene            complement(<461306..>461606)
                     /locus_tag="MYCTH_2127554"
                     /db_xref="GeneID:11510049"
     mRNA            complement(join(<461306..461408,461542..>461606))
                     /locus_tag="MYCTH_2127554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663711.1"
                     /db_xref="GeneID:11510049"
     CDS             complement(join(461306..461408,461542..461606))
                     /locus_tag="MYCTH_2127554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663759.1"
                     /db_xref="GeneID:11510049"
                     /db_xref="JGIDB:Spoth2_2127554"
                     /translation="MNPNPLSDREKALENKYIKEKEKEMAKKRAEKKQQSAKDADHGS
                     MGQQQQREEPK"
     gene            <464455..>465875
                     /locus_tag="MYCTH_52332"
                     /db_xref="GeneID:11510050"
     mRNA            join(<464455..465171,465465..>465875)
                     /locus_tag="MYCTH_52332"
                     /product="polysaccharide lyase family 1 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663712.1"
                     /db_xref="GeneID:11510050"
     CDS             join(464455..465171,465465..465875)
                     /locus_tag="MYCTH_52332"
                     /EC_number="4.2.2.2"
                     /note="CAZy_ID 267902"
                     /codon_start=1
                     /product="polysaccharide lyase family 1 protein"
                     /protein_id="XP_003663760.1"
                     /db_xref="GeneID:11510050"
                     /db_xref="InterPro:IPR002022"
                     /db_xref="JGIDB:Spoth2_52332"
                     /translation="MRSSAIWSTAFAALAHTAAAVTGAAEGFAKGVTGGGNATPVYPK
                     TTAELVSYLGDSEPRVIMLDRTFDFTGTEGTATETGCAPWGTGSGCQLALNKNDWCTR
                     EQPNAPKVSITYDKAGILGITVKSNKSLIGVGNKGVIKGKGIRMVSGTSNVIIQNIHI
                     TNLNPQYVWGGDAITLDNTEMIWIDHVTTSLIGRQHVVLGNNPSGRVTISNSKFDGQT
                     SWSATCNTYHYWGLYFTGSNDMITFKNNLITHMSGRSPKVAGNTLLHAVNNYWYDSKG
                     HNFELDAGAMVLVEGSVFQNVEAPLQSGGAGRLFASSGTASACAPYLGRVCQANGFGS
                     SGSLSGSDTSFLQYFQNKNIAGATDYNTAKNVLDTAGFGTI"
     gene            466575..469469
                     /locus_tag="MYCTH_2315436"
                     /db_xref="GeneID:11510051"
     mRNA            466575..469469
                     /locus_tag="MYCTH_2315436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663713.1"
                     /db_xref="GeneID:11510051"
     CDS             466662..468503
                     /locus_tag="MYCTH_2315436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663761.1"
                     /db_xref="GeneID:11510051"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Spoth2_2315436"
                     /translation="MERALRVTRPAGLLAARCSPVLSSTRTSLRLWQQQQQHCSGPTT
                     TPQHTGFIPSFQHGRLSTVRSNHTDAQNSGQENTQAATAAEGQKGGDVKVPEGAQTGD
                     VQAGDRPGGDRSNKTSAKGKATTTKKKKKQPKKPERFTRMKNDAGVVEFNSQKLKFRW
                     WDTPSNPDLVLSPLWLRDSCPCHLCVDPDSGQKNFSTTELRDRPVIESAQVTADRTLE
                     IVWANDPPSGGASHKSVFPAEEVKEWLMDDKWQRGRVVPRDPERILWDKAQYEALLAE
                     GRCRVSYKDWLSDEPAFWDALLDLRQTGLIIITDVPSDEAAVERIANRVGPIQETFYG
                     RTWDVRAKPQAENVAYTDKFLGLHQDLLYYDPVPGLQMLHCLSNSCEGGESLFSHGVR
                     AAYELRLKDPAAYKRLAELSVWFGYRKGDNHYFATRQTIKQGAKGIPSEVRWAPPFQA
                     TFKLASGPSRGRNLYQWKRAANRFQAILEDDHNVVKFKLKEGECVIFDNRTVLHGRRQ
                     FKTGSAGSRWLKGTYVSYQSYLAAATRLAEHLEAGGIQLPLARATWVEQEKVKQSLQE
                     RKRADFEQVFSEKKKKSEPVPEPSPIPAAKSAGAAETTNSEPTQPKQ"
     gene            469953..472449
                     /locus_tag="MYCTH_2305903"
                     /db_xref="GeneID:11510052"
     mRNA            469953..472449
                     /locus_tag="MYCTH_2305903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663714.1"
                     /db_xref="GeneID:11510052"
     CDS             470206..472320
                     /locus_tag="MYCTH_2305903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663762.1"
                     /db_xref="GeneID:11510052"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="JGIDB:Spoth2_2305903"
                     /translation="MTSSRLPAFALFPIAAWRDQLPADEWVSCLNAWVALLGSHLSLS
                     DPEFSTISINDDSLQAFLTSFAREVALGGAATLGSSSAAKRLVKDCFSVVARLLRSPS
                     PPPGLVQWEFLSDLSRVYGKKKVERLLDSVSANSKGHLDSSLSSLKRFLIKNMDAGLN
                     GGDLKGIEERLERVNDLIRVSTSVAEFFVAGSDFVDGLISCYKITNPPLRRALIATTY
                     LCLTGLAEGQKMSALTDQLYSLKAAADTHRAGPLNANDSLVAELVTSTPLLQRLQRKL
                     EESATPFNRTKSVLAELSAFKKPGGGLTKPKRLIKRKIDKGKGIAEYDEAQAQQDLNV
                     HRMSQISQIQDLFPDLGTAFISKLLDEYASSTEEVISHLLDDSLPPHLQSANRSEDLA
                     PQQPSPLKPRRDSFVPRPTPPLSPSNPPIPNNNNDDDDDNDDDDLALLAGRAGGKLHI
                     GKRPGDADALLAQRPTAGSKSAILSALAAFDSDDDERDDTYDAADVGGTVDASASAPP
                     PDGYGYGYDKDKDNDNDNDNDGASALPADAEATLFRAWMANPGAFARDTGARKGSERA
                     RLRAETGMRDEAIEGWAVMLGRDAGMKRRLTARYGEWTGEQAELPSTAWRAGDDREEG
                     GSEGTSGGRGRGVVVVVGGGRGRGRGRGGRGGSRGGGAAASPGPDSDLARRRKEANKG
                     SRANHNRRDQRARKMARAGFAG"
     gene            complement(<472579..>474578)
                     /locus_tag="MYCTH_2065718"
                     /db_xref="GeneID:11510053"
     mRNA            complement(join(<472579..472936,472988..473973,
                     474026..474333,474533..>474578))
                     /locus_tag="MYCTH_2065718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663715.1"
                     /db_xref="GeneID:11510053"
     CDS             complement(join(472579..472936,472988..473973,
                     474026..474333,474533..474578))
                     /locus_tag="MYCTH_2065718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663763.1"
                     /db_xref="GeneID:11510053"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Spoth2_2065718"
                     /translation="MTVCRYYQQGYCRYGNACKLEHPRKGGQQNYNRFGALSGQGNQG
                     MGGRASDTPAYPGLTAEGIERDLRSELPQWILSCYGPGRDAPEQLWGGYPREQSFEEI
                     RLHFMLGAMAGNPQGALSDIQNLYQNAQQQIQHTLNNIPAAIQFIIDAAKTHPNRIDV
                     CKATSGGAAPDGAFGSQRNAFQQSAPSANPFGATSGPTTGGGVFGQPATLGQKPNPFG
                     APAAAPAFGQPTQPAAPAFGQPATLGGSSPFGRPAQTTSAFGQTSVLGAKPNPFGAPS
                     LGQPAQPAAPAFGQSGFGQPGILGQRPNPFGTPAGGGGAFSTAAQPAPQSNPFGQPAQ
                     QPQQAQNAPNPFGQPANNQPANNPFGQPSAASPFGQPATATPSPFGQPPQQQQQQQQQ
                     PAINPFGTSATNAAPANPFGAPATSTALANPFGQPATTSPFSAAGGTTASSAPNPGAN
                     PYGPNVTRQHPDISTYATHNPDKTLRMFKGKPVTYEEPKPGSKPVPMVRNFDGTMVRI
                     WMPNGAPPYTTQTEAEPEKYQDPTVMQQWKAFVETGRFAGGVMPEVPPKREFCMWDF"
     gene            <475732..>477376
                     /locus_tag="MYCTH_102965"
                     /db_xref="GeneID:11510054"
     mRNA            join(<475732..476403,476462..>477376)
                     /locus_tag="MYCTH_102965"
                     /product="cytochrome P450-like protein"
                     /transcript_id="XM_003663716.1"
                     /db_xref="GeneID:11510054"
     CDS             join(475732..476403,476462..477376)
                     /locus_tag="MYCTH_102965"
                     /note="Cytochrome P450-like protein"
                     /codon_start=1
                     /product="cytochrome P450-like protein"
                     /protein_id="XP_003663764.1"
                     /db_xref="GeneID:11510054"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_102965"
                     /translation="MTFSAEHLQLWLGLVAISGFLYTTCLVIYRLFFHPLAKYPGPFL
                     AKLTDAYMLYYAWRGDRHLEFWRMHEKYGKFVRFGPNSLSINSNTALKDIYGFRANVR
                     KAEFYDAFVHPAPNTHNARDKDLHARKRRVLSHAFSDGAIKEVERYILANIRTFCEAI
                     GDYGRVIHEKKGWSSPKNMSDWCNWLAMDILGDLCFGKAFHMLDRPDNRYAVDLVGVA
                     AQRHLLCGTMPIINKLSLDKILFHRIAAGRARYMAYSRQQLAERTALGDETDRRDFFY
                     HLLKARDPETGQGFTTPELWGESNLLIIAGSDTTSTAMAATLFYLVRHPDALAKVTAE
                     IRSQFASLEDIHQGAQLNACVYLRACIDEAMRLSPSVGGLLPREVLKGGMTIDGEHIP
                     AGIIVGTPHYAIHHNPAYYPDPFAYRPERWIVGSEKGDGVDVSDEAQVALAQSAFCPF
                     SIGPRGCIGKGLAYVEMTLTLARVLFLYDLRKAVGVADPGEGKPGAGYGRDRVGEFQL
                     VDTFTSLKDGPMVEFRRREL"
     gene            <477840..>479283
                     /locus_tag="MYCTH_52514"
                     /db_xref="GeneID:11510055"
     mRNA            join(<477840..478442,478618..>479283)
                     /locus_tag="MYCTH_52514"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663717.1"
                     /db_xref="GeneID:11510055"
     CDS             join(477840..478442,478618..479283)
                     /locus_tag="MYCTH_52514"
                     /note="CAZy_ID 267925"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003663765.1"
                     /db_xref="GeneID:11510055"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_52514"
                     /translation="MKPILGVGALLNLGATVKGLVSSRADWPNGPLVTSGRWIHDASG
                     NNVTYAGTNWPGHTDVMIPEGLQYQSIETIVQKVKSLGMNAVRLTFAIQMIDEIYANN
                     GKDITLERAFVQALGQTNGIKVLNQVLANNPQFNTSTTRLQVFDAVAAELNKQQIYIH
                     LDNHISKGMWCCSSTDGNSWWGDTYFSTENWVRGLSYMAEHGKSWPALTSIGLRNEPR
                     EPTSNPALAQSSYNWQSWYRYMRQGADAVHGANPDLLIFLSGLNFDTYLTPVVRGEPL
                     APGTDRFDVADFAAGPAGKLVLELHNYETGATSCDALRANLDRNGFEALLSPDDAVAN
                     VLPVVMTEFGFQMDDRTWRGVYASCLAQYLPERKAGWTIWVLAGSYYVRSGTQDYDEG
                     WGLLNHDWSDWRSPGYVDGALKAMVRETLS"
     gene            complement(<479422..480502)
                     /locus_tag="MYCTH_2305912"
                     /db_xref="GeneID:11510056"
     mRNA            complement(<479422..480502)
                     /locus_tag="MYCTH_2305912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663718.1"
                     /db_xref="GeneID:11510056"
     CDS             complement(<479461..480262)
                     /locus_tag="MYCTH_2305912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663766.1"
                     /db_xref="GeneID:11510056"
                     /db_xref="JGIDB:Spoth2_2305912"
                     /translation="MLCKSQSTTAPATLPALKQSSPKPKRTRLSLLLALWASSLAASV
                     ARPASPRSVPANGFSKALCADRRAVTVFEHSNGLEWDLSENSINPEQAHSQTYHTAFG
                     FEHSKRPLFMRVEVEGKLRGRSRQMKHDLLKFSPRSAEIYIDGDDFARHVEFKKPLDQ
                     IARSLDMAMQMENIKKIPVEMPDQMPAQFTRENITQNSPSEAQMLLPQQRPVSLRKNW
                     EQARARKWKNALNSKDMSAASLNNTLRIPFSSLFGDSYKARPLATWTPI"
     gene            482740..483834
                     /locus_tag="MYCTH_108391"
                     /db_xref="GeneID:11510057"
     mRNA            join(482740..482819,482865..483834)
                     /locus_tag="MYCTH_108391"
                     /product="glycoside hydrolase family 72 protein"
                     /transcript_id="XM_003663719.1"
                     /db_xref="GeneID:11510057"
     CDS             join(482792..482819,482865..483829)
                     /locus_tag="MYCTH_108391"
                     /note="CAZy_ID 270083"
                     /codon_start=1
                     /product="glycoside hydrolase family 72 protein"
                     /protein_id="XP_003663767.1"
                     /db_xref="GeneID:11510057"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="JGIDB:Spoth2_108391"
                     /translation="MLSTANSPKAPSLKAAVRDLHAFRGARSYRHIPLAYSAANVPPL
                     LLLTAEYLTCTGGSGSGSGSSATIDLLGLNIFEATPCASSTWTALRAARRRSSPSPSS
                     SPRSAATCASRPGSSRVRRKGEGGGVRRSMIRGRKTTSSAPRRRCWGPDVREHLLGRQ
                     RVLITSGPSTPRASSAGWSTSVRGGGGGQHRRRRRRDADARGRVRRVPVLFPDRPPPA
                     CPTRDQAEGWLVDADEPLPTIDGLVIGTVTVEETITGTGGSPLGSFLFCRNTRGKPRV
                     SQLGALTRSFATTSKDARVDRPPWRQQLLQCRQQRQQRQQHASNKLRTPKERRD"
     gene            <484368..>486109
                     /locus_tag="MYCTH_53905"
                     /db_xref="GeneID:11510058"
     mRNA            join(<484368..484633,484753..484801,484930..485260,
                     485400..>486109)
                     /locus_tag="MYCTH_53905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663720.1"
                     /db_xref="GeneID:11510058"
     CDS             join(484368..484633,484753..484801,484930..485260,
                     485400..486109)
                     /locus_tag="MYCTH_53905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663768.1"
                     /db_xref="GeneID:11510058"
                     /db_xref="JGIDB:Spoth2_53905"
                     /translation="MSGVSFLRRVSLHGFRGRSKSGVPQPETEKPPFKTAPIIPETQT
                     VLLLHAARQPYELTENYPVSDLRDDHEVLVQTRAIGLNPVDWKAPELAGEVIKRRSSS
                     RLKVLVISTDYRDLRKSAFQHYVVALDYNTVRLPPSISHEEGSTLGVAFVAAALSLGV
                     CMGLDFSSVLDGPDIYSLIRQLPPDALAPDVRDECLNALPSQERAQPGDWLAVWGGSS
                     TSANLTIQLARLAGLRTIAVADTAKHGVRLSNHRSTRPDLLVDSHDPARAVAVIRANA
                     ARNGGRGVRFAIDTRGKDSAGWLARALARDYDAEKNDGTKDKETNPAAAAGAPPSPPG
                     TPDSDDEDSDDSDGGRPGDRPARPILPPDAHLIGLTGLPKEPAPAGVVYHTVPIKVFH
                     EVPAVGRALVEWLERLLARGLVAPADIIDVERGLESVNRGLDRMRRGEISGGKLVVRV
                     D"
     gene            complement(486422..490367)
                     /locus_tag="MYCTH_2134470"
                     /db_xref="GeneID:11510059"
     mRNA            complement(join(486422..488723,488784..488829,
                     488880..488964,489036..489077,489196..489322,
                     489403..489735,489807..489974,490062..490367))
                     /locus_tag="MYCTH_2134470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663721.1"
                     /db_xref="GeneID:11510059"
     CDS             complement(join(486721..488723,488784..488829,
                     488880..488964,489036..489077,489196..489322,
                     489403..489735,489807..489974,490062..490155))
                     /locus_tag="MYCTH_2134470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663769.1"
                     /db_xref="GeneID:11510059"
                     /db_xref="JGIDB:Spoth2_2134470"
                     /translation="MAASRYKDKDAGVVLSFNGQWVSWSHTAVAYLAFLSALIVGSAL
                     HYHKIVRNEWFGYPDEWFPSVSATIGDRYPERSIFMIFIAITSGPRFALVGLWYLLTA
                     KPGRTLPKAIAISGLIRTLTCGGWTYITSTDDHDWHDILMISYIVFTIPWTTGCIALS
                     PPNAKAIKYRKYLASAFFGTLVPLVYFFIQHKVHRVPGAYTIYAFFEWSLIILDIAFD
                     AVTALDFDTFEVVVRDVKGASMGANQSSVPTAVLEKEKEKATAGVFSAGFRLDEALDI
                     AADIYHGFVFWSILTSLGVVVWYFPLWHMGISGFEALIMTSVAPALLGIRSLRSLVLK
                     NQRLTHLLSLAGLVAYLVEDPTRRLFVVGFGVAVSCLGWAATLSSDSVHPARLEMRVL
                     AWVIGLLMSSVAKFAWYTNNPIWPIMHAANGGWNGTGLVLAVLAVLRFTRRAPLQGGN
                     SSEAKSGSTLLSALGIGGLFFALHSLLSDTSTMILWVWDGYPIRGPVSNVHGWYTVAA
                     MTAGVVAGISRPALVTTWTAYGVGCVGAALLTLYHHWLGYCGGLALAAYLTAIAIPLI
                     SSAAKKSPAVTFGLGFLIYNFMVLFHVWVVAYAFVPGGPLVRERTDWIMITMMLLIGA
                     GLLDLISQQAKSARVQAAPRGATKTNHRKYHLGALAVLNVLFLCANVLRFPANDYKPY
                     HAENRLITAGIWTIHFSLDNDMWSSEYRMRDLLKELEVDVVGLLESDLQHIIMGNRDT
                     TQFLAEDLGMYVDYGPGPNKHTWGAALLSKFPILNSTHHLLPSPVGELAPAIHATLDV
                     YGTLVDVFVFHSGQEEDPEDRRLQSEYMARLMGSSPRPSILLSYLVTTPLQGNYNTYV
                     SATSGMHDVDETDDDRWCEYILFKGLRRTGYARVSRSTITDTELQVAKFVVPASEDDA
                     ASTWSAPKALRDRRVPEEEVPEGMRFPAMFRGEGVRGHRYHVFDEPRYYAF"
     gene            490661..492277
                     /locus_tag="MYCTH_2305924"
                     /db_xref="GeneID:11510060"
     mRNA            join(490661..490840,490952..492277)
                     /locus_tag="MYCTH_2305924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663722.1"
                     /db_xref="GeneID:11510060"
     CDS             join(490751..490840,490952..492118)
                     /locus_tag="MYCTH_2305924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663770.1"
                     /db_xref="GeneID:11510060"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="JGIDB:Spoth2_2305924"
                     /translation="MAGVSDKARFYLERAAPELREFEEKGIFTKDEIRALVSKRSDYE
                     HLILSPGTKPSDFLSYVAWERSLDRLRAKRCRRLNIRATSGVGSSHASHARTFGIFER
                     AVLKHPGSVPLWRAYLDFAGGEARASKRWRRICTRALRLHPTDAGLWALAGRRAAQAG
                     DMERARAHFLRGCRFCTGEATLWVEYARCEMEWLARIEAKKAGKGVRKGVNAMEAVKA
                     TEAVQEGDVMMLEDDDDDDDSGDEDGLMLPDPDAQGQGKMAKPQVFDEETTKKMEQSP
                     ALSGAIPMAIFDIAKKQPFYGPAAAETFFDAFAVFTAVSSQPKIVQHVLSAMEESFPN
                     HPCTCSCQVRQPLIGVDVQTAAFPKALRESLARLKSGMERTEDKKTLADKMVVWIDGI
                     LETEGLDAAIKTVLEHTKRSLQSSTC"
     gene            complement(492277..493401)
                     /locus_tag="MYCTH_2305926"
                     /db_xref="GeneID:11510061"
     mRNA            complement(join(492277..492677,492744..492966,
                     493071..493401))
                     /locus_tag="MYCTH_2305926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663723.1"
                     /db_xref="GeneID:11510061"
     CDS             complement(join(492499..492677,492744..492966,
                     493071..493094))
                     /locus_tag="MYCTH_2305926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663771.1"
                     /db_xref="GeneID:11510061"
                     /db_xref="InterPro:IPR002740"
                     /db_xref="JGIDB:Spoth2_2305926"
                     /translation="MLLLHSCTDQTNSESQPLDKKSPAEGKAASETATLSDNVAASEG
                     ERNYWLMKAEPESRFENGVDVKFSIDDLRAKTEPEPWDGIRSYVARNNLRAMKKGELA
                     FFYHSNCSEPGIYGTMEIVREHSPDRASVRPLESSRMKP"
     gene            494284..495373
                     /locus_tag="MYCTH_69953"
                     /db_xref="GeneID:11510062"
     mRNA            join(494284..494570,494662..494941,495076..495373)
                     /locus_tag="MYCTH_69953"
                     /product="epimerase/hydratase"
                     /note="Has EST support"
                     /transcript_id="XM_003663724.1"
                     /db_xref="GeneID:11510062"
     CDS             join(494327..494570,494662..494941,495076..495241)
                     /locus_tag="MYCTH_69953"
                     /codon_start=1
                     /product="epimerase/hydratase"
                     /protein_id="XP_003663772.1"
                     /db_xref="GeneID:11510062"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_69953"
                     /translation="MAVPEQKVIFILGGGPRIGHAVAKKFLSQGYKVAIGRRNTEKTE
                     LDGVLPVYVDVTQPETIEEAFREVESKLGVPSTVVYNAAALTFPPDNDPFGVDPADFS
                     RDLAINVDGAYAALHHATRLARRRNVSPLAFIATGNVTPFKAHPLAVTLGPGKSALAH
                     LISLGTSAYDAKEFRFYFASQVTDDGGPVPYPEVSGEAHGEAYWRLVNGERAEWDVRF
                     TAAPDSSPKFA"
     gene            497411..502282
                     /locus_tag="MYCTH_2305929"
                     /db_xref="GeneID:11510063"
     mRNA            join(497411..497806,498503..502282)
                     /locus_tag="MYCTH_2305929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663725.1"
                     /db_xref="GeneID:11510063"
     CDS             498558..502037
                     /locus_tag="MYCTH_2305929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663773.1"
                     /db_xref="GeneID:11510063"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="JGIDB:Spoth2_2305929"
                     /translation="MSSWINEAAVPNHNGNGFPQINDPSAVAGSMMDPSAFMGNPAQF
                     NPQFANPQQMVMPNGPMRNASPSFPNPMYQTNSVVPSKRPRPSNDNMGQSPRPAPGML
                     PTSRAETPQQSAFPGFQQPGMAQQSSGQPSPYPHLQPNGSTNATPSPIMANQMRPGSV
                     PQRVASSSPHPFSPAAQQFPQPSPLSTEHGGATPQSFMQQNAFQQNFNPQFSAAQSPA
                     RPSPSPNPITGQMMPQQMGQMQMGQVPQQMQQMQQMGQLGQMPGQVSGQMMPSQMAGQ
                     LPGQMQGQMQGQMGHQVPNMMFPQQMGQPRNALEQQKLLYQMQLQQQAQQTSMQMQQM
                     NAQNMMQAPHPNPAQAQAQAQVQTQAQTQAQVQAQAQAQAQAQAQAQAQAQARNMMAA
                     RQGAVANGQIPPGAMRPQQGVPQQPMMRLPPPEQFMKHLAAFMNSKGLPLDMHPVVDG
                     RTVPLYNLFQIVYNKGGGYRNTTQSNSWLQVAQIMGFAPHQIPSAAQQLKSIYERNLF
                     KYEELWTTQQKMRLQQQQGSMANAQGMQQGTPTKPMPSGQMPPQMMQAGQQAQLQSQV
                     QSPAKPPGPQHPNANGFPAPQQPPHGQQPPAAGPNQGHSRNSLPRSVQATPTTDEFPL
                     PSPAQSKAGTVSVPGSAHPENQGPADDTGSSMKFPAPFSTNPDEYVPCSREITTHGGL
                     DVKAMKKIGDELQRAKIDVPLPIDYGNVDIHALTKSIQSGIHGEVRLALDTLASLTCS
                     DYYFVSPTQPIPIPQIDLRLCDELVEALVECAEDQLDLLVENSEEASNEITISPYEEV
                     VRACRTEGLALRSVAVFGSLAYDLDRAADRLICITTILRNLSWREENHAPLADETVIR
                     FLCVLIRYLGTREMLLRTHANTLDLMKDLVTLLSNTASAVEIPGREQAYCLLQFLLAF
                     APTPGPTLHEDRLFFPPYEPSLHPYLPHAVDSLAKLLARDEPNRTHYRNIFAAEATVV
                     TSPPCELLTRTFGLAISPIPDHLREHRPVNLPPLVEARKPLLMQGLLSADILAGLAPG
                     FESGVTRSWLASGNGFAQNLFLLARQLSAQFEGSSVRPGSGQSRAQPKKDLDLVYIIG
                     LAVSMLRRLTEKALDPNDPTGESSIPPEVLPTKESVLGLLQLQSQEWAKEGILADLLD
                     YASMVDKSLGRRG"
     gene            complement(502360..503480)
                     /locus_tag="MYCTH_2305931"
                     /db_xref="GeneID:11510064"
     mRNA            complement(join(502360..502733,502845..503480))
                     /locus_tag="MYCTH_2305931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663726.1"
                     /db_xref="GeneID:11510064"
     CDS             complement(join(502683..502733,502845..503270))
                     /locus_tag="MYCTH_2305931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663774.1"
                     /db_xref="GeneID:11510064"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="JGIDB:Spoth2_2305931"
                     /translation="MLRPATLLRGFATPSRLALRQTALSTTPLARAYSTPSQPPSTTT
                     TTTRTTTASNPPPSSSPAAQEPASVTQPQVAKPYFVRRTPSNQLAVYHLAKRGGNKKL
                     TTIKKVEGDRARFRSALAQGLGLPEKGVVVNNLTGHIIVPGHRKEEVTGWLEKQGF"
     gene            503596..505691
                     /locus_tag="MYCTH_2139409"
                     /db_xref="GeneID:11510065"
     mRNA            join(503596..504224,504288..505691)
                     /locus_tag="MYCTH_2139409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663727.1"
                     /db_xref="GeneID:11510065"
     CDS             join(503796..504224,504288..505202)
                     /locus_tag="MYCTH_2139409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663775.1"
                     /db_xref="GeneID:11510065"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2139409"
                     /translation="MASAPTANGDAAAADYNLISKLAKHLDRHLIFPLLEFSASQLVD
                     EESGEVKDEAKAREISQAKYSLLKKTNMTDYVANLYCELQGLEEPPAEFAEKKQKVFS
                     QLQKYEQETSKIIELLERDDVVNNLRSDKVANLEFLKRDHQVTMEMVDALFELGNLQY
                     SCGNYADASEMLYRFRVLSTDNDKVAYATWGRLACEILTMNWETAMEELQKVRETIDS
                     RLSQNPLAQLHHRTALTHWALFPLFNFEKAREPILELFFSAGYINTIQANCAWILRYL
                     AVAVITNRSRAKNPGIHQKQMKDIVRIVKQEAYEYQDPVTRFVHALCIDFDFEEAQRQ
                     LVLAEEVLRADFFLLAHADDFVDSARHLIFESYCKIHARISLQDLSARLGLNADAAEK
                     WIVNLIRDTRLDAKIDYKEGTVVMNHPPSSVYQQVIEKTKGGFFRTQVLSAAVAK"
     gene            complement(505658..>511753)
                     /locus_tag="MYCTH_2080800"
                     /db_xref="GeneID:11510066"
     mRNA            complement(join(505658..508962,509012..509472,
                     509527..511340,511491..>511753))
                     /locus_tag="MYCTH_2080800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663728.1"
                     /db_xref="GeneID:11510066"
     CDS             complement(join(506164..508962,509012..509472,
                     509527..511340,511491..511753))
                     /locus_tag="MYCTH_2080800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663776.1"
                     /db_xref="GeneID:11510066"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="JGIDB:Spoth2_2080800"
                     /translation="MWQQPMEASESHWPRLVCLTDPLLEIGLVVTHPEPPATGKSRKT
                     PAAPVLLNRAEEILHVEAVHIPVPSAPGHRELTIAVTVNRGTNIESFGVPLPGKKSRK
                     SVKAEDKDKALEEALNSLVDAERGNDAKRRQSRLVSSLLARADLSASQDRATFAEQSI
                     HGGHGSRRIESHGNHRLRLSSGYGGPSFGGSYNYNRINHLPEAPVDNLLEELRAGGDF
                     EGFHNMGLDDHDFDGLAREMLFTKIQSVSMENTNMRYSLSSKPAKTQAKVFILAGPQT
                     AADEQGRSILLIAIQDPVDKRLQLLTLYVQGLEDTAPKKRKAKRSPDLDDLLIIPGEP
                     RRVQSVVDSCKISDGYESIMILSEDRNGGRELSLQSPWGKVTTLALPLLLFDNLSSLE
                     FSGSHRVNVAAQGRHSLGVNLTGTQIDAMCHADSRGTVDLRDKDGKYHRIRIQLQPSS
                     PQVRMVLDVCRSVLHPSYADRVVAGWWHVMQWLQDTKRQGLVHGIVDIEWSAVTILLL
                     SSFLAMGHNSETSLRTLGSEVVTAVAKNKWEAMHLRETPNSSACPPWMRKKAWQWLLD
                     ESPEAPGTISAEPTASSDYVLFHIHLARRWMASTSGLSAFGFEGYLPTALSRTGEPRN
                     TAAWSVMLALHLFVEEQKLNILSSEYLSPGQTDLKALLHQLAKWLGWHRYVALYALGA
                     QAEPTPANDLFPFVLSDLAEPPSEYCILSWIQEHLAGGHDTEYPTLSDLYANATRDSA
                     GGRLRDQLWASLTPRTLMFERLLARFKSVTHRLEAVTAMHQCGFTSQILETLPEAILT
                     ALQDVISTCQPDPPLSWPKDLLALIGRTDVSSVLQPTKTWQSLSSDVKVPSHEAKWDF
                     QTLCRTLEGPNDHVEDAGAAERQAVVRSLFREDRRLNEAQGMLSTSKHRVVRLDPKPE
                     WTEADYLEKQKELVTTIANSTLAISAGRGLLHFALRYPLLTQKYQISAFNLSCLVKPA
                     NNMVSVDKNMFPEEKISWAFFHQGVSGGLAISPQAKGIDTSWILYNKPGQDLSNRHAG
                     FLLALGLNGHLKSVARWVAFKYLTPKHTMTTIGLLLGLAASYIGTMDALMTRLLSVHV
                     TRMLPRGAADLNLSTATQTTGVMGIGLVYCNSQHRRMSEIMLSEIEQVDSPGEEDEEE
                     GGAVRDESYRLAAGFALGFINLGKGSDLKGLRDMHLTEKLLTIATATKRVELVHILDW
                     SAAGAVVAIALIYMKSEDKIVARKIDVPDTLLQFDYVRPDILLLRTVAKHLILWNEVD
                     PTFEWIERGLPVEYRPLYQLTSISKLRSRDLPFFSILAGLCFALGLRFAGSANVRVRD
                     LLVHYLDQFMRIVRIPVNNYDSELARNNACMCMDVLALSCATVMAGTGDIIVLRRLRA
                     LHGRDDSTTSYGSHLAAHLAIGALFLGSGTATFNTSNLAIASLLVAFYPLFPANVQDN
                     RSHLQAFRHFWVLATEHRCLVTKDLVTNQPLNVPILIHLRPDSPSAAAVAAYQTTPMD
                     TNEESPSGPAESATITLRRQTPCLLPPLDDIERVETDAKALGYWDLAIPFADTPRLRD
                     DFRRNQTVYLRRRPADEGTFSATLRSLSAAVDDGAGADEAIMMEGSDRDQQWRKKDGE
                     PCLEWVFGLDALAGLSVAERAMVLDRLGAGGGGVGEGEGASTAVDARLTLRAGADGVG
                     GWSRDRLLGLRLLFEWAERRGSFAQGKGPGGTERQQQEEAGTTKGKGKAKKGSSGKSK
                     KKVSLGAPAPEAGSSEQEKKADEVAAMDGAWWLRDSAIDELKGRTWLAGREG"
     gene            512984..517810
                     /locus_tag="MYCTH_2305937"
                     /db_xref="GeneID:11510067"
     mRNA            join(512984..513527,513595..513621,513677..514662,
                     514716..516417,516523..517810)
                     /locus_tag="MYCTH_2305937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663729.1"
                     /db_xref="GeneID:11510067"
     CDS             join(513123..513527,513595..513621,513677..514662,
                     514716..516417,516523..517461)
                     /locus_tag="MYCTH_2305937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663777.1"
                     /db_xref="GeneID:11510067"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2305937"
                     /translation="MTDSSPQPGDNDRQETSETQPSPGCATDRDTSVTKAGTPGDAPL
                     SSSQSATMAENCPGTTEGLSTDNRDGSDDDEEDDEGDEDEEEEDEEDEEDEEEEEEDE
                     EPKLKYARLTQHLGPVYRNGDATSAFLVAGDKMIVGTHNGNIHVVQLPALQSIRVYHA
                     HSASVTSIAISPFPPPLPTARGEAAPRSVPGSPLRPPTETSEGHAPPAAASRRPREPP
                     LVPNIPSNNIYIATSSMDGNICVQSLVDPKDVQLRNFARPVQAVALSPEYKHDKMYLS
                     GGLAGQLVLTVGAPTGRSTSMTTGATAQASGWLGSMVGAGTGKDTVLHSGEGTINTIK
                     WSLSGKYVAWQNEHGVKIMRTKLHLDHADADDAWKRIGHIDRPQTEEWETMAGVWKAR
                     IEWIDEQAVEHDETPTDRAEVVLSPAAESLRQQQLKSSRKIERLLVGWGGTIWIVHIH
                     PGGIGTGRNAGERSAGRAEIVKILRMDCIISGLSLYTQTLLLVLAYCLPDEDEEEEDG
                     RETRGHVRSLSEASRENRRSGGIPRRQNNQPPELRLIDLSSQAEVDKDGLTISRYERL
                     SSNDYHLGILPAQNAAAAASSRGALETLAGLGSEMLNAALNPLSLFSSAASVMSRGSD
                     GASGTNVPPPASRTGRASVHPHLLKPGVKIFIHSPYDCVLATRRDLGDHLAWLLDHHQ
                     YQQAWQLVDEHPEIMAGAPDATPSSPQHTHSTDDFYDDSASVTEGMRSFYSAAEKEKR
                     RIGELWIQDIIETGDWARAGQVCGKVLGTPDRWEKWVWTFAGANKFDEIVNYIPTERT
                     RPPMPGTLYEVMLGHYLQVNKPRFRELLERWSPDLYDVSAITTVLENQLKYRDVREDS
                     VEDGEVGRDWRIVMESLAKLHEANGRNREALRCHIRLQDADSAMRLIKEGHLADAVAD
                     DIPSFIGLRVPQGQAGKMSQAELEEATAEAITLLVDEAQHGLVKPEDVVSQLQEKSLD
                     LYTFFYLRGLWRGEGIHEHSDESRARLATDSKSLVDHFADLAVHLFAMYEQPLLMDFL
                     KTSTAYAFEKAAQECEVRNYVPELVYLYSKTGQTKRALYLIIDRLGDVSRAIAFAKEQ
                     DDPDLWEDLLTYSMDKPRFIRALLEEVGTAINPITLVRRIPEGLEIEGLREGLKHIMK
                     EHEIQYSICEGVAKVLRSEVAAAQRLLRMGQRRGVKFEVAPPGDLPYENEKDVPLPAV
                     EAAAPPPPPPPAENRSSAAAEQAPPAQTNGDAAAAAAVARPASDSRKARKWAPGHCAE
                     CLEPFVPWETETLVGFACGHVFHVSHLLRRLRPGEEEEVDEVLLRGIAEPRASATHLV
                     GAKVTHARLLRDRIAGGCPVCVCADKGGEGRY"
     gene            517841..517925
                     /locus_tag="MYCTH_t102"
                     /db_xref="GeneID:11510068"
     tRNA            517841..517925
                     /locus_tag="MYCTH_t102"
                     /product="tRNA-Ala"
                     /note="Anticodon: AGC"
                     /anticodon=(pos:517874..517876,aa:Ala,seq:agc)
                     /db_xref="GeneID:11510068"
     gene            518643..519714
                     /locus_tag="MYCTH_112025"
                     /db_xref="GeneID:11506415"
     mRNA            join(518643..518823,518957..519714)
                     /locus_tag="MYCTH_112025"
                     /product="glutathione S-transferase-like protein"
                     /transcript_id="XM_003663730.1"
                     /db_xref="GeneID:11506415"
     CDS             join(518770..518823,518957..519574)
                     /locus_tag="MYCTH_112025"
                     /note="Glutathione S-transferase-like protein"
                     /codon_start=1
                     /product="glutathione S-transferase-like protein"
                     /protein_id="XP_003663778.1"
                     /db_xref="GeneID:11506415"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="JGIDB:Spoth2_112025"
                     /translation="MAPFGRIYTYPNNYRVQRVQAIAALNGLEVEVVPDFQMGVTNKT
                     PEFLAKFPLGKVPAFETADGSLQLTEGQAIARFVAESGPKADQLVGADPKTRALIEMW
                     TCFAEQELGANLVPPLLMVVAKMFPYDEARYNFHVAAVERALKRIEHELKDGRKFLVG
                     GQLTLADIMIAGVLQLGTKFVVDKDMRKEVPAVEAYLKAIMEIPEMKQAFGDLQACET
                     RVKPE"
     gene            520694..521554
                     /locus_tag="MYCTH_2305943"
                     /db_xref="GeneID:11510069"
     mRNA            520694..521554
                     /locus_tag="MYCTH_2305943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663731.1"
                     /db_xref="GeneID:11510069"
     CDS             521146..521343
                     /locus_tag="MYCTH_2305943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663779.1"
                     /db_xref="GeneID:11510069"
                     /db_xref="JGIDB:Spoth2_2305943"
                     /translation="MWEVGSQGSEHRGVAGSSPAPEDGREDDVMDTDEPSWDLPDSLD
                     GTNGMMDPRALDTSRVRTGVY"
     gene            <552950..>553246
                     /locus_tag="MYCTH_2064750"
                     /db_xref="GeneID:11510070"
     mRNA            <552950..>553246
                     /locus_tag="MYCTH_2064750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663732.1"
                     /db_xref="GeneID:11510070"
     CDS             <552950..553246
                     /locus_tag="MYCTH_2064750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663780.1"
                     /db_xref="GeneID:11510070"
                     /db_xref="JGIDB:Spoth2_2064750"
                     /translation="LFLKYRYFVKVYIDNIIIFSKTEKEYLKYLYIIYKILDKAYIYI
                     NTTKSFIGYLAIKLLRYIINGKGITKTDDYITTFKKLKFPDTLDSLEHYLRIAG"
     gene            591524..592186
                     /locus_tag="MYCTH_2305949"
                     /db_xref="GeneID:11510071"
     mRNA            591524..592186
                     /locus_tag="MYCTH_2305949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663733.1"
                     /db_xref="GeneID:11510071"
     CDS             591659..592051
                     /locus_tag="MYCTH_2305949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663781.1"
                     /db_xref="GeneID:11510071"
                     /db_xref="JGIDB:Spoth2_2305949"
                     /translation="MNPKGARYFGFNFLMPNPTTVDFCPGAACRTMSDFLKCTAAATA
                     FLRASMKLKAAADLNKFPRTVDGLNKFFEHPGGDGVFLASLFADHYNHKTPKPITTVP
                     TIKVAGVGSGAGKVQGKGGAGVGVQVRA"
     gene            592187..593554
                     /locus_tag="MYCTH_2305950"
                     /db_xref="GeneID:11510072"
     mRNA            592187..593554
                     /locus_tag="MYCTH_2305950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663734.1"
                     /db_xref="GeneID:11510072"
     CDS             592322..593410
                     /locus_tag="MYCTH_2305950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663782.1"
                     /db_xref="GeneID:11510072"
                     /db_xref="JGIDB:Spoth2_2305950"
                     /translation="MEKKRPRYRILSFTTSHEGDKRQWFSLEIQLHTSRFRISVSLSN
                     FRNSPIRSEEFQKYFALLLSENDNHNDSFEETDEEGDAPGRTALLDCFDWAVTPFLAD
                     FERLSPAPPPLGSGQLTLSHFLVTASFECNLTAADEILAPGEIERVEMDEDCWPTLSS
                     GDAWTTSFPSFSPAEIVVICDDPEHPFDSNPTRVRIGQQHLYFKESSEPDDVVAKKEV
                     ETYERIDSANLGAGVRTSRLYGVVRNERNQLIGLLLYPIEEDTLLTFAVGPETPDALK
                     DRWAQQIQDTLAALHRAGITWGDAKPDNVLIDVHGDAWIVDFGGGRTEGWVDSGKAGT
                     VDGDLQALERILKFIASGGDDMMDYSKE"
     gene            complement(<593630..>593914)
                     /locus_tag="MYCTH_52807"
                     /db_xref="GeneID:11510073"
     mRNA            complement(<593630..>593914)
                     /locus_tag="MYCTH_52807"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663735.1"
                     /db_xref="GeneID:11510073"
     CDS             complement(593630..>593914)
                     /locus_tag="MYCTH_52807"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663783.1"
                     /db_xref="GeneID:11510073"
                     /db_xref="JGIDB:Spoth2_52807"
                     /translation="FASGCLLWQGLKAATGKEKDARIKEKKESSSGESLYYRILPEEF
                     ATYINYTRRLHFDEKPDYSYLRRLLRRRFAAEGFKHDNVFDWTEKRFHEM"
     gene            594853..596295
                     /locus_tag="MYCTH_2305952"
                     /db_xref="GeneID:11510074"
     mRNA            join(594853..594972,595102..595301,595408..596295)
                     /locus_tag="MYCTH_2305952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663736.1"
                     /db_xref="GeneID:11510074"
     CDS             join(595133..595301,595408..595700)
                     /locus_tag="MYCTH_2305952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663784.1"
                     /db_xref="GeneID:11510074"
                     /db_xref="JGIDB:Spoth2_2305952"
                     /translation="MKCLSMLATAFGLLAMASAMPVIEERDEVQTVHLIFHAGPAEYS
                     LAIPADGSVHKTNSDLSVNIIDAPDYNAFYQCKFETQNDATLASSISPEGVNQIMVGP
                     PTPIISVSCQGMCVPTYGDCYRDGQWVGPCCAGYCAANKCRPWVNPWGKNE"
     gene            <602681..>608198
                     /locus_tag="MYCTH_2127585"
                     /db_xref="GeneID:11510135"
     mRNA            join(<602681..602690,607990..>608198)
                     /locus_tag="MYCTH_2127585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663737.1"
                     /db_xref="GeneID:11510135"
     CDS             join(602681..602690,607990..608198)
                     /locus_tag="MYCTH_2127585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663785.1"
                     /db_xref="GeneID:11510135"
                     /db_xref="JGIDB:Spoth2_2127585"
                     /translation="MSVCTPSPTYRAYSSASTRPIPMPINFGRSRAYRSSSPVKRAVY
                     LVYIRNNPTLATITIILKGEDKEEEVVE"
     gene            625718..629111
                     /locus_tag="MYCTH_2305956"
                     /db_xref="GeneID:11510136"
     mRNA            625718..629111
                     /locus_tag="MYCTH_2305956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663738.1"
                     /db_xref="GeneID:11510136"
     CDS             625822..628800
                     /locus_tag="MYCTH_2305956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663786.1"
                     /db_xref="GeneID:11510136"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR014809"
                     /db_xref="JGIDB:Spoth2_2305956"
                     /translation="MARLDELQFDPARLKKASVEDYSSSESDGDEEDEYLMPSRNPHD
                     SEFADLNPRKRRRTGGDAKERAALGIFGSESEDEGPGGRWKHKRLRDKAVSFVSSAKA
                     DEDYDVELDDDDDDNDDDDEEEEDEANDQKVDDEYDDANPGAVPASAAAGEEDEDEDE
                     DEAMAGVGLGFKGPSAAAAAAGQGLGWTPPTQQAMFNKRPTAPPKPFVKSKVDSANPL
                     GNGFTPTSARGPTLLVKDEEPATPRPVLPSAFSKTKGGKTKINANSFGARMLAKMGYV
                     EGQGLGKEGQGRNVIIEANLRPQKVGLGAVKEKTEQERQEEKRQARLRGEEVIDSEEE
                     EKKKAARKKKAVAGGIGSRPGSGTSTPKRPKPKYMTLDEIKKAAPGLKIPEAFTPILD
                     MTGPGKKLLTSSSGLMTPTGGAAPAESVEAAENRKLVRRAQNDFLAIVEEWQGLQERK
                     AYLDLQLKQEQQELEELSASLQGNRSVTAASEAASRPAESGEAEPKADICHRLSQVIA
                     GLAEASNSLSDSILPQIKSELSSLAVAAIHPLFNQYRQLWDPLEEPKPPFVDGLNSIR
                     GLLGLDNETKKTYRKPTATPYETMMYEQWLRTLSATVREWNVRDPDQLTAVLDAWSPL
                     LPPFVRAQLLRDIIRKLEDALQKWQPKKHTNNLPHRWIFPWLPYLPPSHLDPRSSTGL
                     VADVRRKFRQLIDSWDFRRGVIPGLKQWKDVLRPADAGGRDSTATPSASSTTTTKDMW
                     RPLVMNHLLPGMARSLRTHFRVEPQDQAPYMEVLDRILEWSPDVVRPSMLGEVLVAEV
                     FPAWHAALYQWLLLEEADYNEIGAWFQWWQDEVFPDDIKALPSIVAEFEKGSAMIERA
                     LDLGDRVRADLRPPEKGPALKTTRRDRDSGGRAEPAPEQQQQQQQPAVLGRKPEEISF
                     RDVMEAWCQEHDLQFMPDRSQLHAEGPMYRITGPEGKKGALVYFKGNSLFALAKDQKN
                     PLEIRRDNEEDWWTVLSLVS"
     gene            complement(<629424..>630543)
                     /locus_tag="MYCTH_2110837"
                     /db_xref="GeneID:11510137"
     mRNA            complement(join(<629424..629452,629572..629784,
                     629903..630028,630135..630150,630309..630368,
                     630541..>630543))
                     /locus_tag="MYCTH_2110837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663739.1"
                     /db_xref="GeneID:11510137"
     CDS             complement(join(629424..629452,629572..629784,
                     629903..630028,630135..630150,630309..630368,
                     630541..630543))
                     /locus_tag="MYCTH_2110837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663787.1"
                     /db_xref="GeneID:11510137"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2110837"
                     /translation="MGAHTLQPDQIAQYKQVFEIFDKDGTGDITADELGQVMRELGLN
                     PSEAELRDLVSEVDINNDGVISFDEFLTLMSQTVKEVDTEQELLNAFKVFDKDGSGTI
                     SSDELRNVLKSLGENLTDQELDEMIKLADRNGDGTIDYHEFASIMK"
     gene            631423..633194
                     /locus_tag="MYCTH_2305962"
                     /db_xref="GeneID:11510138"
     mRNA            join(631423..632140,632204..633194)
                     /locus_tag="MYCTH_2305962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663740.1"
                     /db_xref="GeneID:11510138"
     CDS             join(631510..632140,632204..633135)
                     /locus_tag="MYCTH_2305962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663788.1"
                     /db_xref="GeneID:11510138"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2305962"
                     /translation="MWSVIQQRRLRRQAESQRNDSQTEKGGRTSSGQATDGDAEKPGQ
                     FNSQDNKIWVKTTGDDDPIDPRNWPLLDRSKNIAILAYLIFVQAWAGAAESMANSAAS
                     QEQGHSKVAENLTIAMYLFGIGIGSLFAGPVSESVGRNPTYLVSTFCFLFFVLGAAMA
                     PTFGGRIAWRFLMGLSASPTLAINGSSVKDQFRPVKRAFVFPIIAWANVAAPMIAPVA
                     GGWIVESRGLGWRWTEWTTLIISAPAFILALLFLPETYLPILLDWKAAGLRRATGDDR
                     YVSQHAESSTFKERLKKQATMPARFFFTEPVVAVLGIYLILVYILLFTFLSGFDYIFK
                     DTYGLSTGMTGSCFAAIAAGTTAYTLLAPGLNSWSRRKTEYVKGAPVEPEFRLWSGIV
                     AGPLLPLSLFWLGWGDYSSVSIWCSLAACFLFGIAVLAIYVSSYEYIIDSYGEHSAVA
                     LSSITCVRYMVAGGVVMASRPMYSGIGVHWTLTLLGCIAALLAPAPLVFWKLGLKLRR
                     KSPYAESPDEDK"
     gene            <634102..>635401
                     /locus_tag="MYCTH_2065690"
                     /db_xref="GeneID:11510139"
     mRNA            join(<634102..634211,634263..634552,634635..634840,
                     634898..634924,635039..>635401)
                     /locus_tag="MYCTH_2065690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663741.1"
                     /db_xref="GeneID:11510139"
     CDS             join(634102..634211,634263..634552,634635..634840,
                     634898..634924,635039..635401)
                     /locus_tag="MYCTH_2065690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663789.1"
                     /db_xref="GeneID:11510139"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2065690"
                     /translation="MTSLLSIGQRLKGRLSTYSIVKELHRAADQGAVFLATNHDGKKC
                     IVKSIKGHWRLQNEADILKRYQGRTPFLRPLLDEIVEPSDPPSIVLKHLDTDLLTESN
                     RKRLSRPEIKQVAKCVLQALKVLHEDGMVHTDIKLDNIFVNYGKNQRFSEIQLGDCGG
                     VVSQDSEFAKGHLIGAGFTRSPEATFQIPWGTATDIWSFGNAILSLLYGGNYHLFNPA
                     IDKVRPEDDLYELTVLKRMYKFFGPFPRSYEDFNDEETMIFVNHLNSQGPPEKPFHLV
                     TKREIPPADNVFIRKIMKLDPRDRPTAEQLLQDEWFTEESEDTRDPLPGEKGDTS"
     gene            <636380..>637483
                     /locus_tag="MYCTH_2110839"
                     /db_xref="GeneID:11510140"
     mRNA            join(<636380..636383,636449..636478,636608..636868,
                     636986..637153,637211..637337,637372..637405,
                     637463..>637483)
                     /locus_tag="MYCTH_2110839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663742.1"
                     /db_xref="GeneID:11510140"
     CDS             join(636380..636383,636449..636478,636608..636868,
                     636986..637153,637211..637337,637372..637405,
                     637463..637483)
                     /locus_tag="MYCTH_2110839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663790.1"
                     /db_xref="GeneID:11510140"
                     /db_xref="JGIDB:Spoth2_2110839"
                     /translation="MADPIIDFAHHAHKFPSLESRGRYELQRDCAAIAAEAAEHAVQK
                     FKPEQIMADAEARGNRARRVITAREEAAGEPKYTVTRMDVLEVDFYRLVATAARNLVQ
                     RRKRVLEQDVAERKELAERVTGELSRLSEQYRASKEDVMLALEAKASNDGGFVMVPNS
                     ESVGTEPQEGSSVEGWIHAAVDDEFCAGIEVETDDDWSTRGKQYFIVIKKGIPR"
     gene            complement(638941..639365)
                     /locus_tag="MYCTH_2305964"
                     /db_xref="GeneID:11510141"
     mRNA            complement(638941..639365)
                     /locus_tag="MYCTH_2305964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663743.1"
                     /db_xref="GeneID:11510141"
     CDS             complement(638985..639350)
                     /locus_tag="MYCTH_2305964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663791.1"
                     /db_xref="GeneID:11510141"
                     /db_xref="InterPro:IPR001106"
                     /db_xref="JGIDB:Spoth2_2305964"
                     /translation="MVNVWSRYGGTAMLSRDPRDLQLVSDSVDFLKRQLEAGNVIYGV
                     NIGFGGSADTRTQHLEQLQSAAIQHLNVGILLKADKTDAEEADRSQDNGLLRSHTLPT
                     PIVSATRLCGAIRACGSAS"
     gene            <641177..>642448
                     /locus_tag="MYCTH_2064803"
                     /db_xref="GeneID:11510142"
     mRNA            join(<641177..641291,641583..642053,642119..642246,
                     642311..>642448)
                     /locus_tag="MYCTH_2064803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663744.1"
                     /db_xref="GeneID:11510142"
     CDS             join(641177..641291,641583..642053,642119..642246,
                     642311..642448)
                     /locus_tag="MYCTH_2064803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663792.1"
                     /db_xref="GeneID:11510142"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2064803"
                     /translation="MPGVTSKTSASSKYDQIPGPLGLASASLEGKVALVTGAGRGIGR
                     EMALELGRRGAKVIVNYANSDSAAQEVVNLIKKNGSDAARIKANVTHVNEIVRLFDEA
                     VKKFGKLHIVCSNSGVVSFGHVKDVTPEEFDRVFNVNTRGQFFVAREAYKHLEVGGRL
                     ILMGSITGQAKGVPRHAVYSASKGAIETFVRCMAIDFGDKKITVNAVAPGGIKTDMYH
                     AVCREYIPNGDKLDDEGVDEYAAGWSPLHRVGLPIDIARVVCFLASQDGEWVNGKVIG
                     IDGAACM"
     gene            648916..650222
                     /locus_tag="MYCTH_2305966"
                     /db_xref="GeneID:11510143"
     mRNA            join(648916..649395,649452..649560,649633..650222)
                     /locus_tag="MYCTH_2305966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663745.1"
                     /db_xref="GeneID:11510143"
     CDS             join(648926..649395,649452..649560,649633..650037)
                     /locus_tag="MYCTH_2305966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663793.1"
                     /db_xref="GeneID:11510143"
                     /db_xref="InterPro:IPR013107"
                     /db_xref="JGIDB:Spoth2_2305966"
                     /translation="MLLGYHLLWSRTANVVGNDEQADRLQKLIIENNYYVGGAVNPRD
                     SDLKITYDDEKITYNGFKNFTTGAAVSDLIVLEGAVEGRPPEEHIFAIVPTAQAGIIF
                     SYNWDNIGLRLTESGAAKIENVSAPWADALGWDPATKKPDPAVLGIAFPSLLLPSIQL
                     VFSNFYLGIAIGALEFAKQYTVRHTRPWPYGGENKSAATDEFYILSTYGNFFAHLRAA
                     EALADKAGEEADRIFATYGNNRAALTARERGDWAEWVASIKVVATDTGLRVTSGVFEV
                     TGARATASKVGLDRFWRDIRTHTLHDPVAYKNRELGRYFLLDQVPEPTWYT"
     gene            651391..656293
                     /locus_tag="MYCTH_2305972"
                     /db_xref="GeneID:11510144"
     mRNA            join(651391..652449,652517..654649,655056..656293)
                     /locus_tag="MYCTH_2305972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663746.1"
                     /db_xref="GeneID:11510144"
     CDS             join(651781..652449,652517..654649,655056..656099)
                     /locus_tag="MYCTH_2305972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663794.1"
                     /db_xref="GeneID:11510144"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="JGIDB:Spoth2_2305972"
                     /translation="MFWRFGGYANVSTIDTILERDNFELEELLDESDLVQELKQHNAR
                     LVEYLRDPQVLEKLLRYVVAPKLEPVASPDDEEEDEDGDEKAKNALRASTASEGSSRA
                     DDTSREDREKKRNRYALISTEILSSDTWSMYDALMESKPLLRDFWQFLKRDAPLDPLQ
                     ASYFTKVNESLFDKKTEEMLDLLKSMDGAVQDILRHVECPMIMDLLLKIISLERTESG
                     QGIVEWLYTQNVMSALVSFLSPEHSWATQTSAADFIKAIITVSANASQNEQTCIGPNE
                     LTRQLVSKPCVEQLIKYMLGGGNPLTCGVGIVIEVIRKNNSDYDPEGVDINAPPSSRD
                     PIYLGTLLRLFAEHVPDFMNLILNAPAQNQHLSSTFGNKIEPLGFDRFKTCELMAELL
                     HCSNMMLLNEQGAEELIAARDAQRHRLRAEGQLLPVSNREPAPAEDLSMRVSQSSASE
                     QGRKLEVMNATVEDDGFEEVSHAADEDNTHGVLELPDAPAQPPAPLVDKDDEEFVDEP
                     LTSPNPGAHDPAVRPHLPSKEGVETPGRGEAKTDIPATGSAVESPQSKSQETPERAQD
                     LGTQEPEQAVKTDSTPPVSEGENAENKIGSAAPVEADSTAHGEIQPRPEDIPAPLFSR
                     ENRQSTSGEPPSSAEGASGTTVTASPEQDPRLDQAKTEDSSAPQPAQPGGDSSVATGD
                     AAEPAPSAPAQPKPVVGDFLKMQFVEYRVVPTILSFFFRYPWNNFLHNVVYDIVQQVF
                     NGPMDRGYNPTLAISLFEAADITNQIIKGQLASEKSQAESKTRMGYMGHLTLIAEEVV
                     KFTERHPPELLSEVVLEKVMAPDWVNYVEGALAETRERDNAILGGVRPEVAMNRASGQ
                     GLMGGGFSGLSSIGLGGGASSALADAGLNGGSDLAEGAGGGGMGPFSISSGTLMSGFG
                     SSSDEDDDEEQDTEEDVNNEFRAYTDPLNANHNSMDPPSIPPPPPPPPPLNIPPSRAR
                     LQLAARLAMNKKNAATAAASNGGQEGSSPPTADDATGSGVFSLPNTSASERLRNPFAD
                     YEDDDDDNSGSGSSDGEPETVEGEESLGLGAGNSTWHRGSWWRDVVRGSRGRRRRSGS
                     RDEGDAQDMEIERFGDGRDDDSSDEEGGRRLADDDYIEDEEFGDFAMPEVEERTTSST
                     VSGIDPSRKSIIHKPTAVHPTASTIKSSGISPFSSLWPFSREKREGEEAATVTTKSEG
                     SNASAPAGSAQGNGGGITEEPVELAKEEEEEEAVIGEDGKKIDRAVEATRRTSIEDPD
                     EDEVDVGEEIIVHRGAGVQ"
     gene            <657129..>658658
                     /locus_tag="MYCTH_102943"
                     /db_xref="GeneID:11510145"
     mRNA            join(<657129..657364,657470..657804,657901..>658658)
                     /locus_tag="MYCTH_102943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663747.1"
                     /db_xref="GeneID:11510145"
     CDS             join(657129..657364,657470..657804,657901..658658)
                     /locus_tag="MYCTH_102943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663795.1"
                     /db_xref="GeneID:11510145"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_102943"
                     /translation="MSTVSTQDGAGANGEHEAVIRKEVPSFLTRLSYAGYMYGLKSIL
                     AAFFWLREWKESRNPPEGGPDIVKTYECRPHLPVRIFFPSSYDQTSPVALPTLFTIHG
                     GGFCVGHQRDDDEWNRAFADSYSVLVISLNYSKAPTYPFPAAPHDVEALLLAALEDAS
                     LPIDRGARAPASRTAILGFSAGGNLALSVSQLPAVRAHPLAPRAAITVYGSLDLSCPP
                     HEKLQNRPYKPALRAPRGNWTWTGTGTDPVLALAPASDWSYIPYGQDLRDPLLSPLYY
                     RDRAALPAFVGVVAAELDMLAHESWRFACRLSRGRAVPDRRSADARRRVCGDPHGRVT
                     SRPGELIGLLPGREDERFAFEETVYASPPPPPPPSYYSSAGSGGGGGGGVAAVGGVKW
                     LLVPDVLHGFDNPHMRALMGGTETIKDAELKTEAYRAELARWLKEVVWRV"
     gene            659005..659091
                     /locus_tag="MYCTH_t103"
                     /db_xref="GeneID:11510146"
     tRNA            659005..659091
                     /locus_tag="MYCTH_t103"
                     /product="tRNA-Tyr"
                     /note="Anticodon: GTA"
                     /anticodon=(pos:659039..659041,aa:Tyr,seq:gta)
                     /db_xref="GeneID:11510146"
     gene            complement(659033..661643)
                     /locus_tag="MYCTH_2305976"
                     /db_xref="GeneID:11506416"
     mRNA            complement(join(659033..660345,660441..661643))
                     /locus_tag="MYCTH_2305976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663748.1"
                     /db_xref="GeneID:11506416"
     CDS             complement(join(659408..660345,660441..661497))
                     /locus_tag="MYCTH_2305976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663796.1"
                     /db_xref="GeneID:11506416"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2305976"
                     /translation="MAGPIPDDLDRERFEGSSSQARTETDPGRELGLASTKEGNGDGD
                     GDGDCEKRNGHRGSKDDASGSKSDNNTDTDADADTDDDTDADSDYDYDGHRPTPLDLR
                     LSRARSASTVTTVASHNTAAGRRASTLTGASIANANASASASNNNNTTTTNNNTLTRR
                     TTNLLSRIRSRPAVPAFTHPLSHIPTGPELLVDFDGPEDPYKPLNWPLHKKVVTTLLY
                     GLVTMSATWASSCYSAGTAQVAAAFGVSSQVAVLGTSLFLVGFGIGPLLWAPLSEVYG
                     RRLAVFAPMFVAACFSFASATSKDFQTLMLTRFWGAFFASAPVTNTGGVLGDLYGPAQ
                     RGIAMAGYAMAVVAGPALGPIVSAALVAQPGLGWRWTEYLAGIIQAAILLVAVIFIDE
                     SYPPKLLVYKARRLRIETGNWALHARFEEWDVSVAELARKFLVRPIQLLRTPICFLVA
                     LYASFCYGILYMQLGSIPIIFAEVRRWSHLVATLPFLCIFVGAVLGCAINVYNQLLYN
                     KAYHAAGNRAVPERRLPPMMLGSVLFAGGQFLTGWTSDPDIHWLVPCIGLVMLGTGFF
                     TIFQAALNYLVDTFTKYAASAVAANTFLRSCFACAFPLVVGPLFHNLGVGPGSSIPAG
                     FSVLLIPVPFVFFVYGRRIRARSKWSRASVHDGDKQKREM"
     gene            662121..>663467
                     /locus_tag="MYCTH_2080826"
                     /db_xref="GeneID:11510147"
     mRNA            join(662121..663351,663406..>663467)
                     /locus_tag="MYCTH_2080826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663749.1"
                     /db_xref="GeneID:11510147"
     CDS             join(662343..663351,663406..>663467)
                     /locus_tag="MYCTH_2080826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663797.1"
                     /db_xref="GeneID:11510147"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Spoth2_2080826"
                     /translation="MMNQHDTCRFGALVEWAEQHGARLHPSVEIYLDPVSKYSLRVSP
                     SATEGLQPGFAAVSCPARITLSYLNALVDGLLDPSALSDRSAQSARLDQETSSTGAFP
                     PRFTRSVPPHVLGRFFLVKEYLKGKDSFWWPYIATLPPPEQVAVWALPPFWPDHDIAY
                     LEGTNAHVAIQEIQENVKREFKQARKLLKEEDFPDLPAYTQLLYKWAFCIFTSRSFRP
                     SLVLSDATKRRLSALLPQGVQLDDFSVLQPLLDIANHSPTARYTWDTTSVPDTCRLIC
                     HDPYQPGTQVYNNYGLKTNSELLLAYGFILPETPSLHNDYVHVRKRARQQPQPQPQHQ
                     QEQPPPQSFLISLRPMAHPSSLA"
     gene            664229..664325
                     /locus_tag="MYCTH_t104"
                     /db_xref="GeneID:11510148"
     tRNA            664229..664325
                     /locus_tag="MYCTH_t104"
                     /product="tRNA-Ser"
                     /note="Anticodon: TGA"
                     /anticodon=(pos:664262..664264,aa:Ser,seq:tga)
                     /db_xref="GeneID:11510148"
     gene            complement(664672..664757)
                     /locus_tag="MYCTH_t130"
                     /db_xref="GeneID:11506417"
     tRNA            complement(664672..664757)
                     /locus_tag="MYCTH_t130"
                     /product="tRNA-Trp"
                     /note="Anticodon: CCA"
                     /anticodon=(pos:complement(664723..664725),aa:Trp,seq:cca)
                     /db_xref="GeneID:11506417"
     gene            664923..666903
                     /locus_tag="MYCTH_2305977"
                     /db_xref="GeneID:11506443"
     mRNA            join(664923..666102,666192..666559,666673..666903)
                     /locus_tag="MYCTH_2305977"
                     /product="carbohydrate esterase family 4 protein"
                     /transcript_id="XM_003663750.1"
                     /db_xref="GeneID:11506443"
     CDS             join(665783..666102,666192..666559,666673..666749)
                     /locus_tag="MYCTH_2305977"
                     /note="CAZy_ID 267910"
                     /codon_start=1
                     /product="carbohydrate esterase family 4 protein"
                     /protein_id="XP_003663798.1"
                     /db_xref="GeneID:11506443"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="JGIDB:Spoth2_2305977"
                     /translation="MLAETVLAGLALASSAIAAPAPNPIEFVKRAPTPGVVIQKCSTP
                     GVLALAYDDGPYQYTSRLVDILDAAGAKATFFWTGTLYGCIYNQANAVKKAFASGHQI
                     ASHTWTHPHWASLGEAQIRQEITKLEDAFVNLIGKKPAYVRPPYLETGGQVLPVLRSL
                     GYKVITNDIDTGDWNHYSPQQSEQAFLQAGAGGNGHIPLMHETYDSTVNVLTPWLINW
                     AKQNNLKLVTVAECLGDPDGAYQAGNFEPNGQNSCY"
     gene            <691562..>691858
                     /locus_tag="MYCTH_2063115"
                     /db_xref="GeneID:11510149"
     mRNA            <691562..>691858
                     /locus_tag="MYCTH_2063115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663751.1"
                     /db_xref="GeneID:11510149"
     CDS             <691562..691858
                     /locus_tag="MYCTH_2063115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663799.1"
                     /db_xref="GeneID:11510149"
                     /db_xref="JGIDB:Spoth2_2063115"
                     /translation="LFLKYYHFIKVYINNIIIFGKIKEEYPKYLYIIYRILNKAYIHI
                     STIKFFIRYLAIRLLRYIVNGKGIIKTDDHIAAFKKLKFLDTLDSLEHYLRIAG"
     gene            713904..715684
                     /locus_tag="MYCTH_2305978"
                     /db_xref="GeneID:11510150"
     mRNA            join(713904..714077,714165..715684)
                     /locus_tag="MYCTH_2305978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663752.1"
                     /db_xref="GeneID:11510150"
     CDS             join(713936..714077,714165..714235)
                     /locus_tag="MYCTH_2305978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663800.1"
                     /db_xref="GeneID:11510150"
                     /db_xref="JGIDB:Spoth2_2305978"
                     /translation="MCDYTQREYSCGHFRWIASKWCRDYTMTHKRCQPNVTHFEYRAE
                     ELCGECKPKEYPPWENLIKRPKQQTY"
     gene            <722248..>723447
                     /locus_tag="MYCTH_95335"
                     /db_xref="GeneID:11510151"
     mRNA            <722248..>723447
                     /locus_tag="MYCTH_95335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663753.1"
                     /db_xref="GeneID:11510151"
     CDS             722248..723447
                     /locus_tag="MYCTH_95335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663801.1"
                     /db_xref="GeneID:11510151"
                     /db_xref="JGIDB:Spoth2_95335"
                     /translation="MDAAQLAPSQHQHLSIHTSAGQATMNGVLPSPQYEYDREWRWPW
                     WKFELMPDVLFTTLHERFNTRTCPIQLPHTFLFDVRACAEESHDIDTFYAKLAEKRDQ
                     RVAELEAAWEEVSDRMHSLLNRGPVCGLPGCKSMEMEDENPFSKSNNRFARSAAFCHL
                     SRTMAFDCLINFFDGLVRDNREKDRRREEDLKTPARNLELTYDSESIGAGQPPTADAD
                     DAFAGDPVRPTPPQPIRHPLSPCLSPESTPSDEVDPPQIFPDQKDAGGESSPNPVPAD
                     DPTPVSSGRHNSAPLATEATKQAAGAPQCDPPSTRRRPPGGLPSRPQRKRKRDEPESN
                     SGGGGATDTAVGDSEAQDTGVGQITERPPANRQAARRLGGGKRGRTAQEERACRQVSD
                     EADAPSS"
     gene            725172..727089
                     /locus_tag="MYCTH_2305979"
                     /db_xref="GeneID:11510152"
     mRNA            725172..727089
                     /locus_tag="MYCTH_2305979"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663754.1"
                     /db_xref="GeneID:11510152"
     CDS             725313..726848
                     /locus_tag="MYCTH_2305979"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663802.1"
                     /db_xref="GeneID:11510152"
                     /db_xref="JGIDB:Spoth2_2305979"
                     /translation="MEPELVDIVIVGAGLSGINAAYRVQTLLPHHSYAILEARAEIGG
                     TWAFWKYPGIRTDSSMGLFGFPWRPWPHEVSMAPGPAIKSYMEECAAAEGIDKKIRLG
                     HRVIAMAWSSDEQCWTLQVEVRHGDGDGGGGGSNNSGAGEKKVIKAWWVIGASGYYSY
                     ERPLPAVIPGIERFGGQVVHPQFWDESVDYAGKKVVIIGSGATAVTLLPNLAKTAASV
                     TMLQRTPSYVFGLPGEDKMVSRLARFMPLSWAQTLHWWRSMLLETVFTWLLTTFPNWG
                     RRFITQEMRKQLPAHVDVDKHFNPWYNPFEQRLCFCPNNDFFKALHRPNARVVTDTIE
                     TVTETGIRLRSGGAELEADMIVTATGLYFELLSGVDVTVDGESVTASLGRRYIWNGTM
                     LEGVPNAGLITGYTAASWTPGADVRIRQLIKVIRHMDRTGAAAAAPYVDPRERASLPV
                     RPAVGLSSTYMVSAHDRMPKVAGKAPWVNGANWATDVWRLFWSDVKQGMKYTFKGDKE
                     KRV"
     gene            complement(727113..727202)
                     /locus_tag="MYCTH_t129"
                     /db_xref="GeneID:11510153"
     tRNA            complement(727113..727202)
                     /locus_tag="MYCTH_t129"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:complement(727167..727169),aa:Glu,seq:ctc)
                     /db_xref="GeneID:11510153"
     gene            complement(727927..728979)
                     /locus_tag="MYCTH_2305981"
                     /db_xref="GeneID:11506442"
     mRNA            complement(join(727927..728726,728787..728979))
                     /locus_tag="MYCTH_2305981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663755.1"
                     /db_xref="GeneID:11506442"
     CDS             complement(join(727968..728726,728787..728813))
                     /locus_tag="MYCTH_2305981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663803.1"
                     /db_xref="GeneID:11506442"
                     /db_xref="JGIDB:Spoth2_2305981"
                     /translation="MEMLAFNPELLYSFQASAPGSRAFHLRLIELAAVAVHQIAVFLY
                     KQDTRVHDHHTNDPDYTVDGATSWDWEPPQQSGGYYPLLVPPPPWKTLFSHPYYVAHN
                     QYPDGLADVVGYWAEDRIFGGVVLFDRSQTWRRCDGEGPGASEPNFYMHSARDDVTFR
                     LWQVKNEEQEALVGFLLAPTPAPADNGPLPILPTRSHRVRIDPDRAIVDSKVYRDVWE
                     RPEPLHNRDRDDHRPRNPEDYPEEEDTQARIFALLYNKKPGSE"
     gene            complement(<737054..>738932)
                     /locus_tag="MYCTH_2063204"
                     /db_xref="GeneID:11510154"
     mRNA            complement(join(<737054..737681,737777..738594,
                     738711..>738932))
                     /locus_tag="MYCTH_2063204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663756.1"
                     /db_xref="GeneID:11510154"
     CDS             complement(join(737054..737681,737777..738594,
                     738711..738932))
                     /locus_tag="MYCTH_2063204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663804.1"
                     /db_xref="GeneID:11510154"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2063204"
                     /translation="MTVASQLFGFPSLTLAAAIEFLVAIRLFPDLVSSHGRLTLAAGA
                     ILVNYAFGLVFWAFLYPNFFSPLRRIRGPRAIVSAAYRALIVKEGPSGNLFLDLVRRY
                     PDEDLIALDCFGRQILVAKPHLLADLLVHRCYDFAKPRRISAFLRRVLGDGLITVEED
                     QHKFIRKNTMPAFRARHITDLYPMMWSKAGILVRTLDRQIASASSAESKGSGSAVLEL
                     TSWAHKVTLDIIGVAGMGRALNVVEKPGDPLQELYEELLEPDREKIIFAALSLAFGFP
                     VIRMFPWRMNNLFIYLTSSLENICRDLIKEKRKAIVENKDDHFDILSLLIKTGNFDDE
                     VLKDQLLTFLAAGHETTASALTWSSYLLAKHQEYQKKLRDEVTEALGEKPLAGEPPDD
                     LAGVLKQLPYLNGIMHETLRLYPTVPLTMREALRDTRLGDQAIPKGTEVVVSIWQVNR
                     SAEIWGPDADRFRPERWINADDGKANRHGGARSNYDFLTFLQGPRSCIGQEFAKAEMR
                     CLLAALVTSFSWDLAMDESKIVPRGVITIKPEHGMYLRMRPLHHSAA"
     gene            complement(<740654..>742716)
                     /locus_tag="MYCTH_2037656"
                     /db_xref="GeneID:11510155"
     mRNA            complement(join(<740654..741405,741618..742173,
                     742360..742554,742657..>742716))
                     /locus_tag="MYCTH_2037656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663757.1"
                     /db_xref="GeneID:11510155"
     CDS             complement(join(<740654..741405,741618..742173,
                     742360..742554,742657..742716))
                     /locus_tag="MYCTH_2037656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663805.1"
                     /db_xref="GeneID:11510155"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2037656"
                     /translation="MVFPGRFSTGCLRCRQRKVKCDEARPSCRRCCIYGKPCPGYTDQ
                     FQFRHRGTQLGPGSSAASGQRERAGEAAGATVAGAGKKQGQQHQHQHQHQHQHQQLQQ
                     GAVQTLPWDRALVRAPDPSYDDLSLSYFVRRFVSPNPTDGFPGHLSFLPSLYDSHSQG
                     LLEAATLSVAQMAAYNKFGGERFRVQSYRNYGRAIRMLQDIIRSEHQATDDRVITSVL
                     LLCTLKDISGEGSGDPGEHAPGLYYLVEKRGPEQIATSRGAELLFLALIRLVIYSFLH
                     DDDTYVDPGSIATAWGAFDPLLRALSMMSRTLSLRKRLLSPGAEQPPLVDDPVEQAAV
                     LHGCFETLDAFHRWDEEAAEYWKTTFEGRAVPTALGEVAPPSSSSAAAAGGGGGAAPQ
                     HYDVETACTIILTRSERLILLMSMIAYHYYQERDGRGAETGLAECVPVLGQHVGMAID
                     DILASVPYALGDVGPGGVPSSLAHDGAAAIVIVQSIRLVASCALASPAQLRSANDVLA
                     RLNAGIGIRAAAG"
     gene            743273..744854
                     /locus_tag="MYCTH_2305985"
                     /db_xref="GeneID:11510156"
     mRNA            join(743273..743415,743515..744854)
                     /locus_tag="MYCTH_2305985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663758.1"
                     /db_xref="GeneID:11510156"
     CDS             743639..744724
                     /locus_tag="MYCTH_2305985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663806.1"
                     /db_xref="GeneID:11510156"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2305985"
                     /translation="MASVLYSPVIELLDSAKRLVLSPLLTGPLLYSFTHPDAVRRVLA
                     AIAQHLPEQAAARLSSLPNSATVTVLQVLVALGLVRMVNGALNSMAANSWRLTAAPGW
                     DWPNEIAVVTGGSSGIGKGIVERLAALGVRVAVLDIQDLPKDLQGNPRVRFFRCDVTS
                     SESVGTAADAVRRELGHPSILVNNAGVAKTAPILQTDENFLRRILGVNLMSMWFTTQQ
                     FLPRMVQVNKGHIVTVASIASFVALATAADYSATKAGALAFHEALASEIKHQYKARNV
                     LTSVVHPNFVRTPLIEDFSSRLERRGVRLLTSDRVADDVVAQIKSRRGGQLIIPPSAT
                     GVSGIRGWPTWLQELLRDGVAAGAVKP"
     gene            <745615..>750181
                     /locus_tag="MYCTH_2063555"
                     /db_xref="GeneID:11510157"
     mRNA            join(<745615..745899,745969..746918,748651..>750181)
                     /locus_tag="MYCTH_2063555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663759.1"
                     /db_xref="GeneID:11510157"
     CDS             join(745615..745899,745969..746918,748651..750181)
                     /locus_tag="MYCTH_2063555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663807.1"
                     /db_xref="GeneID:11510157"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_2063555"
                     /translation="MKETQTPTAQIQVRNNRANRLLSYCYTLVATPFLLSRFALDVVL
                     YLVPWMRPAREWTLNQAVRVRVVRLVLLYWSLLRWGDRLHLRPGREGNRFEEKPEDYD
                     YYYYRGDLAVTTTTAAEDDDDDDAVRPEPIGATWTPARPPPPALVRPGLVVALHFHGG
                     GFAVGNGRDADAGFAAQTLIRHMGCTHVCAPQYRLASSGSGNGRFPAPVQDALTAYLF
                     LVRERGIPGRQIVVSGDSAGGTIALGLVRYIAEHGAALGIPRPGAVALWSPWVDVAAA
                     LQHDMRASPNYRTDYLNNEFGRWGAAAVSGYGAVDPSGPYLAPLHHPFRLGEEEEEEA
                     RPPPMFIHGGDREVLWDDIELLARRYADAGWTVHLHRSRHCPHDLILLGPRIGFAAEA
                     EEAARAARTFFLASTDLKLRERVCVCVCMPAMANGTPAGPGRPDDDGLSFDVLIVGAG
                     ISGINAAYRIQTEGPADTTYAILEGRDSLGGTWDLFRYPGIRSDSDIYTFGFPWSPWR
                     HDTALASGDQIKAYLAQSARSQGIDQHILYRHRVVSADWSSAGKEWDLRVVVDGREDQ
                     PPAVFRARFLLLGTGYYDYEKPLEAAIPGIETFAGKVIHPQFWPEDYDYTDKEVVIIG
                     SGATAVTVLPAMAERARRVTMLQRSPGYVFSLPSRGLLTALLFAVLPAAAAHYLCRLL
                     WLVRSHLTTAFCRAWPALAKRVIKRATLRQLPPTIPWDPHFRPRYNPWEQRFCACVDG
                     DFFAALRSGKADVVTDTIRTVTPDSIELGSGRALHPDVIVTATGLKLRFGGGIDFRVD
                     GEPFRWRDKFAWRSAMLQDVPNLLFLTGYETASWTLGADVSARLFVRILRRLRHRRAA
                     AVVPRPARPDMPERPMMSLTSTYLRTARDVLPKGGTGVWAPKTNYFADMARARWGDLS
                     KDLEFIM"
     gene            750857..753071
                     /locus_tag="MYCTH_2305988"
                     /db_xref="GeneID:11510158"
     mRNA            join(750857..752251,752381..753071)
                     /locus_tag="MYCTH_2305988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663760.1"
                     /db_xref="GeneID:11510158"
     CDS             join(751513..752251,752381..752820)
                     /locus_tag="MYCTH_2305988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663808.1"
                     /db_xref="GeneID:11510158"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008273"
                     /db_xref="JGIDB:Spoth2_2305988"
                     /translation="MSETSVTALTGYLDNLTAEEEAKLQEAWAHLLRLCGVEGSDKLP
                     PADRTGELLEQHLDPAGLKSAAVFRERLWSFILVDEPDVLVLRFLRARKWDVDRAVAM
                     LASAVGWRHERRLKADVIRRGDAVGPDAPADDDGSFLAQYRSGKAYVRGSDREGRPVF
                     VIRVRLHDPKLQSPEAMERFVLHNIETIRATLRHPREKACLLFDLTGFGLKNMDFHVV
                     KFLVQVFEARYPEYLGVVLVHNAPFIFWGVWKVIKPWLDPVIASKINFTSGGADLARF
                     IAPEELQTCFGGKDGWEYKYIEPVPGENDRLESEKKADVEAERDGLIRRFERLSVEWA
                     ALDARSAEAKQKSADRREVAKQLSDAYWKLDPYIRARTYYDRAGVLSSSGAVDYRAAQ
                     "
     gene            754186..756557
                     /locus_tag="MYCTH_2305992"
                     /db_xref="GeneID:11510159"
     mRNA            join(754186..756131,756284..756557)
                     /locus_tag="MYCTH_2305992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663761.1"
                     /db_xref="GeneID:11510159"
     CDS             join(754299..756131,756284..756346)
                     /locus_tag="MYCTH_2305992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663809.1"
                     /db_xref="GeneID:11510159"
                     /db_xref="JGIDB:Spoth2_2305992"
                     /translation="MRFSTLLVAASAPVGLFARESIDQLSPGELVAFLEKHNLAIVPK
                     SELTDALTELNALLKSQQLQQRHVVPIFRRDNGTANKSGQGQGGGGDGGATTSVTDSD
                     DEGSTVTAQLLGLDDLADLIRGLIKAIGDLPEILKAVEGLLTSEFLNGFHDAMVYLAQ
                     TLQPPAPELLQKLVKKAGPLVDLLDGLDLERLVDQLKGVDLAGLIGGVLKLLSDKNLE
                     NIESLVSNGAALLTPSFVNQTSTLIGGAAPLLAELGPLLEKVTPLLDKLGDVDLEGIL
                     DAVSPLLTKESIQGLVTLLQNAQQLLTQETVNSLKSLLKTAGPLLDSLGDLDLKGLLD
                     QVGPLLEELGKVDLKGLVEAVSPLLTPKSVRGLLGLLGNAENLLTPEFVKQTKGLIGD
                     AGPLLSALGEIDLQGLVKQLQPLLSALGKVDLAELLEQASPLLSQISPLLEELGKIDL
                     AKLVGQLSPLLDTLGEIDLRGLLDALSPLLTPQSVKGVLGLLDNAEDLLTARFVNQTH
                     TLVGGAVPLVAALEGVDIEGLLKKVAPLLEELGGVDLAGLVGAAKPLLDAVRKIDVKG
                     IVEQIMPLLTPESVKAIVGLVHNAGVLLSQTFVSQTSELIDDATPLVATLADLIHAVL
                     KEFVGKQ"
     gene            757159..759188
                     /locus_tag="MYCTH_2305993"
                     /db_xref="GeneID:11510160"
     mRNA            join(757159..757735,757816..759188)
                     /locus_tag="MYCTH_2305993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663762.1"
                     /db_xref="GeneID:11510160"
     CDS             join(757473..757735,757816..758965)
                     /locus_tag="MYCTH_2305993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663810.1"
                     /db_xref="GeneID:11510160"
                     /db_xref="JGIDB:Spoth2_2305993"
                     /translation="MATQPTTTTTTTTTPPTTTGPQGPVANAAGTRPENVLDDASSLN
                     DGVHEKGAPVGLSKREKAKQHFRRFWWAYVLALVIFLAIFLPILFKVIIPAIIRNVVK
                     DQELPVRGGALNFTAPTHLNMSMDTMLDTPLGVKIDSVPLNLYQPPADPEHDDTDVKG
                     PFLRLQMPDQHVNGETKIHAPEQVVQVLNQTQITAWFNEFFDKELVDLHIKANDMSVH
                     LGALDYKVDMDKTVKVPGLNYLKGFGVIDMKFSIPAEPSGRNLRGHLLIPNAGVIALG
                     MGNVSFNIMAGDVNLGLVRLYDFDLRPGNNTPAFDGEFYFDQLIPNLPAILDSQRSAL
                     AEGVVELHAKGNSTINYGRHIPYIEGVLNIKRVPMRIPVTTLLVDLMEALVSHGDGNG
                     NGTSSQGVPLLDHLGDVLGNRTLFEQMLSHWDSTGGGGDDAKGSASGGKKSSSLTRSV
                     RRSMHTNILKLGLRRLRSKF"
     gene            complement(<759970..>762735)
                     /locus_tag="MYCTH_53804"
                     /db_xref="GeneID:11510161"
     mRNA            complement(join(<759970..760460,760554..760836,
                     760966..761177,761316..>762735))
                     /locus_tag="MYCTH_53804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663763.1"
                     /db_xref="GeneID:11510161"
     CDS             complement(join(759970..760460,760554..760836,
                     760966..761177,761316..762735))
                     /locus_tag="MYCTH_53804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663811.1"
                     /db_xref="GeneID:11510161"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="JGIDB:Spoth2_53804"
                     /translation="MKWLGDFYERQWEGRWAERFARVRPYLPPINFITLHYAYFILSC
                     LFFALVFWGSGSSSSVKIGFLDSLFLIMSALTSTGLNTQNLSQMSLGQQIVLFLAMLL
                     GHPILVSLWTVLFRRHVFEKRFRAIVKRERERKLRAGSSIWLYSGFSDLLALARLKSL
                     SKSKSKCDEGQQQLPGLGSRIRAGQSSTSEVPGSESGRPRERDVEEGLAPIPENRLSR
                     SPGARSVVFVEPPRPPPGKAAAQEINRDRTAEVRNFLQEKRKNVGRNGEFFNLTLKER
                     EYLGGVEYRAIEVLVVTVALYYVLWQVLGALALGAWIAANAPEIPTANGQNAWWTGIF
                     LAVSAFSNTGLSLLDAGMTAFQSGYYFVVLVGAVLMLVGSQASPIFLRFIIWVCSRLL
                     RLATDSPNYEVWKETFEFILHYPRRVYINMFPARPTWMLGLWLGAFLIVDWIMFFLLN
                     IGNKALDKIPPGPRVVDGLFQSVSILSTGFSIVSVSAVYFGLQVLWLIKMYASAYPTS
                     ITVRGSNVYEERSLGIYAGDEPEMPHDDKGMKEKEGQQPLSPTSVSSQASRLSRLSVA
                     SRGGIDKIVDIGREGGQFISRQLQRRMTGFQGVGVPPGPLPRRPNKRPKTGALASAQP
                     TPYIQTSGGGGGSTKDAAGRGPDLMAHHVRSQLSHDVWWVALAFFLVTVMETSHTLAD
                     PAAFSLFNILFEVVSAYANNGISTGLPAASYSFSGGWHAGSKLVLILVMLRGRHRDLP
                     VALDRAVKLPSMDLDDKEEDDAEIRRFISRTAATPYMAGGEQSSPQARSPGRSVIRPF
                     APV"
     gene            764310..764389
                     /locus_tag="MYCTH_t105"
                     /db_xref="GeneID:11510162"
     tRNA            764310..764389
                     /locus_tag="MYCTH_t105"
                     /product="tRNA-Asp"
                     /note="Anticodon: GTC"
                     /anticodon=(pos:764343..764345,aa:Asp,seq:gtc)
                     /db_xref="GeneID:11510162"
     gene            764824..768535
                     /locus_tag="MYCTH_2315449"
                     /db_xref="GeneID:11506418"
     mRNA            join(764824..765527,765640..765717,765844..766341,
                     766459..766943,768069..768132,768212..768452,
                     768468..768535)
                     /locus_tag="MYCTH_2315449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663764.1"
                     /db_xref="GeneID:11506418"
     CDS             join(764992..765527,765640..765717,765844..766341,
                     766459..766495)
                     /locus_tag="MYCTH_2315449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663812.1"
                     /db_xref="GeneID:11506418"
                     /db_xref="JGIDB:Spoth2_2315449"
                     /translation="MSTQELSMDLPVIDLDVFLHQPRDSPAVQAECAKAADALITYGA
                     LVLHDSRVSEQDNDTFLDLLEDYFAQPEADLKKDERPELAYQIGVTLENTEKPKCAVD
                     EPCLRVIERLAPSERPLDISAHSPDPKCRFFWRMVEQPPYKTQFPVLNAENVTPEAPH
                     IKERWGPVMNQWGTAMKNAVEGLTQMAAVGLGLPVDTFKDAGRYGPHLLAPTASDLQK
                     YGQKDTILAGFHTDLNFLTIHGRSRYPGLHIWARNTGRRIPVKIPPGNYLLVQAGKQL
                     EHLTGGLIKAGYHEVVVNERTLQVIEERRARLPDRPLIRISSTFFWHLSSDYDLVPIP
                     ELAERAKLVRAQQFDLGKDEGEEVEYPPMKVGEQVQNELKHIALMASS"
     gene            766885..766964
                     /locus_tag="MYCTH_t106"
                     /db_xref="GeneID:11510163"
     tRNA            766885..766964
                     /locus_tag="MYCTH_t106"
                     /product="tRNA-Asp"
                     /note="Anticodon: GTC"
                     /anticodon=(pos:766918..766920,aa:Asp,seq:gtc)
                     /db_xref="GeneID:11510163"
     gene            770706..773000
                     /locus_tag="MYCTH_2306000"
                     /db_xref="GeneID:11506419"
     mRNA            770706..773000
                     /locus_tag="MYCTH_2306000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663765.1"
                     /db_xref="GeneID:11506419"
     CDS             770911..772878
                     /locus_tag="MYCTH_2306000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663813.1"
                     /db_xref="GeneID:11506419"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2306000"
                     /translation="MALHTSLSLLVIGMFSAAAVSAQHVLVPFSQHKDVVLSARASSE
                     RGALKSSAGYAYVVDATVGTPPQNLSLLISTTTGDTWVPDANTRECSPQWYYRTYYDD
                     SYGDDDDYSDALSGSLCRWGSFNSTLSSTYLPPNSRYDDFSVSYADMNYVSGRNMTDR
                     LAFADVEFDDYPMGLVSSAYRWIGVLGLGYNSSSGYYTASSSAGVYDNLMDRMVLSGK
                     IATPAYSIWLDNAQASSGSLLFGAVDRSRYSGDLVRLPTGYNSYSYSYQYGFSVTLNA
                     INGTSASGVPMPAIRTNDFPVDVVLGHGEVFSFLPDSLADQIAAMAGATYNKSLGYFT
                     IPCDAGERNNTKFVFEIGGEGGPKLDVETADLVQPSIMYSDLTWYDSPLESGMCFFAI
                     QKYYTDSSSTSSYSNLYSLGGSILRRTYVVYDLANHEIAVAPVKFPSDGSTPTPEIKA
                     FESYGAYAPGASEFCTSNYCSSNYGGSGSGSDDNPDHKYYGPYGPGFDYWKKIAIGVG
                     VSFGVVALVGAVTAIILCRRASRGTGAAKEVDEEDSAGHTTPAGSSSPTVAQNPIGGS
                     TVVPPGPLPAIQERSEAQTGEPRLPASGNQIIVQPATPPEPTGSANSNTQSAAVSAPS
                     SERAPQREVRDDASAPEAGAAAPPSPKGKEK"
     gene            <773572..>774114
                     /locus_tag="MYCTH_51515"
                     /db_xref="GeneID:11510164"
     mRNA            join(<773572..773770,773975..>774114)
                     /locus_tag="MYCTH_51515"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663766.1"
                     /db_xref="GeneID:11510164"
     CDS             join(773572..773770,773975..774114)
                     /locus_tag="MYCTH_51515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663814.1"
                     /db_xref="GeneID:11510164"
                     /db_xref="JGIDB:Spoth2_51515"
                     /translation="MAVTDAMTDLIKSVGELLSSVSDAAYAIVHSFVSGIFNLFAGLY
                     AFLSDLGKGVFDLAGGVGKFIAGNAVIIVVLVAAVFAYTRFVRTPQAQQAQGRKPAVT
                     KEVGAGKKTN"
     gene            complement(774541..777963)
                     /locus_tag="MYCTH_2306004"
                     /db_xref="GeneID:11510165"
     mRNA            complement(join(774541..776982,777060..777369,
                     777468..777963))
                     /locus_tag="MYCTH_2306004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663767.1"
                     /db_xref="GeneID:11510165"
     CDS             complement(join(774545..776982,777060..777369,
                     777468..777827))
                     /locus_tag="MYCTH_2306004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663815.1"
                     /db_xref="GeneID:11510165"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="JGIDB:Spoth2_2306004"
                     /translation="MYGYSSSSDTDDEYYYRKHKGAAPTNNNSNDANKKKKKRKLPPQ
                     QSINRIWKRFSNKRFNKALAVLPFDPVLPPVLCDRSNELLTAGYERAVEECRRKVQKI
                     IQECRRVNTRYRDPGWDIDWDLKMEKGHCLNSLGRNKFDLSMSSMMNPNSVVPKAVKR
                     VHEIFENPTFLANVSGSDVKQGSLGDCWLMSSLSGLANVKDGIRRICVEWDTRIGIYG
                     FVFYRDGEWIYSIIDDKLYLKSPCWDSPSLQRDLLQQIDREDVERVYRKTYQTGSKAL
                     FFAQCKDQNETWVPLIEKAYAKAHGDYLSLSGGWIGEGLEDLSGGVTTELLASDILDL
                     DSFWENELSKVNEEFLFGCSTGLLDGGYGDRDGIEEGHAYLVMEARTLKNGTRLVKLR
                     NPWGMNKKGLWEGAWSDGSKEWTTEVQEELNHQFGSDSVFWISYEDMLRKYQHFDRTR
                     LFRDPDWRCCQRWIGVDVPWKPQYHEKFHIKLTREGPLIIVLSQLDNRYFRGLQGQYT
                     FRLQFRVHEQGRPDPEDYIVRSHGNYLMSRSVSVELPSMLPGTYSVFISVAGERNPDV
                     PSVEEVVKRECKKRVENEKLAQVGYAYDLAHSKGAAHLEAVKKARKKADQKKASEARQ
                     KERHRLWEKRHLNRQITKKQGRKNNQKLEAKQAAREEKRRKAEELKPQDKGVQTEEPK
                     QDKPEEDKEQAKGAASEEKPKAEGKADSEAKKEDMQTQGGDKADDGDDSPDSTPIATP
                     VETPTTETASQLADNADGTGDSESKPEEKAGSCAGSDSSGSPSPTPKTDASSTPSPDV
                     KDKDTEKVPVPPVDESKVSGGPPPPPAAAEKKAPNMYVTSDGESSASPISDWEELYSS
                     DDMSRKPRMAAPAPPNTATVSKYHDETEDENEPDPWNAIAIVGLRVYSKDEDLELRVV
                     MEGGELLEGGMGEKGGVDLDNAQANAGGARTTTRPDKKSEEEEEEDAEAYEGDSEVEK
                     KKKEKMMGKKGKKKDNDGDGSEGEGVADKEQAVVDDGMAPYAVIVQKGKGDEEYETAA
                     ETLMD"
     gene            complement(<779925..780291)
                     /locus_tag="MYCTH_2306006"
                     /db_xref="GeneID:11510166"
     mRNA            complement(<779925..780291)
                     /locus_tag="MYCTH_2306006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663768.1"
                     /db_xref="GeneID:11510166"
     CDS             complement(<780032..780234)
                     /locus_tag="MYCTH_2306006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663816.1"
                     /db_xref="GeneID:11510166"
                     /db_xref="JGIDB:Spoth2_2306006"
                     /translation="MAVGYAIGNSGLYELQSCSPDAPKSASRQRRDSKVTSARSRMGP
                     CSSSGSVKSVPPTERGCLIESDD"
     gene            782189..783799
                     /locus_tag="MYCTH_2306007"
                     /db_xref="GeneID:11510167"
     mRNA            join(782189..782328,782543..783053,783144..783799)
                     /locus_tag="MYCTH_2306007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663769.1"
                     /db_xref="GeneID:11510167"
     CDS             join(782679..783053,783144..783533)
                     /locus_tag="MYCTH_2306007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663817.1"
                     /db_xref="GeneID:11510167"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="JGIDB:Spoth2_2306007"
                     /translation="MSPTGDQPPPRVAILLNSYRSPFISEIRDSYVRCIGAVRPDAQL
                     AFFYPADKPGDFPDPAAFDLIVIGGGNADPRKKHPWILRVHQFILDVVANHPRKKLCG
                     ICWGHQTISMLFGAELVDMETPELGVTEAQLTPAGRRFFARQGGNDKVLLQQHHRRKV
                     VTPPKGFHELLVENQSFLSYNNAILTLQGHPEKDARCAKLRIRDATRWFGVEEDDKAA
                     LASFAEAMEREDDGPEIWRRIFQWVREKHPGHEGRL"
     gene            complement(<783857..>784833)
                     /locus_tag="MYCTH_2064349"
                     /db_xref="GeneID:11510168"
     mRNA            complement(join(<783857..784223,784300..784382,
                     784672..>784833))
                     /locus_tag="MYCTH_2064349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663770.1"
                     /db_xref="GeneID:11510168"
     CDS             complement(join(783857..784223,784300..784382,
                     784672..784833))
                     /locus_tag="MYCTH_2064349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663818.1"
                     /db_xref="GeneID:11510168"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="JGIDB:Spoth2_2064349"
                     /translation="MSSPSLNKIAANSPSRQNPSELEQAIAGALYDLETNTADLKVAL
                     RPLQFVSAREIEVGHGKKAIVIFVPVPSLQGFHRVQQRLTRELEKKFSDRHVLILASR
                     RILPRPKRSSRSRNTLKQKRPRSRTLTAVHDAILTDLVYPVEIVGKRLRTKEDGSKTL
                     KVILDEKERGGVDYRLDTYSEVYRRLTGRNVVFEFPQTTIADY"
     gene            785149..786015
                     /locus_tag="MYCTH_2315454"
                     /db_xref="GeneID:11510169"
     mRNA            785149..786015
                     /locus_tag="MYCTH_2315454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663771.1"
                     /db_xref="GeneID:11510169"
     CDS             785385..785681
                     /locus_tag="MYCTH_2315454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663819.1"
                     /db_xref="GeneID:11510169"
                     /db_xref="JGIDB:Spoth2_2315454"
                     /translation="MSQLANLYFAFALTEALVLRSTSDLRVWRTVLFCLLVADFGHLY
                     TVSALGPKIYWNVFEWNAIDWGNIGYVYFAALMRVAFLTGVGFVGKGERLRKAA"
     gene            786723..788203
                     /locus_tag="MYCTH_112014"
                     /db_xref="GeneID:11510170"
     mRNA            join(786723..787014,787078..787306,787461..788203)
                     /locus_tag="MYCTH_112014"
                     /product="alcohol dehydrogenase-like protein"
                     /transcript_id="XM_003663772.1"
                     /db_xref="GeneID:11510170"
     CDS             join(786810..787014,787078..787306,787461..788109)
                     /locus_tag="MYCTH_112014"
                     /note="Alcohol dehydrogenase-like protein"
                     /codon_start=1
                     /product="alcohol dehydrogenase-like protein"
                     /protein_id="XP_003663820.1"
                     /db_xref="GeneID:11510170"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_112014"
                     /translation="MSVPEKFTGFQVHSAETWLEFHKNEFQPKPFGDYDVDIKIECCG
                     VCGSDLHTISGGWGEQHYPLAVGHEIVGTAIRVGPKVTLIKPGQRVGVGAQSYSCLEC
                     RQCKNDNETYCLKQLDTYGAVWPDTGIVSQGGYSSHVRTHEHWVFPIPDALPSTIAAP
                     MLCAGLTAYSPLVRNGCGPGKKVGIVGLGGIGHLGVLFAKALGAEVWAISRTHAKEED
                     ARKMGADGFLATADKDWNKPHVMTFDLIINTANSFEGFDLDAYLSLLDVHGRWVSVGL
                     PEGDGIKVRNQQFLKNGCFIGSSHLGSRKETLEMLQLAADKGIKTWVEEVPINEKNLA
                     TIMQRLHKNDVKYRFCLTNYAEQFGA"
     gene            complement(<788331..>790190)
                     /locus_tag="MYCTH_2064870"
                     /db_xref="GeneID:11510171"
     mRNA            complement(join(<788331..789828,789886..>790190))
                     /locus_tag="MYCTH_2064870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663773.1"
                     /db_xref="GeneID:11510171"
     CDS             complement(join(788331..789828,789886..>790190))
                     /locus_tag="MYCTH_2064870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663821.1"
                     /db_xref="GeneID:11510171"
                     /db_xref="InterPro:IPR008603"
                     /db_xref="JGIDB:Spoth2_2064870"
                     /translation="VAMAALAPYTYIQCPCSDAATLGRPSDPNSSTGADAEEDDRTFD
                     PRAPRSNYSLYPLEYLMYCEDCHQIRCPRCVSEEIVTYYCPNCLFEVPSSNLKSEGNR
                     CTRSCFQCPICIGPLAVTSIETKPDPSLLAAPDNTAAPHSGPYALTCSYCNWSSTEVG
                     IKFDKPNGIHAQLAKLRNGGSTRLTAKDRKERRKDPAYRSQGTNTGEGGSGAEEKLDL
                     ETQFANLKAFYQSQLADPNSMDTGLAALGGLGFSSPASLSRLMSIYTGGSLQDRKTRS
                     RVGAMREAIRPDEGLQIANLDESAAIEALRSEGYDGTASTAQLADQPPNLGEEHLHGR
                     RRFVSELRPIPYLLRTKRSKRCPVCRHIISKPESKIQTTRFRIRLVASSYIPSIAIRP
                     LSLSATGGSSASGAAVPGAPLEPLKPAHFLLTFKNPIFETVKVTLGAPAETPGRFASK
                     VTVLCPVFEIDANTDVWEEALKEGSSGSGGGGGGERGERRRRNGDEGGLGSAGQPGGN
                     QLEVGKIWERGRNWVSIVVEVVPAQLKVEPGDAPLREDEDVLEVPLFVRVEWEGEAGG
                     DEVIPSAAAKDKGEAKEKRELAYWCVLGLGRIRR"
     gene            complement(790773..791434)
                     /locus_tag="MYCTH_2306018"
                     /db_xref="GeneID:11510172"
     mRNA            complement(790773..791434)
                     /locus_tag="MYCTH_2306018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663774.1"
                     /db_xref="GeneID:11510172"
     CDS             complement(790826..791278)
                     /locus_tag="MYCTH_2306018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663822.1"
                     /db_xref="GeneID:11510172"
                     /db_xref="JGIDB:Spoth2_2306018"
                     /translation="MAPRSGSSGNNVASQGGWAHTPSTLILLWMAVSLPLVVWDTGYM
                     LLRPHTMPGGRLHYPVWVPYALYGEVDHMYGSKQWNLRNPFAAGQSIMNAVETLLYLV
                     YLGLWYAYGSPPAPGARRAVGGRVGGLAVLIGFSAAVMTVSKTVLYCA"
     gene            complement(791859..792626)
                     /locus_tag="MYCTH_2306019"
                     /db_xref="GeneID:11510173"
     mRNA            complement(791859..792626)
                     /locus_tag="MYCTH_2306019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663775.1"
                     /db_xref="GeneID:11510173"
     CDS             complement(792049..792558)
                     /locus_tag="MYCTH_2306019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663823.1"
                     /db_xref="GeneID:11510173"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="JGIDB:Spoth2_2306019"
                     /translation="MICRACLRARSAPTSETFLSQRLLQTAQKQSISTFTARLRPSMT
                     AGVRASCSQLSKRPSRHQPFSTSSSISSAAAQPQESAPTPSGTPEKPNYLSEGESQIW
                     DILVAEFAPTQLVVQDISGGCGSMYGIEICSEKFRGLNMLKQQRLVNAALGDLMKEWH
                     GVQLKTRVP"
     gene            794801..797850
                     /locus_tag="MYCTH_2306020"
                     /db_xref="GeneID:11510174"
     mRNA            join(794801..795012,795070..795420,795500..797850)
                     /locus_tag="MYCTH_2306020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663776.1"
                     /db_xref="GeneID:11510174"
     CDS             join(794893..795012,795070..795420,795500..797722)
                     /locus_tag="MYCTH_2306020"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663824.1"
                     /db_xref="GeneID:11510174"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR010435"
                     /db_xref="JGIDB:Spoth2_2306020"
                     /translation="MVRLDWAAVLLAATAVAKAVTPHTPSFVPGAYIVEYEEDQDSHA
                     FVNKLGGKASLRKDLRFKLFKGASIQFKDTETADQMVAKVAEMPKVKAVYPVRRYPVP
                     NHVVHSTGNVADEVLVKRQAAGNDTFSTHLMTQVNKFRDAGITGKGIKIAVIDTGIDY
                     LHEALGGCFGPDCLVSYGTDLVGDDFNGSNTPKPDPDPIDNCQGHGTHVAGIIAAQTN
                     NPFGIIGAATDVTLGAYRVFGCNGDTPNDVLIAAYNMAYEAGSDIITASIGGPSGWSE
                     DPWAAVVTRIVENGVPCVVSAGNDGDAGIFYASTAANGKKVTAIASVDNIVTPALLSN
                     ASYTLNGTDDFFGFTAGDPGSWDDVNLPLWAVSFDTTDPANGCNPYPDSTPDLSGYIV
                     LIRRGTCTFVEKASYAAAKGAKYVMFYNNVQQGTVTVSAAEAKGIEGVAMVTAQQGEA
                     WVRALEAGSEVVLHMKDPLKAGKFLTTTPNTATGGFMSDYTSWGPTWEVEVKPQFGTP
                     GGSILSTYPRALGSYAVLSGTSMACPLAAAIYALLINTRGTKDPKTLENLISSTARPN
                     LFRLNGESLPLLAPVPQQGGGIVQAWDAAQATTLLSVSSLSFNDTDHFKPVQTFTITN
                     TGKKAVTYSLSNVGAATAYTFADAKSIEPAPFPNELTADFASLTFVPKRLTIPAGKRQ
                     TVTVIAKPSEGVDAKRLPVYSGYIAINGSDSSALSLPYLGVVGSLHSAVVLDSNGARI
                     SLASDDTNKPLPANTSFVLPPAGFPNDTSYANSTDLPKLVVDLAMGSALLRADVVPLS
                     GGAATATARLTRTVFGTRTIGQPYGLPARYNPRGTFEYAWDGRLDDGSYAPAGRYRFA
                     VKALRIFGDAKRAREYDAAETVEFNIEYLPGPSAKFRRRLF"
     gene            799819..801343
                     /locus_tag="MYCTH_2306025"
                     /db_xref="GeneID:11510175"
     mRNA            join(799819..800408,800482..800718,800796..801343)
                     /locus_tag="MYCTH_2306025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663777.1"
                     /db_xref="GeneID:11510175"
     CDS             join(800039..800408,800482..800718,800796..801022)
                     /locus_tag="MYCTH_2306025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663825.1"
                     /db_xref="GeneID:11510175"
                     /db_xref="JGIDB:Spoth2_2306025"
                     /translation="MKFLSTALAAVMAGSAMAAPVLENTTSCPCNNGGDDGYDVDAPT
                     VDLPTAYSTTAVTISTATTVATTVATTVPISLNTSVPVPNGDDGADVDVDTADVVVVV
                     KTVVATVVDVEAKVKGHLDLIAQICAGADIDAQALLKVLVDLKVDLQVLLDLVPKLNG
                     LVIDANALVAADVQVILDLVVRVEALIAEIQTVLAGLAKLKAEILAVIGVELHACLDL
                     VVSIVGPVVNFALAVVAKLSAIVELKVLVGQVSAVVGKLNAHISALLHVLGPVFKLLH
                     L"
     gene            801976..803203
                     /locus_tag="MYCTH_2306027"
                     /db_xref="GeneID:11510176"
     mRNA            join(801976..802234,802396..803203)
                     /locus_tag="MYCTH_2306027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663778.1"
                     /db_xref="GeneID:11510176"
     CDS             join(802101..802234,802396..802732)
                     /locus_tag="MYCTH_2306027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663826.1"
                     /db_xref="GeneID:11510176"
                     /db_xref="JGIDB:Spoth2_2306027"
                     /translation="MKFFSSVALFLASLATANPVSHNGPGPYHISEFYASKIHDSGTC
                     IYDFDVTAPGLDGAVHCHASVDAGFSGATWLAYVYEGAGNCNNSAVTWTFFQPASPVG
                     SDAQFNVTVNGVKRRRIIPGSDISVNLNNETNPFDNDVYYSGPREFDITESVNN"
     gene            complement(<804559..>805152)
                     /locus_tag="MYCTH_16301"
                     /db_xref="GeneID:11510177"
     mRNA            complement(<804559..>805152)
                     /locus_tag="MYCTH_16301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663779.1"
                     /db_xref="GeneID:11510177"
     CDS             complement(<804559..805152)
                     /locus_tag="MYCTH_16301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663827.1"
                     /db_xref="GeneID:11510177"
                     /db_xref="JGIDB:Spoth2_16301"
                     /translation="MASLRSLLAAGLLFLSAANAHFELNQPTPLEGDKMDESLESSGP
                     CGGGVPDLSKNTATDFHVDGDAVSLLLAHPQANYLIRGTLDDKAAGNWTQLFPIVQQS
                     GRGDFCEPSVKAPKEWAGKKGFIGIACAAPDGMLFQCAAVNFVSGAADEVPSSCANGT
                     SVSISFTDDASLSALLGDSSTNTPTSTAGSPSQSTSGS"
     gene            806729..808902
                     /locus_tag="MYCTH_2306028"
                     /db_xref="GeneID:11510178"
     mRNA            join(806729..807084,807141..808902)
                     /locus_tag="MYCTH_2306028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663780.1"
                     /db_xref="GeneID:11510178"
     CDS             join(806945..807084,807141..808866)
                     /locus_tag="MYCTH_2306028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663828.1"
                     /db_xref="GeneID:11510178"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Spoth2_2306028"
                     /translation="MEGTHTHMNMFSTVNTDLARRYWYTVAGFAGAFMMIRAVNFYKA
                     QLRLRRKAANSVEFPTKPSNRVLEIWATLTAVVREASAPQLHIPFRGFSWLTPPPLGR
                     LITLLVYWIIIIYMMTINVVVKDVFFWERIGYRNAWVTITQVPLLYLLASKCSVVGFL
                     VGTSHERLNWLHRWVGRTMFVTASVHGWHFFTDWVRTDFVEYEFRVMPSVKYGLGAWA
                     VLLWTLLSGLAPFRRMAYELFVLQHLLSAAFFLWLIYVHVPSNARYNVWFAIAALCFD
                     RFCRIGLLLWRNVKFFPDKSKCRGGQRIGHQAQFKAVGESITVITIKDVHFKWRPGQH
                     LYLWVPRLGPLEAHPYTIACAHKLPGTCICNSIQLVVRKHGGFSRRLHEFAAKTGGKE
                     HQTVFVSGPYGAPPRWDIYETIVLISASTGASFTLPILEGLLKSKRTNCVKRVDFLLA
                     ARQGEEIDFYVSRLHTLIGRATEVGIELAVHIAVTQGASTFMQDPRAAGIQNVGTASV
                     ASSGSNLGEAMDEKVAGGSSADVEQQPVRGARKRASEASTDSHVYFSSVRPDVDDFIR
                     GAVEATGGETSVVVCGGPSLVSRVRNCVAALSDERAVHKGTGAQGIHLFAEEYNF"
     gene            809463..811994
                     /locus_tag="MYCTH_2306029"
                     /db_xref="GeneID:11510179"
     mRNA            join(809463..810053,810113..811320,811401..811814,
                     811866..811994)
                     /locus_tag="MYCTH_2306029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663781.1"
                     /db_xref="GeneID:11510179"
     CDS             join(809781..810053,810113..811320,811401..811814,
                     811866..811872)
                     /locus_tag="MYCTH_2306029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663829.1"
                     /db_xref="GeneID:11510179"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR015945"
                     /db_xref="JGIDB:Spoth2_2306029"
                     /translation="MEQLAQKVGGMSLDAITEKYPNCHPEINPFDFYRAHLANVLSGI
                     TGVEPKIIYPALSWTSGLDKGDLMLAAPALRIKGQKPDELAQQWADKFPEDDPLFQKP
                     TVVNYFLAFYLKPQPVVQTVIPLIQKQRAEYGRNKYHGLRDPKDPSKGKKRMIVEFSS
                     PNIAKPFHAGHLRSTIIGGFLANLYEGAGWDVIRINYLGDWGKQYGLLALAFEKYGDE
                     EALKQDPINHLFQLYVRINSEMSAEKEQIEKRKQEGEDVTELEANSLDEQARRYFKKM
                     TDRDPSALAQWKRFRDLSITRYQETYARLNIKFDEYSGESQVSEEMMERIGKEMQEKG
                     ICKEDKGAMIVDFQELVPGKEGKRLEKPIVRKRDGTALYLTRDISELLARYEKYKFDH
                     MIYVVASAQDLHLRQLFKIIELLGHKDIADKCQHVNFGLVLGMSTRKGTVKFLDDILR
                     DVADKMHETMKKNETKYSQVENPDATADTLGISSVMVQDMSGKRINNYTFNMDAMTSF
                     EGDTGPYLQYAHARVSSIRRRAGLSDEDLANADLSLLTETHAVNIVRLLALWPDIVQT
                     TLRTLEPTTVLTYLFKMTHALSSSYDHLQVVGSERELMKARMALYDAAHTVLGNGMRL
                     LGLTPVERM"
     gene            813288..814345
                     /locus_tag="MYCTH_2306031"
                     /db_xref="GeneID:11510180"
     mRNA            join(813288..814061,814171..814345)
                     /locus_tag="MYCTH_2306031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663782.1"
                     /db_xref="GeneID:11510180"
     CDS             join(813329..814061,814171..814256)
                     /locus_tag="MYCTH_2306031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663830.1"
                     /db_xref="GeneID:11510180"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2306031"
                     /translation="MSRKAAWFRQRKLCNFLMHTSTSASLHSYPTLERDRFLYLLFLW
                     PDQYIEWIEQLTSRTVSRLCWGTPQPGQILRHTTLGLLETISPSGSLPNVLNFLRHLP
                     FLLSPWKRKEKGRRELEMRLFDANLAFVQDGLDRGQAGPSFVRAFFETKEDPDERVRQ
                     RWGDVPEAVNVVGLMAIAGALTIGSPLQSYMLAMLHYPEWQSRLQDEIDAVCGGACPQ
                     WDDRERLPLLRAVVKEVIRWRPPVPTGIPHASEADDVYNGYFIPAGATIHALEW"
     gene            814312..815266
                     /locus_tag="MYCTH_2306032"
                     /db_xref="GeneID:11510181"
     mRNA            814312..815266
                     /locus_tag="MYCTH_2306032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663783.1"
                     /db_xref="GeneID:11510181"
     CDS             814632..815222
                     /locus_tag="MYCTH_2306032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663831.1"
                     /db_xref="GeneID:11510181"
                     /db_xref="JGIDB:Spoth2_2306032"
                     /translation="MGGMAWGFNIGKKRDPQHAGRELAVHWNDYTPLLIAKPSIFPFE
                     ATPRSPEKAGRMRAMYGASVAAGRLPRDMDLGQFRDELGDQVYCDVDDDLMRCEQEEE
                     REEEEAGKARDVPAVGGGEQDEHNGEMKEAEVMGREETGEVEESGENDKAGDVDLSEP
                     RFSPKFQRHSPSCSGRERPSPIRFVEVAPDVGGENW"
     gene            complement(816882..818491)
                     /locus_tag="MYCTH_2306033"
                     /db_xref="GeneID:11510182"
     mRNA            complement(816882..818491)
                     /locus_tag="MYCTH_2306033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663784.1"
                     /db_xref="GeneID:11510182"
     CDS             complement(816895..818436)
                     /locus_tag="MYCTH_2306033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663832.1"
                     /db_xref="GeneID:11510182"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="JGIDB:Spoth2_2306033"
                     /translation="MSTPRRSTYVYSGTGYQPFAVQEDRPLPDPYRSLRGPPPAQAEE
                     AGFQSSQSTIRGSPTASGRSSTEYSESYVGDIEKSLHNDTVPSLPLHSLQSDNGSHDG
                     EQQDKEKYGAPGVEMKSTTTTTGAAADHSGETGARARPKLPIRERLKHFTWAWYTLIM
                     STGGLSLLMRAQPHQFPGLFQIGLAVFVINIVLFVLVTLAQIARFVLFPGIFARSLGH
                     RREGFFFPTFFLAVATLITCTQRYCVPEDADEARATAGTLLWLLRAAFWTYLLLATCV
                     AVGQYSYVFSAHSFGLQTMMPTWILPIFPVMLSGTIASVIAGSQPPEEAVPIAVAGLT
                     CQGLGIAVAFMMYAHMVGRLMQSGLPDREHRTGLFMCVGPPAFTALAFIGLATGLPQD
                     FDHDMDGFVDAVVIETMGLVGAGFLWALSFWWFGIALLAVLQSPPEHFHLGWWASVFP
                     NTGFVLATISIGKAYHSEGILWLSTALSVVLLLTYLFVLYHHVRAVIVQDIMYPGRDE
                     DVEDH"
     gene            complement(819377..824754)
                     /locus_tag="MYCTH_2306035"
                     /db_xref="GeneID:11510183"
     mRNA            complement(819377..824754)
                     /locus_tag="MYCTH_2306035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663785.1"
                     /db_xref="GeneID:11510183"
     CDS             complement(819555..824585)
                     /locus_tag="MYCTH_2306035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663833.1"
                     /db_xref="GeneID:11510183"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2306035"
                     /translation="MTSNGVPVNQPPDPTLDAVMDGLPEPFPAPDPTRFPNTRRRISS
                     SATKGFRTNPPDSQTSDPDTCRICRGEGSEDEPLFFPCKCSGSIKYVHQDCLMEWLSH
                     SQKKHCELCKTSFRFTKLYDPNMPKSLPVHVFLRHTAKYLLRNLLVWMRAALVANVWL
                     VWLPYLMRTIWSFLFWISDEGLGGKAVVSGVGSGEFDLIAGASHNSNVCPSSPLFAAT
                     TTVASIGGVIDNLPPESARLVKGLYGIKLTSSDPIYSAILRLFFGPVATRDKPAVGLN
                     ATGAAPTPSLYHKSLLSDVDFLRNLTRHPSINRAVIHVLEGQIITILVIVCFILIILV
                     RDYVVQQQPEINMRAAFAAVENPVQPAAVEPANAEVQAEAEPDDEQFEDVLDETTYAF
                     DDTNSETADEDLRATLRDRLPDEPAESSSRPMSPNLVPPTIPAQGNDMQGLDRTTIQE
                     YLDIYREAGGNLEEVLRIARERNLEVKLDHWMRLTRSMMARQRDNDAVRTDQAEPSGS
                     VALREEKSDTNPFGPLVDESETSEENNSKGKEILVEDAEDTWGQPMGLPLRPRAHTDG
                     PLINNTVNPFANNNWSFTDLPPDPPSRDSVVPESGIQRPSEHAFPAWEAPESSSDATA
                     PRDRGASTDDSSQALPVGPDSPNRADAQPVPQAPNARGPAGFIGRIADFMWRQVDAID
                     PDDLAPVDFLGDFAEDEPEEEVVENAPANEAGQDRQGADAAGGLDAEAIEDAEDLEGI
                     LELLGMRGPVAGLFQNAIFCAFLVSITIFVGVFIPYNIGRVTIWGLANPMRIARMLFS
                     LSKFLQDCLLLFLGLASSTISESFYLLSRALWLSSVADYSLRAVNASWFMALGAANRI
                     GAGFVTELPLISASEVRNFSAISHAALFVLKDRIVLALSSLWHFVEFFFGGDYTVKGA
                     EAYAAAAKILVFVKRLLPTVFNPTSWVLNFDLPKNTDTINHELAYWAGMDRFWATLAG
                     YIAISLMAALYLRRGAPLSTTQAAQEWEASIIDGLNQASGVMKVILIISIEMLVFPLY
                     CGMLLDVALLPLFEHTTLKSRLLFTLNYPVTSIFVHWFIGTGYMFHFALFVSMCRKIM
                     RKGVLYFIRDPDDPEFHPVRDVLERNVTTQLRKILFSAFVYGALVVVCLGGVVWGLSV
                     SLPVLPIHYSSNEPVLEFPIDLLFYNFLMPFAVKFFKPSRRLHAMYTWWFRRCARALR
                     ITWFLFGERRVDEEGQLILPQDSPDRNLPFWRRWFLEVDSNGRVVARSWRGILQGGTE
                     KSLATKKERIPRKESLIRSGQLIPDGRFVRTPASDQVKIPKGAAVFLDVDENNKRLDK
                     LPETDIYSTKQYQLVYVPPHFRFRIFLFILLIWIFAAVTGVSITIIPLVFGRWMLKQL
                     IPPHIRTNDIYAFSIGIHILGSASYALFRVRAIYSTKNYLAAALGALGHRDVFRRTWH
                     AVSRAARVAFTYFFTLVVFPLLAASLLELYALVPLNEVMYGSVLRPGFPNSVAAGSVK
                     PTVPTHTIRVVQTWTLGLLYLKLAMRITNTVFRGSRVSNAARAVIRRGWLDPDVSILT
                     RVFVIPGLTIWLVAVATPLLLAKTVIANGFAHTLIRNFVTGPVHEPPDQALYDVFVVL
                     IYRMSFPFVAFVILGGLSLWSMLGVFRSWQVRIRDEAYLIGERLHNFGGTNAFRDRAV
                     WRHGRRRI"
     gene            826060..829494
                     /locus_tag="MYCTH_2306036"
                     /db_xref="GeneID:11510184"
     mRNA            join(826060..826415,826478..829494)
                     /locus_tag="MYCTH_2306036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663786.1"
                     /db_xref="GeneID:11510184"
     CDS             join(826243..826415,826478..829370)
                     /locus_tag="MYCTH_2306036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663834.1"
                     /db_xref="GeneID:11510184"
                     /db_xref="JGIDB:Spoth2_2306036"
                     /translation="MDDTNGTPRTSSSSSSRAANGINGATKSPVNGHAPSNKTRTKPR
                     GPGLFSRTFSIAARLLTWYTILTILFRCPASLDACDDTSPRICKPYFQLKHVVAPHVE
                     PYYDAYAAPYVEAVRPYYNIVDQKIIAPSWGYARQYGAPRLQQVQAFAEVQWEKTVQP
                     QVKRYQSLARAQYDEKLAPHVNTITTALGPYYEIARTNSLQTYHEFLVPAYLYMQPYL
                     VEGYRATSNFASNTIFPTCAWTWNKTYNFLNGTVGPQIRAIYVENVEPQLVKIGKRLG
                     RYSTGKKSVPKPPTDSSTSASVKTTSSFTKPAVSVTATSTSVYAPSSSSSTSATETKK
                     DRAAAESPRLRSTLQPIPPPEVDENLEKEDPRRRETREIVAADLKDWQERYAKAADEA
                     AAEIDDRVQEITKTMMRQNARVTGKAHLDRLQSTAVDELGALRSAIIEIIGTVKKGGA
                     TPEDAQDQIVKAVRKAGLAVKEKGQAVRTWREEYEKELQNSVTQAAETHFTILENIRD
                     LALQKIGMKWAWTDGITYKDWAKYHQLKGRFDEWKNDLRNHVISHPSIEVAQIEAANI
                     EDEAMEVAASTAKELARLKQVANWKLTAGDDTPEFDSTLMQQAAEAVEAAKLAAASAA
                     EAIGNVAKEAKDSVLDGISEGVSLVSEAANQASSAVLGSKEAEGGSEEQGADSEDVSI
                     ASETSDPSSEPAVEASLVLEDSQSSPTEVPRTEDATKLGVVASSEDASEPGEQATARA
                     VDPSSELSVASEELSSVADATSEPTPIVADQPEIVEQPENASSMIFETPVILGNSTEE
                     VEDVGEDKASPVELPTEQSGSTEEHEDNGDLGVEEDALPVSETATVRPAIFGAAAQSV
                     PNRRPILDEDTLDDDVSAAMESMREDLKSAYTSAMSLANDQYSQALSIVSAQIRGTPE
                     PAHEKLLASVTAAYSKAMASASSRLDDAIKGASDQLYGSTTTKSGILPTELPVPAVEW
                     SQIQSIASERLQQGLQWAEEQYESAKVAVGLAEATDAVKDKASGLKDEL"
     gene            complement(829869..833952)
                     /locus_tag="MYCTH_2306038"
                     /db_xref="GeneID:11510185"
     mRNA            complement(join(829869..831890,831945..833952))
                     /locus_tag="MYCTH_2306038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663787.1"
                     /db_xref="GeneID:11510185"
     CDS             complement(join(829909..831890,831945..833772))
                     /locus_tag="MYCTH_2306038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663835.1"
                     /db_xref="GeneID:11510185"
                     /db_xref="JGIDB:Spoth2_2306038"
                     /translation="MDSFIPMGGVQLPAFQRRLSRLYNDTKKSSDFVKEPVHHAEADP
                     EIKALHRKLRIQKDRLVTWGLEWSDPSQSAEVLIDSSLNKAGLSEVVGSIMSTIKDIL
                     AEAEPLWHSSRRLAGEKVEPEEAAKKGEKIRMVVWDKNRFEDLIRDLTTSIDTLYDLS
                     RTRSSQASAALRQRMPAPTPAPEDLRPFESSRIQTPRQIDPKSLTNLRSLQAEPMTEL
                     AEQERPREIVFMSKQAYAELTQSTAGGRQPHAPLLLEYAPFDPIYSMTGISPSMGRFE
                     KVSAGLQQEPQRPPGSWTGLPRLLGYFEDMDNSRFGLVYQFPRTFNPVTFEHLTQNPL
                     YNLCSLSDLLARPDFEPKLEAKFRLAANLANTVFDMHARGITHGNLISENISFCNAVG
                     TDPEVSGITQGEVDIRRPLISSFDIFSDPQSQDAPKPYSLYKHPLDPRNSTLSPLANN
                     ADSKTFDLYSLAMILLSVGLWTKLENLVPNTESPTLPESVLEQLAIRCGSLYMKAVQT
                     CWNAVDQEIAGGQTTEQIVSRVQFKASRYLEACCILDGVSNLEERLGDDLGEPRPEPV
                     QPATAGPSVRKSEDSPSSQKPESKPEQRSAVESSQEEAQAESQAEESIRSSKKMRLYP
                     HAPLPPDIIEKWNTVFMPQINSALRHFYRKNPESVEISLESIGESPQQTKPTVLVVCT
                     SVGKVKAILKKKLGNLFDGTAGVALKVCRGQVLRSRKQPSRSMAKSVDEGQEEVVAAN
                     PGFQERPRNGASIGAWIGDRHLPPVSLGGLIMVDNKQYGMTVHHMLDDPDQVVQAGKG
                     GPSRSMAGPRSDLAAWYAEQYEHSEPDPDSGSEVYACEFSDSDLDTLSESAITSDYSD
                     GEEEEEEEEEDEQFTEPGDIPGVEPGCGDGYIITQPALDDVPEGFYPSAETEDEDHLD
                     TYSVGEVYASSGIRRRTENGLLHEIDWALFEFNEDRAPDGNLIPTLTPAPKSEGRRRM
                     SWESEPADDEGNEFSFVHPTSVVPSSSLPGLEVQCMARTSGLQTGQVLQAIASVKIYG
                     RVSPSHIYQVAGTYPPQSRSYPRPRRPVLPMGIPGDSGAWVVDREQGAVCGHILAWSE
                     RKRVAYICPMDVLMLDIAETLEANEIRLPGGEIIFSRKPLSTLAGPTTREKRGSARMS
                     TQSSRLSRASGLSRVSEQGSELDDDDSEDAASSLVSPLQQNRQSVQSRRSRLSQRSSY
                     LAHPPQQQQDDVDALTPAPGKSTRHDHDDESYDEGVEVELPPTKEFMDMQLSEKDVPV
                     GMMGWIA"
     gene            complement(836782..838952)
                     /locus_tag="MYCTH_2306041"
                     /db_xref="GeneID:11510186"
     mRNA            complement(join(836782..838559,838627..838952))
                     /locus_tag="MYCTH_2306041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663788.1"
                     /db_xref="GeneID:11510186"
     CDS             complement(join(836881..838559,838627..838927))
                     /locus_tag="MYCTH_2306041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663836.1"
                     /db_xref="GeneID:11510186"
                     /db_xref="JGIDB:Spoth2_2306041"
                     /translation="MTKVGFPRIRVLALLFIALSLGLVGTLLVTRDDARLEPLPLAHG
                     RPDPNARPAIKTASPRETNIKEWSFAPPRVPCVGPRGLVLGSEENDDNLRESIIDISY
                     PRPFVGSHETLGLGQTWMTAAERYGPYGWEEEKPSYDRIKVAWNSTDWAALQNQCLER
                     NARRFKDTTPIRPTERRFRMRKPGEEVRLPAIHPQAAEHVPRTAIVFRAFEGYNYTKE
                     DLVNLRATIAETALRYGGEYTAFILVDVKNKERNIFSSEENYQRAVRELVPPEFQGMA
                     VLFDETLLQSWYPRIKSHITTYQVMQPLQLFGLFYPEFDHYWQLELDVRFTGHAGRYL
                     AAMSDFARAQPRKQSIERSTWFYMPTFHGNYSDLLAAVNATLEGGGGLGWDMRIQDFE
                     PIGPRPPVDDPRDDNFEWGVGEEADFIAVGPCTHVQYMVDWAWRHWYQGLRAGTGTPR
                     WMCQPAMGRASRTLLLAAHHAQAVQGLAVHSEVTLPSFALWHGLKLVAPPHPVYRDPQ
                     WPLDKMNEMYNGPGDVESHKKPGMVGMARGEAIYRITPHAYITTSASFWYSSAFPDKI
                     YDAWLSRGFRGGNDSDDLPYLLWRSEDGKIYAPNMMLHPVKTNENLIDLPAGPGPVAY
                     AAMGGVVVFILCLAAAGLRWWRLRRGGLLYTPLRR"
     gene            839603..840488
                     /locus_tag="MYCTH_2306042"
                     /db_xref="GeneID:11510187"
     mRNA            join(839603..839853,839961..840488)
                     /locus_tag="MYCTH_2306042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663789.1"
                     /db_xref="GeneID:11510187"
     CDS             join(839744..839853,839961..840237)
                     /locus_tag="MYCTH_2306042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663837.1"
                     /db_xref="GeneID:11510187"
                     /db_xref="JGIDB:Spoth2_2306042"
                     /translation="MTAPVDSDSTVASASLATCPNDEVQSSERARQREIAAYFSAASF
                     PPGLPAAFQEKPSLCTDPTLNALTQLGALRLNVDRQYQYVICEMTCSHSFVEMKCDPG
                     DTVAIGVCKLRNCDGVCPATMKAFIG"
     gene            840489..842083
                     /locus_tag="MYCTH_2306043"
                     /db_xref="GeneID:11510188"
     mRNA            840489..842083
                     /locus_tag="MYCTH_2306043"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663790.1"
                     /db_xref="GeneID:11510188"
     CDS             840739..842034
                     /locus_tag="MYCTH_2306043"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663838.1"
                     /db_xref="GeneID:11510188"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="JGIDB:Spoth2_2306043"
                     /translation="MVSLSSQESTQSGQSLATPQEGASEAPPMTPRDDLRTNPMEEQL
                     LAAIAHSPAERSPSRSASVPSEHSESHGFISSANIKITFFRAAATIRRTMNLDCRMFL
                     DAVPSSYLDRPDQPSLDSRDPPRSPTEGPFCATIVKPVAGHGTDAATHSNFQLPEVSP
                     HRFIQAYPRGHVFTADELGPIDDSYGLGKPFQSRPAADKKSLRLRNDITALFRILPAA
                     KYIILLPLWHFQRECWYTATFGWVEDPIRAVNVGELGLILAFGSSVMAEVSRLETLAA
                     SRAKSDFVSSPSHELRSPLHGIMASSELVREGISDRTLLSTLDMPDSCATTLLDTFNN
                     LLDHAVVTHSGLKRGSGALLTSRIRETDLGALVRRSWRSLEWDISQGTRFRCIRGAAN
                     VDLPVGHRACRTIPCSSRYRPRNASGSFPSTWAFGNVLS"
     gene            complement(844097..845747)
                     /locus_tag="MYCTH_2306044"
                     /db_xref="GeneID:11510189"
     mRNA            complement(join(844097..844503,844601..845747))
                     /locus_tag="MYCTH_2306044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663791.1"
                     /db_xref="GeneID:11510189"
     CDS             complement(join(844290..844503,844601..845625))
                     /locus_tag="MYCTH_2306044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663839.1"
                     /db_xref="GeneID:11510189"
                     /db_xref="InterPro:IPR007822"
                     /db_xref="JGIDB:Spoth2_2306044"
                     /translation="MDDNDRYLTISPPPTPAFDDDGGGGGGGTSTTDGYLRAALEDIV
                     TNYPPRSRYPQEALHGLWSGPTGVAYLLLTVSARRPDLTLQGRPAADWARAYLGPGGS
                     RGHNLRLGSHGCGIADEKMAYEAVRCAAAAAAAAAAAKEGESSSSPGGLRDSVRRFVA
                     DCAAQVLAVDEYPDEMLYGRAGALYLLRMVRAWVGEASRELVDPAIAEISNTILNRGP
                     RWRWHGRRYLGAVHGDIGIVTQLVLTSPELAGRLQPVLERLLDMQLPDGNWPSSEESG
                     ARGKGLVQFCHGAPGFVLSLTALRPHFPELRDRIDAAIERGRECIRMQGLLKKEPSLC
                     HGIFGNALALAPGPERERFLAIATPESVTRMKRADPSVFERADYGRSYATTTSYASSA
                     VWAWLVWRDEEPKMLGYNDV"
     gene            complement(846262..847820)
                     /locus_tag="MYCTH_2306045"
                     /db_xref="GeneID:11510190"
     mRNA            complement(846262..847820)
                     /locus_tag="MYCTH_2306045"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663792.1"
                     /db_xref="GeneID:11510190"
     CDS             complement(846389..847657)
                     /locus_tag="MYCTH_2306045"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663840.1"
                     /db_xref="GeneID:11510190"
                     /db_xref="JGIDB:Spoth2_2306045"
                     /translation="MFTSRFPVRGAPVVRSASLRAARRTGRRFQSSSSASSSTTGGTS
                     SYSSSHFVSGVMGGVAGAGLLYGIYLMTPTGKMARKINAAAKEADNKYQQVAATLRDK
                     TPSTDEAVDKLKQFCYSYVIWIPGGRQYVDTAFNDLAAIRESHAEEVDKIVSETYREF
                     QDVARAGLSLESASKAYDALVNLAKKIASLSGSAADQILQRHPQLNDKVGGSIRELKE
                     MGAQYGPEARKLVDETWSQVNDVLSRGFSAENADKVRKIVQERIQQVRKAGDEFWDKS
                     LEQAKPYLDKSPKLRELVTNNRDVLKQGNVAGLFKQLKSLGDGGDAAKVEEYVKQAVD
                     KAKDKGSEAAGGRTGLSALGQFLGASSDDAGRKLQDHIGLLSEAVSEHSSEAKQLLDE
                     TKNDLRKLVEEKAKKAQKIVERTKNESSKE"
     gene            849318..849931
                     /locus_tag="MYCTH_2306048"
                     /db_xref="GeneID:11510191"
     mRNA            849318..849931
                     /locus_tag="MYCTH_2306048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663793.1"
                     /db_xref="GeneID:11510191"
     CDS             849397..849903
                     /locus_tag="MYCTH_2306048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663841.1"
                     /db_xref="GeneID:11510191"
                     /db_xref="JGIDB:Spoth2_2306048"
                     /translation="MLEKQSPMRIAVFLRKKSPFYSLRNDEVLAKACSTLGIDPVESR
                     AKLMTVCKWDRLTVFVFNVWYDGYDWATAHHKVDLPVVLVDYGKKVSTVKICSQNFCD
                     EVNHFVARQHELHGWDSKPPYFEDHTLPGVVPTYPNPRCVKLIGPDGIARRQVKTPPP
                     GSTGVYPP"
     gene            850021..850627
                     /locus_tag="MYCTH_2315462"
                     /db_xref="GeneID:11510192"
     mRNA            850021..850627
                     /locus_tag="MYCTH_2315462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663794.1"
                     /db_xref="GeneID:11510192"
     CDS             850209..850439
                     /locus_tag="MYCTH_2315462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663842.1"
                     /db_xref="GeneID:11510192"
                     /db_xref="JGIDB:Spoth2_2315462"
                     /translation="MSLATSFTSSFSGSQTSSKRTRAPDSPPSNSQPHKKHGSARRTR
                     QSASPRAAGSSTQASTSSGSAIPPPASTKKWR"
     gene            <852357..853828
                     /locus_tag="MYCTH_116553"
                     /db_xref="GeneID:11510193"
     mRNA            join(<852357..852614,852717..853352,853485..853828)
                     /locus_tag="MYCTH_116553"
                     /product="glycoside hydrolase family 10 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663795.1"
                     /db_xref="GeneID:11510193"
     CDS             join(852357..852614,852717..853352,853485..853718)
                     /locus_tag="MYCTH_116553"
                     /note="CAZy_ID 267971"
                     /codon_start=1
                     /product="glycoside hydrolase family 10 protein"
                     /protein_id="XP_003663843.1"
                     /db_xref="GeneID:11510193"
                     /db_xref="InterPro:IPR001000"
                     /db_xref="JGIDB:Spoth2_116553"
                     /translation="MHLSSSLLLLAALPLGIAGKGKGHGHGPHTGLHTLAKQAGLKYF
                     GSATDSPGQRERAGYEDKYAQYDQIMWKSGEFGLTTPTNGQKWLFTEPERGVFNFTEG
                     DIVTNLARKHGFMQRCHALVWHSQLAPWVESTEWTPEELRQVIVNHITHVAGYYKGKC
                     YAWDVVNEALNEDGTYRESVFYKVLGEDYIKLAFETAAKVDPHAKLYYNDYNLESPSA
                     KTEGAKRIVKMLKDAGIRIDGVGLQAHLVAESHPTLDEHIDAIKGFTELGVEVALTEL
                     DIRLSIPANATNLAQQREAYKNVVGACVQVRGCIGVEIWDFYDPFSWVPATFPGQGAP
                     LLWFEDFSKHPAYDGVVEALTNRTTGGCKGKGKGKGKVWKA"
     gene            complement(897192..897865)
                     /locus_tag="MYCTH_69854"
                     /db_xref="GeneID:11510194"
     mRNA            complement(join(897192..897625,897673..897865))
                     /locus_tag="MYCTH_69854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663796.1"
                     /db_xref="GeneID:11510194"
     CDS             complement(join(897579..897625,897673..897796))
                     /locus_tag="MYCTH_69854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663844.1"
                     /db_xref="GeneID:11510194"
                     /db_xref="JGIDB:Spoth2_69854"
                     /translation="MPYSYYFSRGLCCRIIESSSRYGKYVRRRRSYDGSGVPVSSLSR
                     IMDESKRLDRLE"
     gene            complement(914660..915047)
                     /locus_tag="MYCTH_2306052"
                     /db_xref="GeneID:11510195"
     mRNA            complement(914660..915047)
                     /locus_tag="MYCTH_2306052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663797.1"
                     /db_xref="GeneID:11510195"
     CDS             complement(914703..914987)
                     /locus_tag="MYCTH_2306052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663845.1"
                     /db_xref="GeneID:11510195"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="JGIDB:Spoth2_2306052"
                     /translation="MWRKNRQRQRGTTCVGRDLNRNWDVHWDRKGGAATGPCRSTYRG
                     SKPLDAPETRALAVELQAIKESQGVRLFIDWHAFGQLVMYRRSQRPPPSS"
     gene            complement(<916107..>918908)
                     /locus_tag="MYCTH_2063030"
                     /db_xref="GeneID:11510196"
     mRNA            complement(join(<916107..916207,916266..916384,
                     916450..917358,917428..917475,917526..917723,
                     917777..918064,918121..918361,918408..918653,
                     918818..>918908))
                     /locus_tag="MYCTH_2063030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663798.1"
                     /db_xref="GeneID:11510196"
     CDS             complement(join(916107..916207,916266..916384,
                     916450..917358,917428..917475,917526..917723,
                     917777..918064,918121..918361,918408..918653,
                     918818..918908))
                     /locus_tag="MYCTH_2063030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663846.1"
                     /db_xref="GeneID:11510196"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2063030"
                     /translation="MSDSQKSPSIEDLTPEEASRIIHSHRKVRYGTACWPCRQRKVKC
                     DNKSPCENCVKREHPQLCSYKPNRSATTGKSVSTSSEHPTSGRKRSRSPDRQESRSQS
                     NEAREAIRAYVFIDPDNTETARYVGQNSIPALLREQTSVSEPQEVNGIRQDMRSLLGL
                     DNSAPFPLMSSRHLDRLTLDISSELPSDREVMKLFRTYKEIPQPFWGFVIDIDDLESR
                     LMVYLEERAKNARSSIKSTKPVSASWLAILFAVLAVGSQYHDSPYHVRTRDSQKYIQI
                     SFHFLRLGNFLLRPNLDSIQALLMTSFVLLNDMKAEASWALLGLTCRLAQSLGLHRAQ
                     PLDGRQTPDAARKEMARRKLWWTCLWHDTLTSLSFDRSPMTNIPCCPIPMSPTANTEG
                     WAYLEAMFNLCQIVSQRLNPDAIATATYEQILDNCAAVENIRSKLSIQLRSKETCKSA
                     LDRLQHFAIRLHTSFMISVCCRPALIRRDSNHLDATQRKFLADRCKANLTETVRMFLA
                     MHQLSVIPTRSWAFTYHGLSSAVLLGILGETKADPEVRELQGDLISALSATAAKDQTS
                     PQPHIRKSDLDIELSGPLSRALAALKNIYDHGSVVAPPIKRESSTSGPASGARTPLPQ
                     MQAPGFPGNGALAQDPRAVPATLDPHQNAALAMTELQQQSGGAVADFSAGIPFSQTPP
                     VPGAQQQLPDIAAFDPASYMSPMDLYDSIFWESPDPFNTGMDAMNFDFLAHPPPGQPT
                     QQQFYF"
     gene            919725..924228
                     /locus_tag="MYCTH_2306054"
                     /db_xref="GeneID:11510197"
     mRNA            join(919725..921034,921095..924228)
                     /locus_tag="MYCTH_2306054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663799.1"
                     /db_xref="GeneID:11510197"
     CDS             join(919909..921034,921095..924063)
                     /locus_tag="MYCTH_2306054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663847.1"
                     /db_xref="GeneID:11510197"
                     /db_xref="InterPro:IPR007855"
                     /db_xref="JGIDB:Spoth2_2306054"
                     /translation="MVALSGAALPVTPDKNTRDKIEIEKVVRKLNTDYGIGIQIPDPT
                     LSPNDRRNLGARDEQFARWDRIHRGIQFLYYQRGDVLEQALCAFFSEAKAASLRWAPK
                     PRANPGTFPSIRTPPKAQTADQQENLQNILIKVINDYKARMTPSLRLPKPSGAAVVAR
                     PGDESDASSPKSASESPSSASSKRSFVRDDDHESKRLRAKEFSALRYQSPASIDALDK
                     VPSRRRLGGARTDLSPERRSVDEEPGISSIAASSNSSSSNVSSLFSHSEGQQLSQTTQ
                     DEDVYEKRLLATRGLAFSPPLHCDLPRRSAPQASAFEELGDPVQHPSQRSSTSSGDGS
                     GFAGSSNATLGKTLETPRNRGDRLSEARKPSVIHSRLQNIWPKFPAWLHDAPLAIAWE
                     ITRICLHCKVDLEDSALKYDPSWASSDMLTIWKSLMQLDVFRGKSFPERPSAEVFAAG
                     LTSFESRGNAVVMSAALEFNPEEDGPLFLLDMRPLQFDEGCRLTRRFGPDRFLEVLVP
                     SPTALNAPPIIKKTQGAAEDIIRWLTQQPHFLVGRQWRAFFSKDAGYRKPAKDFTLGP
                     DAKAIYKERVHFFAESGPNFRPAVIRAWHDIPTDTVQQRTQLKVSQMLDWLLQLESNR
                     EQPYLKLFSRIQLGLSKTTPTVTFEPGQIIHRPEDILSPTKKIMNDGIGRMSRSVARK
                     IRDLLGLTDIPSAVQGRIGSAKGMWLMDVTDHGDADWIETYPSQRKWNCDDADEPFHR
                     TLEVRKVASELKPASLNLQFLPVLEDRAVDKKAMRCAISNRLLNDLAKQFEDQKTALK
                     RPLQFRQWVHENSNNNRPERVKHGQVPFLGGLPADKNEILALLMNSGFDPKSQRYLRD
                     LAWELQKQKCDTLRTKLNIKVGRSAYIYMVVDFWGVLEENEVHVGFSSKFRDELDGVS
                     YTLLADCDVLVARSPAHFVSDIQKVRAVFKPELHALKDVIVFSTKGDIPLADKLSGGD
                     YDGDFAWVCWDPEIVDNFENAEVPVEPDLSAYLRKDKTTFDELVCRTGKTGRRARHDA
                     VYDMIDKSFQFAMQPNYLGICTNYKERLCYYNNSVSDEGAVLLSSLVGKLVDQSKQGI
                     IFTADSWDRLRRDKFPGKMYLDDPAYKGNYWSGPGEPSHIIDYLRFSVAKPAIDHELQ
                     SLHESMGPESSAGASDGAAHWWDPDLTTYYEHLKGLAKDTRSRSLKSLLDALQRAIGS
                     AELEWKRTISSRSSTLSYPDRVKKVYAKWLEIDFASVSGRCSDGIGSGSKLAALLEQP
                     FLAERGAGATSYWALLKASTAFKLYYNTSPKFVWQMAGYQLAFIKAQVSSGVGGMPVL
                     VTPLMYAGLATDGRFVKQYVARLEGDGSEYHDAEGGRDSGDEFE"
     gene            complement(927589..929345)
                     /locus_tag="MYCTH_2306056"
                     /db_xref="GeneID:11510198"
     mRNA            complement(join(927589..928946,929009..929115,
                     929167..929345))
                     /locus_tag="MYCTH_2306056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663800.1"
                     /db_xref="GeneID:11510198"
     CDS             complement(join(927684..928946,929009..929115,
                     929167..929233))
                     /locus_tag="MYCTH_2306056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663848.1"
                     /db_xref="GeneID:11510198"
                     /db_xref="JGIDB:Spoth2_2306056"
                     /translation="MARTRAQTAAQKALPSPASNSQGNRLGPRKDSSRKRVSRHAERN
                     RLHPTTPIETPIPKEQPAPVQSRCRKRKHSIEHVLETSPDPNPDPDPDPKRQCRSPQR
                     RTEDAFVEPAISSGVYKHTDPIAFWVKEGRWPEKDWPEETSKTDFTMDRLPLARKKSS
                     SNLSRKRSNSTTSWTTPSDQKPREEKSVPYRDQRYKTLLEVKGSYMTEAPLGLAGAGQ
                     ALCRSLLEKTTLVPSDNTLFRDDIFETTCQKIDNKNEARVIQDISRLIVPSAESLATF
                     GAKHLDILIESVNEGWNNSIPLTSPRPQPDYSVGFKRDAFTKDQLAKLSPFIGDFIAG
                     DQSFFIATYYMYFPFLTCEVGALEIADRQNAHSMTLAVRGIVELFRTVKREDEVNRKI
                     LAFSVSHDHRSVRIYGYYPVINGKDTKYYRHPIHEFSFTTLDGKDKWTAYRFTKNVYD
                     MWMPEHFKNICSAIDQLPSDLDFDVPPL"
     gene            930049..930445
                     /locus_tag="MYCTH_2306057"
                     /db_xref="GeneID:11510199"
     mRNA            930049..930445
                     /locus_tag="MYCTH_2306057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663801.1"
                     /db_xref="GeneID:11510199"
     CDS             930108..930386
                     /locus_tag="MYCTH_2306057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663849.1"
                     /db_xref="GeneID:11510199"
                     /db_xref="JGIDB:Spoth2_2306057"
                     /translation="MHLDHPVNQSLQQIDENSWLFGGGVSAVWRVGDAICKAKKYTET
                     LERSLLDASSPIVLWCCQISRHRQGFDCWRKRAQVQSFDPSRWDLRCS"
     gene            complement(<930506..>931874)
                     /locus_tag="MYCTH_2118950"
                     /db_xref="GeneID:11510200"
     mRNA            complement(join(<930506..930843,930905..>931874))
                     /locus_tag="MYCTH_2118950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663802.1"
                     /db_xref="GeneID:11510200"
     CDS             complement(join(930506..930843,930905..931874))
                     /locus_tag="MYCTH_2118950"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663850.1"
                     /db_xref="GeneID:11510200"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="JGIDB:Spoth2_2118950"
                     /translation="MSAATLPLEDLELALELQREDLEGLKKAGKGKGREGETDDFNLA
                     IQLYEAELASCILVTSDYSMCRSIARAVRLDADLIGPILLEEEQAALDREFARTLSPE
                     GMPTTPGGRASIVSALDEQLLAKLEALYVSTEEHPAESSIWAASRPVPWTGGGEGEQP
                     KIECIGCGDKRYRSDVSRCPCSHEYCRECLASLFMASLSDESLFPPRCCGQPIPLDFC
                     RAYLPTNLAGEFLVKKAEMETPNRTYCHQPTCSVFIPQQFIDGEVATCPRCQKTTCVT
                     CKGQSHEGDCPYDVAAQELLRVAAENGWQRCYSCRRVVELDHGCNHMTCRCGAQFCYA
                     CGLVWRTCGCEQWSEERLLARADAIVNRDVDAGRLDDVERANRLERERQNLMLNHECE
                     HRAWRSRGGSHQCEECYNFLPLFIYECVQCRIMACRRCRFNRL"
     gene            <934477..>936474
                     /locus_tag="MYCTH_95293"
                     /db_xref="GeneID:11510201"
     mRNA            join(<934477..934997,935124..>936474)
                     /locus_tag="MYCTH_95293"
                     /product="GMC oxidoreductase-like protein"
                     /transcript_id="XM_003663803.1"
                     /db_xref="GeneID:11510201"
     CDS             join(934477..934997,935124..936474)
                     /locus_tag="MYCTH_95293"
                     /codon_start=1
                     /product="GMC oxidoreductase-like protein"
                     /protein_id="XP_003663851.1"
                     /db_xref="GeneID:11510201"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Spoth2_95293"
                     /translation="MKFLRKSDRGSVLGSTLFSLAFLFYSPPTAAQSPPPDGAVYDYI
                     VIGSGPGGGVVGANLAKAGYSVLLLEAGDDSPGAGFGVYTPTVTWDFYVKHYPEGDPR
                     DNQYSHLTWLTPDGRYWVGQSGAPEGSRLLGVYYPRGATLGGSSMINAMVVWLPNDSD
                     WDYHAEVTGDDSWRAENMHKIFQKIEKNNYLPRGTANHGFDGWFQTQMGTMVQTNRTG
                     PLQGNGVMTTYAQDWNLTIPMSDLLIRDPNEIGPDRDQTSSIYGQVSHQFANGNRYSS
                     RHYVQDAVSSGANLTVSLTSLATRILFDTVTEPDSPRATGVEYLFGKSLYRGDRRRAD
                     GAIGVNRTAVARREVIVSGGAFNSPQLLLLSGIGNATELEALGIPVIRDLPGVGRNLM
                     DNQEMPIVGTGSPGGGPGAVAGVAMYKTRHPAHGERDMFLFGGPGFLFRGFWPNEAVH
                     LPDEPAQPVYGVSMVKGSSVNNGGWVKLRSRDPTDTPEINFNHYAVGAEYDLEAVKDT
                     VAWIRSVYRRVGIATVEPPCARGPDENGYCGEEDEAWIHKQTFGHHPTSTNKIGADDD
                     PTAVLDSKFRVRGVRALRVVDASAFARIPGVFPVVSTFMISQKASDDILAELEAESR"
     gene            936847..936934
                     /locus_tag="MYCTH_t107"
                     /db_xref="GeneID:11510202"
     tRNA            936847..936934
                     /locus_tag="MYCTH_t107"
                     /product="tRNA-Pro"
                     /note="Anticodon: TGG"
                     /anticodon=(pos:936879..936881,aa:Pro,seq:tgg)
                     /db_xref="GeneID:11510202"
     gene            complement(937191..937663)
                     /locus_tag="MYCTH_2306062"
                     /db_xref="GeneID:11506420"
     mRNA            complement(937191..937663)
                     /locus_tag="MYCTH_2306062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663804.1"
                     /db_xref="GeneID:11506420"
     CDS             complement(937206..937415)
                     /locus_tag="MYCTH_2306062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663852.1"
                     /db_xref="GeneID:11506420"
                     /db_xref="JGIDB:Spoth2_2306062"
                     /translation="MAEADVQKVIDGLGGRVNLQPRKASPVQPKALRSADIARMGAAR
                     ISVGPQLYNAVVATLTAAANEVFAV"
     gene            complement(938454..940050)
                     /locus_tag="MYCTH_2306063"
                     /db_xref="GeneID:11510203"
     mRNA            complement(938454..940050)
                     /locus_tag="MYCTH_2306063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663805.1"
                     /db_xref="GeneID:11510203"
     CDS             complement(938690..939835)
                     /locus_tag="MYCTH_2306063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663853.1"
                     /db_xref="GeneID:11510203"
                     /db_xref="JGIDB:Spoth2_2306063"
                     /translation="MGLLLWNTASNAPYPGAPSSSDGLSNWDRRGAISSSSTQQRQHP
                     TRTHPSATRPSHLAETSSPPGPDAGRRYVPTEERDDCHHRKVRRIRSAASATPHRDNH
                     NGPPGGPFCLTIPHQEEDHRRPPDRGGFNGRRSRSRGPSARGALVSSSLFATTLPAGQ
                     SGTTRRRPPSLERQGAFRDERTARRRRRWAPSGEDDDDDDDDEHRQDAERCRIRLLLN
                     DERELDKGFAPDRIAREGPGCYCYYCCSLPTWRPRGQERRGEDEALAGWLLSGSSSSS
                     STSSFSTSRLRQVDAVREEVPPWRDEASYDGQQLTVIHELADDLSDDVLLSGVSSVAG
                     QVDDRTVWAVLDDRNHLDAAAFQAVGAMVVGMDESRRSSGYAGHDGS"
     gene            complement(<941348..>942421)
                     /locus_tag="MYCTH_2110896"
                     /db_xref="GeneID:11510204"
     mRNA            complement(join(<941348..941566,941691..941888,
                     941953..942191,942238..942318,942367..>942421))
                     /locus_tag="MYCTH_2110896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663806.1"
                     /db_xref="GeneID:11510204"
     CDS             complement(join(941348..941566,941691..941888,
                     941953..942191,942238..942318,942367..942421))
                     /locus_tag="MYCTH_2110896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663854.1"
                     /db_xref="GeneID:11510204"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2110896"
                     /translation="MPLGSELFSVPMMVIKGLDGIIQDGSLPPQSRDCISSAPASVPF
                     PDVYVPPEGVRPGDRVPVLHNFHGSAYAFSSKDIFFSPMGLFDLMHRQNKTKFVAVAN
                     NYRSVLLLLLLLLLLLLLFLCGTNGNTGVTWADGEDLDGNVGMLDCLAAAEWTAAHIH
                     KCGGDRKRVTILGQSAGAGIIYYLTVLDGGRGQTSVSNPELAFAFEAKLLALVLGEDM
                     AWPTYGKDKRMYNITNTFEATTMPPKLRHRCELLSRFVLDPANGA"
     gene            959420..961725
                     /locus_tag="MYCTH_2306064"
                     /db_xref="GeneID:11510205"
     mRNA            join(959420..959635,959778..960391,960507..961253,
                     961340..961725)
                     /locus_tag="MYCTH_2306064"
                     /product="glycosyltransferase family 1 protein"
                     /transcript_id="XM_003663807.1"
                     /db_xref="GeneID:11510205"
     CDS             join(959832..960391,960507..961253,961340..961637)
                     /locus_tag="MYCTH_2306064"
                     /note="CAZy_ID 267892"
                     /codon_start=1
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="XP_003663855.1"
                     /db_xref="GeneID:11510205"
                     /db_xref="JGIDB:Spoth2_2306064"
                     /translation="MTTKKVLLVVNSEYGQANVFLAAGHALQALDKDVQIHFASFKQI
                     ANDVATSSKYSVKCTPGAAPWTFHLLDGPSFMEAIQYKDGPRTALERIMGQRPTFSSI
                     MAMMKVLVHLFLPWDQPEFDLVYKSLVRIFDEVQPDITVVDSLFAPGLTACRALGRRH
                     IVLSPNTLKDFAVAFQPRAALLWKFPIMGSAFEFLVPWRNIPANTVYGLAQIYFSLTD
                     TRLRETRARARQKLGAELVTFESLMMNPPAGLKILVSNRPEIDFPLVIPGHLTACGPL
                     IRPVAPVADDDGELDAWLRRGPTVFISLGTHRVLEEYEAVEMARALRVLLDAVEAWED
                     TLRRRGGEGGEGGEGGSNVGVGGVPGKLQVLWKLKRHKPGQDAMYEVGPGTRVHGILR
                     REIEADRVRIVDWVKPQPSAVLQAGTVVCSVNHGGANSFHDALTSAVPQVILPAWLDC
                     YDFANRAEYLGIGRWGNKQAMPSCAEAELGPILVDVVLGPRAAEMRARVRDLADLCAK
                     TPGATVAASSILDELKSYDEGEEGEK"
     gene            <962290..>963924
                     /locus_tag="MYCTH_2127657"
                     /db_xref="GeneID:11510206"
     mRNA            join(<962290..962385,962469..962571,963547..963752,
                     963841..>963924)
                     /locus_tag="MYCTH_2127657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663808.1"
                     /db_xref="GeneID:11510206"
     CDS             join(962290..962385,962469..962571,963547..963752,
                     963841..963924)
                     /locus_tag="MYCTH_2127657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663856.1"
                     /db_xref="GeneID:11510206"
                     /db_xref="JGIDB:Spoth2_2127657"
                     /translation="MLSTAVRRLLGVRFSTADEGASEVTDDGTDGMLPDPAELGNILP
                     VRHNEFLGLGNQALEDKVDDVLATALGAPSSPAVGRSAPVVRRAGPCDAYSEACRPVI
                     QANACFAAYIVFGTKEQVLQCVDVNDLAKAEEAICACYGCAEQAVQDWAVETLGCEAP
                     SD"
     gene            complement(964023..966125)
                     /locus_tag="MYCTH_2306068"
                     /db_xref="GeneID:11510207"
     mRNA            complement(join(964023..965343,965523..965865,
                     965959..966031,966108..966125))
                     /locus_tag="MYCTH_2306068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663809.1"
                     /db_xref="GeneID:11510207"
     CDS             complement(join(964427..965343,965523..965799))
                     /locus_tag="MYCTH_2306068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663857.1"
                     /db_xref="GeneID:11510207"
                     /db_xref="JGIDB:Spoth2_2306068"
                     /translation="MLEYYYILLWAPLYAALVGADTDPLLIDCYRWDGGVTANNTKCP
                     NSNACCGPTATCLSNRLCHNVGDGPDLFVRGPCAVKGWDPDCAQICKYDEQGGVFPRV
                     TICADGSLCCNNDPQCCQDGKGVFLDEAGNIASARATAATTSYPPLGGGPSRYTLTPS
                     ASTTTTPTARSGSSTSNSNNPSSMRASSFTSEPGETAAAIASSASSTATRTTAIDQPP
                     SGVLGSSSNSGSISEDDDNGGGGGGGNTTGFKIGLGLGIPLSVLVTACVVYYLAARRH
                     RSHFVSSSSGSGGGDSPASYYQHPSVPPQQQQYPGSAAHSPGPGPAYYVYGGTVKETG
                     TGPAGQQPTVAVVPVEAQGQSAAELDAVGAGRNGAREERYYNHGVEMARGWYAPGGPG
                     GVVKS"
     gene            967821..970005
                     /locus_tag="MYCTH_2306070"
                     /db_xref="GeneID:11510208"
     mRNA            join(967821..968033,968100..969632,969743..970005)
                     /locus_tag="MYCTH_2306070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663810.1"
                     /db_xref="GeneID:11510208"
     CDS             join(967858..968033,968100..969632,969743..969917)
                     /locus_tag="MYCTH_2306070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663858.1"
                     /db_xref="GeneID:11510208"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="JGIDB:Spoth2_2306070"
                     /translation="MAANETTSAVADGQSGAPDAAPAAGSPAETNNGHRGNRGGRERG
                     NDKQKRKHSGFGSAKGPVPDKRERVQNDRNAKRRKVIDEDNKGSSYMSITFTPEEIAA
                     EGRRPKRKVAVMIGYAGTGYHGIQINHKDKTIEGDIFAAFVAAGAISKANADDPKKSS
                     LVRCARTDKGVHAAGNVLSLKLIVEDEDIVDKINAHLPDQIRVWGIQRTSNGFSCYQA
                     CDSRWYEYLMPSYSLLPPLPRSFLGKKLAESANEKGVYDEYVERLNDVKDFWEQVEKN
                     DIQPILEKLEPDVRAEVLRKLHDTQDQDLGDEGAQTKADSDAAAATNAGEDTEMKEAQ
                     GQEEDVEEKKKEKPKEDAEGGSAEAGAPLENSASETQGQSAARGPRAEPVLTPVERAL
                     REIKAAYVAAKRRYRVSPVRIQRLQQALDLYLGTRNFHNYTIMKSFKDPSAKRHIKSF
                     QVNPTPITIRDTEWLSLKVHGQSFMMHQIRKMVAMAVMVVRCGAPLSIITESYGPRRI
                     SIPKAPGLGLMLERPMFTEYNKKAASLGKEPIDFSKWEDKIAAFKDEHIYRRMFELEE
                     KENSFHLFFNQVDNFRTDYFLWVTAGGVEASHERSERTEKVPKALETELGDEADGVEE
                     VGT"
     gene            complement(970005..970990)
                     /locus_tag="MYCTH_2306072"
                     /db_xref="GeneID:11510209"
     mRNA            complement(join(970005..970351,970508..970650,
                     970822..970990))
                     /locus_tag="MYCTH_2306072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663811.1"
                     /db_xref="GeneID:11510209"
     CDS             complement(join(970094..970351,970508..970650,
                     970822..970858))
                     /locus_tag="MYCTH_2306072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663859.1"
                     /db_xref="GeneID:11510209"
                     /db_xref="JGIDB:Spoth2_2306072"
                     /translation="MDRDATSATNLLERKNILIADILTSVRDYFNLALAPVDDTASTG
                     QTAERSLAMETKLSAMIKSTEDLVSLSRRIRELWIIGALKPVTGEADQGMDMDSEQVF
                     SLLGALRERQRQSLLQHAAAAGGGFTYEVGGLDGPAVPGSESK"
     gene            complement(973184..975510)
                     /locus_tag="MYCTH_2080893"
                     /db_xref="GeneID:11510210"
     mRNA            complement(join(973184..974312,974374..974461,
                     974565..975101,975188..975510))
                     /locus_tag="MYCTH_2080893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663812.1"
                     /db_xref="GeneID:11510210"
     CDS             complement(join(973390..974312,974374..974461,
                     974565..975101,975188..975382))
                     /locus_tag="MYCTH_2080893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663860.1"
                     /db_xref="GeneID:11510210"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2080893"
                     /translation="METDGAKEKQENALSDSSSTAAASIHAVKADAETKTAEGRGDSK
                     TAHPRDAESDADDVDVELGAQSRDGDGLNLNRTSTRTSVRSRLSRVLSRKRTPQQRIP
                     PTPIPVSDLDAGVVGWESQDDPAMPLNFPQRKKWLIVGLLSGITLLTPLASSILAPGI
                     TTLNRDFDNHNDVVGTMTVSVYLLGYVIGPLFLAPLSELYGRRPVLAAANIFFCIWLI
                     GCALAPSIASLIVFRFFSGVGGSGCLTLGAGIIADVFRVDQRGTAIGIYTLGPLIGPT
                     VGPVAGSWLSQTIGWRWDFWIVFIVSVIVVGLYELLTTETNPRILMRKKVERLKKELN
                     RTDLRSCYEDPGAEKLSTSRVLLNGLIRPTKMLFLSPTVFLISLYLAFTYGTLYLLFT
                     TIPLVFQATYGWSVGITGLVYICLGLGNFTGWAVVTATSDRGVVKRTKANGGVFEPEM
                     RLPLTIIFSCFLPITFFWYGWSTYYKTHWIVPVIGLFPFSLGIIGLFLPLTTYLVDCF
                     PMYAASAIAANTVFRSLVGMLLPLAGPAMYENLGLGWGNTLLGFICIVMIPVPLLFFK
                     YGGKLRKMGLQLVN"
     gene            979199..981056
                     /locus_tag="MYCTH_2306078"
                     /db_xref="GeneID:11510211"
     mRNA            join(979199..979416,979477..979528,979607..979874,
                     979991..981056)
                     /locus_tag="MYCTH_2306078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663813.1"
                     /db_xref="GeneID:11510211"
     CDS             join(979507..979528,979607..979874,979991..980720)
                     /locus_tag="MYCTH_2306078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663861.1"
                     /db_xref="GeneID:11510211"
                     /db_xref="JGIDB:Spoth2_2306078"
                     /translation="MAPSGEPVLWSLYVYAPNKVAPVFFAIAYGISAIFHIWQCFRHK
                     AWKLMWLHSLCAVFFTIGYALREWGAYNYLYSPTDKTPLIIFIVSQVLIYVCPPLLEL
                     SNYHILGRVFYYVPYCAPLPANRVLATFGGLMAAVEALNAVGVSLGVNPSGNSQSLGK
                     NMTIAAISIQVIIIAAFVALAALFQVRFARTHLRSRAVRTTLLVLYASMALIFARCVY
                     RLVEHTGNTEVDFKDMEALRRLSPLLRHEAYFYVFEATLMLLNSGLWNTWHPGRLLPR
                     ENHVYLAEDGTEVTGEREEDSRPLLARTAHVLTFGILFRNKTKGGHHRMQELSEYPPS
                     SRRFP"
     gene            complement(<981218..>983039)
                     /locus_tag="MYCTH_2065658"
                     /db_xref="GeneID:11510212"
     mRNA            complement(join(<981218..981971,982091..982221,
                     982471..982642,982666..>983039))
                     /locus_tag="MYCTH_2065658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663814.1"
                     /db_xref="GeneID:11510212"
     CDS             complement(join(981218..981971,982091..982221,
                     982471..982642,982666..983039))
                     /locus_tag="MYCTH_2065658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663862.1"
                     /db_xref="GeneID:11510212"
                     /db_xref="JGIDB:Spoth2_2065658"
                     /translation="MTENPRRHCWECLRRCLVCDSTRPACNRCAATGYPCPGYGDVKP
                     TRLVWLAPGKVKSRTRRRKEATTVSAKPNEPRDYRQPSDSDPQTSTPALFDPSDAILR
                     IFLSRFGVYTDADALVHGAEYCNFHTLHAMLTRPEQSMVVFTKTYVLSSNSGTIQPYI
                     AYRLPLFANRFRSQTTYAMECFLQQGASLNWRPHADGAIKLVQLRGGFASMATCKTLG
                     PQLLILFFVAVIGNTTCPASDLSMTQAHLAALDVVQQLSRTAAVPFQMCPAPLFAEII
                     KINHLRHRAAKYASRGLVLPREMAQEALETLERVRAFSPDHWASTKPRSRPDWALIGH
                     IYHAAVALYWASSLQSLSVLQAAAPPPPLCATAQARLLRGLLVRALACPHLRHFILWP
                     LVVLGVQAAGEGGAAARDFVAAELPSLARSGGTRAPLTAKRVLERFWALGETRWDACF
                     DRPYAFVMQIAADTSRIVSGGGGGCS"
     gene            <984140..>984680
                     /locus_tag="MYCTH_2127665"
                     /db_xref="GeneID:11510213"
     mRNA            join(<984140..984176,984238..984259,984376..984446,
                     984502..>984680)
                     /locus_tag="MYCTH_2127665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663815.1"
                     /db_xref="GeneID:11510213"
     CDS             join(984140..984176,984238..984259,984376..984446,
                     984502..984680)
                     /locus_tag="MYCTH_2127665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663863.1"
                     /db_xref="GeneID:11510213"
                     /db_xref="JGIDB:Spoth2_2127665"
                     /translation="MESLTAATPSLGSSLVLSLADLNMPEQFGFAQRQVITLFCMPSA
                     NQDALLAQQAGLSPNELFKETVNFGLLKEIPDAPLVLYFRSVSGTIASGWRPNSYVPL
                     "
     gene            complement(984974..987184)
                     /locus_tag="MYCTH_2306081"
                     /db_xref="GeneID:11510214"
     mRNA            complement(984974..987184)
                     /locus_tag="MYCTH_2306081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663816.1"
                     /db_xref="GeneID:11510214"
     CDS             complement(985350..986939)
                     /locus_tag="MYCTH_2306081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663864.1"
                     /db_xref="GeneID:11510214"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="JGIDB:Spoth2_2306081"
                     /translation="MTAAVTDPTDVTPPNADYLYEDDDDDLEDIFNSADELDDDLLEN
                     PSADLTKSYNRQRQIHGAASQSAAGLPASNSQKPKANTFASIDDQIAELSKHAAKIRL
                     DNVKQNQERDKDKADRATAELVLDQRTRMILLQMINRGVVNEIHGAISTGKEANVYGA
                     VLYPDGGGEPIQRAIKIYKTAILVFKDRERYITGEHRFKAGAEKGNNRKMVKLWAEKE
                     FRNLRRLHAAGIACPEPLMLKLHVLVMEFLGDRRGYAYPRLRDARFTGDDVDERWRKL
                     YIQLLGIMRRLYQVCSLVHADLSEYNILYHDNRLYIIDVSQSVEHDHPRALEFLRMDI
                     KNVGDFFRRQGVDTLQDRTIFNFITAPDGPVDEPEMAKAIEHLYEVRPPVADTAEAAA
                     ELEVDNEVFRNQYIPQSLDEVYDIEKDATKKVDELVYRHMLADSVVRKNEDEEEAESS
                     DASSDAGSDDGAALSDGNSGDEDESRFEKRRPRGRKFEDKEEKREHKWLVKEERREKR
                     KTKMPKAVKKRLVATTARKKK"
     gene            1016317..1018468
                     /locus_tag="MYCTH_2306082"
                     /db_xref="GeneID:11510215"
     mRNA            join(1016317..1017056,1017151..1018468)
                     /locus_tag="MYCTH_2306082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663817.1"
                     /db_xref="GeneID:11510215"
     CDS             join(1016541..1017056,1017151..1018134)
                     /locus_tag="MYCTH_2306082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663865.1"
                     /db_xref="GeneID:11510215"
                     /db_xref="InterPro:IPR007240"
                     /db_xref="JGIDB:Spoth2_2306082"
                     /translation="MPRPASSAEPRSRPTSYHDSPSPEFNVDHVPVEVLVRHLLAAKQ
                     SLSSMALVLRANDLTTHARQMHEESVILGAQTGFLRRLIDEEVVVLRKLRRGMGRALD
                     RGRREFVQLLRTLDAANEKLEGTMRMLRETKVDPVFRPPGEEAKNLMDFLDVNSVEAM
                     RNTLKGSVDELQAAQESFDGDIYRFDHDLRLLNKTLAAAPSPDSPASSTAYKPIPHLL
                     ATLVEHSEAMATHLASLTSHFDMCVKAVRATEGGAALARRRAAEATHDGDPVSISGVI
                     TEQESHLPDLEPMDPQELAEMVQVVVGDAQEVDEVVAEIQAGLQQMEQNFGALKEQAD
                     RIKGAWFATLGAFQVLEDLGSRLQSYVAAEQEFEQRWEAEKDIIYGKLEEMDSLKRFY
                     EGYASAYSGLLLEAERRRAVEDKIRNTLRKARDNVNNLIEADRKQREHFRQEVGEFLP
                     GDLWVGMNSPPKKWELVPVDADDGGPSGSQDGLATPTVAKPGKGKAPVR"
     gene            1018507..1020353
                     /locus_tag="MYCTH_2306085"
                     /db_xref="GeneID:11510216"
     mRNA            join(1018507..1019463,1019586..1019945,1020010..1020353)
                     /locus_tag="MYCTH_2306085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663818.1"
                     /db_xref="GeneID:11510216"
     CDS             join(1018774..1019463,1019586..1019945,1020010..1020075)
                     /locus_tag="MYCTH_2306085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663866.1"
                     /db_xref="GeneID:11510216"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2306085"
                     /translation="MRCWTATSRGSPRQALTLNPAAPTPSLPADGPPSSSSSSSSSSL
                     VLVRITHVTLNPADLNTLRLLPPWLPFRRAPVPGMDFAGEVVALGGSRASTDADAAPP
                     PPLRVGDRVCGAAGLREVFTGRGTLAEFVLLDRALVTPVPAGWGGREAAGTMGIAGQT
                     ATAMVKRVVPGGDLRSDRRGLEGRRVLVNGASGGVGTVLVQICKGLGAAEVVGVCSGA
                     NEGLVKGLGADEVVDYRLHDPLETHLVERFGEHQFDVIFDCAGSQGLYSCSPGYLKPE
                     GRFVSIVGGWSQGVVPYIRNKLRPVFLGGTPRSYDLFLLSASGEIAREVATLVEQGVI
                     KQAVIDSEFPMEQAVEAFEKLATGRARGKIVVNISNS"
     gene            complement(<1020383..>1021959)
                     /locus_tag="MYCTH_95278"
                     /db_xref="GeneID:11510217"
     mRNA            complement(join(<1020383..1020478,1020642..1021142,
                     1021558..1021726,1021829..>1021959))
                     /locus_tag="MYCTH_95278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663819.1"
                     /db_xref="GeneID:11510217"
     CDS             complement(join(1020383..1020478,1020642..1021142,
                     1021558..1021726,1021829..1021959))
                     /locus_tag="MYCTH_95278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663867.1"
                     /db_xref="GeneID:11510217"
                     /db_xref="JGIDB:Spoth2_95278"
                     /translation="MTLRSLAHRLALSSYLGFAPGLPSSHNDRSPSGMLLVHTDILER
                     YPTDHPWYEGATSYNSVPNSADPMPDAGSRNNPLSARWSSLSIHLPFKKNEERTGKLI
                     PHELRQRLIFVYSPAETLPNNGILDPGIGGGGKTDLVLVGECIALLDASRALAAFGRL
                     LRCPKAPRLSPSTGGPFSRAGRTRPAWTRYTYDRVAAAISSLFRPYSGTLASPSYLAA
                     APTRVSPLNNVALPASEWDHVVRYHSTHAEIEQGFEEIRDEALGESKVTNHQAMSGQC
                     GKAGQFEVVLEPYTAQATLPSW"
     gene            complement(1024151..1026910)
                     /locus_tag="MYCTH_2306087"
                     /db_xref="GeneID:11510218"
     mRNA            complement(join(1024151..1024452,1024566..1026606,
                     1026813..1026910))
                     /locus_tag="MYCTH_2306087"
                     /product="carbohydrate-binding module family 21 protein"
                     /transcript_id="XM_003663820.1"
                     /db_xref="GeneID:11510218"
     CDS             complement(join(1024255..1024452,1024566..1026473))
                     /locus_tag="MYCTH_2306087"
                     /note="CAZy_ID 268042"
                     /codon_start=1
                     /product="carbohydrate-binding module family 21 protein"
                     /protein_id="XP_003663868.1"
                     /db_xref="GeneID:11510218"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="JGIDB:Spoth2_2306087"
                     /translation="MPYTPPSQRSPASSGPSSPEGSRRPSFHQPSSSSSRPALPRSAS
                     YLTRHRRTPAATQPAAGQPSPESASEDLKSMMASSSVRQSPPPITGVSGMPNGAIMSP
                     PDSASDDDDLPQVRSRRVENLKELHEAVSQIPQQRARLTPNGGSPEQDRADAGDLLVL
                     PSQATALAEGMHHSFSTGSLDELKMGDNRRFTHSRSATEPHVSIGRSTGSSTTGSDEE
                     SDEGSQQKPQMVRKKSGELVRPALRPASRRRPSSMPGTPTFSKVVHFDAHLEHVRHFL
                     QVDRPLAVSAGSSPVDSYDSDTEYPFSSDGRSTTRSPPFEWEIIMTNFPVDTPVRKAQ
                     MVRLEKVWLSTDQKSLVGSVAVANLAFQKFVACRFTLDYWKTTSEVAAEYVGEAVRPV
                     DTDTPYTQDRFNFSIKLSDLANLETKTLYFCIRYVVNGQEYWDNNNSTNFQIDFRKKF
                     LPQNGKKGAAGAATRSFNGLPKSNRRSGQKSKPSSSASDEFGDCQKLNFDKSIHDYLG
                     ETSGPTGLRLKAVKSAGDLPSDNPSKGLLGPSGQFASRYDFGDSLSKAIQNAKGEMAG
                     RSEGLYMKSRKKAGSPTSAETGAEKEKAQAPDPTGPSTTTAGAPITSPAESPSAIISS
                     ASYEEIVSKWCFYGSKPRGQSSKPRDGPFEGADDTSSSRTASYLEVRWATTTSGTAAP
                     GTRCHAHGTKARTLRTFSF"
     gene            <1031938..>1034080
                     /locus_tag="MYCTH_2127673"
                     /db_xref="GeneID:11510219"
     mRNA            join(<1031938..1032003,1033943..>1034080)
                     /locus_tag="MYCTH_2127673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663821.1"
                     /db_xref="GeneID:11510219"
     CDS             join(1031938..1032003,1033943..1034080)
                     /locus_tag="MYCTH_2127673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663869.1"
                     /db_xref="GeneID:11510219"
                     /db_xref="JGIDB:Spoth2_2127673"
                     /translation="MGSAKFLGAKRHSRSLNGANGNCEAADIVCPSPVNHHPGSALIQ
                     VPLASEQYQEPILAGSTTGSGRE"
     gene            complement(<1041856..>1045112)
                     /locus_tag="MYCTH_2110911"
                     /db_xref="GeneID:11510220"
     mRNA            complement(join(<1041856..1041966,1042029..1043205,
                     1043328..1044093,1044203..1044749,1045095..>1045112))
                     /locus_tag="MYCTH_2110911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663822.1"
                     /db_xref="GeneID:11510220"
     CDS             complement(join(1041856..1041966,1042029..1043205,
                     1043328..1044093,1044203..1044749,1045095..1045112))
                     /locus_tag="MYCTH_2110911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663870.1"
                     /db_xref="GeneID:11510220"
                     /db_xref="JGIDB:Spoth2_2110911"
                     /translation="MYNLYEILLSEVVVMEPISIASTFATLIGFSMQLYSACKDYVDA
                     VRGACPNDIKLILVETSSLTASLKAAQDLLPASNGPEGDKEKLEESLKECRHCIEQLI
                     KMVPKPMLKAEEKKLSKKEKVDLFLKILSWGPSKKETCATLLRSINMHKATIIFHLTA
                     EISRDVKRIGQEVGSVRTSVQDMQDKLSANERAEICMWLEQVNPSRNHNSAGEVREKE
                     TCRWLSDSTEWRSWKDGSGSGSKLRLLWIHGVPGAGKTVLAHTMAEELASEARSDGHL
                     GFAYYYCSYTRSRDETAPFLAWVVSQFCRQARFIPATLREQYERRLEPGIKDLYAHLE
                     AVLNRFHRAYVVVDAVDESTKHENLVNVLCTLGSDARFAKLRLAVTSREMQDIKAAFQ
                     NRAIALPMANGGVKEDIRRYVESKLKERPYTRWNQQLRERAAHLVPSRAEGMFRYAAC
                     LLELLAKCGDPGAVSRELNQLPPTLDATYVRILEMIDHKSIDQCVRALALTMAAIEDA
                     GPIRAENLVAGVTGGARESFTTIEDICNDCICLLGLSNDGTVELAHYTVREFLGSGRL
                     PQHLRAFALPEEKARHMYHKTLMATAVKFSGTPNVRTMRQDDNGIPVEFGPYAVCQTR
                     VAMFWHREELLSDPETRKMLIDLLNPYAACYPGLQLLGQDGHSDSAHYHLFEWLTRFN
                     PHAEGAERTAAHLTMIASMRNPDLVTTFLGSIIGGDKQKAAALFSTEMQVLLPAQWAI
                     FRKTGTYDQHPERVTVLSFYEQGRARGYHTDEVLKMLRHMLSSHQANKESRPGAGSGK
                     RSSSHSTHAPRPESRGSTSSSSSHHVTATPTTTSAKGKAPVPDPGPSELDKLSAARTS
                     GSPEQNAQRYYGDRRQ"
     gene            complement(1045700..1049736)
                     /locus_tag="MYCTH_2306093"
                     /db_xref="GeneID:11510221"
     mRNA            complement(join(1045700..1047090,1047169..1048656,
                     1048731..1049326,1049498..1049736))
                     /locus_tag="MYCTH_2306093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663823.1"
                     /db_xref="GeneID:11510221"
     CDS             complement(join(1045964..1047090,1047169..1048656,
                     1048731..1049040))
                     /locus_tag="MYCTH_2306093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663871.1"
                     /db_xref="GeneID:11510221"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="JGIDB:Spoth2_2306093"
                     /translation="MKDCRRDPSPELPDGWFNWIKPFFAIKDDYILNNCSLDSYFFIR
                     FLQRLSIICLAGVCIVWPVLLPINGTGGSGLAELDSLTIGNVKVGNKLYAHVFVAWCF
                     FGFVLYMICRECIYYVNLRQAYLLSPNIAKRLSSRTVLFTCIPKPYVDEAKLRKLFGD
                     SARNVWIVKDTSALRALVEDREETADRLQQAEVRLIRLANAARQKYIKKNPGASCLNP
                     HLYGEVISSNASQIDPEKGQGIETAANLAQPQASAPESVSSEKEADPEYTHPYGLDPS
                     LPDVRGSVAALWIPAQSRPHHRPLTNFGRRVDTIRWTRARLKVLNKEIWQLRRRFRRG
                     DGSSLNAAFIEFDSQTNAQAGFQLLAHHQPLHMSPCYIGLQPDEIIWSALRIRWWERI
                     MRRFLMMGVITAAIIFWSIPAAAVGMISNVKSLSEMLTFLSWIMLLPGPILGVIQGLL
                     PALALSWLMAAVPWMLRGCARVAGVPSHALVELYVQHAYFFFQVLQVFLITTLTSAAS
                     AAVFEAIQNPLHITDMLSENLPKASNFYLSYILIQCLAAGATRLANFGDLIQHELIGK
                     TTANPKRRFYRWRKLRRIHWGSEFPRFTNLGVIAISYSCIASLILVFAGLGMFFISYV
                     YRYSLIYVCDPGHDTKGLFYPRALMQLMTGLYIAEICLIGLFALKKAIGPLLLMVMFL
                     VFSALVHISLNEAVTPLLNNLPRTLALEKDTGLVAEDERPGDDTALPTPLRPTGSLAA
                     DYYNMADENSDSDSLPGGAHNDNNEDHGLDTDIQLRGIEGGSSLKYQLTEWAKSRLKS
                     ALNPKKLITTNNNNNSNNSNSNGNSSSQGDPSASGLTRILTYIKQSITPDPSRPPNAL
                     LTFLHPEIYQSFRVLQQRVDPGPSSAEALELPRDYAKRAYWPPEMWTPAPRLWLPRDE
                     ARVSRQEVAHNADCVGGVSDRACWLVMSESDKMRWGVGKGRIECEMENSPLWEGEKRW
                     IF"
     gene            1052070..1053264
                     /locus_tag="MYCTH_2306097"
                     /db_xref="GeneID:11510222"
     mRNA            1052070..1053264
                     /locus_tag="MYCTH_2306097"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663824.1"
                     /db_xref="GeneID:11510222"
     CDS             1052271..1052834
                     /locus_tag="MYCTH_2306097"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663872.1"
                     /db_xref="GeneID:11510222"
                     /db_xref="JGIDB:Spoth2_2306097"
                     /translation="MEVTAPAARVLEVRTRIITQTITRPSTTITALVALGDAPSDLLL
                     LTPTDASATPPALAAAAPTTDLAVPSSSSSSSTTLSSKQLGALLGSILGFAFVILLTC
                     CFLSLRRRQQLRQRRRDAREYDRHHRRYYYYYYGDDDNDGGGGRVRVASSTWTTVPAS
                     VWFPPTPRYTTYSQTSKEQIGGVRRYP"
     gene            1053628..1054907
                     /locus_tag="MYCTH_2306098"
                     /db_xref="GeneID:11510223"
     mRNA            1053628..1054907
                     /locus_tag="MYCTH_2306098"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663825.1"
                     /db_xref="GeneID:11510223"
     CDS             1053684..1054799
                     /locus_tag="MYCTH_2306098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663873.1"
                     /db_xref="GeneID:11510223"
                     /db_xref="JGIDB:Spoth2_2306098"
                     /translation="MPLWSDFHFWSPPEDPERPPFPYASVFTVTITEHVPPRPFGLPS
                     VYPFIEPPYDTSDEHLKTLTQTELVVSCPPLEADDDTDSVVPEKPAEATLKVERPIAV
                     EDGRGPQLVACTVTPQNGQGKPFQAVAKIFDPLYYSFENENAPHRPVATTLAADSDYS
                     IEAAAYAHLQKTGHTGGFAPEYYGSWTFTLPIRHRGIQHERHVRLLLIEYIDGVCMRD
                     LCYRESAALGFTEEHRLDVLARILDGDARLEHSGINQRDLLPRNIMLKLEPEAEDPLG
                     KGRPRVVQRAVLIDYNISVVYHLAPEAWKYRKSTELPLNPIDLFWSTSLDDFGYWVPQ
                     SWQGNRRAQQEWLIERFGGQNALAYAPVSRELELDDA"
     gene            complement(<1101909..>1106375)
                     /locus_tag="MYCTH_95272"
                     /db_xref="GeneID:11510224"
     mRNA            complement(join(<1101909..1102296,1102331..1104828,
                     1104925..1105433,1105496..1105546,1105609..1106146,
                     1106265..>1106375))
                     /locus_tag="MYCTH_95272"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak and only in last two
                     exons"
                     /transcript_id="XM_003663826.1"
                     /db_xref="GeneID:11510224"
     CDS             complement(join(1101909..1102296,1102331..1104828,
                     1104925..1105433,1105496..1105546,1105609..1106146,
                     1106265..1106375))
                     /locus_tag="MYCTH_95272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663874.1"
                     /db_xref="GeneID:11510224"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Spoth2_95272"
                     /translation="MSTCSLLLILISAVIRTPGRPEKPDKRSFLVASVPHRAGPNMGA
                     GAADRDCDLGLTRRSKSAVRYRKWLKGRKGDCSSLGRSIDGMAQLAVGLTGATAGTTT
                     NGFPKSDWLELFVCFLCNIQRGMKMTDCLKVPARSSELLLQSILQFDQSRLRDQLQPA
                     VAMLTPGYANLWVHFYPIGNTPAVFLTQGLPPEKDANILLLGCGDVRNIFFTVHSDGS
                     RRMDITCCDIEPAIIATRNVLLVTLILDDSNGQWNNDNWDLYHHVFINKACHDRLQKQ
                     AKKLHTLATSFEAWREGDYGNLVAFCDRGTLTRVAEVWAFYISTATERQSWMKKTFKT
                     AIETRNRKRRGTGVILSGLRSATPAGMLAGLDLNELHDQFWKHGTVDMDHMVRSQATY
                     ANPLFVSPDSTPRVSKLEDVVAAARAELCTWSDTFRGRGRENVRLRFFAGDAIPFCYT
                     LQNRRATGFDRTVCWYRSRHTSLDPLVLVEDDYGTDGTAPVSFNVIDTSNLIDHVGGL
                     NLLTAASPLLDGDASSSLYTETLVQRKRSYQEQLDEILGGHLPTSSLLLGLFPVEYWT
                     NTCPSSIGDEQLMGFIQSLQQTTVEPLRQLYSRITWKRPPCSSASHIERLHMDDEQLA
                     SLLYRVYVDMFPGENIGRMFSMATMNPESILHASLPTYTRASFVSFLVLVKKRIVASW
                     DRAMDILLARIESNRTHLIGCLFLQELYLYMHLLDIHSVDTFKSFAKRDMGMGTAPKG
                     APSIAHWQDMPSSVCITLKVPRSALRVFTDPDFSTVGTIPVHGVVRDSSGGYVGWENY
                     FAAVQLGFGSLSPSGIPFSNAFELVITEDYQGWHGNCPLFVSFRVPSWMLLLEPRTAI
                     VGFCMQSTPTTASRFIRRLGVDLCIFKTNLGDTNHVYISKDLPNQAGTIVVAGFAKDA
                     FASPAPENSEVRTTVSVTINPNTARIACMTARLDVVSDALKSALLGSCPVQSTTTSPC
                     TFTITINKTPVKVTFPVPVVAESYTMRIARKSAYIELIAIVMPNPAVHPSATFTSPLL
                     FSNCPDNTNDPVPILWNTPQISLPTAPVISLCNPRALSFLSVHTDQMFSTREARLRNN
                     PILLAAATRPERARIALKESLHCLFMQFAGLNSNTRNPASPRRESIFALHNPNQGEGG
                     GGVNNAHLPLDPAPRPRPPHRPPRLRRAPAHARHHARAGTPRLPGGRRGPARRGGGIH
                     HGRCGRAKAMEGGAARVGGAVSRRGVGAPGRMAPVSVDMGEEVVCGCGKGVFPAGWEP
                     DVPMWEVVKRFCVRAAISPLFASVLVEDVMPDVEPFGPGLGQDGRKEKGDGVTGCRSC
                     AREKSKEGGELKAFAKCLKVKYCGRTCQRADWKRHKKECIAKHS"
     gene            1107807..1109557
                     /locus_tag="MYCTH_2306100"
                     /db_xref="GeneID:11510225"
     mRNA            join(1107807..1108213,1108391..1109557)
                     /locus_tag="MYCTH_2306100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663827.1"
                     /db_xref="GeneID:11510225"
     CDS             join(1107932..1108213,1108391..1109272)
                     /locus_tag="MYCTH_2306100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663875.1"
                     /db_xref="GeneID:11510225"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Spoth2_2306100"
                     /translation="MAPSEAEASQAAEQPASRSRSRASSVGAQYREGEYDTIEDVRTT
                     SLYSALSGLLTSGKFSDMIVRCGGREFKAHRAIVCPQSSFFDRAITDGFSESTTGVVE
                     LPDDDPNVLERFLQFLYTGNYEDETILDWHKPAEVSMMTPEEVAELLAEVPGVSVTAP
                     AAEQPLNDAASSSSAAAPPETAGAADTANPPPPGGNNDDDSDTEDGSYRSRLSNGEPG
                     EPEEPAEEYNEFDAEDPEEDSSTDDHRSKDQINRRHSQLLRELGDSFAAERQLLNELR
                     TRQSLFLPLRLYVMADKFDVPALKLLARDRFYRAAELAWREVECFPDVVDELYTTTPA
                     SDLAMREIVCRLVGCSIKDDEQRERMAPVMRKHGDFAVGVLNYFIESERHIWT"
     gene            <1109767..>1110916
                     /locus_tag="MYCTH_2127683"
                     /db_xref="GeneID:11510226"
     mRNA            join(<1109767..1109772,1109836..1109985,1110053..>1110916)
                     /locus_tag="MYCTH_2127683"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003663828.1"
                     /db_xref="GeneID:11510226"
     CDS             join(1109767..1109772,1109836..1109985,1110053..1110916)
                     /locus_tag="MYCTH_2127683"
                     /note="CAZy_ID 270036"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003663876.1"
                     /db_xref="GeneID:11510226"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_2127683"
                     /translation="MTKCTPGTAWLACGTGDHPLTASWVEKGLIKTNWDTFSLDTSTF
                     VANGTRYLNPWTIGGTAVAISRPTLPWERIGYKVNEGPYVIQRNGKVFLTCSASASAT
                     DSNYCMGMPTATEGSDLLNPASWSKSQNPIFASNPKTNQWGPGHNLFVVSEDGLSDIL
                     VYHDRGYKDIRGDPLNDPNRRTRMQKLYWKEDGTPDFGVPVPEGNTPVRLRSAAGLGQ
                     DVRYYTGSDGPTDTPALADTQFRIASPGLAGGSMVSLESTSNPGMFVRRADDGSAQFV
                     SSDALGSASAKASASFNLVPGLADVSFEASDASDQYLRLEASGRLTTVQAGEDAQEQA
                     TFFLE"
     gene            1112099..1114724
                     /locus_tag="MYCTH_2306101"
                     /db_xref="GeneID:11510227"
     mRNA            join(1112099..1112864,1112976..1114317,1114387..1114724)
                     /locus_tag="MYCTH_2306101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663829.1"
                     /db_xref="GeneID:11510227"
     CDS             join(1112343..1112864,1112976..1114317,1114387..1114646)
                     /locus_tag="MYCTH_2306101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663877.1"
                     /db_xref="GeneID:11510227"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="JGIDB:Spoth2_2306101"
                     /translation="MPPLLRATPPRATSASRALQRHHRHAAAAAVTGISRPGARRFLS
                     STSRAPDDGSSTSSTINPANSVLTRPPQSAPLVSATPLLSTNPTTLTTTHPSRTATTA
                     ATQARWSSTVATDDKPKMYTASFAFFEALWDAGVEHVFVNLGSDHPSIIEAMVKGARE
                     KKDQFPRIITCPNEMVAMSMADGYARLTNKPQAVIVHVDVGTQGLGAAVHNASAGRAP
                     VLVFAGISPITQDGELRGSRTEFIHWIQDVPDQKQIVAQYCRYAAELKTGANVKQMVN
                     RALQFARSDPQGPVYLCGSREVMEAEIEPYQINQDQWEPVELGGLPSSAVRKIAEALA
                     GAKEPLLVTGYAGRNQAVPGALVELANTVKGLRVLDTGGSDMCFPADHPGWLGLRYGV
                     EDAVRTADTIVVLDCDVPWIPTQCKPKEDAKIFHIDVDPLKQVMPLHYIPARHRYRAD
                     ALTSIEQITAMLKSDAGLKAQLTGEESDKRWAALQESYKKRLEAIELRSQPLANGEFG
                     TTHLCAKLRELCPKDTLWAIEAVTNTLFVHDGIRPTLPGQWINCGGGGLGWSGGGALG
                     IKLATDHEARRNGEKGKFVVQIVGDGTFLFSVPGSVYWISKRYNIPVLTIVLNNKGWN
                     APRRSLLLVHPDGLGSKATNEEINISFEPAPDYAGIAKAAAGGDLHAARVDKAADLER
                     VLKEAIEAVQRGQTAVVDCKVAMGC"
     gene            1115850..1117311
                     /locus_tag="MYCTH_2306103"
                     /db_xref="GeneID:11510228"
     mRNA            1115850..1117311
                     /locus_tag="MYCTH_2306103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663830.1"
                     /db_xref="GeneID:11510228"
     CDS             1116125..1117228
                     /locus_tag="MYCTH_2306103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663878.1"
                     /db_xref="GeneID:11510228"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="JGIDB:Spoth2_2306103"
                     /translation="MAEGETQPEAPASGNGRDSSSAHTPPPPPIPAADPRLQDVTNTG
                     SHASSPDVVAEIDDIFKVSPQAALRLLSAGIEALVSMTGDIPPTPPPRSPTIPHMRGM
                     EAEKKSIVRSNSEKNLARLAQRGSASNSPLPGRSPLQQAQSSSEPVPAKPPPATAQSQ
                     VIDGVRLRTTGPAPRTPPSSCSGSQSSQPLAPYIIVGENSQPLNQQHSAITRKFYCRV
                     PPPISITDYLLRMHRYCPMSTGVYLATSLYIHRLAVLERAIVVTKRNAHRLLLAGLRV
                     AMKALEDLSYPHKRFARVGGVSERELARLEISFCFLTGFELAVNAHLLSQHWELLRRG
                     TECWNVLDDDLQPDVGFVKPEKPPGASDVKAEA"
     gene            1117585..1118368
                     /locus_tag="MYCTH_2315464"
                     /db_xref="GeneID:11510229"
     mRNA            join(1117585..1117941,1118036..1118368)
                     /locus_tag="MYCTH_2315464"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663831.1"
                     /db_xref="GeneID:11510229"
     CDS             join(1117839..1117941,1118036..1118250)
                     /locus_tag="MYCTH_2315464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663879.1"
                     /db_xref="GeneID:11510229"
                     /db_xref="JGIDB:Spoth2_2315464"
                     /translation="MDEGDIPKEVPRQEEFAGEPENIVRGHKANLSNPQTSDRAKENS
                     RRVLESYDEPYDASQASHGTAEQGDKDPGNVVRGLKASISNPGVSEGAKKAAREKLGQ
                     LGA"
     gene            <1119117..>1119539
                     /locus_tag="MYCTH_2063631"
                     /db_xref="GeneID:11510230"
     mRNA            join(<1119117..1119306,1119415..>1119539)
                     /locus_tag="MYCTH_2063631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663832.1"
                     /db_xref="GeneID:11510230"
     CDS             join(1119117..1119306,1119415..1119539)
                     /locus_tag="MYCTH_2063631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663880.1"
                     /db_xref="GeneID:11510230"
                     /db_xref="JGIDB:Spoth2_2063631"
                     /translation="MTESAPYQRDDRLGAELSRDAPSGQVNDPSYKTRGTEAVPVVDD
                     DAPIDDPLKPGSADSDRQLEQDEREAVDKGNVLKERTRKAKPTGTYAEPSDAQMGLRE
                     ER"
     gene            complement(1119530..1121554)
                     /locus_tag="MYCTH_2306107"
                     /db_xref="GeneID:11510231"
     mRNA            complement(join(1119530..1119952,1120019..1121137,
                     1121210..1121554))
                     /locus_tag="MYCTH_2306107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663833.1"
                     /db_xref="GeneID:11510231"
     CDS             complement(join(1119853..1119952,1120019..1121137,
                     1121210..1121373))
                     /locus_tag="MYCTH_2306107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663881.1"
                     /db_xref="GeneID:11510231"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="JGIDB:Spoth2_2306107"
                     /translation="MDYDRILQGKYPAKRHAKRVVDYIRTKVPDATGVIYLESRMTKL
                     LEDNDEPEPFRQRRFFYYLTGCPLADSFLVHDMDSAKTTLFIPPIDPDSVIWSGLPVS
                     AQEALEKWDVDDVKYTNEINAELAHLAKQKSKATVFAIPGQVSDQVTFLGFGETNFDV
                     LKQAIEVCRVVKDEFELALMAKANAVSADAHHAVMKQVRHAKNERELEATFLASSISA
                     GAREQAYHGIFASGRAAATLHYVHNDKPLAGKLNLLLDAGAEWNCYASDITRTFPING
                     KFSKESREIYDIVLKMQLECIAALKEDVLWEDVHVLAHKIAIDGLLKLGILKGDKDEI
                     LANRTSVAFFPHGLGHYLGMDTHDTGGNPNYADKDPLFRYLRIRGKVPAGSVVTVEPG
                     IYFCNFIIDPFLKDPKHSKYIDADVLEKYWDVGGVRIEDNLVITKTGAENLTTTLKDP
                     DEVERLISSS"
     gene            <1122632..>1124917
                     /locus_tag="MYCTH_2127689"
                     /db_xref="GeneID:11510232"
     mRNA            join(<1122632..1123073,1123141..1123217,1123982..1124200,
                     1124319..1124735,1124813..>1124917)
                     /locus_tag="MYCTH_2127689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663834.1"
                     /db_xref="GeneID:11510232"
     CDS             join(1122632..1123073,1123141..1123217,1123982..1124200,
                     1124319..1124735,1124813..1124917)
                     /locus_tag="MYCTH_2127689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663882.1"
                     /db_xref="GeneID:11510232"
                     /db_xref="JGIDB:Spoth2_2127689"
                     /translation="MSFASYSFDGTVQAIPLVETNHQRALRPVFIKQRKLGGKRGKTL
                     RAFSRFVLVPVVEIALILDDDDDDDDSDADYDDDDSDVSTVIDIGLAHWGVQVGDYLW
                     ELHTDRKHAKTLSMQRLTRSQIWRADVGEEEVGNTNMTDVEIDRAAHAALEKMKTKCG
                     GKYSQVGNNCHDFTPRALWRASTAALKLVARAVTLPYYQLFRQMTLLPVRSIAASVRD
                     GDDPEVIAKKLRLWRERKSAEFQIVQVAGTLLAAAVIGSFSWDGSQQPHWIGPAAWYC
                     SLILSFSAVLLASSQASIFRAVSDSVSREHGFSLVQELALVMAVQRTEDDAELPLTRG
                     LESARVRWNLVFIWQAPTMMMSYSIIGFLVGLVVYVTAPLYNQESFHGSSKAAVVFLL
                     CAGISGSMFMWCSFWGYRFEDPQTRIF"
     gene            complement(1126805..1129174)
                     /locus_tag="MYCTH_2306112"
                     /db_xref="GeneID:11510233"
     mRNA            complement(join(1126805..1127120,1127214..1128818,
                     1128904..1129174))
                     /locus_tag="MYCTH_2306112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663835.1"
                     /db_xref="GeneID:11510233"
     CDS             complement(join(1127065..1127120,1127214..1128818,
                     1128904..1128937))
                     /locus_tag="MYCTH_2306112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663883.1"
                     /db_xref="GeneID:11510233"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Spoth2_2306112"
                     /translation="MASEYDFVVVGSGPAGCALAYGLVHSAKKPKVLLLEAGGKNGDP
                     NLRVDGQRWLTFTNKDVNWGYKTTPQTHCAGRELDYSRGLGLGGSSAINFGVFTVGAR
                     DDYDEWARIVGDDAFRWEHAQARLKRLENFQSNPPAGVSSKYAAPKPSDHGSAGPLRV
                     GYAAECEADLVPLLDAFERAGYPLNPDHNSGNPIGMSLLISSAHKGLRSTSHDLLVPY
                     PENLTVVTEAPVQRVLLDGKRAVGVEANGKRYLASKEVIMTAGSLDTPRILMHSGIGP
                     KEQLEKYNIPVVHPCAAIGQGLRDHAFVPLVYTRREGSTDRASFYGNQAAMDAALEEW
                     KQHRTGPWTKFATEMAIGYFKSDAIASSAEFKSLPADEQRYLNAETVPHYEVFTHFPI
                     HWFLPGFRNEDLNYSCLLVFLYNAQARGTVTLQSSDPDVPLLFDPNFLAHPFDRRSAI
                     EALREVLRFTRTEAYAKDIVSTIAAPKSDSDEDLLAYWEQTIGSSWHMTGTVKMGKPG
                     DADAVVDNSFRLMGIDGLRVADMSVVPVLASCHVQAVAYITGATCAEKLVKEYGLE"
     gene            1130643..1132745
                     /locus_tag="MYCTH_2306113"
                     /db_xref="GeneID:11510234"
     mRNA            join(1130643..1131031,1131144..1131370,1131478..1131617,
                     1131674..1131765,1131841..1131954,1132038..1132745)
                     /locus_tag="MYCTH_2306113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663836.1"
                     /db_xref="GeneID:11510234"
     CDS             join(1130897..1131031,1131144..1131370,1131478..1131617,
                     1131674..1131765,1131841..1131954,1132038..1132508)
                     /locus_tag="MYCTH_2306113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663884.1"
                     /db_xref="GeneID:11510234"
                     /db_xref="JGIDB:Spoth2_2306113"
                     /translation="MAQNAEAFTLLSLVLFIIACRTLVRVRNVGFRGLQLDDYLMPVA
                     GILCIIDLVAAIFVVEKAHGLTNSYMTDEQRASLSPDSQEYKDRVLGSKIQVFGWVLY
                     AASLWCIKACVAVFYSRLTTNLAHLQIRVYIAYVFIGVTWVITTLLLLFGCRPMSKYW
                     QIYPDPGICQPTNSKLYVLSVLIPDILTDLYLLSIPLPLLWSTNISVKKKISLTVLFS
                     GVLFVIMAAIIRGVVILTSGPEGAVTGSEWAIREEFVSIVVSNLPILQPPIRAFCNKI
                     GLSVLFSSHKSNHVTPYEGRTIGGGGGSYPLRSQRNRSNKTGAHDDTVTAWDSDERIL
                     CENGAQTNGRNIVVTREVAVESESGSVKEQAGWGPSPSESGVPASHPKPVAQRGFVVA
                     "
     gene            <1135385..>1136698
                     /locus_tag="MYCTH_53112"
                     /db_xref="GeneID:11510235"
     mRNA            <1135385..>1136698
                     /locus_tag="MYCTH_53112"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663837.1"
                     /db_xref="GeneID:11510235"
     CDS             1135385..1136698
                     /locus_tag="MYCTH_53112"
                     /note="Contains conserved domain SET[pfam00856], SET
                     domains are protein lysine methyltransferase enzymes."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663885.1"
                     /db_xref="GeneID:11510235"
                     /db_xref="JGIDB:Spoth2_53112"
                     /translation="MARRQLSWARVLFFGLLAPLATAADANAEAEGGSADGLAYETIQ
                     NVDIYTDNATAPTTQTPPVEGWWDSRICSGSYCVYTNRRIANGRGLVAVTRTDDFQKF
                     ERIEQHLNRGENNYLQDPVPFKTTDIPNKGSGVTATKNIRRGKPLMAWSPVLAVHKSF
                     FEDVTKRKERDRLLEAAVSFLPEATRAVFDKQRARPGDSEGTNRRSVEDIVLAHPFEI
                     DLGYVSYRQMNSEEHSRHYVNYPEVAVFQHDCRPNVATFIDASFALRATVARRVQEGE
                     ELTVAYVDPFLPREQRASWVRQYRGFPDSKGCPCSACSPPGGPKGGKAAQGDKRLKEI
                     LRIRGELRNPDSTKVDFATIERFLKLYEEDRLHAKLAEAYELAALNFNYLGDDKRAKK
                     YADLAVQAGIIEQGVDANDVIAMKIMAKDIKGHYSYRYTLKRRGK"
     gene            complement(<1137545..>1138750)
                     /locus_tag="MYCTH_102878"
                     /db_xref="GeneID:11510236"
     mRNA            complement(join(<1137545..1138377,1138467..1138556,
                     1138618..>1138750))
                     /locus_tag="MYCTH_102878"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663838.1"
                     /db_xref="GeneID:11510236"
     CDS             complement(join(1137545..1138377,1138467..1138556,
                     1138618..1138750))
                     /locus_tag="MYCTH_102878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663886.1"
                     /db_xref="GeneID:11510236"
                     /db_xref="JGIDB:Spoth2_102878"
                     /translation="MTWSDFSDTTSEDWRKCQVPGCHKKHTGHTQHNKRKVYSDFCFR
                     HTCWVTYPEEEGKGYYCSIPKGSDDRYCAFHMKCGEDDCARTGEWPGAHDYARWFCRE
                     HRCTYPDCRLRATDRQQQRCAAHLVKCAVPACARPAYQHRDGALDTMCAAHYGTQRCL
                     WPNCARRASSRYCSAHGCRRPGCDRPRARAVPDTPASPAAADGNNGANDSPYLYCLAH
                     TCKTAGCRAGARLEDVHCERHARARERRRPVSLGVDPLGLGFGWEEQEQEQDEEEEER
                     EDRRGGRYEPPTAAAAARGGDEWQREREWKRLSDDLERIRRRQRELAAERARVERARE
                     EREKAERFYARYMAGSS"
     gene            complement(<1140735..>1141320)
                     /locus_tag="MYCTH_95259"
                     /db_xref="GeneID:11510237"
     mRNA            complement(join(<1140735..1140936,1141016..>1141320))
                     /locus_tag="MYCTH_95259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663839.1"
                     /db_xref="GeneID:11510237"
     CDS             complement(join(1140735..1140936,1141016..1141320))
                     /locus_tag="MYCTH_95259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663887.1"
                     /db_xref="GeneID:11510237"
                     /db_xref="JGIDB:Spoth2_95259"
                     /translation="MLVVGLWYTHEEQISRSSWWYSFSGGSLPVSPLINYGMGHIRGG
                     SMQPWQYYLINFFSSAWMQCIGLGTSNVAGHTKKAVYAAATFIAYSVGNIIGPLIFDA
                     SYAPRYDKSFTGVMICFVICFLCAEILRFFLARENKNREARYGPPNDVHSLEDLTDKE
                     NKPFRYHL"
     gene            <1141596..>1141970
                     /locus_tag="MYCTH_2023245"
                     /db_xref="GeneID:11510238"
     mRNA            <1141596..>1141970
                     /locus_tag="MYCTH_2023245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663840.1"
                     /db_xref="GeneID:11510238"
     CDS             <1141596..>1141970
                     /locus_tag="MYCTH_2023245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663888.1"
                     /db_xref="GeneID:11510238"
                     /db_xref="JGIDB:Spoth2_2023245"
                     /translation="SMANLAAALFEAEQFDEAEELGKRMLDERVEVLGDNHPDTLVSM
                     SNLATVYKSRGRREEAGDLMVETIQRQSSQLGEEHPSTLISKFNLALIRLEQGQWELA
                     EDALVRILGKMETVLGREHECTV"
     gene            complement(<1143238..1145238)
                     /locus_tag="MYCTH_2306119"
                     /db_xref="GeneID:11510239"
     mRNA            complement(<1143238..1145238)
                     /locus_tag="MYCTH_2306119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663841.1"
                     /db_xref="GeneID:11510239"
     CDS             complement(<1143309..1144941)
                     /locus_tag="MYCTH_2306119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663889.1"
                     /db_xref="GeneID:11510239"
                     /db_xref="JGIDB:Spoth2_2306119"
                     /translation="MSEKLAVLAEGYKLTPTRRRRPLAQPNKPIQGSTAERKLDVGFV
                     DDPEAGKDSRCHWSQILIPGELKSNPSADTASKAWLDLGRYAREVLAAQDVRRFVLGF
                     TICGSLMRIWEFDRLGGIASERFDINKDGLQFVSTVLGFLWMNEEQLGFDPTITTQDG
                     RRLATIKRNGQTERLVIDKLVRRAPCIAGRATTCWVAHREGEPGIKFVIKDSWQYTER
                     EEEGDLLKEATDKGVVNVARYYHHETVFVRGEIDEIRSNVRYGLNIMEATNYRPGRSE
                     VSPGMSVVGAPRKGRSSTASLKRSSSQTGAALPPRKRSCLASPTKADSSALPNRVHRR
                     VILRDYGKPIYKASSLSALLAALEGCINGHESLHRAGILHRDISINNLMINEDNDNPS
                     WHSFLIDLDLAIREKRDGTSEAKTGTRAFMAIGALLGEQHSFMHDLESFFWVLFWICI
                     HYNGPGKGEVVTQFDRWNYMDTDELAKLKLGTVVEEAIFMKTITDNFTPYYASLIPLL
                     NRLRKAVFPKDKPWEREDEKLYAQMRDILRQEGKDL"
     gene            complement(1146276..1147552)
                     /locus_tag="MYCTH_2306121"
                     /db_xref="GeneID:11510240"
     mRNA            complement(join(1146276..1146635,1146746..1147141,
                     1147314..1147552))
                     /locus_tag="MYCTH_2306121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663842.1"
                     /db_xref="GeneID:11510240"
     CDS             complement(join(1146292..1146635,1146746..1147141,
                     1147314..1147467))
                     /locus_tag="MYCTH_2306121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663890.1"
                     /db_xref="GeneID:11510240"
                     /db_xref="JGIDB:Spoth2_2306121"
                     /translation="MVSLRFLATVALPCIGAALTPAAVYDAGYGTSWPIHLGIGNGGA
                     GQSGLIEALANAFIEDSVSNGSEPFRVAWYQSDTTYSIKNLEDGLIDVAITYSPAAEK
                     IAIDQGIALEPSYYAFRDHFLIVGPPSNPANISSESDVYTIFSDLHQAAEAANSTPPV
                     RFLSRYDKSATNIKESVLWASIGQVPWATAYSTWYHQYITFPIQALTAAILLDEYTLT
                     DRGTLLSLPTNLMSKTTVYKASTDEADDPLLNPAHLLIGAKAANAETAQSFADWLVSP
                     AGQDVIKGFKKNGEQLYSPAP"
     gene            complement(<1148384..>1148647)
                     /locus_tag="MYCTH_2065257"
                     /db_xref="GeneID:11510241"
     mRNA            complement(<1148384..>1148647)
                     /locus_tag="MYCTH_2065257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663843.1"
                     /db_xref="GeneID:11510241"
     CDS             complement(1148384..>1148647)
                     /locus_tag="MYCTH_2065257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663891.1"
                     /db_xref="GeneID:11510241"
                     /db_xref="JGIDB:Spoth2_2065257"
                     /translation="LNTLGLLSTFPVFQTYVETGELFETSSSNISWIGSIQSFLLQLT
                     GIIVGPLYDRGYLRSLLCTGSLLVVLGLMMLSLCTEHWQALLG"
     gene            <1149901..>1150413
                     /locus_tag="MYCTH_53171"
                     /db_xref="GeneID:11510242"
     mRNA            <1149901..>1150413
                     /locus_tag="MYCTH_53171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663844.1"
                     /db_xref="GeneID:11510242"
     CDS             1149901..1150413
                     /locus_tag="MYCTH_53171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663892.1"
                     /db_xref="GeneID:11510242"
                     /db_xref="JGIDB:Spoth2_53171"
                     /translation="MDQRAQIIRAPSRPAITGKVAVFLAGTTTGTTAAAAAAGADWRE
                     TVTLAVSHLPVTVLNPLRPDWDGSWREDPSFAPFREQIEWELDMQERADLVVVYLGPG
                     TDAPVSLLELGLCARSGKAVVVACYPGYRKRGNVQIVCRWFGLEYVDGEDDLAGRVVK
                     RIERLLELGN"
     gene            1151073..1154262
                     /locus_tag="MYCTH_2306123"
                     /db_xref="GeneID:11510243"
     mRNA            join(1151073..1151448,1151505..1151531,1151579..1152294,
                     1152353..1152587,1152650..1152847,1152910..1153714,
                     1153772..1154262)
                     /locus_tag="MYCTH_2306123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663845.1"
                     /db_xref="GeneID:11510243"
     CDS             join(1151245..1151448,1151505..1151531,1151579..1152294,
                     1152353..1152587,1152650..1152847,1152910..1153714,
                     1153772..1154010)
                     /locus_tag="MYCTH_2306123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663893.1"
                     /db_xref="GeneID:11510243"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="JGIDB:Spoth2_2306123"
                     /translation="MAGITVHNSLKPGAPVPFVPREEGKVSWYACGPTTYDLSHLGHA
                     RNYVSTDIIRRILMHHFGFKVNFVMNYTDVDDKIIIKARRKRLLELEKEKPYTPEQIR
                     DLVFKAFRAYAESNLPLLTADGQSALDENNYLDRRDAAYGRVLAGGTLSGEGKPSDAE
                     AKVKMHLSNMDSAAKSLRDASGFDGAEEVLLPYLDSLYKETIDTSDQTIFTNLTQAME
                     KAFNDDMRALNVLPPDAVTRVTEYVPQIVKFVEQVMAKGFAYEANGSVYFDIAAFEKA
                     GNTYARLRPESKNDKALQEEGEGSLSKSLEGKKRPGDFALWKKSKPGEPYWPSPWGPG
                     RPGWHIECSVMASDKLGEQMDIHSGGIDLAFPHHDNELAQSEAYFHECGKGEHTWVRY
                     FLHMGHLSIAGSKMSKSLKNFQTIQDALATTYTARNMRIVFLMGRWNDGVEISQDMRK
                     QADSWESTIDNFFTNVKAKLTEAGSMTEGVKNLSLTEGTGDSLIAELEQAKTDLDSAL
                     RNSFDTPGAMQVILRLVKEANIHMNDKSAQPSLQALEAVARWVTKIVGILGLDANAQP
                     PYDGLGWSSTSAAAAANLDPQTAVKPYAGVYAKVKADIEALNLAAPSVQNLLQGQTPD
                     AEFAELEKIGERDVEKLAMPYLRATSRLRDELRSIVATLEPASKQAVLALSDRIRDYD
                     LTDIGVQLDDQADKPSLIKFVPAAKLIAAREEKAALLAEKARQKEEARKAREKAEEEK
                     WAKAKVPPQEMFKGDPKYQEWDADGLPTKLADGTELPKSQAKKLRKEWERQAKLHEEY
                     RVKFGIGKE"
     gene            1194560..1196027
                     /locus_tag="MYCTH_2306125"
                     /db_xref="GeneID:11510244"
     mRNA            join(1194560..1195348,1195474..1196027)
                     /locus_tag="MYCTH_2306125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663846.1"
                     /db_xref="GeneID:11510244"
     CDS             join(1194741..1195348,1195474..1195807)
                     /locus_tag="MYCTH_2306125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663894.1"
                     /db_xref="GeneID:11510244"
                     /db_xref="JGIDB:Spoth2_2306125"
                     /translation="MGKRSKNHPPRAYHDGLIPATHDTYQSYPEVVPDDYDQVKHEKS
                     YPELAPPPDADSKQQQQQQQQLAPDDQHSTILPASSAHSAHHPHQEQQQQEQQQSQLS
                     GSGAGALPLSITPVIPALHPLPRTSGVHSLRQAWSELDESDGDDDRRGSLRYQEDRPA
                     LWKRPILWVVVVMTAVIVALAGILGGVASGRIETALGSSGKTSGGSASSTPSVMDPTC
                     PSANNLNYTSTAASMPKTFRIQCGSNYPDGDGDLGRLDDPVDNLAGCLDACAKDKRCV
                     GAVFSPGSPASCWLKEFLGVVDKEGEATEMVSGVLWQ"
     gene            complement(1198391..1199482)
                     /locus_tag="MYCTH_2306127"
                     /db_xref="GeneID:11510245"
     mRNA            complement(1198391..1199482)
                     /locus_tag="MYCTH_2306127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663847.1"
                     /db_xref="GeneID:11510245"
     CDS             complement(1198648..1199214)
                     /locus_tag="MYCTH_2306127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663895.1"
                     /db_xref="GeneID:11510245"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="JGIDB:Spoth2_2306127"
                     /translation="MATQDQVAPTPAPAAEAQAPAAAAAAAATRSDSDPSILAHVEHY
                     HATRCAASPIYAFLLGTPADKPLVRFTHARKGLFTARLRLDAQHLNSAGGIHGSVSAT
                     LVDWAGGLAIAAWDLRAATGVSVDINISYLSSARLGDEIEIEGRVERVGSNLAFTEVR
                     IFKVDARGERGAVVASGRHTKFVRDTKK"
     gene            1199854..1201172
                     /locus_tag="MYCTH_2306128"
                     /db_xref="GeneID:11510246"
     mRNA            1199854..1201172
                     /locus_tag="MYCTH_2306128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663848.1"
                     /db_xref="GeneID:11510246"
     CDS             1200031..1200798
                     /locus_tag="MYCTH_2306128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663896.1"
                     /db_xref="GeneID:11510246"
                     /db_xref="JGIDB:Spoth2_2306128"
                     /translation="MVSHGSENVYSARVKFGLRSSPQRWGQEPIFCVQRFGRTETKLP
                     DGRIVYIVGEHEDSYDPDFYIYNDVVVVHKAGSNAGGESAATGAVDDSDRDSDSISDS
                     ELPDYLPKRREEELADNLMGATLAAGADPADIDIYGYPTDVFPGTDFHTATYVREEGS
                     NGKEYIYIIGGLGYITSPHRAATMTHRLDLQDHTIQRIETTGEAPPPLAGSKTEQKAQ
                     LHGDRIVYTVGSDTYVLSLADMRWSRDQAHAESPAVG"
     gene            <1201500..>1202162
                     /locus_tag="MYCTH_2110936"
                     /db_xref="GeneID:11510247"
     mRNA            join(<1201500..1201827,1201896..1201948,1202046..>1202162)
                     /locus_tag="MYCTH_2110936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663849.1"
                     /db_xref="GeneID:11510247"
     CDS             join(1201500..1201827,1201896..1201948,1202046..1202162)
                     /locus_tag="MYCTH_2110936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663897.1"
                     /db_xref="GeneID:11510247"
                     /db_xref="JGIDB:Spoth2_2110936"
                     /translation="MAEELESSAFRDGPVVRMMVLETDESHPETKSRRGTFGEILHHH
                     FLDAGNAHDPPLGIETDTRYVISEKAGSMPKFQDFKNCHALLITGTTYSAGGNDPWIL
                     ELLALLKANIASELWLHHPRMCFSGIGTRHIKHYHENNSTVHPTRKRSVASELILNYE
                     NLHTD"
     gene            <1203532..>1205359
                     /locus_tag="MYCTH_2064932"
                     /db_xref="GeneID:11510248"
     mRNA            join(<1203532..1203717,1203889..1204494,1204605..1204674,
                     1204839..>1205359)
                     /locus_tag="MYCTH_2064932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663850.1"
                     /db_xref="GeneID:11510248"
     CDS             join(1203532..1203717,1203889..1204494,1204605..1204674,
                     1204839..1205359)
                     /locus_tag="MYCTH_2064932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663898.1"
                     /db_xref="GeneID:11510248"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="JGIDB:Spoth2_2064932"
                     /translation="MGSNSDDITVDNVEIIGFEVIDLRFPTSLDGVGSDAMHVGTNGS
                     HPYVRLKTNHPDLVGEGIAFSNGRGSELITLALDVFARRVVGKTMERLTRDMGKTWRY
                     MVSDSQYRWVGPEKSVTHLAVAGVLNAVWDLWGKIVGKPVWRIVCDMTPEELVRCIDF
                     RYITDVLTPDEAVAMLRRTQEGKEARLQEALANRAVPAYTTSPGWLAFGGDKMREVLQ
                     ETIRQGFTVFKFKVGTSVEADRDRLRAVREVLGYDNGYQIMIDANQVWSVPEAIEYMK
                     QLVEFKPVFIEEPTNPDDVLGHAAIRKALKPYGVGVATGEAAQNRVTFKQLFQAEATD
                     VAQIDAVRLGSVNECLAVMLMALKFNVPCVPHNGAMGLTELTSHLSLIDYVAVSGKKS
                     MLEFADSHRENLRHPSRIVDAHYVTPLEPGYSIGYTDEALEKYTYPNGSFWRSEIGQQ
                     IIAQPTGGEL"
     gene            complement(<1205801..>1207627)
                     /locus_tag="MYCTH_102871"
                     /db_xref="GeneID:11510249"
     mRNA            complement(join(<1205801..1206446,1206520..1207506,
                     1207575..>1207627))
                     /locus_tag="MYCTH_102871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663851.1"
                     /db_xref="GeneID:11510249"
     CDS             complement(join(1205801..1206446,1206520..1207506,
                     1207575..1207627))
                     /locus_tag="MYCTH_102871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663899.1"
                     /db_xref="GeneID:11510249"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_102871"
                     /translation="MSFQRRRVALACTYCRHRKRRCDAGRPSCRSCIEADVDCHYDDT
                     PSQRIDSSGGSREIIGRLQEIETMLQHHLSGIAALASGIHTIASQSAAGALAATSPAS
                     QASTLQAARILSHDLAGAGSSQQWALPLPIDSQPDPSSVADAELAPLTIPVGHKTSSN
                     YLLRLPATKQLIGEYPADLFFMLESRNSFPPEAPVHPTSPVKPLSAAELDKDVLDCLV
                     SAFFTQVYQYHPILDKADFSRIYRAFHENYYSQPWSIESVLCLVVFALGAASLAPPGA
                     QGFQTSPPGMSYMESALPLLLSMSSWDVNYSLLLPQALVLASVYFAYIIRPLQSWRLI
                     YSASSLLQFKLCRLSARAADPAAKEIILRIFWSCFLVECDRLAELELPQSGLQQLIDQ
                     TSLPSFDGVDSAQSTAYLAEISIRRLLNRVHHTLYPRKQNVLSLSSTSLTAADDLSAA
                     EIASITSVCEELHRQLNSWYESIPEPSRPSLGTEPTGSDRKRVLRIRYYAARHIIHRP
                     FVLYIVTNNLQQVSNSTVLEKASVCIESCRAYLHNTTEILRKQSQYTWTFSLS"
     gene            complement(1208412..1210485)
                     /locus_tag="MYCTH_2306135"
                     /db_xref="GeneID:11510250"
     mRNA            complement(join(1208412..1208844,1208935..1209571,
                     1209645..1209816,1209898..1210485))
                     /locus_tag="MYCTH_2306135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663852.1"
                     /db_xref="GeneID:11510250"
     CDS             complement(join(1208703..1208844,1208935..1209571,
                     1209645..1209816,1209898..1210089))
                     /locus_tag="MYCTH_2306135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663900.1"
                     /db_xref="GeneID:11510250"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2306135"
                     /translation="MGFFDGLRGNWLIACITVVNATSMAWFGYDQGVFSGVLISSDFK
                     HWFPETNKANIPGITSSCFSLGAFCGAIFAFTLGDKLGRKKTIALGLLCNVVGAILQI
                     VAWHLPQMIIGRVINGFGMGLTSSTCPVYQAECSRPAVRGKLVVVQSVCNTAAFCLSN
                     WMNYGLYFSGGALQWRFPLGFQLIFPAVVSVALLFVPESPRWLLLRNRHGEALAVIAR
                     LEGKDATIHDDKVTAEYLSIRTALQHERKDRPPFSDVIRFRDRQQNLRRLLLSCGTQF
                     MQQFSGVNALGYYLPTLLQQSVGFDEQMSRLMTGVNGTIYLGAALCCILIIDRFGRRK
                     MMLYGASTMGACYLVAAMCLRAGQAGQADKKQVRTRESKLWFPAAC"
     gene            1211009..1212426
                     /locus_tag="MYCTH_2306136"
                     /db_xref="GeneID:11510251"
     mRNA            join(1211009..1211342,1211407..1212426)
                     /locus_tag="MYCTH_2306136"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663853.1"
                     /db_xref="GeneID:11510251"
     CDS             join(1211184..1211342,1211407..1212204)
                     /locus_tag="MYCTH_2306136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663901.1"
                     /db_xref="GeneID:11510251"
                     /db_xref="JGIDB:Spoth2_2306136"
                     /translation="MAKGEAMMKARPQYAGKLDFVQISDFDQMNNNEQLSIFDEAVKG
                     VDGIIHTASPLTYNTTNNEAELILPAINGVRALLAAAAAANRDPNNKRAIRRVVLTSS
                     FAAVMDASRKAPPYFTYTASDWNPLSYAEAADPSTSAVVAYRGKKFAELAAWDFVREH
                     GGGGGGGFDLVTLCPPMTFGPVAHPVESVERLNESNAMLWKVASGARPLPVARVPFWV
                     DVRDVAKAHVEALLRPEAGGKRFLPAAPERFTYALAARIVEEEFEWAKGRVSTEEQVV
                     DESHGVDGETAARELGLEYRRFRQTVAELVAQAATMKGSGLT"
     gene            complement(<1213308..>1215327)
                     /locus_tag="MYCTH_51992"
                     /db_xref="GeneID:11510252"
     mRNA            complement(join(<1213308..1213913,1213968..1214379,
                     1214430..1214616,1215246..>1215327))
                     /locus_tag="MYCTH_51992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663854.1"
                     /db_xref="GeneID:11510252"
     CDS             complement(join(1213308..1213913,1213968..1214379,
                     1214430..1214616,1215246..1215327))
                     /locus_tag="MYCTH_51992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663902.1"
                     /db_xref="GeneID:11510252"
                     /db_xref="JGIDB:Spoth2_51992"
                     /translation="MSELGCQSKRDIERCKVIFGAAVSSSPKVHRLLTTAGTEPVQWT
                     LAFHATEQPVDPFIGIWNFGRGEFEDANLNLQQRDGYEYARISHLEIMPLSLAENEEH
                     DPKTSPRPKLELVDQVPDTIFSTSQTMSQTAKTMMEQKIAPTQETGNNSKHSKPGPRR
                     AAAAQLSPPLTIASRRDHSKSATIEKVYGSEMTPNKMSHSTSPSTEDSCRSIPRKRLG
                     TKRKPKRPLQLFEDVTSSLPPTQVIGESQSLGQRSQIWNHRQSAELGTEPTTQDWLVE
                     EISGSVSPDPLRIFDGISLSPEALSDAQTSPGVALLRHAAPSPNIAYQLRLGSSTNDG
                     GLIRLEPPPSVTNGHNCMSQGELRASASAKLLDITISDDEQDLRMVAVEEHHALSHTA
                     AEKGEGLDISFNFSPHTVSRRASLFQDIPNSSEDEE"
     gene            1217522..1221126
                     /locus_tag="MYCTH_2306137"
                     /db_xref="GeneID:11510253"
     mRNA            join(1217522..1217973,1218039..1220678,1220734..1221126)
                     /locus_tag="MYCTH_2306137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663855.1"
                     /db_xref="GeneID:11510253"
     CDS             join(1217668..1217973,1218039..1220678,1220734..1220841)
                     /locus_tag="MYCTH_2306137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663903.1"
                     /db_xref="GeneID:11510253"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2306137"
                     /translation="MEPHRPRSSHKVSMTWHEDEATLTRMMQFADECIETKTVTTTTT
                     TKRSYPPLFLREPRDVLSLDSKEYPLAAKPTPPELRKFTFDLDDYETRSWKNEISDPQ
                     VRRSQSIDYTGEIKREPGVDSPISTTSHRLNEQLEAYQGRSRRSTRGVSPNQTPMPTR
                     SSRAATKPPSIPHTASDKLRHAVSRGYSRDAARVLRRSSGYLATPSTSELATGRLERA
                     ARLRSFPADVADSGTSQSTSVYDVDSLADSESQTFSNVATPPITDPELPPFDDADDSL
                     PPHASDPPPRRSLSTVAAQDVSLPSPRLSPTLAATQVQPTQADDEAEEAEETSFSTQL
                     TRSDRQQWMDESQATDDTEVPGAMDLSPAPYGASLSRSRSYRRPHLDPGSMLDSFDAM
                     PNELKTWMMYQFLRRCPRKTLHVVADVVNPALKCDFLKQLPLELSLHVLSYLDHRDLC
                     RAAQVSKHWRHIIDSNETGWKELFDRDGFRLPPGELQRAINEGWGWQDPVGFEGCEVD
                     LSNQSRLTFSEHELIRSAAKADVPEILPRTRSAKRKRGSTQINAERAKRRVSAQEGKA
                     DRNMPPAKTHKSEGPISAANAAAIAVPDPQLGLPSLRNLHLFKSLYRRHYMFRRSWMS
                     GKVKPGHVAFAAHPRHVITCLQFDDDKIITGSDDTLIHVYDTKTGKLRTKLEGHEGGV
                     WALQYEGNTLVSGSTDRSVRVWDIQKGICTQTFYGHTSTVRCLQIVMPVDTGKVQDGK
                     PVMMPPKPLIITGSRDSQLRVWRLPEAGSRRYIQTGPPASDDQCPYFIRILSGHAHSV
                     RAISAYGDTLVSGSYDSTVRVWRISTGEQLHVLHGHVQKVYSVVLDHKRNRCISGSMD
                     SLVKIWDLNTGACLHTLEGHSMLVGLLDLRDDQLVSAAADSTLRIWDPDTGKCKKVLE
                     AHTGAITCFQHDGRKVISGSDKTVKMWDVATGDCVQDLLTDLAGVWQVKFDDRRCVAA
                     VQRDGLTYVEILDFGAVRDGKPPEELGKRKLLNEAEVQRLIAEES"
     gene            <1221737..>1222964
                     /locus_tag="MYCTH_52645"
                     /db_xref="GeneID:11510254"
     mRNA            join(<1221737..1221814,1221897..1221953,1222035..1222128,
                     1222210..>1222964)
                     /locus_tag="MYCTH_52645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663856.1"
                     /db_xref="GeneID:11510254"
     CDS             join(1221737..1221814,1221897..1221953,1222035..1222128,
                     1222210..1222964)
                     /locus_tag="MYCTH_52645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663904.1"
                     /db_xref="GeneID:11510254"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="JGIDB:Spoth2_52645"
                     /translation="MVPPRPTSGVVDPSGGIVGSFSRFWQRTYASDHIGFVLLLVGYL
                     LLQFFVEPFHRMFSLNDLRIAFPHAEVERVPLLNDFIYALFLPLGVLILANLATHAPP
                     HKHHVTVLGLAISLILASFLTDVIKNAVGRPRPDLLARCVPRPDTPRDVLVTIDVCTQ
                     TDHHTLHDGWRSFPSGHSSFAFAGLGYLSLFLAGQMRIFAHGGGGGGGGGASAGDKVE
                     KLVRGDLLRALLCGAPLLGATMIAISRCQDYRHDVYDVCVGGLLGWTVAYWSYRRYWP
                     RLGSWRCEEPYAGPLGAQDVVGRNGYGRVRDEEEGLGQGRNVGIDLGVLSN"
     gene            complement(1222992..1224326)
                     /locus_tag="MYCTH_2306141"
                     /db_xref="GeneID:11510255"
     mRNA            complement(join(1222992..1223308,1223364..1223782,
                     1223844..1224028,1224112..1224326))
                     /locus_tag="MYCTH_2306141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663857.1"
                     /db_xref="GeneID:11510255"
     CDS             complement(join(1223181..1223308,1223364..1223782,
                     1223844..1224028,1224112..1224135))
                     /locus_tag="MYCTH_2306141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663905.1"
                     /db_xref="GeneID:11510255"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Spoth2_2306141"
                     /translation="MSRRYDSRTTIFSPDGRLYQVEYALEAISHAGTAIGILAKDGIV
                     LAAERKVTSKLLEQDTSAEKLYILNDNMICAVAGMTADANILINYARQAAQRYLLTYN
                     EDIPCEQLVRRLCDLKQGYTQHGGLRPFGVSFIYAGWDPQRQFQLYLSNPSGNYGGWK
                     ATSSGANHASAQSLLKQDYKEDCTLEEACGMAVKVLSKTMDSTKLSSEKIEFATVGQT
                     KDGKIYHKLWSGEEITALLKKHDLAKDETTEEK"
     gene            1224933..1228240
                     /locus_tag="MYCTH_2306143"
                     /db_xref="GeneID:11510256"
     mRNA            join(1224933..1225086,1225232..1225806,1225866..1228240)
                     /locus_tag="MYCTH_2306143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663858.1"
                     /db_xref="GeneID:11510256"
     CDS             join(1225083..1225086,1225232..1225806,1225866..1227962)
                     /locus_tag="MYCTH_2306143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663906.1"
                     /db_xref="GeneID:11510256"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR012921"
                     /db_xref="JGIDB:Spoth2_2306143"
                     /translation="MSEPEPRRSVRATKGQHKALEQLDQAIETPKRRGGNKKTKKTAP
                     EPEEPEEEIIRCVCGATEQDEDSGEPWIACDQCGAWQHNICMGMSQYTEDLPKEYFCE
                     LCRPENHQELLAGIAKGEKPWEARRKAYEEQKAEKKKKGPKKGKKRTSDLKEDASQKS
                     KQSPPPLPEPKKEPKGAGLKRKNGEVAQDKDPKKMRKGTEAQQVPVPEYSPPEDIPAN
                     ISGLPDSRQGPAKALSKSLVASLAVAEKNGIIPADGVSKADRAEKFALQIERAVHDTH
                     PTTSSYAGQIRTLAFNLKSNPELTARLLAQTLTPPMLASMSTEELASKELQKETAEML
                     ARAEKQAIKITEDIPRVRRTHKGDEIIDDDHFIASEDVPSAPVSRPSAPKQESKDTPE
                     FPPQSRHRSVSGPAVDSQQSPSRSDFDLNKVFSSVKPPSHPQGQPRASFAAAPSTGPG
                     DDPDVDRLLDDGTHSPPYSPKEEDNDPDVVWRGNLIMNTIAEVQVAAKHMGGANLSET
                     INLPWDKLLPRNLTVCGRIDEQQAIVYLCGLRYSLPTDVVVVSLEPTTPAAKAGMNKL
                     IDYFVSKKRYGVVGDKGVANVRDTYLVPVPAGTGNQPEFMLNLADNFIPETRSEPMML
                     CVIVYRNDPETIQRIHGTTNPMGTHQAAPRGPGAASQSPGTPTPTQGGFPPTGRQSVS
                     APAFSPTSSQGAFSQYPSPRMATPVQQQPPPHAPAPQQQPKQASTIEELQRQGEATAR
                     EVLGHLITSPTVSFLLPQAHCMSRKEWEVIKKIYEKDPRTRDELPYLSTILEREGQQQ
                     QQREASQSRPQSQVQPPPPHPQQQNRAQSEQQLQGQPQPQPQLHSQHPPPVRTTPIPP
                     PPIPPAPAAGPPKQTPIPPPPIPPQATTNSGPPPA"
     gene            complement(1229754..1231030)
                     /locus_tag="MYCTH_2306147"
                     /db_xref="GeneID:11510257"
     mRNA            complement(join(1229754..1230287,1230343..1230519,
                     1230573..1231030))
                     /locus_tag="MYCTH_2306147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663859.1"
                     /db_xref="GeneID:11510257"
     CDS             complement(join(1229970..1230287,1230343..1230519,
                     1230573..1230821))
                     /locus_tag="MYCTH_2306147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663907.1"
                     /db_xref="GeneID:11510257"
                     /db_xref="InterPro:IPR009244"
                     /db_xref="JGIDB:Spoth2_2306147"
                     /translation="MDGLEDDPNRVTALWPDPPPFWRDFTPENIERFESLKEDYADQQ
                     GLSADAVIRIPNIPEHLINLQPPSEPADGKWRLFSEPETLTETLQSLEDAGIQRLGPT
                     SEIDRDSKHLDRGFELKKLVKSLLLNYLELVGLMGHNPAHAAGKIEDIKVLLLNFHHT
                     LNEYRPHHAREQLIQMMHAHGDQIRAETAGIRSVVDKAKRMIEGLASIQVPQLEKGPS
                     EKEALEPRPEQLQEQRELAGWKRIDEEFS"
     gene            1231206..1232750
                     /locus_tag="MYCTH_2306148"
                     /db_xref="GeneID:11510258"
     mRNA            1231206..1232750
                     /locus_tag="MYCTH_2306148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663860.1"
                     /db_xref="GeneID:11510258"
     CDS             1231391..1232554
                     /locus_tag="MYCTH_2306148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663908.1"
                     /db_xref="GeneID:11510258"
                     /db_xref="JGIDB:Spoth2_2306148"
                     /translation="MADVRALLRQQRAARRIEHPHASYSDTGKLICTVCNDHIKTESL
                     WDGHLRSAGHRQRLQTLHQASAKKTSNGYAGFVGQGSEIQGSAAPASKRKLADSDDDM
                     VGEDEASRRKRTRPGSPPGGKPLHEAETPAKKDNNGKADKPITPPLHRRTSGAPSAGV
                     EMQIPSRPATPSASGTPLATTPKAPPIGRSPLIPEETTAAQQESVPGAQEAQGGAAGT
                     TAAAAAAPVDEDMWAAFEADLIHGSGTKASTKPPAAAAAAGLDDDAVISAPAMSAAEV
                     AAKSEEEERTRRRALVDIQIEDEKEEATRALENEFEVMEELEARARKLRERREALRAQ
                     SNGGAVPTVAATNGDSKGSPPGKENAAMGDEEDEENEDEEDDEDDWDGFRFRS"
     gene            complement(1232851..1233577)
                     /locus_tag="MYCTH_2306149"
                     /db_xref="GeneID:11510259"
     mRNA            complement(1232851..1233577)
                     /locus_tag="MYCTH_2306149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663861.1"
                     /db_xref="GeneID:11510259"
     CDS             complement(1232889..1233560)
                     /locus_tag="MYCTH_2306149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663909.1"
                     /db_xref="GeneID:11510259"
                     /db_xref="JGIDB:Spoth2_2306149"
                     /translation="MTGSPSFLDHRIPPVPVLRSQESKLNKEKPTLEQTSRHLRTLSL
                     NPHLHQTRLRRTRAILPPLLTSPSRPSRADLVRRSIVLTHTAFASRRLARSLASIRLA
                     RQLAKRPSVETLVERCVLPPECLPLAPRSPASSSSGGSGDGKRRNGSYAGVAPVAPAL
                     IARKRAVERERVKDGLRAWVGSVWKGEVGKRQEKVRMWEERAGVGRVWRLRRFWEKVG
                     RGEQV"
     gene            1241484..1242367
                     /locus_tag="MYCTH_2306150"
                     /db_xref="GeneID:11510260"
     mRNA            1241484..1242367
                     /locus_tag="MYCTH_2306150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663862.1"
                     /db_xref="GeneID:11510260"
     CDS             1241725..1242060
                     /locus_tag="MYCTH_2306150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663910.1"
                     /db_xref="GeneID:11510260"
                     /db_xref="JGIDB:Spoth2_2306150"
                     /translation="MCYFDHQLWPCGWWKWGSFRGQCPKEYRTGETCGLKLIYNTYLE
                     PQVCKHCEQIYKKQRRVAKMAEDVKRWRCEGNRRATVEKTEREMMELNLQINQLWTEH
                     EIRRHAINY"
     gene            complement(1245047..1246283)
                     /locus_tag="MYCTH_2315477"
                     /db_xref="GeneID:11510261"
     mRNA            complement(join(1245047..1245665,1245770..1245918,
                     1245977..1246283))
                     /locus_tag="MYCTH_2315477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663863.1"
                     /db_xref="GeneID:11510261"
     CDS             complement(join(1245386..1245665,1245770..1245918,
                     1245977..1246030))
                     /locus_tag="MYCTH_2315477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663911.1"
                     /db_xref="GeneID:11510261"
                     /db_xref="JGIDB:Spoth2_2315477"
                     /translation="MGNCSSCLGSRRRDEYDEEEDEAQHLFDDPNNLHYGSFDQQHMM
                     GQEDPQEAQREIEALQRVVARTSDAMVDIYEIVPQDKPAQPANGPFVYIGQDATTVRY
                     QTLLSKLSSQDDLLSAARVDWGSPDDDTIEMQQDPVPIKVDGSDSLVGNFADAAAAMR
                     "
     gene            complement(1247106..1247664)
                     /locus_tag="MYCTH_2306154"
                     /db_xref="GeneID:11510262"
     mRNA            complement(1247106..1247664)
                     /locus_tag="MYCTH_2306154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663864.1"
                     /db_xref="GeneID:11510262"
     CDS             complement(1247413..1247640)
                     /locus_tag="MYCTH_2306154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663912.1"
                     /db_xref="GeneID:11510262"
                     /db_xref="JGIDB:Spoth2_2306154"
                     /translation="MEELTYNTIRLGGMSSRQSHKSPHPSGESKRPQTGDQFPKPRAK
                     LGGRGTQPVVALNLPVAEDLGRAFFCVVSFF"
     gene            1247682..1248932
                     /locus_tag="MYCTH_2306155"
                     /db_xref="GeneID:11510263"
     mRNA            1247682..1248932
                     /locus_tag="MYCTH_2306155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663865.1"
                     /db_xref="GeneID:11510263"
     CDS             1247855..1248703
                     /locus_tag="MYCTH_2306155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663913.1"
                     /db_xref="GeneID:11510263"
                     /db_xref="JGIDB:Spoth2_2306155"
                     /translation="MAADTLSPYCVNESRTSVISTSATTTTATTATTTTTTTTTTTSS
                     SSLASTTRPSSSRTSSNSVTTSATPVSSSESLPSTDGQTAAPSNTLSTSTSAHHPSST
                     STPTATAGPHNKGGLPLSAQIAVGVVIPVAVILLVGALWFFAFRRPNRAHNGPGHRRW
                     GTGGTASSGFATGSRGPTPPPTYDKSGLDVVVVEPPSSLYEQQQQQYATAPDAEHGRE
                     RAAVGEEFELADLRGPAGGLGNGGVSDGARSRAGGTREVSPLSDASSGGPRGQMPPHP
                     GDVVVV"
     gene            <1271877..>1274080
                     /locus_tag="MYCTH_95235"
                     /db_xref="GeneID:11510264"
     mRNA            join(<1271877..1272166,1272241..1272606,1272725..1273216,
                     1273269..1273668,1273718..>1274080)
                     /locus_tag="MYCTH_95235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663866.1"
                     /db_xref="GeneID:11510264"
     CDS             join(1271877..1272166,1272241..1272606,1272725..1273216,
                     1273269..1273668,1273718..1274080)
                     /locus_tag="MYCTH_95235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663914.1"
                     /db_xref="GeneID:11510264"
                     /db_xref="JGIDB:Spoth2_95235"
                     /translation="MTACFSRTGVVAYRDYDKHDKFTEWSGWHSRDAHQSETSQEALL
                     SFVRDLRMHGGADWAEAIKTGLALAYEHMRLEAKTVILLYCDAPPHTEVDGGSIDKFA
                     SENEENVFSYLPTFRARTVCNDRLNPARDQLISRFGLRVSRMEDAEKKERLNRLLEAS
                     YDFAADIAEMIKAVPDESRYLCVCLEQTVRFSQSENAADDANDDSMESSRDELLEIGR
                     SIPMAMAQQEHGRNFWSLLLHLVLPGTMLAARPAALLAAFSVRMGIQPLQEVAYKELV
                     AWRDNWNTLDIPETWNVNCLSLLLEADQKYWLAVAEGHPGAGSKALLTEEDRELFDVL
                     VSYKLLEMNLDMELMAEVGWSPEKNKAPLGPVVTCQVCQFPRSVTMMAPRCLFSAADT
                     DTTLGTWVECPMKTCRAQYVVYNPPRLHVRPKCHYCRQEGITSKSDPNYETITTAPCV
                     ECTKCKSRVIWAAAYRPSSFDPSTYQCPACPAGTPSTIITAEATPLILASENGTAWLL
                     RNDGATIRDRWNLSLQRLLPASIPVALTIRGKPVHNAAALVATLRQWIAARRIQARAC
                     SLCFASAAHRDLRLACGGRRRSGHQDAPRPRLRRGDGEGGRMRPRQVRVWEAPADTLG
                     EIYQHMTQVHQT"
     gene            complement(1274422..1277952)
                     /locus_tag="MYCTH_2306157"
                     /db_xref="GeneID:11510265"
     mRNA            complement(join(1274422..1276338,1276405..1277677,
                     1277735..1277952))
                     /locus_tag="MYCTH_2306157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663867.1"
                     /db_xref="GeneID:11510265"
     CDS             complement(join(1274856..1276338,1276405..1277677,
                     1277735..1277861))
                     /locus_tag="MYCTH_2306157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663915.1"
                     /db_xref="GeneID:11510265"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="JGIDB:Spoth2_2306157"
                     /translation="MPRIKQESGRVRSITTPDSIPDVQSETPSERDQRLRLIRSAAPS
                     IDTRIRPPTASGPPQFEEDEGDDLIMMQVRHNPKAEHDIIMGSQSIQGSFVGANRALR
                     GIGQKLKDINDALGELQARGIQHVANLPELVLVGDQSSGKSSLMSAIAGLSLPRSTGT
                     CTRCPIHIRVSRADEWSCRVFLKNDYEFCPPNHPLTERDVTSTNKFPPWVKLDPSRQA
                     RREFKTVRDQLDSEEIETVLRCAQVAILNPSTHYQFFIPKSRGEVPDSTREQHLEQVR
                     KKEERAEAQFSPNTVALEVKGPDLADLNFYDLPGVFMTARRAEDSFLERVVQNLTREY
                     ISRQSAIILCAVPMNQDPENSFALKIIKAQRAHNRCIGVMTKADLLSSEHGAASRWLA
                     MLNGEAHQTGFGYFITSRQGSDLEEQNKMEEAFFNRTADATGHWPEEFDDFKEKCGVE
                     KLKAFLSRKLGEEFAKILPEVKHKVESRLHDIDNQLKKYPDPPPNPELEIVKSLAEFT
                     NRVKERVTNQDFMSTWDARFGEPFKKFIINLKPKFNVRDNAKASSRPIYIDLDSDSPS
                     SSPTARKRSAPSTDPAGAGATPKRPRAQNTNGVVKTEPQDSPFFASSTTPSHVRSGTP
                     TTPSRGARSKSLMDIRNLIRRAAIPGQPGLISATVYEPLYIEAAKTWAPHLEWFINST
                     FAFLQAEVFAILDAAFAHLKNRAVYKESLEHMRAFIEAHKAELRAQLLFIYNLESQRL
                     CTKDEETLKRHQAAEMKILVRHRNHFRIAAFNGEELRAVPKMEDMTDEERKQEELKMA
                     KELKNLGPDPFEPELAVAAYIRGYYLTAANRFVDYVSIHVMSGLLPRVASVIDTYLHE
                     KLGLTGRATTQEVLQRLMSEGPEIEQKRRDLRAEKETLDGAMDIIVNLERRERDQAAA
                     AAAASPSQFGSGFDASQADGVFEVGHANGVAGDRGTIYSGTAFGDA"
     gene            1279602..1281653
                     /locus_tag="MYCTH_2306158"
                     /db_xref="GeneID:11510266"
     mRNA            join(1279602..1279798,1279910..1279966,1280034..1281203,
                     1281267..1281653)
                     /locus_tag="MYCTH_2306158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663868.1"
                     /db_xref="GeneID:11510266"
     CDS             join(1279730..1279798,1279910..1279966,1280034..1281203,
                     1281267..1281293)
                     /locus_tag="MYCTH_2306158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663916.1"
                     /db_xref="GeneID:11510266"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="JGIDB:Spoth2_2306158"
                     /translation="MSLQIPLREKPSGAGGATKAVILVGGASRGTRFRPLSLDVPKPL
                     FDVAGHPIIWHCLTAINKVPSIHEVYLIGYYEESVFRDFIKDASTEFTNLSIKYLREY
                     QALGTAGGLYHFRDAILKGRPEHIFVLNSDVCCSFPLNEMLQLADEKDAEAVILGTRV
                     SEEAATNFGCIVSDSHTRRVLHYVEKPESYISNLINCGVYLFSADALFPSIRSAIKRR
                     NDRPRLASYRSSENLASSFLIDEEESQKSEVIRLEQDILSDMADNKQFFVYETKDFWR
                     QIKTAGSAIPANALYLQKALQNGSKELAQPSANIIPPVYIHPSAQVHPTAKLGPNVSV
                     GPQAIIGAGARVKESIVLEDAEIRHDACVLYSIIGWSSRVGAWARVEGTPTPVTSHNT
                     SIIKNGVKVQAITILGKECVVGDEVRVQNCVCLPFKELKRDVANEVIM"
     gene            complement(<1282005..>1283910)
                     /locus_tag="MYCTH_95232"
                     /db_xref="GeneID:11510267"
     mRNA            complement(join(<1282005..1282562,1282596..1282819,
                     1283012..1283055,1283205..1283369,1283732..>1283910))
                     /locus_tag="MYCTH_95232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663869.1"
                     /db_xref="GeneID:11510267"
     CDS             complement(join(1282005..1282562,1282596..1282819,
                     1283012..1283055,1283205..1283369,1283732..1283910))
                     /locus_tag="MYCTH_95232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663917.1"
                     /db_xref="GeneID:11510267"
                     /db_xref="JGIDB:Spoth2_95232"
                     /translation="MPKSASTKRFRARERIQPSRACAPRPRVFPFFTSLPAELRLRIY
                     SLILHISRAIDVTGIWHRKPKLDLALLFVSKQIYAEAAHYFYSVNTFCLLEHCDAHMG
                     NNYDFTRNPGYNWLLSIGMNALSIRNLHIYMRTEWPMTYYTTALLPALARRAPNVARL
                     ALIAESHRVLEMPFGQWGPPVWKMHPNYVETLSPLDMYRLYCALEDEAVMAALAGHEG
                     EKEGEGKMAQEEQEEQEQQQQALEEGSAAEASMDTNNDKNQNEGEEKNKEVEKKQQAA
                     GKDKKADEEDGREGGGEEAKGKPLFPSLRLLQLAGPQESAALDCLCVELRCRVQAIRG
                     LVDGRELSGIMRLWNGVERWMRWYDAVPGLLPDGTVGVRRATRKRRGQEQDDDEY"
     gene            <1286321..>1288330
                     /locus_tag="MYCTH_52064"
                     /db_xref="GeneID:11510268"
     mRNA            <1286321..>1288330
                     /locus_tag="MYCTH_52064"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003663870.1"
                     /db_xref="GeneID:11510268"
     CDS             1286321..1288330
                     /locus_tag="MYCTH_52064"
                     /note="CAZy_ID 267801"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003663918.1"
                     /db_xref="GeneID:11510268"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Spoth2_52064"
                     /translation="MFSRHDNRLVYSYDAEKLWIEPWGPDSLRIRATQLSAMPPEDWA
                     LLPPPEPATSPEITISPDSATLTNGKIRATVSARGKLTVSDARTGTVLLEEYSRNRLD
                     VRDPKCSALNVAAREFKAVPRGGDAHHITARFESLDRQERLFGMGQYQQPLFNLKGAD
                     LELAHRNSQASVPFLLSSRGYGLLWNNPAVGRAVLGTNLMTFEAYSARALDYWVVAGD
                     RPADIVRAYAAATGRVPMMPEFGLGFWQCKLRYQTQEELLGVAREYRRRGLPLDVIVV
                     DFFHWPLQGEWKFDPAYWPDPDAMVRELKELGVELMVSVWPTVDKRSENWDEMVERGL
                     LVRVDRGMRTTMDFQGDTVHFDATNPAAREFVWAKVRQNYYAKGIRLFWLDEAEPEYS
                     AYDFDNYRYHSGSVLSTGNIYPAEYARAFYEGLAREGHADDAVSLVRCAWAGSQRYGA
                     LVWSGDVASSWSSFRSQLAAGLHMAVAGLPWWTTDIGGFHGGDPREPAFRELFVRWFQ
                     WGAFCPVFRLHGDREPRQPQHGTTGGAACLSGGPNEVWSYGPEVYEICKKYMALREHM
                     RPYVRRLMRQAHEDGTPVMRPLFLEFPDDPRCWNTGEEYMFGDKYLVCPVMQPGVAKL
                     AVYLPAGAKWSALEGGGGGEEIEGGQVIEADCPIDYMPVFVRVAA"
     gene            complement(1296699..1297564)
                     /locus_tag="MYCTH_69778"
                     /db_xref="GeneID:11510269"
     mRNA            complement(join(1296699..1297172,1297247..1297444,
                     1297506..1297564))
                     /locus_tag="MYCTH_69778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663871.1"
                     /db_xref="GeneID:11510269"
     CDS             complement(join(1297117..1297172,1297247..1297370))
                     /locus_tag="MYCTH_69778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663919.1"
                     /db_xref="GeneID:11510269"
                     /db_xref="JGIDB:Spoth2_69778"
                     /translation="MPCSWCVSQGLVCKMIVRIKRYKACIYRGCSYDGSSIPLSSFFR
                     SSIILRMLNVILNLS"
     gene            complement(<1312881..>1314388)
                     /locus_tag="MYCTH_2064957"
                     /db_xref="GeneID:11510270"
     mRNA            complement(join(<1312881..1313286,1313362..1313918,
                     1314086..>1314388))
                     /locus_tag="MYCTH_2064957"
                     /product="glycosyltransferase family 4 protein"
                     /transcript_id="XM_003663872.1"
                     /db_xref="GeneID:11510270"
     CDS             complement(join(1312881..1313286,1313362..1313918,
                     1314086..1314388))
                     /locus_tag="MYCTH_2064957"
                     /note="CAZy_ID 268043"
                     /codon_start=1
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="XP_003663920.1"
                     /db_xref="GeneID:11510270"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="JGIDB:Spoth2_2064957"
                     /translation="MTTYTRARPTMMRVFLVQTAQGLTPSSGGYKANVSLLRSLSMQG
                     HATAQICYAVEDEIDQYARRAELKGISPNITHKPLPVVDPAGKVHELYVKTFTDEYKR
                     DELTSRMATLINLFSEHIASFQPTHVIFNDPITMKITESHEIRDTFKRINIIHTAEQL
                     PFGPFVAGVDGHCLSPVVENKMLRELDGIWSVSKAVQDYAWKYGRLKTTFLVHPCMTY
                     LDQTSGGMPRIRNNIDKEEIGMVNPCPHKGLSILIALAQKFPHMKFVTWKSWGSRTAH
                     VQQLQALPNVKIEPTTRNTDEIWDRVKVLLAPSLWYEAWGIVVTEAQLRGIPVIASNA
                     GGLPEAKIGLPYCIPVKEVTGERHANGDYVVPDQDIGPWEDALQKVMTDREEYQALQI
                     LTATKAGEWLRSLDPRAHEKWLLSMMEQA"
     gene            complement(<1315406..>1317905)
                     /locus_tag="MYCTH_2119011"
                     /db_xref="GeneID:11510271"
     mRNA            complement(join(<1315406..1315552,1315613..1315794,
                     1315948..1316506,1316792..1317535,1317627..>1317905))
                     /locus_tag="MYCTH_2119011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663873.1"
                     /db_xref="GeneID:11510271"
     CDS             complement(join(1315406..1315552,1315613..1315794,
                     1315948..1316506,1316792..1317535,1317627..1317905))
                     /locus_tag="MYCTH_2119011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663921.1"
                     /db_xref="GeneID:11510271"
                     /db_xref="JGIDB:Spoth2_2119011"
                     /translation="MLQVDNFPAGDGAEVTEVYQRCILVSGRCSTSLALEQDEGYIRV
                     ETNDDSDQTLFPEQRWPMCRGHFKALVLLSPGINKIIITSGEDAPCRLETPPLHLAIL
                     IAKDSPLLIDCPPAKLGSLSSAHSSLDAAISKFRMTAYMWQALTAEDLRAKGLGRRSF
                     RLEEEWNTDTLSQRSLYVPTASMVPKVHLIRTERTVAELRDAQLAQQNPHARQANELH
                     RIFSDALLAHGPPFTTHNRPIVAGLILDSHYDLTGNSTSSSTNSSTSKPYILAHAALG
                     SHNPAGLSLGIFGSHLTYAWPRFLEEVPACLLDATPPGDTVGNDNGECNTMWQACAVG
                     QGAFLHEVRCDAGIVQVVFSPKGGKKEKDDTLSIANPLNSLSYSRMDLVKQFGTKRPL
                     ALEVTAMNGKQCSIANVWELFRTRTVIRVPGTNIRLMKQSVSSRPDTDWGDEDSWAWG
                     VMLKKRDSKGKLVAATKIDIRVGCALDGAEVYYEDGTKIPCGPRGPDGQDPGMGGHQA
                     RKLAIPRDVEISKVAVTEGVPPKDHRIIGFFGTSGRWGMCYEFGIVTAPRNTVLSDSV
                     YDLEELQNKPEQAGHRNKKRRVSDPESDGDDDTSDDECKNAEEYCTSEDEDGNYDDGS
                     DPELEAVYQGLL"
     gene            1320427..1322524
                     /locus_tag="MYCTH_2306161"
                     /db_xref="GeneID:11510272"
     mRNA            join(1320427..1321016,1321103..1322524)
                     /locus_tag="MYCTH_2306161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663874.1"
                     /db_xref="GeneID:11510272"
     CDS             join(1320776..1321016,1321103..1322196)
                     /locus_tag="MYCTH_2306161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663922.1"
                     /db_xref="GeneID:11510272"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2306161"
                     /translation="MEIEIGTPPQKVMLIVDTGSPNTWVNPQCETSNTPSDCAKYPQF
                     DYTESSSINITDYVDVLRYGSGSATVQYVYETVSIGSATLKDQIIGIALESEDIPLGI
                     LGLSPPVRGVNQYPYILDTMVDQGLIKSRAFSLDLRGVDNPTGAVIFGGIDTGKYIGT
                     LAKLPIIAPSSAPGGADRYYITMTGVGLTLPDGTMVRSEELDVPVFLDSGSTLSRLPT
                     VIHQALAASFTEAMLDQESGLFILPCEYTDMAGSIDFYFAGKTIRVPLREFIWRSGDY
                     CILGVAPEDDEPILGDTFLRAAYVVYDQDNRNVHLAQAADCGTNLVAIGSGEDAVPSS
                     TGRCTELPTPTGDPTRTRAGSSNLDMTATRPPANTFTGRLPTGIAGGPGPARDGSTTT
                     VTGGGLQPMLPTGSPKGSEGTEQNAAGRGVDSGLGAAVAAVLGVVSLLVLML"
     gene            complement(1322665..1323788)
                     /locus_tag="MYCTH_2306164"
                     /db_xref="GeneID:11510273"
     mRNA            complement(join(1322665..1323104,1323158..1323788))
                     /locus_tag="MYCTH_2306164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663875.1"
                     /db_xref="GeneID:11510273"
     CDS             complement(join(1322736..1323104,1323158..1323739))
                     /locus_tag="MYCTH_2306164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663923.1"
                     /db_xref="GeneID:11510273"
                     /db_xref="JGIDB:Spoth2_2306164"
                     /translation="MQPSNGAAPPPSGGPPDANAAARQFAQTISEEDLFQRAQTLFAP
                     FIAYPPNRPMVFVKFGGPEKQAEGDMQMLAFNWLRQERQRNPSCNIHVPEVFKIFSRG
                     GLTFIIMQLVAATPVQQFATKFDPRTWDHNKSRYYDIIAEGVRLLSCMPVPTGATPGP
                     YTRGERRIKHLLFKDHTAPVVYPTIQDLQDHLNRVAERGYRNNPHPPKIALEKELVFC
                     YTDFNDENFMFTTDPDGRPRLYIVDFEHASFLPLSFLAYAVLEPDSRWFLCSWIAKKF
                     GASLPRNNIAVMQRLCYMFQVSSANIGLRKKQLAPDTLDQ"
     gene            complement(<1324500..>1328335)
                     /locus_tag="MYCTH_95226"
                     /db_xref="GeneID:11510274"
     mRNA            complement(join(<1324500..1324681,1324778..1327167,
                     1327237..1327554,1327733..1327791,1327856..>1328335))
                     /locus_tag="MYCTH_95226"
                     /product="glycoside hydrolase family 18 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663876.1"
                     /db_xref="GeneID:11510274"
     CDS             complement(join(1324500..1324681,1324778..1327167,
                     1327237..1327554,1327733..1327791,1327856..1328335))
                     /locus_tag="MYCTH_95226"
                     /note="CAZy_ID 268044"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003663924.1"
                     /db_xref="GeneID:11510274"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Spoth2_95226"
                     /translation="MGQTCSYILVQPGDGCDTLAARCGITGAQFTEYNPSPTLCSTLQ
                     PRQPVCCSAGSVPDLTPKPNEDGTCATHLVVPGDDCWAIADKNYITVDNIEHWNLKTW
                     GWEGCAGLKEGPICISTGDPPMPAPVEDTFCGPQVPGTARPSSWDQISSLNPCPLNAC
                     CNKWGQCGITPDFCTPSESSTGAPGTSAPGQNGCISNCGTDIVNNGSPGGSMRIGYFE
                     AFGVDRACLTMDAYAIPSGYTHMHYAFGDITADYQVDLSQYQTQWERFAAMRSFKRIL
                     SFGGWSFSTNVDSYPIFREGVTEANRLRFAQSVVDTVKRYNLDGVDFDWEYPGADIPG
                     VPIGSPNDGPNYLAFLKTVRALLPTGVSLSIAAPASYWYLKGFPIAEMAEVLDYIVYM
                     TYDLHGQWDYNNTWANPGCPLGNCLRSHINLTETEYALAMITKADVPASKIAVGIAGY
                     GRSFGLADPGCTGPHCLFTGPESTAEQGPCTGTAGYIAQAELDSLVSGGAATSGLARR
                     GAVRTWYDSSSDSDIMTYGGGTWVSYMSHATKASRISRYASYGSAGSVEWAVDLAQFV
                     LGQDEHSPGLSVAQKESEFNDALALSNYDTSLFADYNFTDLATRLESFRGCNGAQRRA
                     IYSGWQQSWKIMNLILSETKNGLDLNSAAALEYLGPPADSGSKKSAFETIFRTHATIQ
                     PGYITTPFDWRLPVRCDDPSNLCPCGKPSNTAAYTMLPGEDPTFNGRQSINFCPLYFA
                     SPTLDSAMQYANKDEWPADIYADVTKYYPNQGRTWYHELMHVDWATGASPQGVPTGVV
                     HITDLMMGYKFRDDDEGIGWTWVHAYGVTNVKALARVYLSSFHVVRNADSLTLYALAR
                     YIQKALNNVYPHLPLAGNPPNRVKGKFEVIGYFTVDSDGTAVLAPGREWESPEPNWAA
                     NGTDDTCSGLSDVGGDRGPDNAAVTLTAGWATQSDYPADYLSSYSSWANLKPTSTAPA
                     DPSPTPNLTPLTRGRIDCFNEADFPGHADIQSDYQDTFSVEFSSLDITIGPGDAPIPL
                     RRTDRYGVNYDYRVEWVAGCVTTVERQSFRFPLGMSQSLITAYLLVREDYTKCNNGGV
                     GGSCQVGCLLYTFEGGRGDQGRFRMPVAPSQYPPSNHSHYVPGENGGIVIDDLK"
     gene            <1332273..>1332911
                     /locus_tag="MYCTH_52735"
                     /db_xref="GeneID:11510275"
     mRNA            join(<1332273..1332540,1332631..>1332911)
                     /locus_tag="MYCTH_52735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663877.1"
                     /db_xref="GeneID:11510275"
     CDS             join(1332273..1332540,1332631..1332911)
                     /locus_tag="MYCTH_52735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663925.1"
                     /db_xref="GeneID:11510275"
                     /db_xref="JGIDB:Spoth2_52735"
                     /translation="MATSVAPDGKSCDYAPEEGGYFDPPLQRVSYGTKPGARVFGWPA
                     KGGVYTMRAATVDLEFLGYGRFEPVPRPDPKDPNTAADEEAHCNKMRQLGARWWESEH
                     AWARSFREVHAVPLEEKFIATGWPAGGGVWVLSGDVEAASEKNAGMLFNAYTMEERCN
                     VIEKLGGTFYANPKDCPDLDLA"
     gene            complement(<1338477..>1339877)
                     /locus_tag="MYCTH_95224"
                     /db_xref="GeneID:11510276"
     mRNA            complement(join(<1338477..1338735,1338772..1338916,
                     1339169..1339321,1339379..1339483,1339668..1339691,
                     1339805..>1339877))
                     /locus_tag="MYCTH_95224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663878.1"
                     /db_xref="GeneID:11510276"
     CDS             complement(join(1338477..1338735,1338772..1338916,
                     1339169..1339321,1339379..1339483,1339668..1339691,
                     1339805..1339877))
                     /locus_tag="MYCTH_95224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663926.1"
                     /db_xref="GeneID:11510276"
                     /db_xref="JGIDB:Spoth2_95224"
                     /translation="MTKKKESSSCSHYSSRAGRVPEARVAKSSLYGVAGSDRPRLNLL
                     IPKLPSSSVSNTHEFKFKSGAGTGNNVATAHATSGGSRQSQSLRAGRLHYGDVGGTKI
                     PPKDVIVILSDDKSSDATNAAFLVKHKAARPDHGCQHDPRPFAEPCETMSKDDISKCL
                     LHDERDKATSRQERETQQKSDGSYRSASYDHHSNGDQTSSSAYRHLPVPDETGEPTKN
                     DLVRLLYIQEQQASPSVVPDHQSISEPKLADAQY"
     gene            complement(<1340791..>1341846)
                     /locus_tag="MYCTH_95223"
                     /db_xref="GeneID:11510277"
     mRNA            complement(join(<1340791..1341029,1341143..1341188,
                     1341352..1341411,1341500..1341613,1341796..>1341846))
                     /locus_tag="MYCTH_95223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663879.1"
                     /db_xref="GeneID:11510277"
     CDS             complement(join(1340791..1341029,1341143..1341188,
                     1341352..1341411,1341500..1341613,1341796..1341846))
                     /locus_tag="MYCTH_95223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663927.1"
                     /db_xref="GeneID:11510277"
                     /db_xref="JGIDB:Spoth2_95223"
                     /translation="MTCSADIIQRRIAGLHVTSRNTYLRGYLSELATIRPDDSLANIY
                     HIVSDVFLPILVDLASVSSREPMTKALGWELTPTQPSTPSERHGQTVTLRRRYTRGMA
                     NGPYDDSEQPAARDVGRWLQERQLGVSDWIGSHTATPAAADRFRWAGAGVDDHERSAE
                     LGDPIGKGP"
     gene            complement(<1348145..>1349149)
                     /locus_tag="MYCTH_95222"
                     /db_xref="GeneID:11510278"
     mRNA            complement(join(<1348145..1348298,1348353..1348467,
                     1348600..1348622,1348741..1348766,1348859..1348872,
                     1349137..>1349149))
                     /locus_tag="MYCTH_95222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663880.1"
                     /db_xref="GeneID:11510278"
     CDS             complement(join(1348145..1348298,1348353..1348467,
                     1348600..1348622,1348741..1348766,1348859..1348872,
                     1349137..1349149))
                     /locus_tag="MYCTH_95222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663928.1"
                     /db_xref="GeneID:11510278"
                     /db_xref="JGIDB:Spoth2_95222"
                     /translation="MSPFKLRKVDLMDYYILNKGSYPILEIGVAYLGAPDRQTRTTDG
                     FQHSFALMDWSDEMWFFFLLDIVAATFAPIVVAVQMVGLACCDREYSDALDILSRRSS
                     PSDQTEVWFWRC"
     gene            <1353608..>1354382
                     /locus_tag="MYCTH_15789"
                     /db_xref="GeneID:11510279"
     mRNA            join(<1353608..1353923,1353988..1354115,1354299..>1354382)
                     /locus_tag="MYCTH_15789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663881.1"
                     /db_xref="GeneID:11510279"
     CDS             join(<1353608..1353923,1353988..1354115,1354299..>1354382)
                     /locus_tag="MYCTH_15789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663929.1"
                     /db_xref="GeneID:11510279"
                     /db_xref="JGIDB:Spoth2_15789"
                     /translation="RPSTSARRTTFGLDDTGVCAFFTEVSDRIKFGDGDARNSQGTCG
                     QALSDSSVSALTNRAEKVDLNGLSGREACERLQRDFLDNFDSDCSASVPGDRWTGITA
                     KVESLSGKESPEPISRRQNKTSNCWPVLPKSNDLTLVERVNTTVSLGQLTCVKAIDLA
                     TATNETQSAKDGDGDS"
     gene            1354767..1356840
                     /locus_tag="MYCTH_2306173"
                     /db_xref="GeneID:11510280"
     mRNA            join(1354767..1355069,1355149..1356840)
                     /locus_tag="MYCTH_2306173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663882.1"
                     /db_xref="GeneID:11510280"
     CDS             join(1354932..1355069,1355149..1356498)
                     /locus_tag="MYCTH_2306173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663930.1"
                     /db_xref="GeneID:11510280"
                     /db_xref="InterPro:IPR000246"
                     /db_xref="JGIDB:Spoth2_2306173"
                     /translation="MEYKRQQASSPKVPPRLIIHGGAGNITPSNLTPDRYAEFRTALL
                     TIISKAHSYMTTPSPDDGNGGGGEKLPSALAVATHAVSLLEDDPLFNAGRGAVFTRDG
                     LNELEASVMVSRGRAKRAAAVSGLRRVRNPILLAREVLRHGDADLRPSKPGRLAAAAD
                     ALATDVAAAAAAAAAAADDDDDDASSAQLNVPSAQGHTHLHGETAEQLAEKYGLALVD
                     EGYFWTKRRWEEHLGGLERERRGGGGWAATWSKDEYVPQGTVGAVALDEDGIVCVATS
                     TGGLTNKVTGRIGDTPTVGAGFWAEEWVERAQSGGGWSRQPVVTLAGALRSWVADCLP
                     TPWLYTPLPAGRGELVTTRSVAVSGTGNGDSFVRTAAARTVGALARFAGDSSREAVTK
                     VVGPGGEVQRSAGDRWGKTGEGEGGMIGVECVVVRDAEGSVVEVRSELLQDFNCGGMF
                     RAWIDDRGVAIAQVFREGEEVPDTYAGEGRPENPRAWSGEKVGLV"
     gene            1356916..>1357588
                     /locus_tag="MYCTH_2093591"
                     /db_xref="GeneID:11510281"
     mRNA            join(1356916..1357030,1357189..1357414,1357519..>1357588)
                     /locus_tag="MYCTH_2093591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663883.1"
                     /db_xref="GeneID:11510281"
     CDS             join(1356931..1357030,1357189..1357414,1357519..1357588)
                     /locus_tag="MYCTH_2093591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663931.1"
                     /db_xref="GeneID:11510281"
                     /db_xref="JGIDB:Spoth2_2093591"
                     /translation="MTASRIAQLMAPFLAALYPPRIANEPPVKNPAIWSSRSWSTYAS
                     SFFLMPLTAQSNVLNKPPQTPKLPPKTGARILIAVMAPSLRSPYGLFLNPLTPCQIVP
                     PTAYWETHTPMQKAPPKSLRMTQGQGSRV"
     gene            1359345..1362683
                     /locus_tag="MYCTH_2306177"
                     /db_xref="GeneID:11510282"
     mRNA            join(1359345..1360656,1360717..1362683)
                     /locus_tag="MYCTH_2306177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663884.1"
                     /db_xref="GeneID:11510282"
     CDS             join(1359667..1360656,1360717..1362435)
                     /locus_tag="MYCTH_2306177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663932.1"
                     /db_xref="GeneID:11510282"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="JGIDB:Spoth2_2306177"
                     /translation="MAGLQGRELDDGCPDSAPDQLHELRHDGSVLTIAVSDKYIFAGT
                     SKGEIAIWSLGTYHHVQTIQAHKRSVLCLVLSEDQKYLFSSACEPIIGVWCPKTFARL
                     YEIYSTYDVGDVFSIAYSSQRETLYLGTQTQDIQWVSLKDPARKVPHDSANHPDRRQH
                     RFFDSRAVGGTSTPRRMEEHYALIPKAATVLEIDPGAIRQYAHYGWVFCMLIAKGPTV
                     LGDPEEDVLISGGGDGTIKLWRLSDEAPDHDDGVLGDIEEMMTLGEDDSESVMSMAVD
                     GSFLYAGKLRGIIELWDLDTKQKLRVIKAHDGNVNTLKMSFGLLWSGATGGSASKHST
                     VHYGRDKNGLPQNVSQKYQCLSRWKAHDAKILSSATATHQADQLFITGANDNTVRVWR
                     VNGMPTECEQEVGGSENMMITSLREFVSFKTISSRPEFTEDCRKGATYLGSLFKRLGA
                     EVEMLSTGKLYNPVVCAKFSGKLEPVEKRKRILFYGHYDVVPADTKGGNWQTDPFKLE
                     GRDGYLYGRGVSDNKGPIIAALYAVSDLLQAKVLDSDIIFVIEGEEESGSRGFQETIR
                     MHKHLIGHIDYVLLANSYWLDDEVPCLTYGLRGVLHATICVDSRHPDLHSGVDGSNLV
                     SEPLTELTLLLSKLKDSKNHVKIPGFYDGILPLTREEDQRYDDIASILIRRNPSHGPV
                     EALKRSLMARWREPNLTIHRYNVSGPDGSLISSHATANVSVRLVPGQEVEDVIEALKK
                     YLQDEYARFDSDNTLTISIDNKAEPWLGVPGNYIFRTLEEAVMRAWAGVGAAGSSASS
                     SSSPTAAAKGSNTGDKGSVVDGVTVALPANATDGEDRPKTRKPLYIREGGSIPPIRFL
                     EKEFNAPAAHLPCGQASDAAHLDNERLRVLNLMKSREIFSTVFRKL"
     gene            complement(<1362929..>1364258)
                     /locus_tag="MYCTH_102849"
                     /db_xref="GeneID:11510283"
     mRNA            complement(join(<1362929..1363114,1363161..>1364258))
                     /locus_tag="MYCTH_102849"
                     /product="carbohydrate-binding module family 18 protein"
                     /transcript_id="XM_003663885.1"
                     /db_xref="GeneID:11510283"
     CDS             complement(join(1362929..1363114,1363161..1364258))
                     /locus_tag="MYCTH_102849"
                     /note="CAZy_ID 267810"
                     /codon_start=1
                     /product="carbohydrate-binding module family 18 protein"
                     /protein_id="XP_003663933.1"
                     /db_xref="GeneID:11510283"
                     /db_xref="JGIDB:Spoth2_102849"
                     /translation="MRLLALAFAAPGLLRLALAQLEVSPDGTCGPGNRYSCLGSSYGN
                     CCTEKGECGGTDEDCGPGCQPEFGLCGRGVGGLPGTTEEPDPTKSSSPTRQTALPTTL
                     TTTRRTALPSTITTRLTAIPSSLLPPSQSQAVSTIVVTSIVTQSTLVTVSTTTALTNT
                     VVVNTTSVHFTTTTSTSYSIVFATVYNTINVTRISTAWETATSTTTQTIDTTQYFNLT
                     RTSTYTQPITVTSHTNATRYVNATSTDFITRTTTVPLTITSTSTSTITINSTRLTTAT
                     ETTEVPVTVTATDTDTEYTTQTDFLTATTTAVTTETHDVTRHWNTTSTALRTVTVTVT
                     ATTAAPGEPATTTTTATATVTTIVNPSISTPTTETETKTETEITTSTVTVTGADPSEP
                     SGPTSTVGPSSVPSSGTTAETTSSSRGQTLTVGMY"
     gene            <1365425..>1366386
                     /locus_tag="MYCTH_2119021"
                     /db_xref="GeneID:11510284"
     mRNA            join(<1365425..1366041,1366368..>1366386)
                     /locus_tag="MYCTH_2119021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663886.1"
                     /db_xref="GeneID:11510284"
     CDS             join(1365425..1366041,1366368..1366386)
                     /locus_tag="MYCTH_2119021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663934.1"
                     /db_xref="GeneID:11510284"
                     /db_xref="JGIDB:Spoth2_2119021"
                     /translation="MPGLSADEGDEGAPPPSQSHFAKFEHFTPNEAASFDDEFARLAS
                     SQQWVPGSQEYTRQRTIAIKEELELHYFSQSQQLDDINEEEELSAEEKTLKGYQALCR
                     EVGIDPSDSIAECKKQLKNTLVNIVDLIDARRTGKRVKVWDSFEEFRAYTLLDENRID
                     IREAKRPPGYLASLLRRLSGPPSRKKRNVPKGGWGLRVVSGRITKAAQPSG"
     gene            1367125..1369061
                     /locus_tag="MYCTH_2306178"
                     /db_xref="GeneID:11510285"
     mRNA            1367125..1369061
                     /locus_tag="MYCTH_2306178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663887.1"
                     /db_xref="GeneID:11510285"
     CDS             1367268..1368878
                     /locus_tag="MYCTH_2306178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663935.1"
                     /db_xref="GeneID:11510285"
                     /db_xref="JGIDB:Spoth2_2306178"
                     /translation="MDTSQPSIFQRFRRRYTMLPKDDIIDNIGPVAARPSRYGDEDDP
                     IRPKRPLWSWHRDHFGGALLFNVAAFILPALYGTLAKLWVANIDRSLVVTTDVYTYIG
                     IVAEVLNEGLPRAAWVIIGDSASRPWTQRLGLTHTLILFQSVLGLIMSIGFLAGAATF
                     AKGFVPIGVRDASITYVRISAFSALSSAIETAVAAATRALDKPDVPLVINTTKFAVNI
                     ILDLLIISRFHVGSYQPTINMQAGIQLTCNMTAAFVGLGYFLWTTTRSSLHDDHPEEE
                     DNDDHTEPTNTRPSLRALLVLLRPGLLTLIESAVRNALYLWLVTTIVALGSTYATAWG
                     IFNTIRWGLVMVPVQALEAASLAFVGHRWGAWRREIGTNTLRPGRVAFRTVLRIVKPA
                     LLAVGIAVAVEVPVAIALSLGGARSFARYLSDSDEVAEVTAYMWWTIDWCYVFYAAST
                     QLASVVLATRPKWYLYQSLASNLLYVLPWAIVCQVGDLDEGNAWTYHSLVFGGSLVFS
                     FVDIVVVDALWVWSLMTGRARLERFREG"
     gene            complement(1369700..1371631)
                     /locus_tag="MYCTH_2306180"
                     /db_xref="GeneID:11510286"
     mRNA            complement(join(1369700..1370594,1370717..1371067,
                     1371134..1371458,1371537..1371631))
                     /locus_tag="MYCTH_2306180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663888.1"
                     /db_xref="GeneID:11510286"
     CDS             complement(join(1370026..1370594,1370717..1371067,
                     1371134..1371413))
                     /locus_tag="MYCTH_2306180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663936.1"
                     /db_xref="GeneID:11510286"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Spoth2_2306180"
                     /translation="MAPSAVETVQQTVEDIKQKVVPVKPAETVSGPEEVLPERLEGHR
                     EPLKLSGALDHLEYFDVTPVIAREYVNVDLVELLRAPNSDELLRDLAITISQRGVVFF
                     RKQDNLTDDLQKELVDRLGKLSGKPPTSGLHIHPVSNSAREHGTKDDQISVISSEQAK
                     KLYSDRFQGFLGGGKYRQSGKNQWHSDITFEPVPSDYALLRLTQLPKTGGDTLWASGY
                     ELYDRISPTLRRFLDTLTAHYAQPLFNETAKRNNFSIYTAERGAPENVGDSLDAVHPV
                     VRTNPVTGWKSVFAVGHHVQRIHGLSEEESRHFLQWFVQLVVENHDLQVRYRWKQVND
                     VAIWDNRSVYHAATPDYAFEDGLGERRGSRAVSLGERPYFDPASTSRREALKAEAAAA
                     AAAAAPA"
     gene            complement(1372059..1372418)
                     /locus_tag="MYCTH_2306182"
                     /db_xref="GeneID:11510287"
     mRNA            complement(1372059..1372418)
                     /locus_tag="MYCTH_2306182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663889.1"
                     /db_xref="GeneID:11510287"
     CDS             complement(1372124..1372336)
                     /locus_tag="MYCTH_2306182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663937.1"
                     /db_xref="GeneID:11510287"
                     /db_xref="JGIDB:Spoth2_2306182"
                     /translation="MSLSYPDYSGQMFAISVIAGRGRDDLLCQKHERLAITAPHREPP
                     PPPQLVKRSYYVIEIQVLSLVASLHA"
     gene            1396156..1397913
                     /locus_tag="MYCTH_2306185"
                     /db_xref="GeneID:11510288"
     mRNA            join(1396156..1396467,1396529..1396820,1396923..1397913)
                     /locus_tag="MYCTH_2306185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663890.1"
                     /db_xref="GeneID:11510288"
     CDS             join(1396324..1396467,1396529..1396820,1396923..1397443)
                     /locus_tag="MYCTH_2306185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663938.1"
                     /db_xref="GeneID:11510288"
                     /db_xref="InterPro:IPR001148"
                     /db_xref="JGIDB:Spoth2_2306185"
                     /translation="MGLTLGALLLAAWATRTAYASCAHGTFLSPRAEDGTVEVGKFGY
                     TGTIGPLNWAALDSPANGACATGTRQSPIDMVDGVFELLQGSDVELTVNDMPEGAEFE
                     NLGTTVEVITQGGSLKVGDKQFELQQFHFHLPSEHLDNGTSQAMEMHMVFQSEAQEIA
                     VIGTYINIADTSAAAPSKRSRVFGRQEAKPPATGAVAATTLLETIFSVVDKIAVPGTK
                     TTTPPLVMSEVVDVLKANAFQIYSGSLTTPPCSEGVSWHVSTARLGITPATFVKARDV
                     IGFNARFPQNKPGEPNLLMVSALGSAAAAVAAIAGAGAGAAA"
     gene            complement(<1399892..>1400383)
                     /locus_tag="MYCTH_2064854"
                     /db_xref="GeneID:11510289"
     mRNA            complement(join(<1399892..1400029,1400180..>1400383))
                     /locus_tag="MYCTH_2064854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663891.1"
                     /db_xref="GeneID:11510289"
     CDS             complement(join(<1399892..1400029,1400180..1400383))
                     /locus_tag="MYCTH_2064854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663939.1"
                     /db_xref="GeneID:11510289"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2064854"
                     /translation="MGSSSKPLKTGTWSPDEDKRLREAVAQYGNSWVAVAAKVETRNG
                     DQCAKRWNENLNPELDHSPWSPHEDRLLLHLVGTFGTNWKSIADNFLEGRAPLALKNR
                     YSLLMRRMRRKR"
     gene            1403865..>1405713
                     /locus_tag="MYCTH_82782"
                     /db_xref="GeneID:11510290"
     mRNA            join(1403865..1404398,1404506..>1405713)
                     /locus_tag="MYCTH_82782"
                     /product="general substrate transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003663892.1"
                     /db_xref="GeneID:11510290"
     CDS             join(1404008..1404398,1404506..1405713)
                     /locus_tag="MYCTH_82782"
                     /codon_start=1
                     /product="general substrate transporter"
                     /protein_id="XP_003663940.1"
                     /db_xref="GeneID:11510290"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_82782"
                     /translation="MQSFLQHRRLRLAAERDVARLSKPQSGSPAPTDNGKNESSSLEA
                     GREANGKPNLIPGVELSEDGTVYQVGWADGDPENPQNWGAAKKWWATAAVCLIAIAVS
                     IPSSIDAPVAPQFNEEYGVGPIAGSLTTGMYLIGIGVGSMFAAPFSETFGRNWVYFST
                     LTVFILFCVGKALAPNYGAAIVFRFLVGFFGAAPLTVGGGTVADIWGPLEITFSLPFV
                     TMTSYAGPILGPIIGAYLPNIGFRWADWISIIIAGAVMAIIFFLQPETFGPTLLEWRA
                     DHLRTLTGDSRYQVPGHASAGSLGRRLLTNCLRPFAMTYTEPIILVFSFYLIILYIVL
                     FTFLNGFPYIFAQTYGISESLTFIIWTALLAGDVVAIPLIPIVYGWTKKAAARAAEAG
                     QPLAPEVCLYFAMLGGSVLMPVSLFWIGWTCYPSISIWSPIVGVFVFGYSLVTIFTTT
                     YIYIVFVYLQYAGSALSFMTFSRYVISGALLPASVPMYENLGPHLTLTWIGAVAAVMA
                     PLPFVLYRYGHKVRAMSKNVQNKA"
     gene            complement(<1406773..>1408188)
                     /locus_tag="MYCTH_11658"
                     /db_xref="GeneID:11513416"
     mRNA            complement(<1406773..>1408188)
                     /locus_tag="MYCTH_11658"
                     /product="transferase-like protein"
                     /transcript_id="XM_003663893.1"
                     /db_xref="GeneID:11513416"
     CDS             complement(<1406773..>1408188)
                     /locus_tag="MYCTH_11658"
                     /codon_start=1
                     /product="transferase-like protein"
                     /protein_id="XP_003663941.1"
                     /db_xref="GeneID:11513416"
                     /db_xref="InterPro:IPR003480"
                     /db_xref="JGIDB:Spoth2_11658"
                     /translation="VPLTPIDHLHRPNYIKICYWFPLQPDVDPKDVYNYLGQGLRKMF
                     SRMPWLGGKVYLQEPNTPGWRPGQREIRYEPWDAEGPVPHQLVYKELDTELTYADWKN
                     EGFPPEAFPDEELLDVPVEGDMEAGCDIFVAQTSFIPGGVILCMSTCHAAVDGTGMVI
                     VMKAWADNCRSLYDASASAEQDDFPPETYDRALPDRLWEEEAGAPVPENPDDWTRGLV
                     GLEGPQTAADDPAKLAYRDRKAVHRTFYIPAAKLAELQKICDEPGEPGESGAAALSTS
                     DVITALMWRAHLRARAAVAREGEPLPEQTVLEGAVNGRLDFSASLPPLYLGNLTFYNQ
                     AVLPTADVLDPAVPLARLARAVRKGAARANAASLNQAYGLLKTAPSFGLVRPRFRRVH
                     GFDLLISNLLAFPVDDILFGARFFANSGRAEALRAYLGKFGRHARCSLVLPKRPAGVE
                     ISMNLFEDEMEHLERDEAWTKY"
     gene            <1409264..>1416461
                     /locus_tag="MYCTH_108317"
                     /db_xref="GeneID:11513417"
     mRNA            join(<1409264..1409524,1409590..1409676,1409765..1409822,
                     1409939..1415145,1415223..>1416461)
                     /locus_tag="MYCTH_108317"
                     /product="polyketide synthase"
                     /transcript_id="XM_003663894.1"
                     /db_xref="GeneID:11513417"
     CDS             join(1409264..1409524,1409590..1409676,1409765..1409822,
                     1409939..1415145,1415223..1416461)
                     /locus_tag="MYCTH_108317"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003663942.1"
                     /db_xref="GeneID:11513417"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_108317"
                     /translation="MTADHNLPNGSASHTTANGINGHAAGRPRPREPIAIIGMSAKFG
                     GSASSPSKLWDMVRDGKSAWSPIPKDRFDVDSFYHPDKDRPGRNHARGGYFFPGDIGL
                     FDAGFFNLSADAAGAMDPQLRLLMESVYEAWEDACIPLDKVAGSETSVYTGVYGKDYH
                     ELQTRDPEVLPAAFLTGNGMAMMSNRISHFFDLQGASMTIDTGCSSGLVALHQACHSL
                     LAGESDMAVVGGTGVILNPDMYIAMSTLGMVGADGKCYAWDARAQGYGRGEGVAALIL
                     KPLRAALRDGDQVYGVIRETGLNQDGLTKTITSPSVESQIKLIEKCYGRAGLDLADTG
                     YVEAHMTGTRAGDLAEATALARTFGRARKPGDPVYVGSVKTNVGHTEAVSGLAAIIKT
                     LFALKHRVIPPNINYQTPNPEIPLEEWNLAVPTSLVPWPADKALRASVNNFGYGGANA
                     HVILEAPPGEYEEKRRARAPKGPAESEQSRIFLVSGKDQVATSGLMANLAAYVRELPD
                     DSTLGGIARTLDEGRTRFRWLAAVRARTRAELAERLSQPSTKPKPQPAHVTSGKRPRL
                     GFVLNGQGAQWHAMGRELIAAYPVFGDAVRRADAVLRGRYGADWSLLEELNRDAKTTR
                     VGEMALSQPVTIALQLCLLDLLASWDVRPSAFSSHSSGEIAAAYAAGVLTFEEALGAG
                     YYRGQIPSRSKELSAVRGGMLAAGVSREDAARFIADTRSGRVVVACVNSPESVTISGD
                     IEAIDEVEARLRAEELFARKLKVPLAYHSHHMRLLADEYTARLVETVRSRPDEGWTRR
                     YRYASPVTGDIVTDSEALGPEYFVRNLTSPVLFSEAFDKMCFGEDGTVQVDVVVEIGA
                     HGTLAGPIRQILKRRGTTELPYVSTLSRNVDAVETMQNLAVGLLEQGYPVDLSAVNDP
                     LGAEPALVYDLPKYAWNHTTRYWTESRVNREIRSRKHKPHELLGSLLPGDNGLAPTWR
                     NFLRQNGSSWLVDHQIQGYVVLPGAGYVAMAVEAVRQHLGAGAGGPGSVGDNDDDDGI
                     TGFRLRDIEVLNALTIPDSSAGVEVQFNLRPTEKDDWYEFRVSSLTLSNTWTVNCTGF
                     IRADTEEYSPLPTVSPDSFFHPGARRADVEPESLWADLRRMSMYHGPVFRPINSIKTA
                     RDKALTSITLKPVVEEAHDYVIHPTTLDGIFIAAYNGLPRKIRDAFTVVPRRIKGITI
                     RRDLHRRGGQDIDCFSQVHSADTRGFDATIAVTNTNGGNGSGTGGRVSLLVDHFYAQA
                     IPREGGDDSDAQQQQPGIISKLQWEPDLTFPVVPARPATSAQQQQQQQQQQQPLVFRP
                     DDKQADFERKAPRVAFHLIHDAVREIEKTPDRLSPKYRDLFGWMKGVVATAARGELGP
                     RSDTWARTSSGTKQLLIDDLNAKPVPAGRLLVRVGEKLPRILRGEVDDRAVAELVNAD
                     NLLSRYYVGHPTLEGTTLKQIARVAEQLAIDRPGATVLEIGAGSGVVSKAVLEAFGAR
                     HGADGARSVLGHYDFTDNSNNNSNNNNNNNNNNSGSSSQQQQLFFDEAAKKLAPWSDL
                     LTFKELDIGADPEEQGFAAASYDLVVASQALHDKAVRRDALRNVNKLLKPGGTLLLVE
                     TTRDPVERELVFRVLPGGKSPTLSAREWEEILRETGFTAPRFPVGGADDSDDASISII
                     LASKGAAAPSYPSSVSIVYAGRAPPPESWTEQLSEAIRARTGGSSVVAVENLDELEVS
                     PETAYIFTPELRAPFTARLDEASFEKLKAFLLDAQLILWLSSGGLVDADEPLVGATNG
                     LLRVLRQEDAGKRIAHLDFDLPRTADANGDDNPNPWTADKIDYIVEVFERTFEKGFAS
                     AYPDHDWEYSVKKDSGVFVPRAYPVLQARDTSDLPPLNLNRDDATYLVIGGMGGIGQH
                     IAAWMMEKGARNVLIVSRGAEASPDVPSMKAMAEADGCKLAIRSCDVTDARAFADLLA
                     WAASSSAGGGGLPPIRGVVNAAMVLRNSVLDHMSYALWRSGIRVKVDGSSNAHALLLP
                     PPDLDFFVQLSSAVGVPGHPSQAHYAAGNTFQDALARHRAVRGLPAVTLDLTAIEGVG
                     WMAQQGDEEAQQEVVRRIRKVGLSPAGIDLVMDLVEAAIRDPLRASAADSQVVVGLST
                     YASIPDGSVTKADRRFGTLRLATKRAVAGADDDAAGGAAASGSGGGGKDGVAELLRAA
                     ADGSISRAEAAPLVVDAVAARTAAIFNLGRDEIDGGRPLSGYGVDSLVAVELRNWLVG
                     CLKAKVSIFDILQSPSLDDFGALLVEKSELLKGLA"
     gene            complement(1417001..1418947)
                     /locus_tag="MYCTH_69746"
                     /db_xref="GeneID:11513418"
     mRNA            complement(join(1417001..1417783,1417936..1418465,
                     1418590..1418947))
                     /locus_tag="MYCTH_69746"
                     /product="dTDP-D-glucose 4,6-dehydratase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663895.1"
                     /db_xref="GeneID:11513418"
     CDS             complement(join(1417248..1417783,1417936..1418465,
                     1418590..1418798))
                     /locus_tag="MYCTH_69746"
                     /note="hypothetical dTDP-D-glucose 4,6-dehydratase"
                     /codon_start=1
                     /product="dTDP-D-glucose 4,6-dehydratase-like protein"
                     /protein_id="XP_003663943.1"
                     /db_xref="GeneID:11513418"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_69746"
                     /translation="MSPFPADLKTARSDDKFTPPDSPRWKERVSVESITLTSDDNDAL
                     KLIGTTRFEPRSDIKNILITGGAGFIGGWVTRHLVVQYPEYNVVCFDMQNYVSSTANV
                     SCLGDFPNFTFVKGDITWQSAVDRVLAEHDIDCIMHFAAHSHVQNSFHDPASFTLNNV
                     VGTQVLLDSARRHGRVRRFIHVSTDEVYGDIADECADENKQFLPTNPYSASKAAAEMY
                     VYAYYKSFGIPVVIVRSNNVFGPGQYPEKIIPRFFTLLSKGQPLTIQGSGLNKRRYLY
                     GADAADGFDTILHKGVVGEAYNVESESGVTNIEVAVRMLGLFGYTPHADFSTRLSWIP
                     DRPFNDHDYRVDGTKLRRLGWRQKVSFEDGLAATVDWYRRNLKVWWPDEGSLDKIAVQ
                     TPAVIINDTGDANPLGAIDARDGVDLRKAIAA"
     gene            1419446..>1421072
                     /locus_tag="MYCTH_82772"
                     /db_xref="GeneID:11513419"
     mRNA            join(1419446..1419674,1419768..1419870,1419952..1420243,
                     1420326..1420448,1420533..1420610,1420704..>1421072)
                     /locus_tag="MYCTH_82772"
                     /product="epimerase/hydratase"
                     /note="Has EST support"
                     /transcript_id="XM_003663896.1"
                     /db_xref="GeneID:11513419"
     CDS             join(1419596..1419674,1419768..1419870,1419952..1420243,
                     1420326..1420448,1420533..1420610,1420704..1421072)
                     /locus_tag="MYCTH_82772"
                     /codon_start=1
                     /product="epimerase/hydratase"
                     /protein_id="XP_003663944.1"
                     /db_xref="GeneID:11513419"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_82772"
                     /translation="MPHMLLEDHREKMNGHKETPVDYLLFGNGWIASQVKQLLLEQGK
                     VVATSFARLENREDVMRDLKRYAPRRVMNFAGVRGLPNADWCEDHKVETARSNVLGVM
                     NLVDCCYLLDIHITHFGSACVYEHDANHPPDHHFTEDDEPFYHASFYSHTRLVSEWAI
                     RHYPNLLILRVRAPIAANLDPNNLLTKLFNYKRILNIPASGTVLPDLLPGAILLAEHG
                     ETGIYNLISPQPFTNNEILSLAKKYVHPSLTWENFELEDQKAVLKAPRCNPVFDTTKL
                     VNKLRELGYQVKDTHDALEDMFIKMGEQLARVASFGGLSSEEALLALTTRERAIGPRP
                     GEQQVNASPIATR"
     gene            1422838..>1425008
                     /locus_tag="MYCTH_108314"
                     /db_xref="GeneID:11513420"
     mRNA            join(1422838..1423696,1423766..1424046,1424083..1424689,
                     1424933..>1425008)
                     /locus_tag="MYCTH_108314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663897.1"
                     /db_xref="GeneID:11513420"
     CDS             join(1423077..1423696,1423766..1424046,1424083..1424689,
                     1424933..1425008)
                     /locus_tag="MYCTH_108314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663945.1"
                     /db_xref="GeneID:11513420"
                     /db_xref="JGIDB:Spoth2_108314"
                     /translation="MSRETDCSERALENFCGSCSRAGCSHGHHRAPNRPEMLNRSQNA
                     FAMPSQDRPGLNKRTLHRQPRLSPPGRQRESRLATQSTDDAEITRSEKTARHSDIPRA
                     LVDVHHDVRKRTVIAPSEDARVATRLATPPLAPHRFGDWEPTALTARGRQSLEWETET
                     LLDPNGTGPDGMASYPCPYRKRNPARFNIRDHEDCARSPFDSIRALKQHIIHYHQRKP
                     ALRQCRRCKERFGAEAELEEHLLLPKDRICDVKEPCLDDYEDGITEKTASILAATDGD
                     DARSWTWQTIWCLLFPGDPEIPDAAHLCSNKASFFAEFHPVAELAEVEQAFDEGQGSL
                     REELREKLELLLPEPVDPSYLGFLTGQLELVFETHRIDVIKRTLARCRPNVLISGEEL
                     SRTQTQPAEQPSVPKKPSRRSRRSTVLQALQRSTHAPYRRDSSAGGTTTRNINNESHQ
                     LGEQSLLRSAEHHPSARKPSPLLHARGSLSAAGPRDSRDSGIGLPCDTCSLEPGGEDG
                     GFSPESFKQRLLRQQLMGA"
     gene            1425883..1425990
                     /locus_tag="MYCTH_t108"
                     /db_xref="GeneID:11513421"
     tRNA            1425883..1425990
                     /locus_tag="MYCTH_t108"
                     /product="tRNA-Met"
                     /note="Anticodon: CAT"
                     /anticodon=(pos:1425916..1425918,aa:Met,seq:cat)
                     /db_xref="GeneID:11513421"
     gene            complement(<1426753..>1427514)
                     /locus_tag="MYCTH_2127750"
                     /db_xref="GeneID:11506421"
     mRNA            complement(<1426753..>1427514)
                     /locus_tag="MYCTH_2127750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663898.1"
                     /db_xref="GeneID:11506421"
     CDS             complement(1426753..1427514)
                     /locus_tag="MYCTH_2127750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663946.1"
                     /db_xref="GeneID:11506421"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2127750"
                     /translation="MDPTIPEFRPQALAQPTDEPRPDTSEESQWRTTCRTCGEKFKSR
                     NQLMRHLYKSHPGKPAKSKASPKATQLRIAPQSPVAPKPGHSQPHSQSQSQSRSRVHP
                     FALLSYQQQVAFAGHVLFAIFSIGMKQLEEEGKEQQQRERHQEQLQNHGALSLQGAGD
                     WKPQKGPTSATPGPEAAVPSQASPDRTPSPDQISRGKPENGAESEDSDDEDGGVALFG
                     PAYGDLPFRPGEKGNVALEDSKGACELDYYDWDLS"
     gene            complement(1428091..1430206)
                     /locus_tag="MYCTH_2306196"
                     /db_xref="GeneID:11513422"
     mRNA            complement(1428091..1430206)
                     /locus_tag="MYCTH_2306196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663899.1"
                     /db_xref="GeneID:11513422"
     CDS             complement(1428403..1430010)
                     /locus_tag="MYCTH_2306196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663947.1"
                     /db_xref="GeneID:11513422"
                     /db_xref="JGIDB:Spoth2_2306196"
                     /translation="MLLAKFLEKAEKEGSIEEPLSHCHCHCIYHTHGSSSPNSLNDNP
                     ENAQPPHPSPAGMGNADTRIVRHDTEPVHVLSPTRTETFPDNEDGAHGLGIHPIDSNT
                     SAGTNKRGFAEKLIRVATALERVSPDRFDDHLAFKQGKATGFPEIPGEPARNRNLAQI
                     RRQWGEPTVDPEDSLAAPRGRRSRASSFSGSVSRSNSVDPRAHSPKPPPRTPTSGPES
                     SMLGLPTTHSPEGTSESVFPARPSVELEKTKSHGTVVTLHEGPNSPAIVLSSDDQENE
                     AQPPTTVSSVIESTQASEQMEDSRPEGRLAVPAGEGSAQRITAAEYQVPPRATTRLSP
                     LDRQPASHIIEQAGRPGGSPSNQISDAAKHDTPPTQVASPPTTSSPATEQQLSSSRTK
                     EKRQIEAPSIETDDATLKNRALQAPQPAAASLPPVEQRPPLDHVEVERVRHAEEPSVR
                     TGYASQQDTAPQQSTPPTPATSGLVVRRPPLHRIEDSVSDGRKESPASESAQQHATQK
                     RAPQPADGRPTEKAPLPSSGDLKRNQE"
     gene            complement(<1430182..>1431311)
                     /locus_tag="MYCTH_2064480"
                     /db_xref="GeneID:11513423"
     mRNA            complement(join(<1430182..1430648,1430719..1430865,
                     1430970..1431106,1431175..>1431311))
                     /locus_tag="MYCTH_2064480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663900.1"
                     /db_xref="GeneID:11513423"
     CDS             complement(join(1430182..1430648,1430719..1430865,
                     1430970..1431106,1431175..1431311))
                     /locus_tag="MYCTH_2064480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663948.1"
                     /db_xref="GeneID:11513423"
                     /db_xref="JGIDB:Spoth2_2064480"
                     /translation="MPVLPPPSSLDILVGRTVANASDPEPLQVVCSWPLSGQYGGGSR
                     ILYYVLVAACVLARKTEWLRNACLAAALIFPATAAIHAIVLASLHTDDAIDMDIYGAL
                     QMCSIGILTAPATVRLSRTYFNNPGRNVLFVWTVLVVAGLLALTVEFFRTEAKDCRDS
                     TGRPVYHLDNFPGDTKQNCSLVCEEGNPFSPMRTGSADNINLVPKPYYLTFGAATLVA
                     AASCVPGILSMVSIWNKIAKLNWSKQFGTPDVDEVIEGTNGATPRGMKTVNDVIRRLL
                     SVVEIPVVCAIPSLFAEED"
     gene            1432360..1434965
                     /locus_tag="MYCTH_2306198"
                     /db_xref="GeneID:11513424"
     mRNA            join(1432360..1432613,1432675..1434344,1434464..1434965)
                     /locus_tag="MYCTH_2306198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663901.1"
                     /db_xref="GeneID:11513424"
     CDS             join(1432517..1432613,1432675..1434344,1434464..1434817)
                     /locus_tag="MYCTH_2306198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663949.1"
                     /db_xref="GeneID:11513424"
                     /db_xref="JGIDB:Spoth2_2306198"
                     /translation="MAGDQPQEVERPDYEQIKSWRSIVTLVVFILANVVVLFPFHIPL
                     YIPRRVFNIICDGLSALRIISPREADDEKTESRHGAGKVTSSFVRFNFPMNMVTAPLI
                     ADLFLLAILAIGRKEVKEGTYGADNIFPLDIMLFFLSLAYIAISIDASGIIRYLAFKV
                     LQWGGDAGHRLFFYLYAFWFALTSFVGNDPVILSGTAFLAYMTRVSSNIVHPRAWIYS
                     QFAVANTASAILVSSNPTNLVLAGAFNIKFIVYTAHMIVPVLATGVILFPFLLYIVFN
                     NEALIPRVIKMHELPAEARTRKPVNPNIPHARGTAEQQEDAAGEQGKLLSLEEIINPF
                     LDRKGAVFGALVMAVTLISVLALNASAQITEENPVYWVTLPAAFVLFIWDLSFGWIHR
                     HETREIARKGREELQRLQLEQALRRERERMAHAAPGERFASSDESVSAQVGAPSGGLE
                     PGGNVLGKDSMDGNVTTTGTTPSKSPTQEFRGAGNEKSAAHGSLGESQLQKPPRRATL
                     VSLAKDAFTWSQETFPTATAVIAHLPFALVPFAFSMFVLVQALVTKGWVPIFAKGWDA
                     WVNKTGTIGAIGGMAFLSVILCNFSGTNIGTTILLSRVIQAWQVLYHFKETEISDRTL
                     SATIYTMALGVNYGAFSTAFSASLAGLLWRDILAKKHIHVKRLDFATINLPIIAIAMT
                     VGCVVLIGEVWIMKDDTPASDRYA"
     gene            complement(<1435362..>1436967)
                     /locus_tag="MYCTH_2127753"
                     /db_xref="GeneID:11513425"
     mRNA            complement(join(<1435362..1435945,1436493..>1436967))
                     /locus_tag="MYCTH_2127753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663902.1"
                     /db_xref="GeneID:11513425"
     CDS             complement(join(1435362..1435945,1436493..1436967))
                     /locus_tag="MYCTH_2127753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663950.1"
                     /db_xref="GeneID:11513425"
                     /db_xref="JGIDB:Spoth2_2127753"
                     /translation="MELDHQAGPIGLASLPDELISLILRNFCLHCRQGTRETPHAYFP
                     ATGQKREERSWYAVDVSALHAMCLVSRRFLPFAQEILYHEFAWAYGDSSASLMDDWSH
                     RLTAFLRTVARKKDLAALVKRVYICLTHFFIIPETEADSVLEDAAHARGIRLADFLDT
                     EFLSSDIIACLVRNKNTLHTLHLKYDVDSQTQDGSARSLAELESSLNTFPALRNLFLT
                     TTLLYQMIDGSAEDDSILTRLLPPSLVSLQLAVVDDNPWLNLRLEISVMADLARAVSQ
                     GHFPHLRRVSCIPTTKGRLDMHRLEAMFSCAGVKFGYDGWQFHDGVAGERVYSLGPSP
                     AYSTALTVGSDDESLQSW"
     gene            1438157..1439641
                     /locus_tag="MYCTH_2306200"
                     /db_xref="GeneID:11513426"
     mRNA            1438157..1439641
                     /locus_tag="MYCTH_2306200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663903.1"
                     /db_xref="GeneID:11513426"
     CDS             1438502..1439443
                     /locus_tag="MYCTH_2306200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663951.1"
                     /db_xref="GeneID:11513426"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2306200"
                     /translation="MASPSVIVFGPTGGVGSVVARTAQAAGARVTLAMRDPSKPAAAD
                     LPATLPRVRADLSDPASVREAAAQAGARAAFLYLVIGLPDRMRATVEALRDAGVEYVV
                     FLSSASLRPGVDVRAVTPDQFLPWQHAGVEAALDDVFGAAGYVAVRPGFFASNLLQYK
                     AALAAAVSGDGDGVVRVPAAEARLDFILPEDIGRVAGRLLVTRDARGPVTLFGPESHT
                     LREALELVGQALGKPVVVEEFASADEAAGYLIQTVGYPDPVARYLVEILKRRAQDPSP
                     EEIKEHGEAAGNILKYGGKEPGRLVEWVEANRAKFLE"
     gene            1445063..1447526
                     /locus_tag="MYCTH_2306203"
                     /db_xref="GeneID:11513427"
     mRNA            join(1445063..1446045,1446121..1446665,1446757..1447047,
                     1447130..1447526)
                     /locus_tag="MYCTH_2306203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663904.1"
                     /db_xref="GeneID:11513427"
     CDS             join(1445336..1446045,1446121..1446665,1446757..1447047,
                     1447130..1447251)
                     /locus_tag="MYCTH_2306203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663952.1"
                     /db_xref="GeneID:11513427"
                     /db_xref="JGIDB:Spoth2_2306203"
                     /translation="MPMPSLRRLAVVGLASHAACTSIKYTTPPAASVICNEHSYTYQG
                     LAGYGSLPSDARDQYGDTISFGSSMAIKNWTRTGNKYKGTMYGLPDRGWNTNGTQNTI
                     PRVHVFELSLTETEATVSKPSGPNVEFKYQRTILLHGPDGKPMTGLDPDFTGGLTYPG
                     FPTMPAATYPGDGFGGPGPGDKRISLDAEGLVVEEDGSFWISDEYGPFLYRFDEKGRM
                     TAAIQPPDALLPIRNGNVSFNSNTPPIYDSSLVPSPEDPDHGRQNNQGFEGLTISADG
                     KTLWAMLQSAAEQDGGASSSKRRNTRLLKYALRRTDKKKTKNKKKGGDVEVTYEAEYA
                     VPLPTYENSKGKTRVAAQSEIHYVSDSQLLVLARDSDAGRGRDDPLSRYRHVDIVDIS
                     GATNIAGPRFDDVRNGNITVGGTSDPSDDLVDGITPAKLCPFIDYNLNSELNKFRTAE
                     GDLVHNGEPVNLGLLNEKWEALALVPVIPDTKGKGKDEGGTCGGKRDGDEYYLFTLSD
                     NDFITNNGYADFGKIHYVDDSATVPFLNSQALVFRITLPRGSKPLIS"
     gene            <1449724..>1450614
                     /locus_tag="MYCTH_52496"
                     /db_xref="GeneID:11513428"
     mRNA            join(<1449724..1449903,1450128..>1450614)
                     /locus_tag="MYCTH_52496"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663905.1"
                     /db_xref="GeneID:11513428"
     CDS             join(1449724..1449903,1450128..>1450614)
                     /locus_tag="MYCTH_52496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663953.1"
                     /db_xref="GeneID:11513428"
                     /db_xref="JGIDB:Spoth2_52496"
                     /translation="MKLKIVASLAMVASAVAQGVTEKIAPEGDAPSGCRPNFDGPFQI
                     TVVPLTDKAKRDLALETRATCSGEGTLVLRLSDGVLTDAQERTGYIASNYQFQFDGPP
                     QAGAIYTAGFTACANGSLALGDSAVFWQCASGTFYNLYDRWSAEQCSPVDIVVLPCGG
                     DAGAGSQEGQNTVGGQVITTTVVVPLSDGQPQVITTTTVIPICQIDDGAFPPHTPRPI
                     LPLF"
     gene            1451925..1452967
                     /locus_tag="MYCTH_2306208"
                     /db_xref="GeneID:11513429"
     mRNA            1451925..1452967
                     /locus_tag="MYCTH_2306208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663906.1"
                     /db_xref="GeneID:11513429"
     CDS             1452010..1452927
                     /locus_tag="MYCTH_2306208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663954.1"
                     /db_xref="GeneID:11513429"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="JGIDB:Spoth2_2306208"
                     /translation="MADYWKSTPKYWCKHCGVYVRDTGLERANHEATAKHQSAVKRSL
                     REIHRNAEQKEREKERAKQEVDRLNGVVSGVRGAASSASKSTTKPGGGAYGAPPPQVS
                     QAERQKQLEQLAELGVNIPTELRGSMAMAGEWTVTSTRVIEPRSEKTDGTDPESVPVE
                     ARATGVKRERERAEEEKEQEEAIKGLFKKPRKWGIGSKTMPTEEDAELDALLSGPLVK
                     TKKEESEAPQIKAEEAPEQPAAGSDIPESVKKETSPPIKKEPEEDESGPGATAADKET
                     SPPPPSSVADSGAPAVVFKKRKPKNIRQK"
     gene            1454482..1455584
                     /locus_tag="MYCTH_2306209"
                     /db_xref="GeneID:11513430"
     mRNA            1454482..1455584
                     /locus_tag="MYCTH_2306209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663907.1"
                     /db_xref="GeneID:11513430"
     CDS             1454509..1455522
                     /locus_tag="MYCTH_2306209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663955.1"
                     /db_xref="GeneID:11513430"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2306209"
                     /translation="MSIRKSSIIDSVVRVPSPAIGLAVAADGQTALRYLCRPPGFVGT
                     LSLIRLLLRYGADVNSPDAHGRTALHHASTFSRGGDQVRELIEFQGGPAVSGLVIDAF
                     DSRSWTPLHYACLFRSWDEPGDRAVAAARLLLESGADVRARTSNGWTPLSLAAFSASP
                     DLVHVLLDHGAHADDLLLSRLSRNAEPTLVPIGRIVFLHWDYGHRLVDLLPEAMNELA
                     VRKARVATLLEHRLGISVPLPPMQEQAVLPLGSRLDPQAPAASLPKFFVDRLEHPFGI
                     AVENHGDLTADDFEKDIDGVLGVLDPLGLEALVVPVSVPIHRPLNWLDIPVNASDHPW
                     ISR"
     gene            complement(<1456104..>1456950)
                     /locus_tag="MYCTH_2110987"
                     /db_xref="GeneID:11513431"
     mRNA            complement(join(<1456104..1456601,1456753..>1456950))
                     /locus_tag="MYCTH_2110987"
                     /product="carbohydrate esterase family 5 protein"
                     /transcript_id="XM_003663908.1"
                     /db_xref="GeneID:11513431"
     CDS             complement(join(1456104..1456601,1456753..1456950))
                     /locus_tag="MYCTH_2110987"
                     /note="CAZy_ID 267775"
                     /codon_start=1
                     /product="carbohydrate esterase family 5 protein"
                     /protein_id="XP_003663956.1"
                     /db_xref="GeneID:11513431"
                     /db_xref="InterPro:IPR000675"
                     /db_xref="JGIDB:Spoth2_2110987"
                     /translation="MKFLSLLTAAGVAAALPTSPAEVSSAGEIEARQLASTRNELENG
                     DSANCPKAIFIFARASTEPGNMGISAGPNVASVLEAAYGDNIWVQGVGGPYRAGLADN
                     ALPAGTTRAAIDEAKRLFNLANTKCPGAAVVAGGYSQGTAVVSNAIAELRGTGTATQE
                     QIRGVVLFGYTKNLQNGGRVPDYPTDRTKVFCNVGDLVCSGTLIVAPAHFLYTAESLG
                     EAPRFLQSKIDAT"
     gene            complement(<1464341..>1464499)
                     /locus_tag="MYCTH_36130"
                     /db_xref="GeneID:11513432"
     mRNA            complement(<1464341..>1464499)
                     /locus_tag="MYCTH_36130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663909.2"
                     /db_xref="GeneID:11513432"
     CDS             complement(1464341..>1464499)
                     /locus_tag="MYCTH_36130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663957.1"
                     /db_xref="GeneID:11513432"
                     /db_xref="JGIDB:Spoth2_36130"
                     /translation="FTVYYLDNILIFSKMIDKHQKYIKVMLDVLYIYKLLVNKEKSEF
                     YVRKTVFL"
     gene            complement(1481883..1481973)
                     /locus_tag="MYCTH_t128"
                     /db_xref="GeneID:11513433"
     tRNA            complement(1481883..1481973)
                     /locus_tag="MYCTH_t128"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:complement(1481938..1481940),aa:Glu,
                     seq:ctc)
                     /db_xref="GeneID:11513433"
     gene            1484252..1486675
                     /locus_tag="MYCTH_2306212"
                     /db_xref="GeneID:11506441"
     mRNA            join(1484252..1485133,1485266..1485563,1485750..1486070,
                     1486257..1486675)
                     /locus_tag="MYCTH_2306212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663910.1"
                     /db_xref="GeneID:11506441"
     CDS             join(1484349..1485133,1485266..1485563,1485750..1486070,
                     1486257..1486370)
                     /locus_tag="MYCTH_2306212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663958.1"
                     /db_xref="GeneID:11506441"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2306212"
                     /translation="MLPEAFSFIPGPYQVPALASLLLFVFLVIWYGLSWRRLSHIPGP
                     PLASLSYLWMLRIARSGEQSARYAHINAKYGSLARIGPNELIIDDPAVVRRMNAARSP
                     YRRSSWYSAMRLDPYQEDLFSMADTAEHDLLRAKMSFGFGGKELPDVEGDIDAQVDLL
                     VHLIRSKYLSDENGVTCPFDMAITAQYFTMDVITKLVFGKQLGFLETDSDVYNLIHSS
                     EGPLQLQVLKSEMPLIGRIFSQPWVLKNLGPKKTNAGGLGRILGTAEEVVAKRFRHDA
                     KDEMDMMGSFIRHGVTQQQCEVNTPFILVAGSDTTASAIRGTMLHLATTRHAYNKLRD
                     EIDRAVAEGRISSPVTVEEAMKLEYLQAVIYEGIRVQIPFSGLLMKEVPPEGDTINGV
                     FVPGGSRIAHNTLAIMRRPEIFGQDVDVFRPERWLGVSPEQKQLMVQTTELVFGYGRW
                     SCLGKPVAFIELNKVFVELLRRFDFEILYPKRPWRELNFNIFYHSELWMRVTGRH"
     gene            complement(1486677..1487637)
                     /locus_tag="MYCTH_2306214"
                     /db_xref="GeneID:11513434"
     mRNA            complement(1486677..1487637)
                     /locus_tag="MYCTH_2306214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663911.1"
                     /db_xref="GeneID:11513434"
     CDS             complement(1486945..1487583)
                     /locus_tag="MYCTH_2306214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663959.1"
                     /db_xref="GeneID:11513434"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="JGIDB:Spoth2_2306214"
                     /translation="MTATSKPVTASGTAQDQAQEAASASSSAPISDLPQPTRFITTHN
                     EAGQAVVHSETKFSWAPYDEGNLAFAVPYTTSAFPPELNGEADVAEHERVVASGTLGL
                     VRPGGTVLRFVDFAPGYACGMHRTLSLDYGVVLEGEVDMVLDSGDRRTLRRGDVAVQR
                     ATQHQWVNRSQTQWARMLFVLQHCKPLVVAGQDVGEDLPPESGLPPSGNTGE"
     gene            1488905..1490363
                     /locus_tag="MYCTH_2306215"
                     /db_xref="GeneID:11513435"
     mRNA            join(1488905..1489628,1489765..1489934,1490173..1490363)
                     /locus_tag="MYCTH_2306215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663912.1"
                     /db_xref="GeneID:11513435"
     CDS             join(1489540..1489628,1489765..1489934,1490173..1490273)
                     /locus_tag="MYCTH_2306215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663960.1"
                     /db_xref="GeneID:11513435"
                     /db_xref="JGIDB:Spoth2_2306215"
                     /translation="MRATATVLFIASLASTALGAATKFYSDDKCEHEIGKKVYNGFST
                     GDAPIPKEAVAIKSDSIMDVWYSYQRNDGKNCQGDLILRLDNGKCYNLEKDLGSAGCT
                     RLCVNALGGGECASSPA"
     gene            <1491092..>1493056
                     /locus_tag="MYCTH_2065104"
                     /db_xref="GeneID:11513436"
     mRNA            join(<1491092..1491938,1492047..1492654,1492808..>1493056)
                     /locus_tag="MYCTH_2065104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663913.1"
                     /db_xref="GeneID:11513436"
     CDS             join(1491092..1491938,1492047..1492654,1492808..1493056)
                     /locus_tag="MYCTH_2065104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663961.1"
                     /db_xref="GeneID:11513436"
                     /db_xref="JGIDB:Spoth2_2065104"
                     /translation="MLKLDRITRSKSATKLPEHHVAAAGSAEAASGWASYVPSWSPSP
                     GGSRPSLSEARVAGFRNPWPSWHRPTLAETWNSFRWGEDGDGDGCVELAASHLPDRAD
                     ADADDDPAQPQDPPKSMRPSFADAREGPDSVGAKAARLLRVETPDFSFPPGTTAKTTW
                     LGHAGVLVQLPPLDDAKLGRPVRALFDPLFGDRCSPSRFAGPVRSYPPPCRVQDLPPI
                     DLVLISHNHFDHMDAGSILSVWDHSRDSARFFVPLGNAKCLLGWGIPADRVVELDWWD
                     SADFTCVHCTPAQHNSSRSFGDTNTALWSSWLLELSPATHHHHHHHHHHHHHHHQHHH
                     RHQQEQQQQPYRVFFAGDTGYQFHPDPSWPPSPNNPGGSEYHDHEDKDKEEEEEEDED
                     EDEEGGPSPACPAFAQIRARIGAPQLLLLPVSVGATFSYLRSFFASFPLGLASSFPSS
                     SSSSSYTRFNPFPRHSAGVTAANHLAPWDAVRVLRAGSGSGGGDGAVAVAMHWGTFVP
                     DPEEVLRTLGALEWACRKQGVRFARELRRGKGQATAEDTGGRDRGLVFVALHHGAGVV
                     V"
     gene            complement(1493188..1495772)
                     /locus_tag="MYCTH_2306216"
                     /db_xref="GeneID:11513437"
     mRNA            complement(join(1493188..1493946,1494062..1495101,
                     1495194..1495772))
                     /locus_tag="MYCTH_2306216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663914.1"
                     /db_xref="GeneID:11513437"
     CDS             complement(join(1493722..1493946,1494062..1495101,
                     1495194..1495392))
                     /locus_tag="MYCTH_2306216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663962.1"
                     /db_xref="GeneID:11513437"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2306216"
                     /translation="MLQVLCSATSLVLLATALVLAIRRVFFRGLWSVPGPFVARFTDL
                     WYAYRVFRGRFEKDNVELHRKYGPVVRYGVNRYSIADPLAANAIYGPGSKFTKSSWYQ
                     PWSSPSPQDWTLFADQDAKRHASNRRQYQNTYNMSALVHYEAYVDECVELLCQRLSGM
                     GANAWSQPVDMGHWLQCYAFDVISLVTYSRRIGFLDAGQDVGNVIQNIDDALAYASVV
                     GVYPWLHPILFRVRNWLAGSRGKGRQYIINFTKECMAVHQEKPSGQPVAEKNSNSSED
                     QWQQQQPTTMDFLSKFLQKHTETPSAFTRYHVLAGCVSNMMAGSDTTSISLSAILYHA
                     LRNPAVFRRLREEVDQLCPRDHDENAASARVTFAQSQDMPYLQAVIKEALRVHPATGL
                     PLERVVPEEGLTFNGIFFPAGTIVGINSWVEHSNKGIFGDDADVFNPDRWLHGDKEKI
                     RVMNRHWMPVSFPFVFLPPVPPGLLFVGNYTPCLTSS"
     gene            1496457..1498237
                     /locus_tag="MYCTH_2306218"
                     /db_xref="GeneID:11513438"
     mRNA            join(1496457..1497178,1497296..1498237)
                     /locus_tag="MYCTH_2306218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663915.1"
                     /db_xref="GeneID:11513438"
     CDS             join(1496877..1497178,1497296..1498079)
                     /locus_tag="MYCTH_2306218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663963.1"
                     /db_xref="GeneID:11513438"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="JGIDB:Spoth2_2306218"
                     /translation="MGSGLMPPTYFQKSSSLPMNTIIRFVPQQTAWIVERMGKFNRIL
                     QPGLAILIPFIDRIAYVKSLKEVAIEIPSQSAITADNVTLELDGVLYTRVFDAYKASY
                     GVEDAEYAISQLAQTTMRSEIGQLTLDHVLKERAALNTNITAAINEAAQAWGVTCLRY
                     EIRDIHAPKPVVEAMHRQVTAERSKRAEILDSEGQRQSAINIAEGRKQSAILASEAER
                     AEKINRAAGEAEAILLRARATAAGIEAVARAIAEGKDAAQGAVSLSVAEKYVDAFAKL
                     AKEGTAVVVPGNVGDIGGMIATALSVYGKVGDAQARTMAKELLAKGGIIDAETPAVAS
                     STTSTTTTTEGRADSASQSAPAPEKSA"
     gene            complement(<1498396..>1503949)
                     /locus_tag="MYCTH_2139484"
                     /db_xref="GeneID:11513439"
     mRNA            complement(join(<1498396..1500257,1500306..1500519,
                     1500573..1503026,1503113..1503201,1503266..1503646,
                     1503702..1503768,1503872..>1503949))
                     /locus_tag="MYCTH_2139484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663916.1"
                     /db_xref="GeneID:11513439"
     CDS             complement(join(1498396..1500257,1500306..1500519,
                     1500573..1503026,1503113..1503201,1503266..1503646,
                     1503702..1503768,1503872..1503949))
                     /locus_tag="MYCTH_2139484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663964.1"
                     /db_xref="GeneID:11513439"
                     /db_xref="JGIDB:Spoth2_2139484"
                     /translation="MTTQLLASELANLIQESKRKHNDLRQAAEKSLDELKNLRASTEV
                     QASEELAQRPNFVNPFIIACGTKNVKFTGIAIVCLQRLIVSRALPRARLSQVLEALQQ
                     ATSAGLDVQLKILQALPALLSNYSADVKGDLLVTALNVCFILQSSKNAIVNNTSAATL
                     QQLVVSVFDKVVAEDKSGTGHPPVGEVPGRDGNIPLPAAALDAYRRPEYLRVSSLFQT
                     FGLELIESVLTNHAAIFTTHPEQADILRMRVMPFITSALRGRPNFATSVRLVRILYTL
                     LRRHLAILPTESGDALEILTHLLDQDTTLWKRALCMEVFRGIFAEHALLRRIFMLYDA
                     EEGQKNILKNLTATFVRVSTEKPSVIGLGHQSTIPVAASNTGASSDQVMLEASGVTGI
                     ISSSVGPDGNNTGISSQWSTMRVPCIDQLDKADAPTIPESYIYSLTLSCITSLSEGLA
                     KFILPLTVSSEGRRKRVPKPEQGRNSPAPQSDETPDKLDRTASFKRNPVPVNPLTLEN
                     HPLYAEIKICAAFIEECWPAVLATCSTFLYAALDSDYYHGLVRAFQKFAHVAGLLQLA
                     TPRDAFLTTLGKAAVPPNVLTACMNAAGPARPPPSPVAVEGSGNIFSNARGLLSVDSL
                     VSPSLLSSEKQRQPSMDASGATLNTRNLLCLRALLNLGIALGPTLASSWSIVLETLQQ
                     ADLVMFSSGKAAGRTPLAAKGPDPQAEQEASALLANFNTEIRAVETAASRLFESTVDF
                     PNSAFVEIVGAVCNLLEHVEPPSEPSSRPQSPPSTGSLKTPPLPSKRVMSISVPSSAA
                     PNQENQFGLSKLGDLASINIERLLAYPPDESGWTRLVTELIDVLGSVSNTAPVRARAA
                     ETLVRILLEEASAVASQPDEVRGQIQHRLLETFRNSLAPLQATERQVSLAKHAVDVDI
                     HKIILEGLKSLLENCGESLISGWELIFEIIDTVFIERNISATGAEDNNRPSLRPNLLT
                     RAVKLIRPSFASLQLICSDFLPSLPNACFLNLVDTLYKFCTQDDELNVALTTVTFFWA
                     ISDFLSANRESTSITEDMISASGEQSLIKLAVEPVGEGSGAALWMLLLLRLTSVATDQ
                     RLELRNSAIQTLMRIMSAYGESLSPEAWSVCMRAVIFSLLSSVERELRAVDKPSAKEN
                     GPEEWRETATVVIKGVSDLFGSYLSLLTSHQSFSEIWRNLIGHFQALIDLEMLDINSA
                     TYSAVRDILHRCTEQERLGIGKESLDLAWELWSQGIPVPKHETDGKTSDNQKCLLVWV
                     EALLPLYELIREDFTVERVRRMLILFRDAMQHATPGAYASDIEYVTPLQGKILEVFRM
                     VRTDLQGVPSAMVAQVAEFVSLAFNQEDVAKATSEKRTYVAMSKESMTILQSLIVKNA
                     GERDIYETGAFANALSALSRPVILKYQFRIVTKSVQPWRVATQSALEVLKAALPRLAS
                     MEFPRETVQNIWRTIVSIANGIISADLSEPTAATADIAGDQAFDIASYRQLRGLIIPA
                     LGSEVVLDETRRAFAEGLFRTSIIHSPSPAEAAIIYGKPGSDPVGLSSFLKPRNGRTI
                     DPAPTKRSLMSEVCLDELFALVEVHDDEETSSTAGTAGTAGTAESTHDRHVRLARTVA
                     PYLILRCALTLRGYVADQPLRGRMPQPMSQRKELSRILRCLVDLRSEPGSIPDAPNVD
                     SETRKHLLRVYPLLVSAVQVAGTAGDVEVLGLIRQALDVVGQEFGL"
     gene            1504305..1505294
                     /locus_tag="MYCTH_111987"
                     /db_xref="GeneID:11513440"
     mRNA            join(1504305..1504465,1504543..1504622,1504705..1504952,
                     1505027..1505294)
                     /locus_tag="MYCTH_111987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663917.1"
                     /db_xref="GeneID:11513440"
     CDS             join(1504393..1504465,1504543..1504622,1504705..1504952,
                     1505027..1505096)
                     /locus_tag="MYCTH_111987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663965.1"
                     /db_xref="GeneID:11513440"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_111987"
                     /translation="MAAQVPRNFKLLAELEKGEKGLGAGACSYGLEDPEDIYMTHWRG
                     TIWGPPHGNHENRIYELKMECGPNYPKEPPEIHFVSQINLPGVSPTDGKVDKNAVGIL
                     RDWTRIAAELSKNARPKEDPLSLEAALIAIRKYMDEHKKLPQPPEGSKYPIYNN"
     gene            <1505462..>1506495
                     /locus_tag="MYCTH_2064609"
                     /db_xref="GeneID:11513441"
     mRNA            join(<1505462..1505510,1505597..>1506495)
                     /locus_tag="MYCTH_2064609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663918.1"
                     /db_xref="GeneID:11513441"
     CDS             join(1505462..1505510,1505597..1506495)
                     /locus_tag="MYCTH_2064609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663966.1"
                     /db_xref="GeneID:11513441"
                     /db_xref="JGIDB:Spoth2_2064609"
                     /translation="MPSFFVPARSSRHRLACFALYRSLIRQGLRVPLPDELSKDSPLG
                     PANPIRTLIRNGFRRNKRDTSPRLAVSALKNGYRFLALLSRAADASTPEHASVLAFLR
                     ENEARVLAVKAKAAEEAAKRISTAPIPGRTPIITKVSAEGEPPVYVPTGPPRPLSSFK
                     SGVRKPPTLAAATAVPFLRLKKPQPRFLERVIRQKVERRAKKAIKIMEMQNEGMIDAS
                     DEDEWERLVAKMLAENGQQPGGAYKEEKTYRDSLSEAVTLTLESLNRDREDSVARAKA
                     LWQIVLAEQEMALKEEKEGLAKEGKGAEEPRRKASSHQV"
     gene            complement(1506829..>1509347)
                     /locus_tag="MYCTH_116510"
                     /db_xref="GeneID:11513442"
     mRNA            complement(join(1506829..1507169,1507237..1507540,
                     1507595..1508890,1509096..>1509347))
                     /locus_tag="MYCTH_116510"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663919.1"
                     /db_xref="GeneID:11513442"
     CDS             complement(join(1507069..1507169,1507237..1507540,
                     1507595..1508890,1509096..1509347))
                     /locus_tag="MYCTH_116510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663967.1"
                     /db_xref="GeneID:11513442"
                     /db_xref="JGIDB:Spoth2_116510"
                     /translation="MRYSEGDLPILNAEVYHESPAFGSPRRLAQSRKKQASSSLPRGS
                     EEGPRKRARTQAVGVPGHGDETKRARGRPRIDTRDEIAADTLEKKVRTLKYANEEMSN
                     AFMQLHDFALSSGLLDRLPDFGHQLRQTTERFLSLAREVSDDDADDDQRNGIASQTRR
                     EPNSHRAQPGSPRQPDAVASSLSATSSPESAAEGGPVALFGEPNIPLNTVTQADLTPP
                     LTLAQQQQQQQQQQQQPLLALPPPEEPPNFAYEILTQPTLENASFPFQPAPFACSSHD
                     LSLPPLIESPPVPQTYTNLEATFGRRLQRYSLEQVLALLSMPDPPQRLVKRIFGFCLL
                     LESTETIRRRLRRMLLREPQQSLFNWQYPFFHLGGAGTHFDVSASSFSIPTTTTTTTT
                     SSSSSAPAPAPAPSSSSLPTTTAPGKPHRVGNQGTVDVLKPQETAGFAMGPFSAEVNS
                     VRDQELDEDMRIILDGFAGEYYDCDEAELYLYQRGVVIPPGADLVTVDVDLSQMESYK
                     ERGWRVETSRGLLLDGTSSPGSGRSLAQQGAGARSWSMGDGGGMAEPALASVFPPGDS
                     FLPATTVAESLAARRGDMLPFGFLPPSELGDSSGYLPNCQRVVVEVMTLLRQITKRGI
                     CLGRTPGFKACDIDDAFWESVKASLM"
     gene            1510716..1513453
                     /locus_tag="MYCTH_2306229"
                     /db_xref="GeneID:11513443"
     mRNA            1510716..1513453
                     /locus_tag="MYCTH_2306229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663920.1"
                     /db_xref="GeneID:11513443"
     CDS             1510979..1513078
                     /locus_tag="MYCTH_2306229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663968.1"
                     /db_xref="GeneID:11513443"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2306229"
                     /translation="MDKLREEAHVMENLDHDHIVKLVGTYCIQSSLYFLLWPVAVCNL
                     DILLNDIDCLRTNHGDREDIISRLHALDLKDLSAIEGPAPAVRNPAGRDSCPLEYLRQ
                     VMGCITRAVAYCHGSNVRHLDLKPSNILLNPGRVYLADFGIAKDVHDRDNTMTIGVQG
                     TPKWRAPEVQQHNADWSMKAADVYSLGLILLNIFTVIYNAPLNEFEAILEDVSADGRA
                     MKLDEYLPKLERLVLASREVDDANAATFSPKHIIGLAARMVSQDPSSRPVIFQVDSEL
                     VELGGLDQIYHSKCCKRSSRYLTERMNAKLIAVTEERDRLRAEHGQMAKRLQILEAKD
                     ETYEHRLRNERKAHADNLVKLQAQLDKERAERQRLETLLAEMQQSRKQHRPVLPRPSA
                     VRQPTSGTSGTSSPQAQPKPQLPAHAVPQQRPQATPVQQPRPAPSVGQGPRPSYSQCV
                     KGAATPQAATVTAKPRRDSLIPSPSPSAIPPHSSNPDQPGFPLRSRNSGSRLPRAINP
                     TTPIRSNTPVLNGDLSSTDSTQYSMSDSVFSRLSLSKASLAGTSVAGTPSTHSPAMVD
                     TQKAANQNASPSSPRHGEPGQHSPLSPEEPPHGLGLGLTDLERRESIASAGTGGGGDE
                     SVRDTASVISSSAAAAAAAATPSSPRALSSAPSGSVLSSPRTTHASMEATVRAGVRVP
                     RLPTAQSWAEVAAGKQR"
     gene            1514000..1514099
                     /locus_tag="MYCTH_t109"
                     /db_xref="GeneID:11513444"
     tRNA            1514000..1514099
                     /locus_tag="MYCTH_t109"
                     /product="tRNA-Val"
                     /note="Anticodon: CAC"
                     /anticodon=(pos:1514033..1514035,aa:Val,seq:cac)
                     /db_xref="GeneID:11513444"
     gene            complement(1514094..>1520560)
                     /locus_tag="MYCTH_108304"
                     /db_xref="GeneID:11506422"
     mRNA            complement(join(1514094..1514495,1514601..1519941,
                     1520076..>1520560))
                     /locus_tag="MYCTH_108304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663921.1"
                     /db_xref="GeneID:11506422"
     CDS             complement(join(1514433..1514495,1514601..1519941,
                     1520076..1520560))
                     /locus_tag="MYCTH_108304"
                     /note="protein of unknown function with Armadillo-type
                     fold; protein of unknown function with armadillo-type
                     fold; protein of unknown function with Armadillo-type
                     fold. protein of unknown function with armadillo-type
                     fold"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663969.1"
                     /db_xref="GeneID:11506422"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="JGIDB:Spoth2_108304"
                     /translation="MPMMDESLERHTGSDAGFAASTGGAAPPFSSGLLASVETISRAT
                     SPGLPCGEHQPEDDKKRYRPRTFSYFRLLPFDVEDDARRDAALRGILKNLYISIMAED
                     FSPGALHWTRELQGWLNLKFEMTRELRARLAHLYYHLALAPGLDHNTADRFSRMAITL
                     SKKKHYLKPGEDLIFDWRPMWKELKALVLPSETASHQGSRRRSSKHLLKLCLHASSYF
                     DPRERRAILEELLPYFSTSAMSNAYIVAAALNAMLPTSPAPPSAPQSQPSDIFPTFFH
                     LWSLMNRSKAFDVCFIDIFSRMARDHLGCTHVPFTEHGIFAREQADLIFTAILRLTEI
                     PVGQANSPYTSLDYGAGLGVHLEKDKSKYPVPYMVARWIVHSLSPLCLDRESSILANL
                     EGLMESIDTFFHPSNQGTWTGFLAQLTYFLTDIFVSRWNREQSGELEVPPERRINGEL
                     KKRFVLALKEVTFMGIFSKSSKVVNYYYSALQGLAYLEPDLMLPGALQRFYPSLQGLV
                     EVHRTTSSLCGLQMIANIMAKQKGYRCHITALLALALPGIDANDLGKTQYTLNFIQSV
                     AYSIPFVPLANQDDKIHDTSLAMNWVQAEMERMEREGQDVKICYDKELTDEDEANILR
                     SSTAGLGEFVLALLGKVFALLENLPDASHLRSGSPEDNVINTLPAALTPLFASLSPEL
                     FDMALDKLAAFVSSHVLHQARDAMAWICNALCKVNPEKTLKVLIPMLIVNIKNEIEYN
                     GAASDRSSGTEVLPRDRALVWHVSMLSMCVVHVGAEVLKYKDELFGIAEYMQERCRGL
                     PTIHISNYIHHLLLNLTHTYPIDNALYEPDRIARGLDVDDWGRTTPPSELTIKWHRPS
                     HAEIVFALELFESQAKSAARRIEQLMSDDPPVSRKGKNKEWSDELSRSLTALRLIISG
                     VATLFDPARASGKRGGRGANGRVKNDADGDAMMEEDNDPLAEVADDDELERQFHYPAG
                     YLLSPKDPVYERIHSLREDIGRLLSRTHAFLNANQEDDVACFTALYATYRTWITDVGI
                     ERSAHPLERLVRLYKADISPFRISGLRKVYPRPLLIKRADAYQLQRVKYNSAYRKKSE
                     LDKQLLLDLAESCTSSYSDVRRVAQGAQDSSLKVLLGGRPLVIPVVLDRLRKALEEND
                     HDRIKGAMYTLLFTTLIKTAIRDWRFAPDLMRLYIETASVDKASIQNLGSSALYPLFE
                     FGKPLERMIIFDRDVVEAIRPDEDCSATIKRRHAFIKERRTKVEAKKAALGLELTEKA
                     RDSHWKVANRCIVFALNCTLRFDSLGNPAFVDLIANGANDQHPSMRMNYLSAFSALFT
                     AIDMRAVYGHDYRNYLIEKEYDENKTQIAVPTDDPNVTEKFLAQFENYDDVNYFVDCD
                     HPGWLVWGKELTVCRADPKPFLAYDEVENRVREQIGKIITRDWFKKCFEYLKQEPRDA
                     GSDRFRMQNAVLLMNVFDLMHYGKTAATFEDVMELVKEVYGDGGDKHQHRATAEILGA
                     LLTGSVDDPKEIRDKVWKFAAPMMLKIIADDLTPDTLSYWVSCLHVIIDGKDPRRFRE
                     LIEALAAFRLDLNSNAAFKESAKLQLIDLIISDAGWHFRHEKPILEDCLAHIDHPYKA
                     VRESIGRLIASIFRTQYHESFKDVTTLLEQNKAESAIGVRAYRPSQQFADTIRDVFAR
                     IEKWRHERTPGQHTPSSYTSGSKTVLIWLDCMLTSQECIQLVPFFPDPFIDQLLHMMD
                     VKEDPELMKLAYHVYRHLPNIPFRSGEDDAFIAALIRVGKTATSWHQRLRALVNMQVV
                     YFRRLFLTQPAQRRMLFDAVGDMLTDPQLEVRDCASATLAGMIRCSPAKIRNPIIYQL
                     KERFERELRLNPMPKKKVPGTDTPVDAQRQIVRRHAAVLGLGALIEAFPYATPPPKWM
                     PEVLAGLATRAASDPGVVGKATKAILAEFKKTRQDSWSVDQKYFTSEQLEDLEGVLWK
                     SYFA"
     gene            complement(1522211..1523520)
                     /locus_tag="MYCTH_2306233"
                     /db_xref="GeneID:11513445"
     mRNA            complement(1522211..1523520)
                     /locus_tag="MYCTH_2306233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663922.1"
                     /db_xref="GeneID:11513445"
     CDS             complement(1522566..1523339)
                     /locus_tag="MYCTH_2306233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663970.1"
                     /db_xref="GeneID:11513445"
                     /db_xref="JGIDB:Spoth2_2306233"
                     /translation="MDSRAFRSHIRRFSCKPPGHDAARQRENQRRHRARVKSRIAELE
                     AALSDAQARLDEALQRIDALTTEVQRLRALSPSSLTAPQPADRARLGDAAAKSELPES
                     PGCCLCSQAAGSLTANAAPDSRDMFRTGRASNEVSTPQPKGQAETVDATAPPAMRSTE
                     PVITGGTRGAAEPAAEIDLEDLNDDCALLPAPGEGESTIPCREAYSIIKEWSASSEFD
                     LAVANEWLRPGFRRAIAPGTGCRVQTHILFAFVDHLTPG"
     gene            1523793..1524964
                     /locus_tag="MYCTH_2306234"
                     /db_xref="GeneID:11513446"
     mRNA            join(1523793..1524101,1524195..1524299,1524472..1524964)
                     /locus_tag="MYCTH_2306234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663923.1"
                     /db_xref="GeneID:11513446"
     CDS             join(1523907..1524101,1524195..1524299,1524472..1524909)
                     /locus_tag="MYCTH_2306234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663971.1"
                     /db_xref="GeneID:11513446"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2306234"
                     /translation="MDSAENLYDKVREHYSAASRGTSVKYSEAVAKSFGYSADELASI
                     PQAANLGLSCGNPLAIASLKEGETVLDFGCGAGFDVFLASKKVGPSGRAIGIDMNEDM
                     LARANQILASSRANDGGDNGNITFLKANITSGVPLPDGTADCIISNCVVNLVPHADKP
                     AVFAEMYRLLRPGARARARVALSDILAKRPLPERLRADLAMYVGCIAGAAQVAEYQAW
                     MEAAGFRGKISFSSCFLFIPTSPLFVL"
     gene            <1526570..>1527835
                     /locus_tag="MYCTH_53288"
                     /db_xref="GeneID:11513447"
     mRNA            join(<1526570..1527109,1527245..1527557,1527678..>1527835)
                     /locus_tag="MYCTH_53288"
                     /product="tyrosinase-like protein"
                     /transcript_id="XM_003663924.1"
                     /db_xref="GeneID:11513447"
     CDS             join(1526570..1527109,1527245..1527557,1527678..1527835)
                     /locus_tag="MYCTH_53288"
                     /codon_start=1
                     /product="tyrosinase-like protein"
                     /protein_id="XP_003663972.1"
                     /db_xref="GeneID:11513447"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Spoth2_53288"
                     /translation="MTGNDEGGGSSSSSSSGSGRGPDNNRVSVNNYSNKTKPAYPPAY
                     VPHASSCGKPKVRVEWKKLKESEKFAYLGAVKCLMDTKPVGVWSKATSIWDEMAWAHN
                     EAKWNIHETDNFLPWHRYYIYMLETLLSKHCSYRGPIPWWRETDDTGNLAGANLFSPN
                     YFGSLPPRTEDGKTTCITDGWFANTTVLLGPGAPTCLARGEDKRIAAEVTTAALDLCQ
                     GDRDTKYERHRRCVEATIHSSTHRAVGGAMESISASPSDPVFYLHHGFVDWQWARWQN
                     VESSRKTTISGCSEPSPVPGKCVELTLDTVLKGYGLIPDMKVRDVLDIENGILCYTYD
                     EF"
     gene            complement(1531922..1533599)
                     /locus_tag="MYCTH_2306242"
                     /db_xref="GeneID:11513448"
     mRNA            complement(1531922..1533599)
                     /locus_tag="MYCTH_2306242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663925.1"
                     /db_xref="GeneID:11513448"
     CDS             complement(1532011..1533339)
                     /locus_tag="MYCTH_2306242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663973.1"
                     /db_xref="GeneID:11513448"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Spoth2_2306242"
                     /translation="MDSMTPDVNMDGITLLSPAELNVLAMERFIYKRVDEDMVKYLAE
                     AAAGVIQCDSDMMPPPTQVSRRGYPTRAVRSTNTPLPSLEQFIWQLVDSSNVQVPTLM
                     STLVYLRRLKSRLQPMAKGLRCTTHRIFLASLILAAKYLNDSSPKNKHWAHYSVVSTK
                     DYIFGFSRTEVNLMEKQLLHLLDWDLRITEEDLCREFERFLAPLRIEIQDEHIEMQKE
                     QRRRRQKREQEMRERKLEEERLARQREREMEADLWRPLAQSQAAWVASREHTAYVTPP
                     SSRGTSRSRQATYTPSHSRGSSRDVSPPGLESSGSSYAGSTTSRATTPLSEADITTAH
                     QPSIFDGHEYGAGGVYDSPMDVQEVFDERPPSVPEKDVVYLQQQQSRGRMHHHHHHHH
                     HHQPQVAAKQPQMLPFEITADQLRDLEQSGRNASAKKFKEIFGRVFGTAR"
     gene            complement(1536679..1537362)
                     /locus_tag="MYCTH_2306243"
                     /db_xref="GeneID:11513449"
     mRNA            complement(1536679..1537362)
                     /locus_tag="MYCTH_2306243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663926.1"
                     /db_xref="GeneID:11513449"
     CDS             complement(1536817..1537227)
                     /locus_tag="MYCTH_2306243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663974.1"
                     /db_xref="GeneID:11513449"
                     /db_xref="JGIDB:Spoth2_2306243"
                     /translation="MPSRSWKRSAAPNPTTYRAQLAMFSVLATRFGSDVERSCRSGPY
                     RFVPSPPLLSRAMSPRQGRGKKDADEGWAVCLATRSLITVLCKTDDAGTGATRRRGVS
                     TDVIRRSLTAPSVNSGYFRCTIQGEGMLLKIATG"
     gene            complement(1540647..1542085)
                     /locus_tag="MYCTH_2306244"
                     /db_xref="GeneID:11513450"
     mRNA            complement(join(1540647..1541053,1541141..1541816,
                     1541885..1542085))
                     /locus_tag="MYCTH_2306244"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663927.1"
                     /db_xref="GeneID:11513450"
     CDS             complement(join(1540798..1541053,1541141..1541816,
                     1541885..1541921))
                     /locus_tag="MYCTH_2306244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663975.1"
                     /db_xref="GeneID:11513450"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2306244"
                     /translation="MENYQKLEKVGEGTYGVVYKARDLNNGGRIVALKKIRLEAEDEG
                     VPSTAIREISLLKEMRDPAIVRLYNIVHADGHKLYLVFEFLDLDLKKYMEALPVSEGG
                     RGKALPEGTGAQLQGMGLGAAMIKKFMRQLCSGVRYCHSHRILHRDLKPQNLLIDREG
                     NLKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGGRQYSTGVDMWSVGCIFAEMC
                     TRKPLFPGDSEIDEIFKIFRLLGTPTEDIWPGVTSYPDFKSSFPKWVRDHSVPLCANL
                     DEAGLDLLEMMLVYDPAGRISAKQACNHPYFEDLEPDPRTAQYNYH"
     gene            1542497..1544261
                     /locus_tag="MYCTH_2306246"
                     /db_xref="GeneID:11513451"
     mRNA            join(1542497..1543028,1543094..1544261)
                     /locus_tag="MYCTH_2306246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663928.1"
                     /db_xref="GeneID:11513451"
     CDS             join(1542755..1543028,1543094..1543971)
                     /locus_tag="MYCTH_2306246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663976.1"
                     /db_xref="GeneID:11513451"
                     /db_xref="JGIDB:Spoth2_2306246"
                     /translation="MTVDIKHLDAHEQPSEELRAKWKAVSRTEPKDVRSEDVDDLQDP
                     SSAAEFRVAGSISSEVLNRSFRHLCPGDTLEFQATKDVPIYYHPLLPGLLIIPSLVPP
                     EVQKILLRRLIHRDLSNPVHQTNLHLHFHLPYPEPVTGGGDADDVDGNNNNNDNDKDN
                     DKDISFFSYPPSSATSFSPKDPSVHKPLTIRQALERKLHWVTLGGQYDWTRRVYPESS
                     EAGGRSPPAFPADVAGFLETLFPETRAEAAIVNFYSPGDTMMMHRDVSEETDKGLVSL
                     SFGCDGLFMIAPNEEGEAVVVPGRNDGREEEEEKKKKKEFLLLRLRSGDAVYMTKESR
                     FAWHGVPKVLKGTCPDYLEDWPAEGGRYEEWRGWMRNKRINLNVRQMRD"
     gene            complement(<1544256..1546286)
                     /locus_tag="MYCTH_2306248"
                     /db_xref="GeneID:11513452"
     mRNA            complement(join(<1544256..1544988,1545074..1545177,
                     1545241..1545338,1545407..1545471,1545550..1545619,
                     1545691..1546286))
                     /locus_tag="MYCTH_2306248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663929.1"
                     /db_xref="GeneID:11513452"
     CDS             complement(join(<1544529..1544988,1545074..1545177,
                     1545241..1545338,1545407..1545471,1545550..1545619,
                     1545691..1545869))
                     /locus_tag="MYCTH_2306248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663977.1"
                     /db_xref="GeneID:11513452"
                     /db_xref="JGIDB:Spoth2_2306248"
                     /translation="MRLGQLATRAMLGGVSMPMLRVDVKTSPNPAGLFVRQSCDIGET
                     MCGGGCMPFGSDCCDEYGYGYSGYCEIGRYCTPEGGCCRNGKTCSGPPSGCDEGEELC
                     NDGCMPEGAVCCPNGGYCRPGEVCVGDNYCEAGSSGSSSGCDEGKITCDSDYCIPESG
                     TCCNMGLGEYCKAGYYCTNSGCCPNGRTCTGNGGGGSGDDGDDGDDDDGGDDSDFTTT
                     TSTDFELSTSAASFESTPTTTSQDDSDSDLEPTSTDSDVDSFPTDEPGPTTTETSSPT
                     DEPDSPPSSSSPGSGGDDGFTVPSAGAKSGLAVPGGCLALLIAGVMALL"
     gene            complement(1564040..1568179)
                     /locus_tag="MYCTH_2306252"
                     /db_xref="GeneID:11513453"
     mRNA            complement(join(1564040..1566686,1566738..1567091,
                     1567143..1567457,1567602..1568179))
                     /locus_tag="MYCTH_2306252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663930.1"
                     /db_xref="GeneID:11513453"
     CDS             complement(join(1564290..1566686,1566738..1567091,
                     1567143..1567457,1567602..1567724))
                     /locus_tag="MYCTH_2306252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663978.1"
                     /db_xref="GeneID:11513453"
                     /db_xref="InterPro:IPR015010"
                     /db_xref="JGIDB:Spoth2_2306252"
                     /translation="MAAPTTYDGVEGRYEGTLFNGIKFWVAQRVPIRSSIVGKIKDNG
                     GKVVLLEKHADVLIADHARKDCPLRSVSWKYIEDSVAKGELLNIENYRIHGTIEPRPA
                     GSTMPVKGTRVPFTQLDEQILVTWVRRAGVDTLGNKIYQKLAERYPHHTWQSWRDKWV
                     KKLSLLPEDQLPPVLEELPSPNPQPGGGIPSNATPSVAALPMAPAATPQPDVNPAPPP
                     RSDPVKRGRAVFTEEDDKLLIEYVTQRMRAGMLPGGNVIYQELEREHPQHTAQSYRSR
                     FLRYLSSRTPNNKPNHRMTETEPDSPSVQPVPASKPATEPPQPHTRPAVPTTPPVPRS
                     AAKSTTTSLPRNQATVDNRPPPSSSPSSSPPSPPPPPPPPQLSITRAVAHADNQRLKI
                     LEELRYRKQRILAARKIQHAWRAQRLRKKLRALLAISRFQARAQGFLVRRFLSIPIDQ
                     PEGSTSLLQTERVFSQKAPVTDEREPEQGQEGIEPSASQGEAEFSIFQQENESEAIHT
                     NVGEDTAPGLGTKITPVLAREEFWRNFNEYNMLNNITSSPWAQVGNHIVDFWDLWRCA
                     TAEPDHASRDWEVISENLGFDWIAEPHVPVHLKVAFEKHLLGFEEALREFEQWEDKDG
                     EEEEEEGEGEGEGEGEGEEVGEKGGYGERNEAQEEQRDCLPQEFEAGSAAEPDDNTVA
                     VSQTSDDFISSPPLVGLKRARLPSTSPFHSLVKKRPRYDQSSEIPETPETRAARAGQG
                     TAGAWAAATNQQTPTRPPRRPEPARQRIELETQLPPPPGQIEGADGSGPPTPSRQLLS
                     DVGAASSPVRPPRTASAAVSSAEPRLPSIEYDEEEDSDSSDAFESISNLPVAVGRSRP
                     LANSGGRPPPRSLPWPRDRGGDRGKQAATMPANTSSPHPWPAAAATTNIRILPPSSST
                     AGRTSSLTPQSVRRRTPINPAPIMNHFLSQRKYPPQLIARAIKATTCQFANAGAVLDS
                     LARGKGIPTNLPGVWTEEEDAALRGIEDWMDALRGRMPPPPPRLSAADAADSQGQPGG
                     GREDRVFWRLVIKHGRERVFGRREFLKVWERA"
     gene            1568861..1570337
                     /locus_tag="MYCTH_2306253"
                     /db_xref="GeneID:11513454"
     mRNA            join(1568861..1569006,1569119..1570337)
                     /locus_tag="MYCTH_2306253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663931.1"
                     /db_xref="GeneID:11513454"
     CDS             join(1568980..1569006,1569119..1570174)
                     /locus_tag="MYCTH_2306253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663979.1"
                     /db_xref="GeneID:11513454"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Spoth2_2306253"
                     /translation="MYDRHPTVLIFFLVLLVGGEALYLPAAWPQLSTLQKTTGSVAVF
                     LPYLFLYLSAASDPGTITEANHVPEMARYPYDFTLFHPGAVCATCRRLKPARSKHCSV
                     CRRCVARCDHHCIFINNCVGAGNHHWFLLLLLSTAVLTLYGGVVGVRLMTAQMRRRFP
                     SWALLPWRADGGRGMSITDWLVVWSWGMQDGGRGGGGGSGGVWLAAVTLLALMISPLV
                     WALLGYHLWLIYCGTTTNESMKWSDWQADMDDGLAWKRRLDPGRIKDLTVEPAWTRWP
                     VEAEQVLVRTNDGKPPTGEVLPGYGEWEGVWRLKDVENLYDLGFWDNLVDVFLPYFMF
                     RDPYVPVAENRLRRKKKRRARKIYLA"
     gene            complement(1570338..1571751)
                     /locus_tag="MYCTH_2306254"
                     /db_xref="GeneID:11513455"
     mRNA            complement(1570338..1571751)
                     /locus_tag="MYCTH_2306254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663932.1"
                     /db_xref="GeneID:11513455"
     CDS             complement(1570431..1571672)
                     /locus_tag="MYCTH_2306254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663980.1"
                     /db_xref="GeneID:11513455"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="JGIDB:Spoth2_2306254"
                     /translation="MATPKRISPTTLPANITRQIRRQFSSSPSQGFPSKYYPPSSKTN
                     PQKKRATLAEPRFPAISYLPSPSNDPQQHVVPSQLPSAASLQQASTVFTSQAPRFLYS
                     ASRFLHIPVNTHTPEVCLVGRSNVGKSTLINALAGADADTARKAHGLKARTAGLAITS
                     RVAGSTKSVNAYGFGPPSKAQRIAALERAREVKERLRIETGSRSERRAKRDLLEPPPQ
                     HRLIMVDLPGYGLGSEAEWGTEIQKYLARRQMLKGAVLLIDAVAGIKEADRMVLETLR
                     DAEVRTSVVLTKVDKLMRDTREERARSRVEEVCRSVWNELRRVEAGSATWLEGAEKGW
                     QREIWVTSAGDPDADGNGVGIVGARWEICRLAGLVEDKRVLNAPPPKPAAQKIVSFDQ
                     IQWMADSEANKARILPQRPSF"
     gene            1571870..1573096
                     /locus_tag="MYCTH_2306255"
                     /db_xref="GeneID:11513456"
     mRNA            join(1571870..1572637,1572765..1573096)
                     /locus_tag="MYCTH_2306255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663933.1"
                     /db_xref="GeneID:11513456"
     CDS             1572040..1572435
                     /locus_tag="MYCTH_2306255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663981.1"
                     /db_xref="GeneID:11513456"
                     /db_xref="JGIDB:Spoth2_2306255"
                     /translation="MAARLRSLYRSLLRELPPRPLLSNPRAPLHQRLRDNFQPSPSPS
                     TTTTTTTTTTGPTAAAAAELRAAQAEQFLAYLRAQRTYVTLLERYNPGMGMDDEERVR
                     LTARRVGMDLPVEYDGSAEDSVEGGEGKK"
     gene            complement(1573096..1577346)
                     /locus_tag="MYCTH_2306257"
                     /db_xref="GeneID:11513457"
     mRNA            complement(join(1573096..1576730,1576782..1577068,
                     1577138..1577346))
                     /locus_tag="MYCTH_2306257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663934.1"
                     /db_xref="GeneID:11513457"
     CDS             complement(1573378..1575591)
                     /locus_tag="MYCTH_2306257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663982.1"
                     /db_xref="GeneID:11513457"
                     /db_xref="JGIDB:Spoth2_2306257"
                     /translation="MLSPSAGKQPERQVLAPKALPTPPTGSRSSSSHRGMGVDPLSAP
                     NTPLPPLTKQAVITQTTDQFARGAIERFTAFARNEAAAADDAERVRLFAEFFVSESRI
                     RRERYGAAISAMGSEILDLTRDLFRPMAARRESSNSITSETVELTPQSSEPRSHRGSI
                     GSALGGNTPTSSQTPAPPSPATPANQNWQSSGYMPSLSPILSMSVSDALDEEDSRGRP
                     ASRWWESDSTGAPGGRLERSKRESKYMGVPKEAREALQWIDDTHPSPGDGSGKRDSFP
                     PEKTGWHDQDPAAPPQNFSRSSLASSSAPATPNPDHLDVSRLVTLPPPYPRHHPAVNN
                     NHPELAQTRAEVRAISDMKEIEVIKDAFEQDSAKMRAEAAEATKKRRQALRQHLQEQV
                     SSGTIGYAEAAAIEAEAKTEEHNQVRELERKDFDSFQTAVVMPVNEILQTRINAATNL
                     FQSLRSRLFDETHESNPNLPQEEGDEQPELLEKLTLLKWIFEARESLHRSLYDLLSDR
                     NDRYRDMVLVPYRLEGQNDKVASAEAFFAEDAAKRALAFAEEALRRTQEFRDVVEETV
                     VRGVEVQLNAFWDIAPPLKRLLDKIPADGADLEGFHIQIPAAEFAENPSYHEHPLQYL
                     YSLLLHAEKSTYQFIESQTNLLCLLHEVKEACVTAKAKVMELDGRDPARVEETKAEET
                     RRLTDDLKEKVRVVQDQWNSALGETVGIVKEGVGGYLLETGGWDESFEEGGVGGV"
     gene            1580215..1581987
                     /locus_tag="MYCTH_2306260"
                     /db_xref="GeneID:11513458"
     mRNA            join(1580215..1580327,1580540..1580833,1580952..1581034,
                     1581100..1581755,1581809..1581987)
                     /locus_tag="MYCTH_2306260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663935.1"
                     /db_xref="GeneID:11513458"
     CDS             join(1580611..1580833,1580952..1581034,1581100..1581755,
                     1581809..1581827)
                     /locus_tag="MYCTH_2306260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663983.1"
                     /db_xref="GeneID:11513458"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="JGIDB:Spoth2_2306260"
                     /translation="MVLHNPNNWHWVNKDASAWARQWFEDNLTKIEAKEGDVTAKITK
                     VISMIGDVEVAQRKGKVITIFDVKLTLEYTGSTPEDDDISGTITIPEVSHDLTEDEFV
                     FEIDIYSESKDKQPVKDLVRSKLVPQLRTEFLKLSPALIAEHGKDIQHAPGSNPSSGF
                     STPKYLPQTTSSAKPATTSSSKTTKTSIVNTTTVTDNEEFRTTAEELYQTFTDPQRIA
                     AFTRAPPKVFEGAKKGGKFELFGGNVSGEYLELEQPKKIVQSWRLDQWPAGHYSTLQI
                     EFDQNDVDKVTTMRVEWTGVPIGQEEVTRRNWLEYYVRSIKRTFGFGTIL"
     gene            complement(<1582920..>1584342)
                     /locus_tag="MYCTH_52463"
                     /db_xref="GeneID:11513459"
     mRNA            complement(join(<1582920..1583199,1583330..1583472,
                     1583610..1583848,1583942..1584111,1584194..>1584342))
                     /locus_tag="MYCTH_52463"
                     /product="polysaccharide lyase family 1 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663936.1"
                     /db_xref="GeneID:11513459"
     CDS             complement(join(1582920..1583199,1583330..1583472,
                     1583610..1583848,1583942..1584111,1584194..1584342))
                     /locus_tag="MYCTH_52463"
                     /EC_number="4.2.2.2"
                     /note="CAZy_ID 267802"
                     /codon_start=1
                     /product="polysaccharide lyase family 1 protein"
                     /protein_id="XP_003663984.1"
                     /db_xref="GeneID:11513459"
                     /db_xref="InterPro:IPR002022"
                     /db_xref="JGIDB:Spoth2_52463"
                     /translation="MKFLLTTTIAALAGLVAASPTPTVNIGGQLYKRASPNDVCDIGY
                     ASTNGGTTGGAGGTTTTVTSFAEFSAAAKGDDKKIIIVDGSISGSGSVKIGANTSVLG
                     KAGASLTGINLTIKGVKNVIVRNLKLSKVVGGDCITVQEATNVWLDHLDLSGDLNVDK
                     DYYDGLIDITHAADWVTVSNTHFHDHWKASLVGHSDSNADEDTGKLHVTYANNRWTNI
                     SSRTPSIRFGTGHIFNNYYDTITTSGVNTRMGAVVLVESSAFVNAKRAITSLDSDIDG
                     SAAVVDVDLGGSTNDAPVANAAPSIPYRYSVVGSANVRDATANSGATLAF"
     gene            1585577..1587048
                     /locus_tag="MYCTH_2306267"
                     /db_xref="GeneID:11513460"
     mRNA            join(1585577..1585939,1586020..1586077,1586161..1586333,
                     1586478..1586580,1586716..1587048)
                     /locus_tag="MYCTH_2306267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663937.1"
                     /db_xref="GeneID:11513460"
     CDS             join(1585847..1585939,1586020..1586077,1586161..1586333,
                     1586478..1586580,1586716..1586855)
                     /locus_tag="MYCTH_2306267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663985.1"
                     /db_xref="GeneID:11513460"
                     /db_xref="JGIDB:Spoth2_2306267"
                     /translation="MAKTLFRLVSFAAALSTVLGHAVVTVPTPRGAGPYYTQRCGETY
                     AVYMEKDKAGPIENGVAKAGSELGCNPFLCRGYQYEDNEAVEYEPGQVIDFHVDLIAG
                     HHPGYANVSIVDLEANKIIGDPLRSWDDYPNATATTPRSDIDFNVTIPNTLGTACSTG
                     GKCAIQWYWYASGNKQSYESCVDFYVKA"
     gene            complement(1609501..1609582)
                     /locus_tag="MYCTH_t127"
                     /db_xref="GeneID:11513461"
     tRNA            complement(1609501..1609582)
                     /locus_tag="MYCTH_t127"
                     /product="tRNA-Ser"
                     /note="Anticodon: CGA"
                     /anticodon=(pos:complement(1609546..1609548),aa:Ser,
                     seq:cga)
                     /db_xref="GeneID:11513461"
     gene            complement(1610084..>1612036)
                     /locus_tag="MYCTH_108294"
                     /db_xref="GeneID:11506440"
     mRNA            complement(join(1610084..1610328,1610413..1611225,
                     1611313..1611675,1611731..>1612036))
                     /locus_tag="MYCTH_108294"
                     /product="cytochrome P450-like protein"
                     /transcript_id="XM_003663938.1"
                     /db_xref="GeneID:11506440"
     CDS             complement(join(1610194..1610328,1610413..1611225,
                     1611313..1611675,1611731..1612036))
                     /locus_tag="MYCTH_108294"
                     /note="Cytochrome P450-like protein"
                     /codon_start=1
                     /product="cytochrome P450-like protein"
                     /protein_id="XP_003663986.1"
                     /db_xref="GeneID:11506440"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_108294"
                     /translation="MITDQIARVLSQHWPSILVTVVVAWLVRNRYHNGLNKYPGPFLA
                     SLTDWWRFFDVYGRRPERSHIALHKKYGPVVRLGPNALSFSDPEALKTIYGLNKGFIK
                     SDFYVVQQSVVKGHSLPSLFSTTDNDFHMQFRRCVNSAFAMSALVQYEPFVDNTTKLF
                     LKQTERLYIDKSEPCDFTRWLQFYAFDVIGEITYSKRHGFIERNEDVDGIVAYLTKLF
                     LYVAPVGQIPILDRFFLKNPIYLKLSEWGILDATFPVAKFARARMAERLPELEKGEPV
                     LPTSEKPTVKSPDLLSKFLAAREARPDFMTDTLVQTMAVSMAFAGSETTAISLSAVFY
                     FLLKNPPALERLRREIDDAAREGRFSDYETGLVTWQESQTLPYLDMCIKEAFRLHPAP
                     GLPMERVVPPGGIEIAGRRIEGGTIVGCSAWVIHRDPAIFGDDVDAYRPERWEVKGEG
                     DEARVKVMNGTMLQFGMGSRTCIGKNISLLEIYKLVPTMLRRFEIRFDDPNSEWEIVN
                     AWFVKQKNFITRFSLRDIVMPEKGVKAAEK"
     gene            complement(<1612307..>1613239)
                     /locus_tag="MYCTH_95166"
                     /db_xref="GeneID:11513462"
     mRNA            complement(join(<1612307..1612701,1612776..1612879,
                     1612950..>1613239))
                     /locus_tag="MYCTH_95166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663939.1"
                     /db_xref="GeneID:11513462"
     CDS             complement(join(1612307..1612701,1612776..1612879,
                     1612950..1613239))
                     /locus_tag="MYCTH_95166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663987.1"
                     /db_xref="GeneID:11513462"
                     /db_xref="JGIDB:Spoth2_95166"
                     /translation="MVCPAVMPCGGVQVTGLHELQRAICTPYVRVAQPQPAKNTGSQP
                     MDVETPEVGARLARAAKAWRARGQATGIPGLAVFAANWAARLDLTSADGILGGLSPWA
                     SSGTGNTIPTSPAQLSMPSTETRLRQWSGFPRSPRENSADAAVSSSTGTRQVFFAFRV
                     RKGGVGLGIITSTPRHKDPDPIVPLWGHAARLSFIDGMSTEEGTIVRDIRARGRCCPG
                     AVGRFRVALTDHVISSRSRGMPGSLVQDRQPGTGLLVKINDLPG"
     gene            complement(<1615961..>1616302)
                     /locus_tag="MYCTH_27318"
                     /db_xref="GeneID:11513463"
     mRNA            complement(<1615961..>1616302)
                     /locus_tag="MYCTH_27318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663940.1"
                     /db_xref="GeneID:11513463"
     CDS             complement(<1615961..>1616302)
                     /locus_tag="MYCTH_27318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663988.1"
                     /db_xref="GeneID:11513463"
                     /db_xref="JGIDB:Spoth2_27318"
                     /translation="TQPTVGNLSGTPVLFYPVPTPWPSAPGCEKYLYRALMETTMVAY
                     DPRAVVAGANPEASSCYVPQHSAWLGQNPNTTPSTALGPTFVCPEAWSAVHSTVLKSN
                     SAGETQFTYCCP"
     gene            complement(1617843..1621971)
                     /locus_tag="MYCTH_2306273"
                     /db_xref="GeneID:11513464"
     mRNA            complement(1617843..1621971)
                     /locus_tag="MYCTH_2306273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663941.1"
                     /db_xref="GeneID:11513464"
     CDS             complement(1617994..1621824)
                     /locus_tag="MYCTH_2306273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663989.1"
                     /db_xref="GeneID:11513464"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="JGIDB:Spoth2_2306273"
                     /translation="MTKLPGLVASGGLLLTTLGSVAADVYTPKHEAGRCAIRGHCGSK
                     SFFGSQLPCVDNGLAEEPDAKLRGQLVELCGPKWAQGPVCCTAEQVDALKSNLQTANQ
                     IISTCPACKDNFYNMFCTFTCSPDQSLFINVTKTMEKNGKTLVRELDQLISEEYGSGF
                     YNSCKDVKFGPTNSRAMDLIGGGAKNHAQLLKFLGQERFGGSPFQINFPTSYPEENMG
                     PLEMTPKKCNDEDPSFRCACIDCPQVCPKLPAVKEEGSCHVGALPCLSFASILTYGVA
                     LFVFLAAVVGRFVWTRHAKRRSERLRLLTDATPSDDEDEGYLTQNGAMFDRPRNAYIV
                     NTWCDAAFSRLGHTAARFPALTIATSTLVVLLLSFGWFHFEIEKDPARLWVSPTSEAA
                     QEKAFFDENFGPFYRTEKIFLVNDLNASAPGPVLSYDTLLWWIDVEASIRNLRGSKYG
                     STLQDLCLKPAGDACVVQSVAAYFHNDPEEVDRHGWKAKLRECADSPVGCRPEYGQPL
                     EPNMILGGYSESGDPADATAMTVTWVLNNYPEGSPEAARAMDWEEAMNNRLLALQDEA
                     KERNLRLSFSTEISLEEELNKSTNTDAKIIVISYIIMFLYASIALGSTTLSFRDLLRN
                     PAISFVESKFTLGVVGIVIVLMSITASIGLFSWAGLKATLIIVDVIPFIVLAVGVDNI
                     FLIVHEFERINISHPDDVVEVRISRALGRMGPSILFSAITETICFALGAFVGMPAVRN
                     FAIYAAGAVFINALLQVTMFVSVLTLSQIRVEDSRADCFPCVQVKSARIHLNGNGGSN
                     GARYYEVPAEGMLQQFVGKTYAPRLLKKKTKAAVIAAFLGVFAAAVALLPEVKLGLDQ
                     RVAIPDDSYLIPYFNDLYDYFDSGPPVYFVTREFNATQREQQQKICSRFTTCQQLSLT
                     NILEQERKREGVSYIASPTAGWLDDFFQWLNPDNEACCVDRRKPCFWRRDPPWNITMA
                     GMPEGDEFIYYLERFLTSPTNEDCPLAGQASYGSAVAVDSERSTIRASHFRTMHSPLR
                     SQDDFIKAYASARRIAHDISSSTGLSVFPYSVFYIFFDQYASIIRLTAALLGSAGAIV
                     FVVSSLLLGSVLTAAVVTATVAMALVDILGAMALMGVSLNAVSLVNLIICVGIAVEFC
                     AHVARAFMFPSRTFMERARNRFRGRDARAWTALANVGGSVFSGITITKVLGVAVLAFT
                     RSKIFEIYYFRVWVALVVFAATHALVFLPVALSLVGGEGYVDPESEGSLEEDLASRRY
                     RALMPEGESDSEED"
     gene            complement(1622633..1624268)
                     /locus_tag="MYCTH_2306274"
                     /db_xref="GeneID:11513465"
     mRNA            complement(join(1622633..1623944,1624093..1624268))
                     /locus_tag="MYCTH_2306274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663942.1"
                     /db_xref="GeneID:11513465"
     CDS             complement(join(1622757..1623944,1624093..1624161))
                     /locus_tag="MYCTH_2306274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663990.1"
                     /db_xref="GeneID:11513465"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="JGIDB:Spoth2_2306274"
                     /translation="MNEPRPPDDADGDVADQNRKRLLAEYGSVLDESLILSISNERDL
                     VKDYDEIKDVLSQLAEPARAEAASGFDPSGLSSVAEIEGLLLDETTTSGNGVDSSAEY
                     ATTISDFSDRSENQRLTEQTDLSEDEKMQELKLVFQDRWKDYKLKLVLKRYDGNLERA
                     FDELLNFQYLEEEGLLPKGIDGFFAPDDDGKPSNSGAGRAHKGNAKNKKKLVAVKYNV
                     VSSTVDDSELEGAKDFVAPTNSRGARAGRAPAAQPLAALPAPSVRPLQPPILPPPTNT
                     DFGASSLRSAAALRRMGPLGRQGAVVYTDRAREERNLLRAHLSRAAEAHVDQQSTATV
                     LDLHGVFVMDGVRITKQRVWAWWNSLGEDRKALAKREGFTVVTGVGKHSAGGVSRLRQ
                     AVGAYLKNDGWRVETLTGGFYVTGRI"
     gene            1626257..1628567
                     /locus_tag="MYCTH_2306275"
                     /db_xref="GeneID:11513466"
     mRNA            1626257..1628567
                     /locus_tag="MYCTH_2306275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663943.1"
                     /db_xref="GeneID:11513466"
     CDS             1626713..1628395
                     /locus_tag="MYCTH_2306275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663991.1"
                     /db_xref="GeneID:11513466"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Spoth2_2306275"
                     /translation="MEWFRFIREIVWHNSGFGSLRKIIPFIEDYEPWFEPQIIPLPAA
                     AESSNTDGNSSANGAGEDQEPAPSVVYPKARYYSVADYRELYLSGTLTPTDVAEALLP
                     LIRRDVDNPTEHSKAFFETRAEKVLAAAKASTRRYKEGRSLGPLDGVPTAVKDEYDVE
                     GYRTCLGSRNTYFSPEDHGTSWCVQKLEAAGALNLGKLSMHEFGLDTTGNNPIYGTPR
                     NPHNPTYYTGGSSSGTAYAVSAGLIPIGLGSDGGGSIRIPSSLCGVFGLKPTHGRLSF
                     RPGANHCISCACLGPIASDMSSLAAVFSVISVPDPSSPFPPLPTPLSLRLPRPDDPKI
                     LGIPSAWTARATPAIQALCNSLVHELVTSHGYTTVPIEIPFLREGQLAHAMTVLTDAA
                     TLLPPDKTRNLTPANRILLALGRVTPATDYTLAQKLRRLLMQHLAWLWQEHPGMLIIT
                     PTTACEGLPILDAAAEMRWGVNEGDRTMESMEYVWLANFCGLPSLSVPAGFVPGRKGT
                     ADVPVGLMATGEWCAEEQLLRFGRLLEEVGADRRRRPKVWVDVVAESKKRRT"
     gene            <1629508..>1630057
                     /locus_tag="MYCTH_2127797"
                     /db_xref="GeneID:11513467"
     mRNA            join(<1629508..1629836,1629904..>1630057)
                     /locus_tag="MYCTH_2127797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663944.1"
                     /db_xref="GeneID:11513467"
     CDS             join(1629508..1629836,1629904..1630057)
                     /locus_tag="MYCTH_2127797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663992.1"
                     /db_xref="GeneID:11513467"
                     /db_xref="JGIDB:Spoth2_2127797"
                     /translation="MFLTCTKLGEKHSAEQARREFRRWSLAAKLSILIPAHVMEALWR
                     LRECTQECQGPRGCPPDLDHSTSDRAAPQAGLILPLLNKEKTPSWQSVPVSPSKAVPK
                     NYFQPTPFITDHSYLIARIGGSSSTVRSCRSPPPDAVDPITPNAPANSVRHSSSFMAS
                     "
     gene            1630149..1633602
                     /locus_tag="MYCTH_2306276"
                     /db_xref="GeneID:11513468"
     mRNA            join(1630149..1630384,1630595..1633153,1633210..1633602)
                     /locus_tag="MYCTH_2306276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663945.1"
                     /db_xref="GeneID:11513468"
     CDS             join(1630706..1633153,1633210..1633461)
                     /locus_tag="MYCTH_2306276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663993.1"
                     /db_xref="GeneID:11513468"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="JGIDB:Spoth2_2306276"
                     /translation="MYGDDEDSGAEDNRPLSFIAAKYGGEHLDKALEPDQPVGDRLRL
                     MRATSDQTSATTHLSPTDANGLNGGGLRKAQTLPAPLSTDRGSSSDRPKSPLPQLSPN
                     PSLRDVQNAEASQYPLNGMDNADDIAQELSNLQALRRMSMDVGNTTDPDLLQFSGVSL
                     VEMPSIAPKGDDDEADPSRLLWVPARVHPELEPTAFKNFLEKRVQTLKRRSGESLLSA
                     DGLQGNNSGSLRRKKSMLSRQVNTNSDSGEGNNDGTEGLGRQRSLHEHAAELSLSELV
                     SDPTKVVQKLAQDTRQENGETDSPILPMAPGMGLRRSTKTTYRKGGSQRYGDRAPFSK
                     RLAARQSGNETKEEPPPVPALDPSIGKPLTRVQSEPITENYSRPTRTVRRQQNFSREA
                     PASISSPTAVADEPAIGEDASPATTTSPPKTQALPVRSSSTSAVHSPAVPVPQIVETP
                     PADESSQPTQPPPEKFSPPQKASLQSHPEQSPVDSPTRSTKRPALTKSSVSVSAARSN
                     SVKEQGSSAQNPLAEINQPQALPGSSNTTTSSLTFIPTFDSIEKKFDKKSKEKDDNES
                     IASHKSTSSWKWFKSEDKEKKKREKEKEKEREREREREREEQARKAKARSGDKTHDHA
                     RMDVLQSSIDNVAKGRESLRLDRDSLEGIPQEERKKETNRKASEGKKEKEGFFGGLFG
                     VSKKNRDKESSHKKKEHRPLTPDPPPRPLRPDIDYPWTRFPIIEERAIYRMAHIKLAN
                     PRRPLHSQVLLSNFMYSYLAKVQAMHPQLQIPTSPQQKRQEEERKRREAEEAQLRMEQ
                     QMAQQAVQDGSFDFEYHRSGSNYGDAPVQHDYVDDAQIYDYDHGDHPQNGGDWDADAQ
                     AQGHGRGHVRQASGSGSGQQDSYYYAQGSNRRPDNDDENSDMW"
     gene            1634866..1637679
                     /locus_tag="MYCTH_2306279"
                     /db_xref="GeneID:11513469"
     mRNA            join(1634866..1635207,1635402..1635561,1635623..1635734,
                     1635789..1637679)
                     /locus_tag="MYCTH_2306279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663946.1"
                     /db_xref="GeneID:11513469"
     CDS             join(1635199..1635207,1635402..1635561,1635623..1635734,
                     1635789..1637556)
                     /locus_tag="MYCTH_2306279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663994.1"
                     /db_xref="GeneID:11513469"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2306279"
                     /translation="MASQPRQNPYNQGYMPNGAAPPHQTAPVPGATPLLPNHGRIIQT
                     GPIRILCIADVRGNLRSLNELARSARADYIIHTGDFGFYDETSLERIAEKTLKHVAQY
                     SPLISETTKKAIAQGVQGSVKSRFPASELPLSELPQLLSGELKLDVPVYTVWGACEDV
                     RVLEKFRSKEYKVPNLYIIDEAQSMLLEVGGVKLRLLGLGGAVVMHKLFDNGEGRTTI
                     AGGQGTMWTTLLQMGELVDTANRVYDPTETRIFITHASPAREGILNQLSVTLKADFSI
                     SAGLHFRYGSSYNEFSVNPTLDHYRGKLAASKASFNDVWETVKGEVEPAISQVEAQQT
                     LLKNALAVVEKMPSTAAGGNPFGGAPAGQSAAALGQVDESAFKNLWNFNLADATFGWL
                     VLEIQDGRIGTEMRAQGFNFSHRGAKQQPNVQPAPGPSGAGTSPAAPTGPSAPPAATP
                     AAQPKAPTPAQQPKPSAPTPAPAQSKPATPQPAPATSPALKEQKAAPAAANGAAASSE
                     TAPAPASKTPADNIIGLFIMNAQSDEQVRDLFAEEDKAKIVKIDRWGANNKVAQFKTT
                     EDRDAAMERLPDEVKNRAPGQEDRSKPLVKIFSPPPRQFSRGGAGNWGSSRGGRDGGN
                     SQSGYRSAGGGGASDSEGAGRRGGRGGRGRGGERGRGRGPRGGGAKGEGAGSAPSADS
                     "
     gene            complement(1638583..1640015)
                     /locus_tag="MYCTH_2306283"
                     /db_xref="GeneID:11513470"
     mRNA            complement(join(1638583..1639494,1639603..1640015))
                     /locus_tag="MYCTH_2306283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663947.1"
                     /db_xref="GeneID:11513470"
     CDS             complement(join(1638714..1639494,1639603..1639910))
                     /locus_tag="MYCTH_2306283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663995.1"
                     /db_xref="GeneID:11513470"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="JGIDB:Spoth2_2306283"
                     /translation="MAARTALRRALRPVRNAVTHPAQQVHFTRPFSTTVPSLAASSSP
                     SSATPEYAIPDPSRPTHFGFQTVTEGEKRERVAGVFTSVAESYDRMNDLMSFGWHRVW
                     KDHFVASLNPGFSPLTSDGDPRGPQHILDVAGGTGDIAFRMLHTAHVLNGNPSVRVTM
                     SDINRAMLTVGKQRSAQLPASQRAALSFVEANAEDLSRTRPLHPYPSPSEPTTHDSQT
                     QKPEQAFFDPATATGSIPDSSVDLYTVAFGIRNFSNIPAALREARRVLKPGGVFACLE
                     FSKADKHPLFNSLYKEWSFRAIPLIGQLVAADRDSYQYLVESIERFPSQTEFRDMIVD
                     AGFVVAGEGYEDLTGGVAAIHKGMKPRD"
     gene            complement(<1640575..>1642048)
                     /locus_tag="MYCTH_95158"
                     /db_xref="GeneID:11513471"
     mRNA            complement(join(<1640575..1641348,1641407..>1642048))
                     /locus_tag="MYCTH_95158"
                     /product="dehydrogenase-like protein"
                     /transcript_id="XM_003663948.1"
                     /db_xref="GeneID:11513471"
     CDS             complement(join(1640575..1641348,1641407..1642048))
                     /locus_tag="MYCTH_95158"
                     /note="Dehydrogenase-like protein"
                     /codon_start=1
                     /product="dehydrogenase-like protein"
                     /protein_id="XP_003663996.1"
                     /db_xref="GeneID:11513471"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="JGIDB:Spoth2_95158"
                     /translation="MKGIRLSRPHGPLLRRGGARLCPSVRPAPLLAPPLGALADHQQR
                     LQHRRDASSLSQRLDSKHVMFPGAVKSAFSNTMRFEQPADYPALPTYRVVDQHGVVVD
                     PDFKPDLSDEEVIKLYRDMLTVSIMDVIMFEAQRQGRLSFYMVSAGEEAVSVGSASAL
                     TKDDVVFCQYREQGVFKQRGFALADFMNQLFANHKDPGKGRNMPVHYGSRELNIHTIS
                     SPLATQLPQASGAAYALKIQRMQDPSTPPRVVVAYFGEGAASEGDFHAALNIAATRSC
                     PVIFICRNNGYAISTPTLEQYRGDGIASRGIGYGIETIRVDGNDFWAVREVTKKAREL
                     ALQDGGRPVLIEAMTYRVSHHSTSDDSFAYRARVEVEDWKRRDNPIARLRKWMEAKGC
                     WDENKEKEARESIRRDVLKAFSEAEREKKPPLRTMFEDVYEELTPDLKQQMKELKSQL
                     ERYPDEYELEQFLGGKESLDK"
     gene            1643119..1644294
                     /locus_tag="MYCTH_2306286"
                     /db_xref="GeneID:11513472"
     mRNA            join(1643119..1643372,1643448..1643555,1643628..1643714,
                     1643819..1644294)
                     /locus_tag="MYCTH_2306286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663949.1"
                     /db_xref="GeneID:11513472"
     CDS             join(1643177..1643372,1643448..1643555,1643628..1643714,
                     1643819..1644060)
                     /locus_tag="MYCTH_2306286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663997.1"
                     /db_xref="GeneID:11513472"
                     /db_xref="JGIDB:Spoth2_2306286"
                     /translation="MSFRVTTRLPRIYQSFPTKLFRVNFGGPDVVLRPWKFASALFDI
                     KTDREGYVYSRAEDVDAGTYLGPNGAIMRPNSPMLHAVLTKHWMHRDEGAVIYEIEQG
                     TEVTQGLTLVHERSDVFSLQPDTRMLLSEFNKVVTQFLQTNGRVYTKKQFLEAYPRPI
                     KIEGAHIVRSIINPGQNNEAAKRSIERPKKRWRRDYEGRYAFGAFKGPKF"
     gene            <1665589..>1665741
                     /locus_tag="MYCTH_2028839"
                     /db_xref="GeneID:11513473"
     mRNA            <1665589..>1665741
                     /locus_tag="MYCTH_2028839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663950.1"
                     /db_xref="GeneID:11513473"
     CDS             <1665589..>1665741
                     /locus_tag="MYCTH_2028839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663998.1"
                     /db_xref="GeneID:11513473"
                     /db_xref="JGIDB:Spoth2_2028839"
                     /translation="LEENLRRGHICLSISLAGYLILFVPKKDRKLRLYVNYRQLNEQT
                     MKNRYLL"
     gene            1713175..1719615
                     /locus_tag="MYCTH_2306290"
                     /db_xref="GeneID:11513474"
     mRNA            join(1713175..1713653,1713746..1713843,1713905..1718875,
                     1718935..1719084,1719157..1719615)
                     /locus_tag="MYCTH_2306290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663951.1"
                     /db_xref="GeneID:11513474"
     CDS             join(1713316..1713653,1713746..1713843,1713905..1718875,
                     1718935..1719084,1719157..1719353)
                     /locus_tag="MYCTH_2306290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003663999.1"
                     /db_xref="GeneID:11513474"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="JGIDB:Spoth2_2306290"
                     /translation="MSSRVTRSSARQAASQRAASANPTTTAGAPSSAPAPPPPIPPTP
                     TPAPSGRKRKNHTSPPQVAIESPSSTRRSKRQRVTQALPHPQPSPASAATPSSSRRRK
                     GKAPATMSSPGSPTSPASHLDNPTSASSSRRSSRNKKSASTAKDDPTAPATSSNRRSK
                     RTAHNDAAPQDQDVVMGGTEEHQKASVAPPPPPPPPEDRVPEDSEENDEDEEGLRRYD
                     DDDDDEDADPFSGFGGPGGSVPGLSNTLRTLTGMVSGTSARLRDILNNLRQKGDPTMQ
                     LIALQELSELLLIHNEDTLSGHFSPDAFVKELVALMQPNELTGEENPEIMLLACRCLA
                     NLMEALPATTSNVVYGHAVPILCQKLLEISFIDLAEQALSTLEKISLEYPSTIVREGG
                     LTACLSYLEFFATSTQRVAVTTAANCCQNLDLESFPVVRDVMPILLNVLGSSDQKVVE
                     KGSLCVTRIVESFRFHPSKLEELISVDLLRGILRLLLPGSTNLIGDHIHTQFLRVLAI
                     AARASPRLSAELFKMNVVETLYQILTGVSPPSGTDDLASKLDSVLIMQALIHRPRDQI
                     IETLNVICELLPNLPRSADPALVGLPEVGSSPESVSATSSGSRKKTSNEKRIELLEDC
                     KEEVRRFSMILFPTLTDAYSSTVNLTVRQKVLMSQLKMLSNLDQAILVEALKPVSYAS
                     FLASIISQQDHPSLVLSAVGAADLLMRRLGSVYRYQLYREGVISEITKLASQDLEPEA
                     KLSTNGSPSPDPETAEPETEPEPESNRSSAEPADDRSDHAESESEDDEGENGEAEEED
                     EDRSHHSSDDDEDDEGQEHDNEDDQNRDDLSASPFSSEGSTMSISGPPGRLISDLPSM
                     KARIIANAKRFLEIHENEKESKAMKKKATEILDNLSALASDIENFYLRRAFPSQLALE
                     SGTELFRKLASYFDSDLLESVTSAELLASGVVRVLEEVLSNPDEQLAVAAQTAFLQVF
                     MGYTVKSKPKTATADSPATPLSVLIHKLQDLLSRSEHFEVITVHHQSFDSNRSSAASM
                     LAKQLRLKLVADEDSDIPRHYRNIMVSIHAITTFKSLDDYLRPRISLSDRPRGSKRDA
                     VSRALAAMASSGLPMSAAAARLMERSFPPSSGSNSTPPPPPPAAASSHSPTPRSARKS
                     KSRSDPPNDSPATPEPSSSREKTSLRRSSRRQAVSDGDTPAHPLPAAEDKFENSLECA
                     DERQLSDDEEMGDDGALDMVGDVDEGMEDAPTPDPSAVNLEVAGGKVTARKEDGTKVP
                     TPSQSQSRPTAALPNRSSALTSATASPTPAASSRPMSYAAAIQSVPQDWHIEFSIDGK
                     VVPNDTTIYRAVHSFAKNTDDQYGRNIWSTVHPIKFRRVPGAPPAESAAFGSTAENGS
                     DAEEGGTPGSLSKSPVTASILRLLKKLHDLNANIDDVLAENKETLRVNVEPLSQFVNT
                     KLTAKLNRQLEEPLIVASNCLPSWSEDLARLYPFLFPFETRHLFLQSTSFGYARSMSR
                     WQNAQSQEEARRDRRDERPFLGRLQRQKVRISRSKILESAVKVMELYGASQSILEVEY
                     FDEVGTGLGPTLEFYSTVSKEFCKKKLKLWRDNDPNGHDEYVSATNGLFPRPLSDEFA
                     ASEEGEKILQLFKILGKFVARSMIDSRIIDINFNPIFFRIGDESAAVRPSLGAIKSVD
                     PVVAKSLMVVKKFVSAKKAIEEDPNRSAAQKVIDIENIVIDKIRIDDLYLDFTLPGYP
                     EIELIPNGAQTQVTIDNVDLYLEKVIDMTLGSGVRRQIDAFRAGFSQVFPYSALSAFT
                     PDELCSLFGRVDEDWSLETLMDSVKADHGYNMDSKTVRNLLQAMSEFTPAQRRDFLQF
                     TTGSPKLPIGGFKKLTPMFTVVCKPSEAPYTSDDYLPSVMTCVNYLKLPDYSSIDVLR
                     EKLFTAIKEGQGAFHLS"
     gene            1720810..1724346
                     /locus_tag="MYCTH_2306295"
                     /db_xref="GeneID:11513475"
     mRNA            1720810..1724346
                     /locus_tag="MYCTH_2306295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663952.1"
                     /db_xref="GeneID:11513475"
     CDS             1720929..1724156
                     /locus_tag="MYCTH_2306295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664000.1"
                     /db_xref="GeneID:11513475"
                     /db_xref="JGIDB:Spoth2_2306295"
                     /translation="MPPRRNPRRSAGAPDTKSNPATLTTNDSATPAEDATSATTSRTT
                     QATKTKRYESTPVPQQITFPARRKIVRKYGGRRSLPARLEEETATASRRSLKQQTLTQ
                     IDYVRSSSGFEQGDLLEDEVIGGPHEEKKGLKSKGEAEAASVAGRRKTADPRSKRRKT
                     MGDMPTPNLEKKGPSFQTQTLTQLLGNRVPEMDRDELRVEDEAESAGLPSSGGGPSVK
                     HSAPPEKGKGKALATPIPHTPTGKRIKVNLDEVPSSQPTPFTPLLGHSPIPPARSPLT
                     QKSTNVDAPLPTIETVSKLPRSLVIQDSYSMDGSSAGYLSSTAGDTPVKRERGETPSQ
                     IPKREPLAEIPVASLELGVSSTPSGETPTTRRKRLFTEIPDSDDELESLGSTPFKTRS
                     TQQTPLRRDPVVDNFEIAADPSLPPSQSSREPRAAVTETPASSSRSNKENESPAIKMW
                     EDEDAAGEGDDGGSPTPKGAKRSQTADRAGQVSPNTASQFWTASAENVGCVGTRRGTS
                     REPLTELVVAEDPTVFRSERPSAAPRASRFHGSMGESSCRGRHATPQLGDSEETASEA
                     EEEPMPVSILRKATSQGVPRADGTTKRKSTPEPNGPESSTSEPPGTPTPIVRKVQIEM
                     PQSSGEEVCKETPREPHGSSPIYQRHTQSRSQARSQFYSQALESQRVPLEVIRSLSPQ
                     TDRSDILISIDAKTVEDIVNGIRDHVFRNYRFPVQASRCWIFTELPVGEVKYMATLGP
                     AQEPGQIDSHSGRGNTEFNRGTLGYKFAHKLLQVYQLNNPVPLAEMEDNGLGAGPPQR
                     YKYVPPAIVGQLLMNLRCPLFAEGDFEDEGEETGDKETEEEEGGEMTISQELADQIRS
                     DIIHSTQLMSSERRRQQHRDDEYLIPASQSPTEKRSVALKASAPAAAETAAAAMPPPH
                     SSQQLRVRRQPRSPGQTRRQPTTTTGQASTSNGNDGDARRYVPPSQATTASDVSASPS
                     QAPSPSFPPARSSSSSSSSDLAYSVPRPPLPDSGELSLLPELPRYDRDRSGGGGGTGL
                     LLHLSSSQVGVLPPDSLLVDEGQAPPPPVEVWDSEEEEEEEEEVE"
     gene            1725046..1729772
                     /locus_tag="MYCTH_2306297"
                     /db_xref="GeneID:11513476"
     mRNA            join(1725046..1725237,1725331..1727312,1727369..1728495,
                     1728567..1729772)
                     /locus_tag="MYCTH_2306297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663953.1"
                     /db_xref="GeneID:11513476"
     CDS             join(1725141..1725237,1725331..1727312,1727369..1728495,
                     1728567..1729629)
                     /locus_tag="MYCTH_2306297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664001.1"
                     /db_xref="GeneID:11513476"
                     /db_xref="JGIDB:Spoth2_2306297"
                     /translation="MNGREVNRAEIFEDEKRRIIESCFAKRDEDGSVIETYITHIRIT
                     EYQTSPSSPPPPSARAPQYEKPRVIIVAVRKSGRVRVHKSKENPNGTFSIGKTWFLDD
                     LSAIESFTSPTVNPNAQQWAGDVGFVVTLGKPYYWEAQTDKEKKFFIASLIKIYNKYT
                     GGRNPTLTGFEQRELEQVLGGAQVSRRQERPPPRPSAPDSAASSAGPAGSSGYNPPHG
                     GQGMPAPGISARVPSRSALGPSGKSSPAQSIDTGRPSQEQQSLLRLATSNKSQESIAA
                     STITRSDDGASLRPSTRDGANGASPYGTPEQTLQSVTEDKPPARKRPPMDPLRPLQVD
                     KNLIPAPLMSPGMRREPTVPPRNVERVSPRKDSISRKNEPAPAPAPAPAPAPAPAPAP
                     RAEQVTTPQETTRPDLPAGSPIAAVSTPPSAPPPTTAISPVPTPPADNTPPQPPPEPQ
                     EETKPGLGPMIKKRSRGEIAGALRKAANAASAFKPRPGGAAERLLLSQNKPSDGPDGI
                     TSVVPAPPRPAQKPPEPAPGVEPPPKAADRNAAPGIPEVKVTESDSATTSSKAQSSGG
                     KEAEDKKAAEASAEEEGPRRSVVAGNDTKYLTTLGIDPSLLDNRANEFAKWLDYFGWV
                     PGEKMRSRTFEEMRADLDRELSKAQAGGWLARFQEGDERVEAIKRGIDLAISECDELD
                     NLLTLYSVELSTLSDDIAYIEAQGQGLQVQAANQKLLKKELESLLETCAIGESDLAAL
                     KTAPLETASGVEDIEAALVTLFKAMIKIDPTLGNNESRKSDDLNGDQSLGLDSDYGKM
                     RIVQEKRETYLSESSQFMRRLVIFMERQFSEAFRQTKAALDGALSKKADARNHEPGRD
                     LLWMYSPLILYARDVDLANWDRILQIYEDKGHPVYKTEFRDAVEAWKKNVRKVTGDES
                     ELLFTSQQEKKEEGLATTARKLTVKRSQTLARSLRSPLGDGSRTNLAADKTPDGRALP
                     YEVFAGVLDDLLPLVEMEQNFIVDLFHATTLEQSDFPELVAASRPQDRRGGDLKRHRL
                     MEPDRDLARRVTKAMESIFSFLESSLQQLMDWVLSMDPLQGVGVLATLERKMADMSQS
                     NQDFLNNILQKLHGNLEAKFRKFVDDQVRAIEETKVKIKKRKGVIHFIRIFPHFTTAV
                     ENMLANVDPSLPIRRMVDREYDRLLKSMFDSLKVIARENPAPGTGPATALSSAHPSAA
                     AADPEDKEALNFHILLIENMNHFLEEVDNPRHLEVLDDWREAAQRELAEHMGLYINAV
                     VRRPLGKLLEHLENIEAQLQAGGKSPAAVAAQPSNSKAVFNKILSGYDGREVRKGIEA
                     LRKRVEKHFGDEDAVGIGGGGGVGQGGSGSLGVGGAGGGAGGGGISGTNNTLVARVTK
                     ECEKFYGEVEMRIGRVTTDVYGGDVLFEWPRAEVRAAFSSLGAR"
     gene            complement(<1730209..>1731258)
                     /locus_tag="MYCTH_2111026"
                     /db_xref="GeneID:11513477"
     mRNA            complement(<1730209..>1731258)
                     /locus_tag="MYCTH_2111026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663954.1"
                     /db_xref="GeneID:11513477"
     CDS             complement(1730209..1731258)
                     /locus_tag="MYCTH_2111026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664002.1"
                     /db_xref="GeneID:11513477"
                     /db_xref="JGIDB:Spoth2_2111026"
                     /translation="MVTLGSFCRRPLDRVRSNAPDNGSTLEGHGASDLDGTITAHDPS
                     DLTHHAGPVGQQAESLPDETASWPRSRPDATDLHLTFESNTRHEGDLAASGIAALESP
                     RAGDHSEAGYRCPSKCACTEFYYDADDERDEEDEDGDDDEDEVYDQPAVVIIHQGASG
                     AIPLSSRPALLHNPNNALIFASFASRHDSPASSTLRAWFDLPSPGASACATPSVVAAS
                     RDEEVRIGIDDDDASASSTADDRSALTYYTDTAYGDYDDNDNDDDEEHVFRWRGDLVT
                     AAELADAAAVVELELEMGLLADGLARRLLQGSSSGGGDSSWSLSSWSLSGGFDESQSG
                     GSGSSDADSVWDADG"
     gene            complement(1731512..1733506)
                     /locus_tag="MYCTH_2306298"
                     /db_xref="GeneID:11513478"
     mRNA            complement(join(1731512..1733289,1733382..1733424,
                     1733473..1733506))
                     /locus_tag="MYCTH_2306298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663955.1"
                     /db_xref="GeneID:11513478"
     CDS             complement(join(1731784..1733289,1733382..1733411))
                     /locus_tag="MYCTH_2306298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664003.1"
                     /db_xref="GeneID:11513478"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="JGIDB:Spoth2_2306298"
                     /translation="MGTAIRVLPSRAARAVNLLRTVQYTHPPSCPCHANPGHHHHAGP
                     SASAAAATTVSRFADRASSAARGGRRGYATPRDAAQQKEYAFEMAASSIRFGPGVTRE
                     VGMDLRNMGAKRVCVVTDPTVDRLEAMRQVREALDGEGVEYRVYSGVRVEPKDYSVKE
                     AVEWARGYAPDAFLAVGGGSVMDTAKLMNLYTCYPEADFMDFVNAPLGKGRPVDRKLL
                     PLVAMPTTAGTGSETTGTAIFDLASRRAKTGVAHRNLKPTLGICDPLNTRTMPAAVRA
                     SSGLDVLCHALESWTAIPFNERTPRPANPILRPAYQGANPISDIFSLNALRQTVKYLP
                     RSVRDPDDMEAQTEMLLASTLAGVGFGNAGVHLCHGMSYPISGQNPGYRHAGYEVDAP
                     LIPHGVSVAVSAPAVFRFTAPSNPERHLAAAEVFGVDVSNVKRESAGEVLADALTRFL
                     ADLGDQPAGLRHLGFTRDHIDDLVEGTIPQARVLSLAPGLAKELEQERDQLRRLFEDA
                     LEH"
     gene            complement(1733820..1737703)
                     /locus_tag="MYCTH_2306300"
                     /db_xref="GeneID:11513479"
     mRNA            complement(1733820..1737703)
                     /locus_tag="MYCTH_2306300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663956.1"
                     /db_xref="GeneID:11513479"
     CDS             complement(1734170..1737361)
                     /locus_tag="MYCTH_2306300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664004.1"
                     /db_xref="GeneID:11513479"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="JGIDB:Spoth2_2306300"
                     /translation="MQLKDDAATGGIAPVPETSAVPDVLDKTPLGSISGPTYATGQLL
                     VQQTAYKLSDKIFSFSPETFDLDLAVREWSRADEKNIHGETTTVVPLQTRAGAGTFAL
                     GYIFSRDFDLSKRHIPQTLLAPSLSLRHLRATLDQLSLLYGVASPFVAHIAAADYSAR
                     DGLVADYESALQIAEDLGLGLVASASAYEAQHMSLLATLLASLLPTLHTYDGLRTARE
                     TLKVVDALSEGAIAETYKKLARQVGLLNKRLDTAGKVVELLRLFNAELGTSYAPFEYH
                     GHESAESVLVVFGSAEAQLAKQVVDALAARGEKVGAVNVRIYRPFIEEAFLEALPESV
                     RRIAVLGQVRDAVAVGDASVQSALHSDVLTAVSFADRPREPVVVDVKYAASTVHTPSS
                     IATIIHQLTAKEDGQGEVSLVLHALEQARQYTFWDVDDSSAVGAPAALGKLLAREAPS
                     HVYVHETYDNLIQGGAVRTDIRITEKPVEAPFAVEEADVVFVGEEKLLKDVDIVKGSK
                     RGGKLVLRLPNFKEEDLEKRIPASARKQVREKGLGLLVLDSSLSPALEKKDAELLLAQ
                     LAFLKVTQPELTVAELSKFGQLGRDKAALAELADALRQALKAVEVPAAWAEVSEAPAA
                     PLRALKPTSFAPFEKDEQEPAVKLDSWQEAAKGLVFKEAYGTRTELRPDLTVKTSTVR
                     VKENRRLTPPEYDRNIFHIEFDLGDSGLTYNIGEALGIHADNDPRQVLEFIKFYGLDA
                     DDLVQVPSREDAAVLETRTVYQSLVQNLDILGKPPKRFFEALAGFATDEAEKKKLEFL
                     GGKEGAEEFKRLSEVDTVTYVDVLQMFRSAHPAFADLARIVAPLKRREYSIASAQAVT
                     PGSLSLMIVAVGWVDTRGRTRHGQATRYLSGLEPGAAVTVSVKPSVMKLPARDTAPLI
                     MAGLGTGLAPFRAFVQYRAMQKAQGKEIGSILLYLGSRHQREEYLYGEEWEAYLDAGV
                     ITLLGAAFSRDQPQKIYIQDRMRQTMADIVKAYIKEEGSFYLCGPTWPVPDVTAVLEE
                     AIAAEAEQSGRKVDPRKEIERLKEDGRYVLEVY"
     gene            <1739614..>1743285
                     /locus_tag="MYCTH_102797"
                     /db_xref="GeneID:11513480"
     mRNA            <1739614..>1743285
                     /locus_tag="MYCTH_102797"
                     /product="ATPase, P type cation/copper-transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003663957.1"
                     /db_xref="GeneID:11513480"
     CDS             1739614..1743285
                     /locus_tag="MYCTH_102797"
                     /codon_start=1
                     /product="ATPase, P type cation/copper-transporter"
                     /protein_id="XP_003664005.1"
                     /db_xref="GeneID:11513480"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_102797"
                     /translation="MAPPSSRRPVAAGPSETVSTSFLLANLHCPTCVSTIKSALHGSC
                     GSLVKWVSPNVVTSVVTVEHAPDASLRQMRQALEESGFEVCGITTSSGTISDSDLETG
                     EFQPNGESSDSRFSNSTNDMGLPVSGLARWFRPVPSQASPSEKSRAHLENCEQCRSTV
                     GTLTDEKAVLNIVSQHTTTPSTPITSLAPLPTTSSSPFIAIGGDKDQPSLWRVSLAVG
                     GMTCSACANMITEGLKKNDWVANVVVNLVGNSAVVDVKERDKADELVQVIEDLGYEAT
                     LDSVTDLSQGKRKATESSDLWRASLAIGGMTCAACSNTITRELMKKDWVKDITVNLLT
                     NSASADIEGRANADRLVEAIEDLGYDATLDTVINLAQEAAEERRRTVEIRVDGLYCEH
                     CPDRVTKSLAGFRRHLEVLTPPSRKRPIMKLSYVPDAPTFTVRQILAAIEASDPGFTA
                     AIYHPPTLEERSKQIQRKHRLQILLRVIFTGVVCIPTFIIGIVYMSLLPSSNPTKHFL
                     MRPWTSGISRAQIALFIMATPVYFFAADLFHRRAIKEIRTLWRPGSRVPILQRFYRFG
                     SMNTLMSLGTTIAYISSVSQLIAAAANKLDEVNDSNFYFDSVVFLTFFLLLGRLIEGY
                     SKSKTGDAVEMLGKLRPTTATLVEGYGTDKEKDVLVKADLLDFGDVVRVTHGASPPAD
                     GTVVGGESNFDESSLTGESRLVKKAVGDQVFSGTVNKDASLLVRITGVAGSSMLDQIV
                     HVVREGQTKRAPIEQVADMLTSYFVPVVTFIAVLTWILWLSLGLGGHIPEHYLDVTSG
                     GWVAFSLQFAIAVFVVACPCGLALAAPTAIFVGSGLAAKHGILAKGGGEAFEKASRID
                     CVVFDKTGTLTKGGEPSITDSEVYAQEAARRDALFAALKAVEENSSHPIAKAVVSFCS
                     TQTSSRATVDDLQEVAGKGLRATYRATDPASSFELAVGNESFMSDFSVAIPAQTAAAL
                     ERWKSEAKSVALVATRAADSQSWTLAAAFSISDPIRPEAPRIIRALRSRGTRVWMLSG
                     DNPTTASAVASQLGIPPDQVIAGVLPTGKADKIKYLQSTLKARAGGSGSGSRGQSATK
                     RAMVAMVGDGINDSPALATADVGVAIGSGADVAISSADFVLVKSDLRAVVDLLDLSAV
                     VFSRIKLNFGWAVVYNCIALPVAGGAFYPIVSRGQHVRLDPVWASLAMALSSISVVLS
                     SLALRVRVQGIGYRERRIE"
     gene            1743722..1746387
                     /locus_tag="MYCTH_2306302"
                     /db_xref="GeneID:11513481"
     mRNA            join(1743722..1744839,1744963..1746387)
                     /locus_tag="MYCTH_2306302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663958.1"
                     /db_xref="GeneID:11513481"
     CDS             join(1744098..1744839,1744963..1746149)
                     /locus_tag="MYCTH_2306302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664006.1"
                     /db_xref="GeneID:11513481"
                     /db_xref="InterPro:IPR012935"
                     /db_xref="InterPro:IPR013909"
                     /db_xref="JGIDB:Spoth2_2306302"
                     /translation="MNSTVKRKFNALLQGIGNQLPNEYSSDRSDRESLDPASSPLSQR
                     SSAHPSRTMAGGDSSLDLQKRRRLGEVTTTPTPSKYATLQTTPMRSSPASIRSVPPAI
                     TTTTTTVSNVTLRKWTPGSASASASPAPDPRDGLPPPPKYCPGDRDQLLRRLATFQEL
                     TDWAPKPDRVNEVEWAKRGWVCQGKERVKCALCGRELAVKVNRKEVDGKEIAVLIASE
                     VAESVVDTYVRLIVEAHAEDCLWRKRGCDDSLLRLPLPNPKLALQGLRQRYDELCERA
                     AFLPYEFNLRLPPGLDLDAIITYLPPTFFTDPPPKHPPAAAADNNKNNNNNNNHQANP
                     NPNSNSNPASTPSPAASAAPAEPTINRPALALALFGWQSLTHPQLGNPVPNSASCHTC
                     LRRLGLWMFKSREVDPATGAVVVPAPMDHLDPLREHRFFCPWKNPAAQRNPGARSSSS
                     SFSSSSSSGPAGMAAWEVLVQGLRNEAFIRERISGAGSGSGSAARRRKEATEKEGRRI
                     EAAVLPGHGRSKSSVPAPGAGSSSLSGDGSGGRAGADDGVPKTPGRPVTAGCQPRITV
                     GDADEDYDGDGDGDRDGVRQSADGLDDEEARAKKDKDMMSRLRRVKSLFNTKTGSKLR
                     RLGGSRPGTSHSNVGGGE"
     gene            complement(1746472..1746555)
                     /locus_tag="MYCTH_t126"
                     /db_xref="GeneID:11513482"
     tRNA            complement(1746472..1746555)
                     /locus_tag="MYCTH_t126"
                     /product="tRNA-Pro"
                     /note="Anticodon: TGG"
                     /anticodon=(pos:complement(1746521..1746523),aa:Pro,
                     seq:tgg)
                     /db_xref="GeneID:11513482"
     gene            complement(1747073..1748966)
                     /locus_tag="MYCTH_2306305"
                     /db_xref="GeneID:11506439"
     mRNA            complement(join(1747073..1747445,1747910..1748966))
                     /locus_tag="MYCTH_2306305"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663959.1"
                     /db_xref="GeneID:11506439"
     CDS             complement(join(1747324..1747445,1747910..1748786))
                     /locus_tag="MYCTH_2306305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664007.1"
                     /db_xref="GeneID:11506439"
                     /db_xref="JGIDB:Spoth2_2306305"
                     /translation="MADARDPAGAVGQPDHSTLEVVEGHYHDKAVFSKNDKVAYVPSR
                     GDYKVVVQQETDAQKPATPGAYSDQNQPEQYSPQTTYAPGASAWKGDAFSAREPPQTD
                     GGGKKILGLKRRTCFTVMWVASLLVAIGVGVGVGVGVSMRSSSGSGSGSGGSDEGADL
                     GSDSAMPPRTTTPGSTGAGSADSSSSVTVTGSASRGATPSSVTLTAPRSTAAVQIGGV
                     GGRCSNNWGADCICLDRDVCVNRWQGEPMTGTGPGDWPCPDDPNNIVACIVKPCLGKP
                     EGSQCMWSEACRQVDNRTQTASSRGRRANRDCLEEPASAARAQGVRAQHGILLYDT"
     gene            1750164..1750272
                     /locus_tag="MYCTH_t110"
                     /db_xref="GeneID:11513483"
     tRNA            1750164..1750272
                     /locus_tag="MYCTH_t110"
                     /product="tRNA-Pro"
                     /note="Anticodon: CGG"
                     /anticodon=(pos:1750196..1750198,aa:Pro,seq:cgg)
                     /db_xref="GeneID:11513483"
     gene            complement(1751641..>1758147)
                     /locus_tag="MYCTH_2081074"
                     /db_xref="GeneID:11506423"
     mRNA            complement(join(1751641..1752287,1752447..1754905,
                     1755117..1755175,1755678..1755792,1755988..1757738,
                     1757789..1757892,1757961..1758027,1758104..>1758147))
                     /locus_tag="MYCTH_2081074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663960.1"
                     /db_xref="GeneID:11506423"
     CDS             complement(join(1751964..1752287,1752447..1754905,
                     1755117..1755175,1755678..1755792,1755988..1757738,
                     1757789..1757892,1757961..1758027,1758104..1758147))
                     /locus_tag="MYCTH_2081074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664008.1"
                     /db_xref="GeneID:11506423"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2081074"
                     /translation="MAPQDTYIDDEEDCCPLCIEEFDLSDRNFRPCPCGYQFCFNNIR
                     TNMNGLCPACRRPYDDKTIQWKVVTQEEVAEFRANIQKNQKKRAAEQRQKEAQKREAE
                     KENRKNLVGVRVVQKNLVYVTGLTPTIREDELLKTLRKPEFFGQYGNILKISISSRKG
                     TDGQSQSLGVYVTFEKPEDAARCIQAVNGSQNGDRILRAQLGTTKYCSAWLRHEQCTN
                     RQCMFLHELGDEEDSYSRQDLSSMNSINSQRPIHNSGPTRSASRQQAHPSPSPAVAQP
                     MARSSSKDGSDHGGDGPALPPSANWARNPQVRSRRGSHATSAAAPSPATSNSVPATAG
                     SAVEDSSADSSAATGAARPAAATVSKKSSATPAEKAKRIPQDALKSLLKSLEGCSLAW
                     PKPGGDLPPEEFNKLYPPLFDIRGGMRRRALRAAEENSSVGEQQSGGAQEASEGEPES
                     SGSLALGGEPEDRDHGRDGSGFDPRRVAQLPIQRAGTNDLFGQAVGSGFAQTTANLAA
                     IGGSRTVTPQQPAFMRQPGNFVDHLSAQANLFQGQGHNRQGSRFNFANDGRDAASATS
                     VKLAANPRIMAQQSSMMPSSFHNQPGGQYYANSMPGPPPGLKSTGTPPGVFGQHGFGS
                     AAFGGATKDANEMLQLFRGRGAGGQTHDAGKLDLADPSILQARMQSQQHLQQQSNAGL
                     GQGLFGGQSQGGFCTVGAEVASVVIIEHHYTDDELPSLDEVRSSVDALVADEPINANI
                     RLPPGAFESLSRSGTPSVPPGFSIPSAHPSPAVSHSSLLANSVGRQTPPVALPKVPVK
                     PPVAASSPLLKKAVTPVPESKKAVRTLAAESGLSKDIAKAKQKVLQDEDFPALDSPKP
                     KPATTPVAQPKPAVIKLGASGSKKSPEKAADKVKEKAKDKDKENEKDKEKEKEQEKEK
                     EKEKKETEKGKGEKEQDKEKEKDKSSPAAASNPAPTSERSETSTPGTKSSEKVSDNSS
                     EKAADKVEKRPVPGVLNIAAATKVSQVKNSEANSATDKATSERDSAFPALPTPTPVSA
                     PSPLPRTGPKTLRVVSTPKTETPSTPVLAGPGVKSVAAAAGVRPDTPASELISDSASI
                     ISASISASRTNSPPPSKIGSAPPRTTTKSQQRKQRKEALKKESASIAAQPVKVEPAVE
                     IGPIVGRKKKQKKDKEKPSNKTATPAESRPDTPSTTNPASAKETKEGSENKETKETKD
                     AKDAKDVKEAKEVKEESSAYRSTANETTTLTDDPPLQSRYASLKSKASDKQDKSQDAS
                     TPRTLPTPASVLRDLQAAELVPSNLEDLPIFKPVNVQVDKSRNEAVMTGLREQAAKNS
                     MAPTKSIVTEDDQAALLAGKPVRKVVDGTRILLTPNGDCIRNLSPEEEDRFLELQQRV
                     AEAAASPAAFVSSRHEAGGGFSLIKGRAVPNGPPSYFPPAPGAYPSDPVNKIQREEAI
                     YYINQYVLPRLNLNSRDMSLPKAMSTWTTDPRGSAAANLSSVAPWLYGSIGGSSSSPS
                     HLPPLSHDDILDAGAAAPELSYPGPVGAFADDLHHHDTYQQQPNQAASSSSSSSALPA
                     GTAAGGGSGGSNSGGSNLTSPGAFGNVPLMSLEDAEQALSAARKETEKLEKSLNQLMR
                     KNRRLLMAPVQGPPAIPAGGGGSGGGDAGH"
     gene            1758875..1760074
                     /locus_tag="MYCTH_2306309"
                     /db_xref="GeneID:11513484"
     mRNA            join(1758875..1759318,1759383..1760074)
                     /locus_tag="MYCTH_2306309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663961.1"
                     /db_xref="GeneID:11513484"
     CDS             join(1758949..1759318,1759383..1759888)
                     /locus_tag="MYCTH_2306309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664009.1"
                     /db_xref="GeneID:11513484"
                     /db_xref="InterPro:IPR001268"
                     /db_xref="JGIDB:Spoth2_2306309"
                     /translation="MASKLCRNRALASALRPANPSVAARNDAVAVVRCFATTARANVA
                     VPKDAQNPRTAPRNQVGALKVPIVNPADKYQSKADDLHKYGSWLMGCLPKYIQQFSVW
                     KDELTIYICPSGVIPVFSFLKYNTAAEFTQLSTITAVDFPTRDQRFEIVYNLLSTRHN
                     SRIRVKTYADETTPVPSLTPIYDGANWYERETYDMFGVFFVGHPDLRRIMTDYGFEGH
                     PLRKDFPLTGYTEIRYDEEKKRIVTEPLELTQAFRNFEGGSSAWEQVGAGVDRTPETF
                     KLPTPKPEEKTEEKK"
     gene            1760297..1760418
                     /locus_tag="MYCTH_t111"
                     /db_xref="GeneID:11513485"
     tRNA            1760297..1760418
                     /locus_tag="MYCTH_t111"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:1760331..1760333,aa:Pro,seq:agg)
                     /db_xref="GeneID:11513485"
     gene            complement(<1761283..>1762247)
                     /locus_tag="MYCTH_52082"
                     /db_xref="GeneID:11506424"
     mRNA            complement(join(<1761283..1761919,1761979..>1762247))
                     /locus_tag="MYCTH_52082"
                     /product="Intradiol ring-cleavage dioxygenase-like
                     protein"
                     /transcript_id="XM_003663962.1"
                     /db_xref="GeneID:11506424"
     CDS             complement(join(1761283..1761919,1761979..1762247))
                     /locus_tag="MYCTH_52082"
                     /codon_start=1
                     /product="Intradiol ring-cleavage dioxygenase-like
                     protein"
                     /protein_id="XP_003664010.1"
                     /db_xref="GeneID:11506424"
                     /db_xref="InterPro:IPR000627"
                     /db_xref="InterPro:IPR007535"
                     /db_xref="JGIDB:Spoth2_52082"
                     /translation="MASDKPSHRFDPNFTKQVIEGMGPNTSPRARVVLGALIRHIHDF
                     AREVELTIDEWMEGVKFINSLGEIYVNSNKTRNETHRICDILGLESLVDEIAHKIVSD
                     TGLDPTSSSILGPFWSPNAPFRELGGVIFQDGVPPGGRVVKMHGVIRDIVTGKPIPNA
                     VFDIWQASANGKYDFQDPENQTPNNLRGKFRANDEGKYWFYCLHPTAYSLPRDGPSWQ
                     LLTLMDRHPMRPAHIHIMVTHPEYQGCTTQLYPSDDPWVKSDTVFAVKDDLVVTFKPL
                     EGDEKATLELEYNVNLAPKGYKGRL"
     gene            complement(<1762891..>1763262)
                     /locus_tag="MYCTH_2127818"
                     /db_xref="GeneID:11513486"
     mRNA            complement(<1762891..>1763262)
                     /locus_tag="MYCTH_2127818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663963.1"
                     /db_xref="GeneID:11513486"
     CDS             complement(1762891..1763262)
                     /locus_tag="MYCTH_2127818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664011.1"
                     /db_xref="GeneID:11513486"
                     /db_xref="JGIDB:Spoth2_2127818"
                     /translation="MGDRPEFPLAGYSGARAAAPPPRDSGRTPAQPQNLVPHSSHEVP
                     RAHLAPSHAHPPFAGQSVRVKAHPRYLSPTKSCMDVYPVHGHVLEYGEGELLEAVHWT
                     FTSSYRMEEGHRAGNDASDLR"
     gene            <1763596..>1764824
                     /locus_tag="MYCTH_102792"
                     /db_xref="GeneID:11513487"
     mRNA            join(<1763596..1763742,1763801..1763909,1763980..>1764824)
                     /locus_tag="MYCTH_102792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663964.1"
                     /db_xref="GeneID:11513487"
     CDS             join(1763596..1763742,1763801..1763909,1763980..1764824)
                     /locus_tag="MYCTH_102792"
                     /note="orthologue of 3-Carboxy-cis,cis-muconate
                     lactonizing enzyme from N. crassa; orthologue of
                     3-Carboxy-cis,cis-muconate lactonizing enzyme from N.
                     crassa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664012.1"
                     /db_xref="GeneID:11513487"
                     /db_xref="JGIDB:Spoth2_102792"
                     /translation="MPLHHLMIGTWTPPGAIFTVQFDDENLTLKLVKRTEIPYDEPIS
                     WMTFDHARKNLYGAAMKKWSSFAVRSPTEIVHEASHPMGGDPKANDANTNTRAIFLLA
                     AQKPPYAVYANPFYNHAGYGNVFSVSETGKLETNIQNYPYQPNTGIHGMVFDPTETYL
                     YSADLTANKLWTHRKLPSGEVELIGSIDAPDPGDHPRWVAMHPSGNYLYALMEAGNRI
                     CEYVIDPATHMPVYTHHSYPVIPPGIPARDRETGKGLYRADVVALTSSGRYMFASSRA
                     NKFELQGYVAAFKLRDCGSIERQILLNPTPTSGGHSNAVSPCPWSDDWMAITDDQEGW
                     LEMYRWKDEFLHRVARVRIPEPGFGMNAIWYD"
     gene            1765176..1765262
                     /locus_tag="MYCTH_t112"
                     /db_xref="GeneID:11513488"
     tRNA            1765176..1765262
                     /locus_tag="MYCTH_t112"
                     /product="tRNA-His"
                     /note="Anticodon: GTG"
                     /anticodon=(pos:1765209..1765211,aa:His,seq:gtg)
                     /db_xref="GeneID:11513488"
     gene            1766344..1768194
                     /locus_tag="MYCTH_2306314"
                     /db_xref="GeneID:11506425"
     mRNA            1766344..1768194
                     /locus_tag="MYCTH_2306314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663965.1"
                     /db_xref="GeneID:11506425"
     CDS             1766863..1767930
                     /locus_tag="MYCTH_2306314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664013.1"
                     /db_xref="GeneID:11506425"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="JGIDB:Spoth2_2306314"
                     /translation="MASPYARELEIAQLAVQRAAILTKRVFHEKAKGTVSKDDASPVT
                     IGDFGAQALIIAALRANFPGDAIVAEEEAAQLRSDDKLREPIWGLVRDTKLEDDAAER
                     LLGGGVKDVDDLLEVLDLGRSPGGRKGRVWTIDPIDGTKGFLRGGQYALALALLEDGD
                     VKVGVLGCPNLPVDDEAPLAADIGANQTDAEGRGVIFSAVVGQGATSRPLGTGGLAQG
                     KRIKMKEVTDMASASFCESVESCHSNQSEAAQIAQRLGITKPSVRMDSQAKYGSIARG
                     AGDIYLRLPTSKTYQEKIWDHAAGDLIVREAGGQVTDTKGQRLDFGVGRTLATNSGVI
                     AAPAAVHGRVLEVVQEVLGLK"
     gene            complement(1768195..1769038)
                     /locus_tag="MYCTH_2306316"
                     /db_xref="GeneID:11513489"
     mRNA            complement(join(1768195..1768623,1768696..1769038))
                     /locus_tag="MYCTH_2306316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663966.1"
                     /db_xref="GeneID:11513489"
     CDS             complement(join(1768460..1768623,1768696..1768972))
                     /locus_tag="MYCTH_2306316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664014.1"
                     /db_xref="GeneID:11513489"
                     /db_xref="JGIDB:Spoth2_2306316"
                     /translation="MLALRTGRQALRRALAATPSSAVTLPGFLVPAFQTPTARNFSAT
                     THRPSKLGRTPLSVPPGVELQISEPYIKKNMTSYLKTYKRNITVTGPLGTLNLEIPDY
                     INVNHDPAARRVELSVKDQNQRNQREMWGTDHWNRRAEQPEQVG"
     gene            <1770033..>1771460
                     /locus_tag="MYCTH_102790"
                     /db_xref="GeneID:11513490"
     mRNA            join(<1770033..1770477,1770531..1770970,1771023..>1771460)
                     /locus_tag="MYCTH_102790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663967.1"
                     /db_xref="GeneID:11513490"
     CDS             join(1770033..1770477,1770531..1770970,1771023..1771460)
                     /locus_tag="MYCTH_102790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664015.1"
                     /db_xref="GeneID:11513490"
                     /db_xref="JGIDB:Spoth2_102790"
                     /translation="MLQKSRLPNIYAVALSELQELESEPLCHRVAARLLVNNCELVDG
                     KDEATILTDSGRKVRDFVDSYAASLAICDLERGSFTIPKECAKFREPSLSQIAIRNEP
                     QLHVSPGEIGLCLSGLAASDAAWSTWVSYRHKALRFCEAARADNEKAQHILLYQRLTR
                     VIARLTDGVESELQKRMDELDRRARQSAEKLDQLNPQLNRLSEGLARLESFLSEDLDL
                     ALKKTSESYRDGLHHAENLQQLLGLLVGNVLDSNSQLAFAHETSVQQASQRINDDMNA
                     LIEVVSSAIASSTSLQQQLQLSHHQTTVLAHRQETLEQGMERLSTATEELATKFEDHS
                     SMLKQVSNMTNDILDSLEETAAVATSMNESLFASRVARSWWPFVVFPTASLIMGSYGL
                     PPSIFRNIGLLAFGEVVGFVVSSYDQLADQFLGSLEEIATNTTASSLR"
     gene            1772602..1774260
                     /locus_tag="MYCTH_2306320"
                     /db_xref="GeneID:11513491"
     mRNA            1772602..1774260
                     /locus_tag="MYCTH_2306320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663968.1"
                     /db_xref="GeneID:11513491"
     CDS             1772697..1773917
                     /locus_tag="MYCTH_2306320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664016.1"
                     /db_xref="GeneID:11513491"
                     /db_xref="JGIDB:Spoth2_2306320"
                     /translation="MNNLGSGTDASAKPRHAYVYGSYLGASLAAGLALTESHVPAAPQ
                     PMTVRGLIAYNGIYNWTMFLPDHPVQRLRSKSSLRRRRRGLASPFVNLNEDPIEEEGI
                     FTDLERHAPGLFAEPSNLFDPFASACFFFHSANLHVPDDFTTPLSASGPASTLSSEFT
                     AAIDALANRSPSPSASAERGGGGEEGDGETAAELLSRAALLAKQQKPPRKGYLVFPPR
                     DSTLRLPPALFLYSSRQHGPRPPAGSDSSSSRSRRKQSRNSFAAQTAELAGLMMRSLD
                     MHELRRRGGGGGGGTGRPGKQFPRKGITAGANAMKEEGGEGVADGEEDRWKEIERRVQ
                     TFEVPLSSSLSSSLSSSLSSSLSCSLSSSPSSFSFEEGLGLEGEAEQVIAEWLRERID
                     EDFGGEKEEGRDGS"
     gene            complement(1775033..1776487)
                     /locus_tag="MYCTH_2306323"
                     /db_xref="GeneID:11513492"
     mRNA            complement(join(1775033..1775221,1775279..1775517,
                     1775572..1775595,1775654..1775909,1775982..1776076,
                     1776136..1776487))
                     /locus_tag="MYCTH_2306323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663969.1"
                     /db_xref="GeneID:11513492"
     CDS             complement(join(1775114..1775221,1775279..1775517,
                     1775572..1775595,1775654..1775909,1775982..1776076,
                     1776136..1776307))
                     /locus_tag="MYCTH_2306323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664017.1"
                     /db_xref="GeneID:11513492"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="JGIDB:Spoth2_2306323"
                     /translation="MSTGSSDSGTQTPSATVEQPNLNGAQQSYTFPTEKLKRRQTQPG
                     KTPLVLVACGSFSPITFLHLRMFEMASDFVRFNTDFEVCGGYLSPVSDAYKKVGLAPG
                     VHRVNMCARAVEQSSWLMVDPYETVNCDEKGEPRYVPTAKVLRHFDYEINEVLGGIEG
                     TDGQRKKARIALLAGADLVMSMGEPGLWAPKDLDTILGQYGAFIIERSGTDIDEALAS
                     LRQYEHNIWVISQVIQNDISSTKVRLFLKKDLSVRYLIPDPVVEYIEEHGLFSEPSAN
                     KSRSRTPDVASGPSDNKPTKG"
     gene            complement(1778765..1779455)
                     /locus_tag="MYCTH_2315506"
                     /db_xref="GeneID:11513493"
     mRNA            complement(1778765..1779455)
                     /locus_tag="MYCTH_2315506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663970.1"
                     /db_xref="GeneID:11513493"
     CDS             complement(1778794..1778958)
                     /locus_tag="MYCTH_2315506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664018.1"
                     /db_xref="GeneID:11513493"
                     /db_xref="JGIDB:Spoth2_2315506"
                     /translation="MKKNDVIAVIIIILFIVLALIAFGIYQLVRLARNNVHGTVTTSS
                     SGSSGELGDD"
     gene            complement(<1780159..1781307)
                     /locus_tag="MYCTH_82678"
                     /db_xref="GeneID:11513572"
     mRNA            complement(join(<1780159..1780224,1780276..1780636,
                     1780689..1780771,1780825..1780864,1780924..1781113,
                     1781227..1781307))
                     /locus_tag="MYCTH_82678"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003663971.1"
                     /db_xref="GeneID:11513572"
     CDS             complement(join(1780159..1780224,1780276..1780636,
                     1780689..1780771,1780825..1780864,1780924..1781113,
                     1781227..1781236))
                     /locus_tag="MYCTH_82678"
                     /note="Chromo domains mediate the interaction of the
                     heterochromatin with other heterochromatin proteins,
                     thereby affecting chromatin structure."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664019.1"
                     /db_xref="GeneID:11513572"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR008251"
                     /db_xref="JGIDB:Spoth2_82678"
                     /translation="MPPALSDEEASDREEFERLSSPKKSGRSRSSTSYNQDIPDDDDM
                     KGKTNGNGGEDYEEDEEEFEEEVYVVEKIMSHMIDKNGKPFFEVKWEGYEKKSDRTWE
                     PEENLIENASEALNEYLESIGGREKLHEETANALKTKKRGRPSSTTPQGGGKRSKRNG
                     DHPANSEPPLSAKAATWKPPPGSWEDHIAHLDACEDEETGKLMVYLTWKNGHKTQHPT
                     SVIYQRCPQKMLQFYEQHVRIVKREPSTEAQ"
     gene            1785330..1787963
                     /locus_tag="MYCTH_2306334"
                     /db_xref="GeneID:11513573"
     mRNA            join(1785330..1786119,1786193..1787963)
                     /locus_tag="MYCTH_2306334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663972.1"
                     /db_xref="GeneID:11513573"
     CDS             join(1785488..1786119,1786193..1787750)
                     /locus_tag="MYCTH_2306334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664020.1"
                     /db_xref="GeneID:11513573"
                     /db_xref="JGIDB:Spoth2_2306334"
                     /translation="MNETPSRPPEGTTTKAVKDKSCPYCHQAFTSSSLGRHLDLYIRE
                     KNPKPPDGVHDVEAIRKLRQNITRRQPKGSASRRVSSAAVGTPTTASRRSPASGDAGR
                     SVTRSPNSSKGDLQAGAASGSQYYPFKHRWEDTGVINDLAVRDGVARGEAEGKAAAQQ
                     LPRREPSQRSAARQMLKQQLEMRQQIQDAEDRSRAAELALRELLGSLRAAKRQIDIGS
                     TPFDFDPFSLDFPALTLQCLDPPPTLFASTQHPTSTSWSILPPGHAQLEALYAYFREE
                     FRRWKIACAAATTALSEELTYPPPLDAVRADPKAEVRKAEKSAEQMEKHVYDHLEATY
                     AIWDALAQDQREQLWRLELARGVGRRRREVDKLKEGQHLLRQEVAVLKSQIEQLTRLQ
                     QPREFKIAPPPTLYIDEKFLTHLQEEAMRNGKHFVGLSLSDRGSDLNTVVSSVIDRWK
                     SVIVSARSAASGLQTQRTLSPGAAGPSPRGSTCDKSTPNKQDGLQMPQQSSICRDRPR
                     PQQLSTACTHGTSYQVSATSPNAASMPTLPETPAVPSTTPSINIHADDDEDEEMSDRD
                     AELAGEPRPNQNDRRDAEGNPTGVSDVDADADVDADADADADADADADADADIDADAD
                     ADADADADADADADADADADADADMDDNPGGYTEFQAQQPLQRQQQLHPVVPVPAPSQ
                     QTGQLGVARTRAQLGGGKRSNTDDGTSGHMVTDQIPESVRGRMPSWA"
     gene            1788272..1791284
                     /locus_tag="MYCTH_2306339"
                     /db_xref="GeneID:11513574"
     mRNA            join(1788272..1788598,1788687..1788866,1788950..1789238,
                     1789336..1789427,1789489..1789559,1789609..1790149,
                     1790211..1790264,1790333..1790351,1790418..1790534,
                     1790591..1790634,1790695..1790741,1790806..1790935,
                     1790997..1791284)
                     /locus_tag="MYCTH_2306339"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663973.1"
                     /db_xref="GeneID:11513574"
     CDS             join(1788340..1788598,1788687..1788866,1788950..1789238,
                     1789336..1789427,1789489..1789559,1789609..1790149,
                     1790211..1790264,1790333..1790351,1790418..1790534,
                     1790591..1790634,1790695..1790741,1790806..1790935,
                     1790997..1791007)
                     /locus_tag="MYCTH_2306339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664021.1"
                     /db_xref="GeneID:11513574"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2306339"
                     /translation="MPDSTAPAPPTEEVANLHLDEVTGERVSKSELKKRQKQRQKEAE
                     KAAKAANAPPKPSSKPKNVAGEEEKDLNPNQYHEIRSRHINELLKNPETNPYPHKFQV
                     TYDDSKFVEEFGHLKSGETAEDKEIRIAGRIYNKRASGSKLIFYDIRTSADTVSIGTQ
                     LQVVCQAQLVKEGSPSFEKQHENIRRGDIIGIIGYAGRTNPKNRLAEGKEGELSVFAT
                     EIVLLSPCLHMLPSVRFPFSDSEQRARMRYLDMLWNDRTRQVLWQRSRMVRFIRDFFH
                     ERRFIEVETPMMHAIAGGATALPFITHHNDLDIDMYMRVAPELFLKKMIVGQFGKVFE
                     LGKNFRNEGIDLTHNPEFTSCEFYWAYADVYDVMKLTEELVSSLVKELTGSYKTTFTT
                     QHGETYEINWEAPWRKVEMIPELEKATGEKFPPYEELHTEETNQFLQRLCKKMNVECP
                     PPLTNARMIDKLTGEFIESTCINPTFILEHPQMMSPLAKYHRSKKGLCERFEAFVCKK
                     EIANAYTELNNPFDQRLRFEEQARQKAQGDDEAQIIDESFLNALEYGLPPTGGWGLGI
                     DRLAMFITNNYSIREVLPFPFLREEKQGTKEKSAAELVGVQPLPEEGIPHK"
     gene            1792033..1797631
                     /locus_tag="MYCTH_2306344"
                     /db_xref="GeneID:11513575"
     mRNA            join(1792033..1792441,1792522..1797631)
                     /locus_tag="MYCTH_2306344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663974.1"
                     /db_xref="GeneID:11513575"
     CDS             1792634..1797619
                     /locus_tag="MYCTH_2306344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664022.1"
                     /db_xref="GeneID:11513575"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2306344"
                     /translation="MALLRQTWTLALKNWLIVLGRHSLATVIRAFVLPIILTAFLSFA
                     RNLFVPAATFGIGDVRPVRSLLNGLEVASESGRNHVVFVNNGFRGGEIERVIDDLATT
                     VRNAGKNATILESEDDVPYICRASLRGVTPCYGAVVFHGSPTEGGAGLWNYTLRADAS
                     LGAGRIDTDKDTNDAQVYMLPLQNAVDMAISRQKGGDGGDMTPLPSVTDEYPFTSLTD
                     EERNDRIRVIYQRNIISFLGVTFLVATIGITYHMAGFIATERESGMSTLIEAMMATKS
                     RWQPQVARLLSYHLSFSVLYLPGWVVSALILWTGVFAHTSAVVVFFYFILSGLALGSM
                     TIFGAAFFKKSQLSGVLLTIVYILLAIIAQTITSPKTPTVVALSLLFTPCNFTYFITL
                     LARWEREEWPTDLLQSPPNSPWELPGIVFFVFLAAQALVYPVLGALIERWLHGTTSSG
                     RNIVVGEDRGDLGSDCTVKLEDFTKVYSPGIVRRMFSFIAKPKEPVVAVNKLTLSATR
                     GQILALLGANGSGKSTTLDTIAGINKATSGNITIDGTGGLGIAPQKNVLWDELTVFEH
                     IRIFNKLKSPGRHATKEEIRDLVLAVDLEKKIKAQSRTLSGGQKRKLQLGMMLTGGSA
                     VCCVDEVSSGLDPLSRRKIWDILLAERGRRTIILTTHFLDEADLLADYIAVMSKGNLR
                     AKGTSAELKDRLGGGYRIHVNNVKLIPRLPDIAGVKKKATREEASYMASTSAMAATVI
                     RELETAGVKDYRFSGPTIEDVFLQLAEEVRAEGGDLDSRGVLSSADEKSATADGMSQT
                     EKGLELMSGQPVGFWRQAWVLFLKRCVIFKRNWFPTVAAFVIPVIAAGLVMLFVKDQQ
                     AVGCSPTDQLSRNEAVNIFDGGFEIFVVGGPADKFSESNLMRLFAPIYINTQGKTGGA
                     GGEIADADGLSTRAVTSAADFFRNLTIVDSIDEFNQAVVQYRKNITPAGIWLGDDRSR
                     PTLVYKGDGVEMVNAWFGKWVMDMLLVNSTIATTYVPFDRPFTPDAGDSLQFLVYVGL
                     ALCAYPAFFSLYPNLERRRQVRGLQYSNGVKPLPLWIAYLGIDFAAVLAGAVISIILF
                     AAVAPDLWYHIGYVFLVFILHGLASTLLAYNVSLFASNQLSAYAFAAAWQVVMLLLYL
                     IGYMCVIVYAPVHRIDSLVLVVHFTISVLAPIMSVIRALFVTLNLFSTACDGQQLSSN
                     PGAMVQYGGPILYLIVQAVILFLVLVWADGGSAGFSLWRMFKRSAPPSQSDADERAAI
                     SDEEVANELIRVKSSSAANPDAGRPTDGLRVVNLTKTFGNNIAVDNVTFGVPHGEVFA
                     LLGPNGAGKSTTISVIRGNLKPSAGGDVFVENASVTRHVAAARSHLGVCPQFDAIDVM
                     TVEEHLRFYARVRGIPDVEHNVSAVIRAVGLSAFRTRQAHALSGGNKRKLSLGIALMG
                     NPTVVLLDEPSSGLDAAAKRIMWRTLASTVPGRSLLLTTHSMEEADALAGRAGILAKR
                     MLAMGSIDQLRQRFGNQLHVHLVCKGAPRTSDAHVEKVRTWVTQTFAGAEVEDKTYHG
                     QMRFKVPAATAAALASGGAQEQVCAKVPHGVGHGSSSSSSSSSSSSSGSAIGKLVVLL
                     EENREYLGVEHYSVSPTTLDQVFLAVVGRHNVKEEGYHEDGKKKKWWKFGK"
     gene            complement(<1798889..>1801123)
                     /locus_tag="MYCTH_2065241"
                     /db_xref="GeneID:11513576"
     mRNA            complement(join(<1798889..1800507,1800566..1800995,
                     1801058..>1801123))
                     /locus_tag="MYCTH_2065241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663975.1"
                     /db_xref="GeneID:11513576"
     CDS             complement(join(1798889..1800507,1800566..1800995,
                     1801058..1801123))
                     /locus_tag="MYCTH_2065241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664023.1"
                     /db_xref="GeneID:11513576"
                     /db_xref="JGIDB:Spoth2_2065241"
                     /translation="MGFLSHRRRHIEVQPEQKWDFISLNDFKSTSVFTPVAYGYLWFS
                     LIISLAVYAVDIFTAYQLLAFNRWSSQIEPAQFIPFDISKWIFTVCILLSFANLAYEY
                     FRAITIMRRGSVAECFLDSLAARLESIRMGEGRGWKRFLVFAELTRSKKGAEYIALFT
                     FFSFQSWIRVLLCSGPRQAINALTLYSVYDARLQINQSSFETSLADFFDKIKALATEE
                     PRQAVILSGMLFTLVIWVFSFLSLLLAALFFVFFLWSYIPREDGGLTGFCERKVNKRL
                     KQIVSIKINKAMAEEERKRKKAELKAAKKNGGDRPVTMKPSLPVLDDDDLPQMPTLNR
                     ADTFASFTEKPSRPSSPGSFEMNSLGRRPPMPTRSETKRTTGSEYSVETSLLGSAAGM
                     GMAPPRSSTPTLPPLDLDGYPPARTATTSSNRSYGPAPHMQRMASNGSSLRDYTASPA
                     NFTSETMPSEPPPVKSPTGSFNYSGPGPNQPRLPYPGDGRPPQRGDTRSPHPGDSRFP
                     YAEGNRLPQRHDTRSTHPNDMRLPYPGDSNGAAFDNRLNGRASPAPSMNTYRSNPMSP
                     RGPGPGGHPIRSATNPMAPQGQPQFPPSRAMTQPMRPFHQPTDSRGSLRSNQSSSRPF
                     QPFQPYHQPSASNSSLRNMINAVQYGGDNGSEYGGTASRPNQQTRNDPWGHRGGYGES
                     NGNGNGNDSWSQDLERGGGPRY"
     gene            complement(1803086..1804083)
                     /locus_tag="MYCTH_2306347"
                     /db_xref="GeneID:11513577"
     mRNA            complement(1803086..1804083)
                     /locus_tag="MYCTH_2306347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663976.1"
                     /db_xref="GeneID:11513577"
     CDS             complement(1803105..1803959)
                     /locus_tag="MYCTH_2306347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664024.1"
                     /db_xref="GeneID:11513577"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Spoth2_2306347"
                     /translation="MPTYIHLVRHAQGVHNLCAENHALPDPDLTPLGKEQCAQLAKTF
                     PYQGQLTHLVASPLRRTIYTCLLSFEPALRARDSSLVRRTVVALPDVQEVSASPCDTG
                     SDPSALAAEFGPGGQVDLSLVAPGWNVKTGGSAFAPVMDRLEARARRARAWLRELGRR
                     FEAAHPGRDAHVAVVTHGGFLHFLTQDWDGMNPQAGTGWANTEWRTYVFAEEQGQDGA
                     GGDEGQARLRETDASWRRRRGSAAPLTETEQMELRCAVEGRLREEWGGGGGDGDDDEE
                     EEEKAQKK"
     gene            complement(1804575..1807448)
                     /locus_tag="MYCTH_2093728"
                     /db_xref="GeneID:11513578"
     mRNA            complement(join(1804575..1805700,1805756..1806539,
                     1806619..1806903,1806964..1807096,1807167..1807448))
                     /locus_tag="MYCTH_2093728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663977.1"
                     /db_xref="GeneID:11513578"
     CDS             complement(join(1804787..1805700,1805756..1806539,
                     1806619..1806903,1806964..1807096,1807167..1807240))
                     /locus_tag="MYCTH_2093728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664025.1"
                     /db_xref="GeneID:11513578"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="JGIDB:Spoth2_2093728"
                     /translation="MMGWWSSGANSALDEQIEKATSSSLEDIALNLEISDIIRSKTVQ
                     PKEAMRSLKKRINNKNPNTQLSALNLTDTCVKNGGAHFLTEIASREFMESLVSLLKAV
                     GPGTVNPEVRAKILELIQSWATASEGRYELGYIGEVYRTLQREGFQFPPRVTVASSML
                     DSSAPPEWVDSDICMRCRTPFTFTNRKHHCRNCGNCFDQQCSSKTLPLPHLGILQPVR
                     VDDGCYAKLTDKSSRGGGIHHERSPSHTLHSNKPRGSSMQPRDARVDDGFDEDLKKAL
                     AMSLEDVKNNSRGYSSNAANGTASGQQKTNGHATPKVAEEEDEDLKAAIAASLADMEE
                     QKKKHAAALKEQASGAASSSSPAPFTLPKNDYELTPVEAENINLFATLVDRLQTQPPG
                     TILREPQIQELYDSIGALRPKLARTYGETMSKHDTLLDLHAKLSTVVRYYDRMLEERL
                     SKAYSQHSIGGYNFPSPRQTSGPYPSLHPSAPSAAGPAESFYTGEQQHDYNRPTTQMS
                     YPHPAPAQLGTYDRRGSVAGPSSSQYPPQQMPQHTGGWGPATPAQQYGQQPSYPPNEP
                     PQPVQPRQNPTQGQLSAPTPNDSVGTTPTADPNASFYFNTQPQQQPHQAASSPPDPAM
                     SPYPNLSQPMHSYQPSLPQTPASTAAQPSQAQQAQQSQQTQQTHQPQPQSQQPYWQHP
                     AAQQTQLPPVWQAPPSSAYPGYTQEAFPSAPQHAPKQPAVEESLIEL"
     gene            1808282..1811742
                     /locus_tag="MYCTH_2306355"
                     /db_xref="GeneID:11513579"
     mRNA            join(1808282..1810612,1810666..1811742)
                     /locus_tag="MYCTH_2306355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663978.1"
                     /db_xref="GeneID:11513579"
     CDS             join(1808477..1810612,1810666..1811601)
                     /locus_tag="MYCTH_2306355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664026.1"
                     /db_xref="GeneID:11513579"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2306355"
                     /translation="MPGSTTMLNDAPSGTLSGRSDGAKGGKRPLPHIDDITSVTVDVD
                     PYAPVEKVLQAAESYLRQAESSKNFGRPDLALKDYIRTNILLLDVVKQNKGWVSLQRD
                     NRAQFERYQRLVRQVHAAHGDFEAIKDQIKADNARTGVEPTSRSAGSAGKGAAINGQD
                     KDTTPNGTAKENGVAASPPPRSKPVVHPKPKNLHGNALPPGPGAATQAKAQDLVQRFA
                     NLRAGANNASRGAHARTQSEMSPARIGSLASSEVPLSSPPLNGAIPELPRMPAAIYNP
                     PRGTISSETAALPTSAPRAMFTRTSSAASLSTVKANNPPRSPEGAASTSASVKRARPA
                     VPDGDTISVEDLLRCMRTGAKDLSILLIDIRSREDFDEGHVMSQATICVEPEILTRDH
                     ISANQVADSMVLAPAAEQLLFEKRHEFDLVVFYDQNSEQIPDRPQTPQAKAVSGLFNA
                     LSQYDFPGASGLKISPKLLRGGIEAWTSLVGSASLQSSSTTASRKYPASPMTRSFLNS
                     RQKYVTRPIQDPAEAKRWEDTIADTGGISPVRTTEDFLRRFPPISEHKESMVSPASPP
                     MSRPQSPFQSRLSHEENLYKSLPSPPTRPPPAVPRRSYSGLAEAEDNSLVLAKKSGPQ
                     VVDTVRKFRTGLQNPGVFCFANSSLQAMFATPGFAREIWTGAWKELYKVPMKPDEKFE
                     NPQLLIKCLTNLFHWLNQGSLRSLAAKTFMEYIHFIHSKSSDGKKKPDCDIFGGSSQQ
                     DAQEFYSFIMDNIHDETNVRRDVKPSKEEKPYTPKDGTIIQNAMDYWRDYSKYSASII
                     DKYFRGLEVFISRCHNPACRQEIRLFQPCDVWILNLAGMGDPTDLDSLLANHQTSEHF
                     PDLVCETCNKPGRTRKAKFARLPDRLAFCLNRFNSAGAGGGGFSNRFMSSGKIHSKVR
                     FPIRDLDLTRYCAEPDPDMATTDDRHFAGKMRYDCYAVTVHVGQGINGGHYYSYVQDE
                     TSKDPTDWFRCNDEVVDRVKIGSGQPGDMTEAMYQNGNTSAYMVFYRRQGT"
     gene            complement(1811749..1814636)
                     /locus_tag="MYCTH_2306357"
                     /db_xref="GeneID:11513580"
     mRNA            complement(join(1811749..1812031,1812082..1812216,
                     1812366..1813920,1814010..1814636))
                     /locus_tag="MYCTH_2306357"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663979.1"
                     /db_xref="GeneID:11513580"
     CDS             complement(join(1812127..1812216,1812366..1813920,
                     1814010..1814455))
                     /locus_tag="MYCTH_2306357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664027.1"
                     /db_xref="GeneID:11513580"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2306357"
                     /translation="MPFTYSAAQTPLYKVQKPPYTIESPGYQPVDGETIPRRHPKAKD
                     GLVERPAPGVNTTFDLLKRGVEHYGNEPAIGSRKLIKIHKEKKKVPKIVDGQTTEVEK
                     EWTYYELSDYTYITYKEYFAQILQVGAGLRKLGLSPKDRLHMFATTSPQWLAISHACS
                     SQSMTIVTAYDTLGESGVEHSLVQSKANAMFVDSHLFKTVRNPLKKADSVKVLIYNEH
                     TNMPVSDAEIEQFKSDHLGLTILSFDELRALGEENPTDPVLPSPEETYCIMYTSGSTG
                     PPKGVPVSHAGFVAAVAGLYTVMEESVTHREKVLAYLPLAHILELVVENLVIFAGATL
                     GYGSPRTLADASMRNCYGDMRTFAPTVMVGVPQIWETVKKGIESKVNSSGALTRTVFY
                     AALAVKSFLVRNNLPGTALLDRTVFAPIRAVTGGRLRFIVNGASGIAAPALHFMSMVV
                     APMISGYGLTETCGNGALGCPLQWTPGTTIGPVPGAVEIKLVSLPELGYSTASTPPQG
                     EILIRGPPVVREYFENPDETAKALTADGWFRTGDIGEFDSDGHLAVIDRVKNLVKLQN
                     GEYIALEKLEAVYRGAPYVHNLMVHGDATSLRPIALVLADEKALKRKAAELGVPEDHM
                     YRDAKVRAAVLKSLQEVARKEGLSAMETVAGVVLANEEWTPANGLVTATQKLNRKAIM
                     EKYSKEIKACLGGN"
     gene            1816323..1817569
                     /locus_tag="MYCTH_2306364"
                     /db_xref="GeneID:11513581"
     mRNA            join(1816323..1817054,1817138..1817569)
                     /locus_tag="MYCTH_2306364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663980.1"
                     /db_xref="GeneID:11513581"
     CDS             join(1816568..1817054,1817138..1817427)
                     /locus_tag="MYCTH_2306364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664028.1"
                     /db_xref="GeneID:11513581"
                     /db_xref="JGIDB:Spoth2_2306364"
                     /translation="MLGLAGSHLGIHGADYSSRALFHRVKAIRLLNQALSTPAASVAE
                     ADARYAATFALAWQASCMSEGMTEFLLMIKGCHIIRNASLLRYKDSLFKAFAQDGYGE
                     SIRKVIGTAPLTLTPDQENIIREFLESLHALAPLCTSPLEVRFLAATERVVKIARVSA
                     AQAFAQFSENYALIFLATNEEFTSFINPDHYPAQLLLIHFILIEFQIGYLALGEAGHR
                     FAFRTKSCIAWMNHLAARLPEEYRKYAEWPMKYVRTLQAG"
     gene            <1819326..>1820066
                     /locus_tag="MYCTH_2111053"
                     /db_xref="GeneID:11513582"
     mRNA            join(<1819326..1819381,1819534..1819851,1819901..>1820066)
                     /locus_tag="MYCTH_2111053"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663981.1"
                     /db_xref="GeneID:11513582"
     CDS             join(1819326..1819381,1819534..1819851,1819901..1820066)
                     /locus_tag="MYCTH_2111053"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664029.1"
                     /db_xref="GeneID:11513582"
                     /db_xref="JGIDB:Spoth2_2111053"
                     /translation="MAYPTRASFATSFKRHFRSRPGTRQNLGRGVLIGVAGATGAGKT
                     SLVNAILEYPELLPSSSTEAATATVCRVAWNYDDTNGHEFRAEIKFRSRNAVVKELNP
                     VLSAMKDRKELRKHESDDENERIYAPSGTSTKASLRSDAFCKGSREALQNAQLQEESF
                     KIKSVSDRFNETNKELKHR"
     gene            1820265..1821384
                     /locus_tag="MYCTH_2306365"
                     /db_xref="GeneID:11513583"
     mRNA            1820265..1821384
                     /locus_tag="MYCTH_2306365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663982.1"
                     /db_xref="GeneID:11513583"
     CDS             1820662..1821285
                     /locus_tag="MYCTH_2306365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664030.1"
                     /db_xref="GeneID:11513583"
                     /db_xref="JGIDB:Spoth2_2306365"
                     /translation="MAWVTYEGILKANGGSFQSKGTRRPFYDFPLALRVFPYLPSSLL
                     DSRCALRGTPFLDDLREDRMQYFQVELPKIREPLIAKASDIWEKDFAEIRSLIGDAAP
                     DILPFFELHQKSSPTKHQHRALREHILVSQVVIRGRLANSSLIHRLAPYRPGPHGGCL
                     PAACGRPPREAAVARPMGRSVAPGSRSACCSKARRRALTTAPATTLR"
     gene            <1822997..>1824303
                     /locus_tag="MYCTH_95125"
                     /db_xref="GeneID:11513584"
     mRNA            join(<1822997..1823377,1823484..1823949,1823993..1824222,
                     1824277..>1824303)
                     /locus_tag="MYCTH_95125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663983.1"
                     /db_xref="GeneID:11513584"
     CDS             join(1822997..1823377,1823484..1823949,1823993..1824222,
                     1824277..1824303)
                     /locus_tag="MYCTH_95125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664031.1"
                     /db_xref="GeneID:11513584"
                     /db_xref="JGIDB:Spoth2_95125"
                     /translation="MAQVWPGLEFVLVNPLTHQEETKTPRRSNWSLYRAAWPVRTVLL
                     SSTNAQSTTPGLLFTGFKSLQGQCSRNSDLFFPYALPFTSSHFHHHVFPILFFICLWF
                     WTSSSTRTWKNFDLVASCCGGVAASYKHVCTVQGCRSKWGVATDSRAVVPDPPPLAVS
                     HPASLPPSLPSPLPPSEESRASPGWGFGECFSKPSESGMVISGYLGKSPLPAPGTRAP
                     SAHPAMANRGSLGRARGGPGGGKGGGALASADAGTEKGTDSLRCIPTQPLQQREPNGT
                     DISELVDQWLRNSGRRQVGSGSRFVRGPGRLQSSTRSRRCNKKKKFAPSIQDCHDPSP
                     GIVALRIIPAIEMEGGQMRAEPTVSYSDTVMIM"
     gene            complement(1828957..1831082)
                     /locus_tag="MYCTH_2306367"
                     /db_xref="GeneID:11513585"
     mRNA            complement(join(1828957..1830728,1830784..1831082))
                     /locus_tag="MYCTH_2306367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663984.1"
                     /db_xref="GeneID:11513585"
     CDS             complement(join(1829086..1830728,1830784..1830883))
                     /locus_tag="MYCTH_2306367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664032.1"
                     /db_xref="GeneID:11513585"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="JGIDB:Spoth2_2306367"
                     /translation="MPMSLEAPVLQVDANVIHKVDTTNPANLFSMWTVFARCRDSVAQ
                     GRRLENLSWRLWNRETFCCEGEEMLMSSCATSQPRDIQYPRETAVEDLPQLSGSVDSV
                     ADEEAVDLNAETTPVDIVRPRMQRQDSCASSRSRGKERHITSDELEKMVVSIMETKSP
                     LSVPLPNLPRSLSTEENKTTKAEQSGSTNTDVRCETPQATSAQPAPAEQTAEPEQEAQ
                     PRTIVTRGFSPSQAPISRTTSLPTSKAPSPCAIPQPTDAPAPKVVLPKKQQAKFALGG
                     SSGSDEESFKNRDVEPRGIAAQPRGKMFQLGGSSGEDSPRPAQQLERAVAADNGQKKV
                     ASFNNEVVTQTYTSSAISDTEDDYLDESAIDDDDEEWEEESAEESGSSMGEEKLQFRR
                     IDSTANLPSRRSLITLMLAANNNRAQRLGNVASQSTSALPRTRASLNGPSLVASPNDS
                     DEAPLMMKRGSSRAPPMRPINEIPRSGAQPSNVTATGMHHQAALSPRTTRRNMLATEL
                     TESLRRNLLRERSQKTSTANAVLKRRHTSTDVANLKQYPERPYMKKDKEVDTDPNSWD
                     KYFQNPFAGYAQAW"
     gene            1848666..1851401
                     /locus_tag="MYCTH_2306375"
                     /db_xref="GeneID:11513586"
     mRNA            join(1848666..1850325,1850473..1850892,1851055..1851401)
                     /locus_tag="MYCTH_2306375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663985.1"
                     /db_xref="GeneID:11513586"
     CDS             join(1848824..1850325,1850473..1850892,1851055..1851196)
                     /locus_tag="MYCTH_2306375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664033.1"
                     /db_xref="GeneID:11513586"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="JGIDB:Spoth2_2306375"
                     /translation="MISIRPRGGASPRSSRQAVAAAPSSRVVPKPVPERETKDARGYQ
                     IEQLRRRYSPQETDLGNGETSFLFHLKPSDPDFPFDLDHLECDLRIPETYPKEAPRLL
                     VKNKNIPRGFAINIEKGWDALVQEKRGATLLSLTNALDRRLESLLSEQKAETVKLTIF
                     KDTRHLNDEPVAEPAPQPAKPVAKPPVSRPYVPEESYTKDQIAEAKARRAQDVRQLEA
                     RLSRLPVYQKSSDGIIYTLSLEPKRRASLPTGLQPVQSVQLIIPLLYPLQPLRILLND
                     VDSEVAEPIEELFAQKAAEQKHMSLTSHLNYLAQNLHVLAKEAQKPPVEAVANPEVQA
                     APSQEAEQAEHTSTLDQGKGHIHVIPRPPEWASDDSTDDSGSEDGSDAEDGEDGGADI
                     EPQQAQAEAGPSLPTQTPERGTAILFPSIELYGVELLQVSVLNLNVKCDRCKTVNEIT
                     GLKDNIEKTSSCKKCAVPFSVRFRQELIHQNSSRAGFIDAVGCTVSDLLPSTFNPTCA
                     ACSTPSPAGLTSVRGETTTNVCRECHARFTFALPDVKFLAYAPGAGSGRPLPAAPGPR
                     RRQERLGLRAGEPLPDRGACAHYRRSHRWFRFSCCSKVYPCDRCHDAAESHTNEWASR
                     MVCGWCSREQRYSPESCAFCGRSVIGNRGKGYWEGGKGTRDPRLMRRGDKRKYKRLGA
                     QKKET"
     gene            complement(1855917..1857834)
                     /locus_tag="MYCTH_2306377"
                     /db_xref="GeneID:11513587"
     mRNA            complement(join(1855917..1856306,1856384..1856954,
                     1857010..1857408,1857463..1857834))
                     /locus_tag="MYCTH_2306377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663986.1"
                     /db_xref="GeneID:11513587"
     CDS             complement(join(1856038..1856306,1856384..1856954,
                     1857010..1857408,1857463..1857474))
                     /locus_tag="MYCTH_2306377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664034.1"
                     /db_xref="GeneID:11513587"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="JGIDB:Spoth2_2306377"
                     /translation="MFSQKKPYSAVTVTIERLTSEAVPIDDLSGIPDLVEVVNLQDTG
                     PSEASRAIRKKLKYGNLHRQLRALTILDGLIQNAGPRFQRSFADEALLERLRFCGTAG
                     LSDPEVKKKCTELFASWAAEYKNTPGMEQVARLYKELPRRKRVVTQEQSKVIKETENP
                     FGEDEEDDDDRPSSAGPSKGHSRTSSQSNPLAKQTYTGYDTKKKKDKKTKKSKPFNLL
                     AEQDKMKTCIADANIAATNLMNVLQTINREKERISENQIAVLRFEACKDLRRKILRYI
                     HNVESEQWLGSLLNANDALVTALMTFEQLDRSIDADSDSDDELAAQAHLYRMATEKAK
                     GKEPSSPTSPPTQALAGMHLGSPSSPARPPPPPRPSAATKPSMLPPRPQAAPDSDVDA
                     DTEDDEDDDEDNPFADRNAVSKGE"
     gene            complement(1858334..1860420)
                     /locus_tag="MYCTH_2093740"
                     /db_xref="GeneID:11513588"
     mRNA            complement(join(1858334..1860060,1860118..1860420))
                     /locus_tag="MYCTH_2093740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663987.1"
                     /db_xref="GeneID:11513588"
     CDS             complement(join(1858539..1860060,1860118..1860251))
                     /locus_tag="MYCTH_2093740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664035.1"
                     /db_xref="GeneID:11513588"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2093740"
                     /translation="MATISASRAAPSSDVNASHPYTCNTCQVAFRNSDLQKGHMRNDW
                     HRYNLKRRVASLPPISSEVFTEKVLQARAETTAQADKAGFERSCETCQKTYYSENSFR
                     NHLSSAKHKTRAAALASRSNGKNDDEASSMSFSLGEPAAESQVDSDAEEEFNEVVDAL
                     KHTNIHEPVSPVKRPSNPHLSAEAQNKPDHPLSQTSSGQESSTTTPSPPTPTGTKPAA
                     AAPPPQTCLFCNYESPTLQLNVSHMERTHGLFIPEKQYLVNLEGLIGYLQEQVFIFNE
                     CLTCGKVKANVFAVQTHMRDKGHCQIPYTTEEEQLEIGEFYDFRSTYSDGEGDWVDES
                     DDDDEQQNGGVKLGAKRESRLVGEDGDEVMDDENWETDSDASSLDSNDLHAVPAEQHY
                     HQYDRLNKHPHHSRSTPRTHRQAGGFHRNAHKRPHAVFYDDYELHLPSGKSVGHRSLS
                     RYYRQNLYHYPTPQERAERLAIQDADRSNEMEVDSEQRPRGRALIPRDVRGLGVASLD
                     DRRTRAIVTKGKKQEWANQKSKGMLQARLAIKEKAPHPATYMR"
     gene            1860961..1865726
                     /locus_tag="MYCTH_2306381"
                     /db_xref="GeneID:11513589"
     mRNA            join(1860961..1861503,1861562..1863831,1863889..1865726)
                     /locus_tag="MYCTH_2306381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663988.1"
                     /db_xref="GeneID:11513589"
     CDS             join(1861277..1861503,1861562..1863831,1863889..1865408)
                     /locus_tag="MYCTH_2306381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664036.1"
                     /db_xref="GeneID:11513589"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="JGIDB:Spoth2_2306381"
                     /translation="MTRDAMRPASAGSHSRKNAEDLDLLAGLWEEARFARLPWDAPSE
                     LRDLVEDIDNPKRVYAIHKASRRHNFQQLVQKYIVQLREGCGAEYCTTSTCFTCRKRI
                     AGQAPVRRYNTTSARTLAVYLASQDNPENGLCPYLRPPKAPPAAVNSLIFLPNHKSRQ
                     RNERVLSASPKTQAAKSRPSSPKTGGGSGLSSACPRSRSATLNGDSKDRVKHASNRAG
                     SDAEKESRHPNFTVIEQPSTKDHRSFAANVFGTVAFKMLEWLTPAAIEDMHERVRVFG
                     GRREPVTEDVVPSKVADKPEEETARSEPRALEEFPVLPVGTDGESPSKRGPSVHGQPE
                     KEARGLKNGQPQHESQSCPRSTNARRNSNATVRTPTGPKPKRQLSVDPHAQDISAEET
                     YATLLKSPRATGSGSDKGPRVPKAASSSLTRPISQLSSAGFFDDVVLEKMPPPKTVDI
                     KRKTSRDMLNGPGSGGSHSPKAPSPVSGGSSEELRAESPSATADRYSELGDEALAPQA
                     LTRLNAEVVDFVCDVIQEDGTAEKHMLEPQTISRSHNGQSGQAKLVRRKHKSGRRRDA
                     SNLRMEWKLFVEQSFFYVLSDPQLALRSFTKKGQLYDSQTLWYCMLRMTRVAPSLVFH
                     SLWMAAASLFAPPKALQNLRSPTTRVFPRTEQALSNLEAGRLISICLHALIAAAPLVD
                     DSRQLFDMSRIRSHGLSLADSGAVARQPTELCLQYEDAFTDPMALRLARRLFAAIATR
                     RHFDALIESNIGPQERGEEDVLAPLFSQLDFLNMDAVYVLDFSFPDRALHETRVPILL
                     LDWARAVMLNDWDGAPEVPGDGPFGGALALIEAMYKRRQELLLADAQFRSDYFAERLD
                     TLKMPLSWLSHTSTRQRLHLLDFPYMFSPSTLVSYFRSINFARMSRAFEEFASFQDKM
                     AVMAQRAGLTQHHKDVLAERLRPAGSKYLILDIRRSTVLEDAFDQLWRREERELLRPL
                     KVHLGESTGEEGFDSGGVQQEFFRLAIAQALNPDYGAFTVDERTRMAWFLPGSMEDEW
                     KFELIGLLVSLAVYNGLTLPVTFPKALYRKLLGEPVTELHHIADGWPDLASGLTSLLE
                     WDEKDGAVEDVFARTYEFSVSAFGQHITREMKPLSDSLHQHGRDSEDEAWPQFAKTLS
                     QSSSQPAPHQGNPAEDEAPLVTGANRNAYVSDYIRYLTDVSVRPQYEAFARGFHTCLH
                     PKSLSLLTPSLLQSVVEGVQEIDIAELKRYARYVGWDASHRTVKDFWSVVKRYDENMK
                     RKLLEFVTASDRVPVGGVKNLMFIIQRNGEEEDPAGRLPTSYTCYGTLLLPEYKDKEM
                     LRERLGMALENAQGFGFA"
     gene            complement(1865676..1868043)
                     /locus_tag="MYCTH_2306385"
                     /db_xref="GeneID:11513590"
     mRNA            complement(join(1865676..1866402,1866462..1867578,
                     1867637..1867685,1867748..1867765,1867830..1868043))
                     /locus_tag="MYCTH_2306385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663989.1"
                     /db_xref="GeneID:11513590"
     CDS             complement(join(1865944..1866402,1866462..1867578,
                     1867637..1867685,1867748..1867765,1867830..1867839))
                     /locus_tag="MYCTH_2306385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664037.1"
                     /db_xref="GeneID:11513590"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2306385"
                     /translation="MAMNLDLSNASVMQDEHGRPFIVVRDQGKKKRQHGNEAVKSHIL
                     AARTVANIIKTSLGPRGLDKILISPDGDITVTNDGATILQQMEVTNHVAKLLVELSKS
                     QDDEIGDGTTGVVVLAGALLEQAAELIDKGIHPIRIADGYDQACDIAVAELDRISDVI
                     EFSREKTENLVKVARTSLGSKIVSKAHDQFANIAVDAVLSVADLERKDVDFELIKVDG
                     KMGGALEDTVLVKGVIVDKDFSHPQMPSEVRDAKIAILTCPFEPPKPKTKHKLEISSV
                     EEFKKLQNYEREKFVEMIQQIKDAGANLAICQWGFDDEANHLLLQNNLPAVRWVGGPE
                     IELIAIATNGRIVPRFEDLTPEKLGTAGIVREMTFGTTREKMLVIEECANTRAVTVFV
                     RGSNKMIIDEAKRSLHDALCVVRNLVRDNRVVYGGGSAEIACSLAVEDAAVKTPGLEQ
                     YAMRAFAEALDAIPMALAENSGLNPIATLAEVKSQQVKDPAGRGRLGVDCMGRGSNNM
                     KEAFVIDPLIGKKQQLMLATQLCRMVLKVNNVIVSGSGEEDF"
     gene            1868555..1871523
                     /locus_tag="MYCTH_2306388"
                     /db_xref="GeneID:11513591"
     mRNA            join(1868555..1870033,1870088..1871523)
                     /locus_tag="MYCTH_2306388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663990.1"
                     /db_xref="GeneID:11513591"
     CDS             join(1868737..1870033,1870088..1871475)
                     /locus_tag="MYCTH_2306388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664038.1"
                     /db_xref="GeneID:11513591"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="JGIDB:Spoth2_2306388"
                     /translation="MSRHQYIRKLDYEDALDEYEGYSENEEEDELSPEDRALMSQGTA
                     EVQAALGVEASKVTVAQIEEALWHYYYDVDKSVAYLISKYVNPRPKATKPATRPPNGK
                     SVTHTFEPTAATFSLELGKPVHWAAKYVDLTDAGLQATQTCPESSTPSFQMTRSLPHF
                     GTTSHVLQPASETRVPLSSLFWDMPWGNVPKERQTILVPPLAPRGGLLGGSGGPPKMS
                     KLQALAAARKKKAEEKKAVNDKVEGARAKMEDLAVEDTQCGGKSVPSNGLSNKRLKTS
                     DPSPEGQSVPVFGPKPTRLKASQPLDVGAAAPSGQLQAVTAQAAESEQPVSMAEPSTF
                     AQLLCGEPSAAHRRRTPEKAVFVGFGCGYGVDNKGEPPKKPSTSVDWFDIRKRKADDS
                     DDFEEVVVLYPNLPQSVKDVFAQPSPDDIVLAAQAKAKTKAGAKTAEAQPKKKGTPST
                     DAVTAGVDGLKISDAPLPKSKNLNVLSELEKSKPKRSASFVVVGHVDAGKSTMMGRLL
                     LDLKVVDQRTVDKLQKEAKTEGKGSFHLAWVLDQRPEERSRGITMDIATRRFETERTA
                     FTILDAPGHAEYIYNMIAGASQADFAVLVIDASTDAFESGLKGQTREHSLLIRSMGVS
                     RVVVAINKLDTVAWSQERFNEIKDQMSGFLSTANFQPKNIAFVPVSGLYGDNLVHRSS
                     NPAASWYTGPTLIEELENSEPSTRALEKPLRMTVFEVYRTMQSPVTVSGRIEAGSLQM
                     GDALLVQPSGQRAYVKSILSNDAPADWAVAGQNVVLHLSQIDPIHVRDGDIICDPAKP
                     VLRADTFTLKALAFDILMPMPVEVHRGRLNQAGRIAAIPALLDKTSGTVVKKKPKIVK
                     PGMVARIVVKLESQIPLEAGQRVVLRSGGQTVAAGLLE"
     gene            1873120..1876203
                     /locus_tag="MYCTH_2315513"
                     /db_xref="GeneID:11513592"
     mRNA            join(1873120..1873443,1873511..1873530,1873671..1873723,
                     1873787..1874064,1874132..1875497,1875558..1876203)
                     /locus_tag="MYCTH_2315513"
                     /product="glucose-regulated protein"
                     /transcript_id="XM_003663991.1"
                     /db_xref="GeneID:11513592"
     CDS             join(1873312..1873443,1873511..1873530,1873671..1873723,
                     1873787..1874064,1874132..1875497,1875558..1875697)
                     /locus_tag="MYCTH_2315513"
                     /codon_start=1
                     /product="glucose-regulated protein"
                     /protein_id="XP_003664039.1"
                     /db_xref="GeneID:11513592"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Spoth2_2315513"
                     /translation="MESRTRSWALGLSFIGFFALLFSLGFVQQVKADDVSEYGTVIGI
                     DLGTTYSCVGVMQKGKVEILVNDQGNRITPSYVAFTDEERLVGDAAKNQAAANPFRTI
                     FDVKRLIGRKFSEKEVQNDIKHFPYKVASKDDKPVVKVEVGGTEKTFTPEEISAMVLS
                     KMKETAESYLGKKVTHAVVTVPAYFNDNQRQATKDAGMIAGLNVLRIVNEPTAAAIAY
                     GLDKTEGERQIIVYDLGGGTFDVSLLSIDQGVFEVLATAGDTHLGGEDFDQRIINHFA
                     KAFNKKHGVDITTDAKAMGKLKREAEKAKRTLSSQMSTRIEIEAFYQGKDFSETLTRA
                     KFEELNADLFRKTLKPVEQVLKDAKISKSDVDDIVLVGGSTRIPKIQSLIEEYFGKTA
                     SKGINPDEAVAFGAAVQAGVLSGEEGTEEIVLMDVNPLTLGIETTGGVMTKLIPRNTP
                     IPTRKSQIFSTAADNQPVVLIQVYEGERSMTKDNNLLGKFELTGIPPAPRGVPQIEVT
                     FELDANGILKVSAHDKGTGKGESITITNDKGRLTQEEIDRMIAEAEKYAEEDKATRER
                     IEARNGLENYAFSLKNQVNDEEGLGKKISEEDKETILEAVKETQDWLEENAATATTED
                     FEEQKEKLSNVAYPITSKLYSGGSAGGDDDEPSAHDEL"
     gene            complement(1876668..>1878134)
                     /locus_tag="MYCTH_2144232"
                     /db_xref="GeneID:11513593"
     mRNA            complement(join(1876668..1877245,1877322..1877958,
                     1878071..>1878134))
                     /locus_tag="MYCTH_2144232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663992.1"
                     /db_xref="GeneID:11513593"
     CDS             complement(join(1876927..1877245,1877322..1877958,
                     1878071..1878134))
                     /locus_tag="MYCTH_2144232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664040.1"
                     /db_xref="GeneID:11513593"
                     /db_xref="JGIDB:Spoth2_2144232"
                     /translation="MTAARLTRATDPTAHCITYVFSTRVIISIHITNGRQETTIIIQA
                     VSVYGQPPGLSVQAPVKPLKPLSHEPGGPHTVSVRLVAVRGGYDEHTVRRWAETGQCF
                     VRLDWGFPNCNYPKFTTRHLLTSPGASSGDVSFSGGLDWAERMLNALRQLHATDYPDP
                     PPPPPPRPLLLLPTPTPSSRGPLARLLRAKTEDGCPASAARELDDDQVSNSSVATCLT
                     AASDSSAAFSEPPEPTTTTTTATATMNDDDHRHANEERTGDGDGDSDGDGDSDGDGDS
                     DGDGDSDGDGDGDGDGDSDGDGDGDGDNVDSDGSSQVGQEEEEEEGERRQSSRYWYPP
                     GLPRF"
     gene            1878796..1880118
                     /locus_tag="MYCTH_2306396"
                     /db_xref="GeneID:11513594"
     mRNA            join(1878796..1879853,1879911..1880118)
                     /locus_tag="MYCTH_2306396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663993.1"
                     /db_xref="GeneID:11513594"
     CDS             join(1879063..1879853,1879911..1880004)
                     /locus_tag="MYCTH_2306396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664041.1"
                     /db_xref="GeneID:11513594"
                     /db_xref="JGIDB:Spoth2_2306396"
                     /translation="MVRRRQRHDWRPLTLHDIGYNNRRIDVEVFLNGSTLTKVPAYGS
                     TDWEENWIAAPIAQALIGCYTFEEGASFGERGRIEYTRSLNLTIMINGKSADATFRVL
                     ENAENRVNVPMLVGEATIREIWGEAWPPSHLPPSRAPPLPLPLNTPPAPAPHQPGTDV
                     HTACSSAPEVYGQTAEAPFAYPQFPSGYSYDSFGFSSGTPFNPAIAHQGSLPVMSTPW
                     PTGAGYALVDLTGTSAAGFSSAQQAGGIATLLDHADRQPVEGDFENLAVLRCIQAHEP
                     VVRTQQDAGPSASNVVWP"
     gene            <1880788..>1881367
                     /locus_tag="MYCTH_2046242"
                     /db_xref="GeneID:11513595"
     mRNA            join(<1880788..1880860,1880910..>1881367)
                     /locus_tag="MYCTH_2046242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663994.1"
                     /db_xref="GeneID:11513595"
     CDS             join(<1880788..1880860,1880910..>1881367)
                     /locus_tag="MYCTH_2046242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664042.1"
                     /db_xref="GeneID:11513595"
                     /db_xref="JGIDB:Spoth2_2046242"
                     /translation="VRFTNVEDLFNLINHTTRDFLIVTHVSPRHFTRIEREREKRHRK
                     FRFRRYESDTQILFITIPTGVLEALHLELNSIYLEELLRMGLSHSWSLMGATTFRQDH
                     PRENSGEGDSTGGPRPERTKGRWPTLVIEAGHSETLQELYNDMRWWFRASNHDVKIVI
                     LAKFDHQQRHILLEKWE"
     gene            complement(1882424..1884632)
                     /locus_tag="MYCTH_2306401"
                     /db_xref="GeneID:11513596"
     mRNA            complement(join(1882424..1882706,1882853..1883829,
                     1883967..1884070,1884161..1884632))
                     /locus_tag="MYCTH_2306401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663995.1"
                     /db_xref="GeneID:11513596"
     CDS             complement(join(1882643..1882706,1882853..1883829,
                     1883967..1884070,1884161..1884197))
                     /locus_tag="MYCTH_2306401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664043.1"
                     /db_xref="GeneID:11513596"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="JGIDB:Spoth2_2306401"
                     /translation="MGINNPLPSSLGSECKKCAKILTSFIDPRQAFGPEKVIPPSILA
                     NAKGLAILTVLKAGFLGSGRFGSGLVVARLPDGSWSAPSAIATAGAGFGGQIGFELTD
                     FVFILNDSSAVKTFSQAGSLTLGGNVSIAAGPVGRNAEAAGAASLRSVAGIFSYSKTK
                     GLFAGVSLEGSAIIERKDANARLYGRPVSARELLMGGERPPPQAAPLLSVLNSRIFRG
                     IGGPGGMADDRMYNDIPVYDDHRDEVVWGGKTGPAYGEGQPRDGGYGGGGGYGVQAHD
                     EFGRPKRSTTWQDDVYDQQPRSFGQQPPSRSSTFHHDGPPGRPAAPKPNYASKEALLK
                     KNEAIALYNFEPDQPGDLGFKKGDIITVLKKTDSDNDWWTGMIGTRHGIFPSNYVKMR
                     E"
     gene            1885017..1886201
                     /locus_tag="MYCTH_2315516"
                     /db_xref="GeneID:11513597"
     mRNA            join(1885017..1885534,1885689..1886201)
                     /locus_tag="MYCTH_2315516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663996.1"
                     /db_xref="GeneID:11513597"
     CDS             join(1885400..1885534,1885689..1885847)
                     /locus_tag="MYCTH_2315516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664044.1"
                     /db_xref="GeneID:11513597"
                     /db_xref="JGIDB:Spoth2_2315516"
                     /translation="MSEAYERERQNNARLDELSAKVSALRGVTIDIYDSARSHEVIDS
                     TSETFSSMGSQLRGSASRLGRMAAAGNKVAIFKLSTIIIGSVLVLYYIWRLLF"
     gene            complement(1886230..1888286)
                     /locus_tag="MYCTH_2306407"
                     /db_xref="GeneID:11513598"
     mRNA            complement(join(1886230..1887933,1887989..1888286))
                     /locus_tag="MYCTH_2306407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663997.1"
                     /db_xref="GeneID:11513598"
     CDS             complement(join(1886375..1887933,1887989..1888106))
                     /locus_tag="MYCTH_2306407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664045.1"
                     /db_xref="GeneID:11513598"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="JGIDB:Spoth2_2306407"
                     /translation="MSRRPPNPAAERAAQNQQTIKNLLKLEPNKVCADCKRNKHPRWA
                     SWNLGVFICIRCSGIHRGMGTHISRVKSVDLDAWTDEQLQSVLNWGNARANKYWEAKL
                     APGHVPSEAKIENFIRTKYELKRWVMDGPMPDPATLDAEGDDDVPLSVVKEKQNVERR
                     ESVRKASAGQSATPQADLIGGDPILAPAAPAPAPLRASSTGPTAMQVPAKSSPAPPKA
                     TSTKDSLLGLDFLGTQPAAPPRPASTTGTPSGTQSRPDLKQSILSLYATAPRPQPQPA
                     AQQASHAPSGSLSGISSPAGMSQAQGSLGGLNDAFSSLSFSSAPSPKPAQTDAFSSLG
                     SFTSSRPAQQSSGSTFSALSGGSFFDSKPAASAHQSKQSIGSSSGWGSTSPPAAAPKP
                     AAAPASSALGDLFDLSAPSPPAAASQPAAAPTTASTSSSIFNLSANQPKSSPPATSAT
                     ATSNPLDPLGSNGWGGSDVWGGNAWATAETSKASPEPAKPALGGTTSSDWASLASKPI
                     VPGASGGFVPKVAADEEFGGWTSSTTATDSTIKPAGGLAGADDLFSNVWE"
     gene            <1889061..>1889574
                     /locus_tag="MYCTH_2127855"
                     /db_xref="GeneID:11513599"
     mRNA            join(<1889061..1889118,1889180..>1889574)
                     /locus_tag="MYCTH_2127855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663998.1"
                     /db_xref="GeneID:11513599"
     CDS             join(1889061..1889118,1889180..1889574)
                     /locus_tag="MYCTH_2127855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664046.1"
                     /db_xref="GeneID:11513599"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="JGIDB:Spoth2_2127855"
                     /translation="MTVYPDQRTPEEWRAVLSPEQFRILREKGTERPGTGVYDKHYPD
                     KGIYACAGCNAPLYKAKHKFASGCGWPAYFDSIPGAVVRHEDRSLGMLRTEIVCANCG
                     GHLGHVFKGEGFPTPTDERHCVNSISLVFKEDEGDEEKGQVKEEGTKA"
     gene            complement(<1889799..>1890929)
                     /locus_tag="MYCTH_53690"
                     /db_xref="GeneID:11513600"
     mRNA            complement(<1889799..>1890929)
                     /locus_tag="MYCTH_53690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003663999.1"
                     /db_xref="GeneID:11513600"
     CDS             complement(1889799..>1890929)
                     /locus_tag="MYCTH_53690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664047.1"
                     /db_xref="GeneID:11513600"
                     /db_xref="JGIDB:Spoth2_53690"
                     /translation="ERSSYDQGLVSGAAPFGSWRLPGQPNAPTYKPRSDTGQPNTSSP
                     HLTSEPTAQGPRPPRFEGYPILSSLQRPPSQPIGPPAALRADQRPWSPAFVPSRPATT
                     LGVPGILGEGIYKVSKIGPASSGRPRVRRTTAVFEHQGPRMYTISKPFDKSISKIDAL
                     HATRGWHPRQRLSSSLQDDPIRYVTRPSTLGVSKGQTPGKLGEDHQASETYGNMSSSL
                     EGFSVDKQRPARIRRLVTIDNASYSRQPSEFDEKIQQSPLFNAFEETRGHVPPKSESS
                     QNNIDDAIIFSSSPTLFESPTDPDMTDDWLLQVSQAQHQGLAQASSIWDDFVEKASKD
                     MASAEPSDGLADILSKYENEFAERWNGVVVATAHQMREHKKY"
     gene            1892160..1895959
                     /locus_tag="MYCTH_2306410"
                     /db_xref="GeneID:11513601"
     mRNA            join(1892160..1893284,1893340..1895959)
                     /locus_tag="MYCTH_2306410"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664000.1"
                     /db_xref="GeneID:11513601"
     CDS             join(1892348..1893284,1893340..1895438)
                     /locus_tag="MYCTH_2306410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664048.1"
                     /db_xref="GeneID:11513601"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="JGIDB:Spoth2_2306410"
                     /translation="MAPTKPTVEHTVDRTPEYEKFIEELRAFHEKRGTNFDPEPKMGN
                     TTVDLLKLFKYIVQHGGYDKVSDEKLMWRKMCEGLGLMRHNAPADAYTLKQIFYKNLA
                     AYEIKTIHNKEPPPPEILEFTTAKGGSLLTRTLETYQARSKADREGSTEDGTPSRERR
                     AEDTPTSSRASRGLREAPAPRVIFHPDTNPTRQTRNASAQHSGASGSTTHSQAHSQSH
                     QNSQSHSGTPAAMHQSQPHPGRGAPSALYNPPGPDMSNPLVQSYQPQPPQQVPLRIVD
                     TPASNPDLFAKKQRLQRQPAAPAPNPASLVRASLPPGTLDGPNIYERCLLALRSGIQA
                     EQAFGLNHLVKISYERGDKYKFSQFSGLAEGLTEFALGVGKLFYDVEWTISNDPDYDD
                     GEIGELDGINGTADILERIAQLKPKDLQDNFQPAEFTDQLVLITEAVLTIRNMVMLPE
                     NAWFISDYPPVKDLICILLHLPPLDLVVELKHCALDIAEQITPHLVLDSEDPLYQTLL
                     SQLQSSDRGIILAALRALGRIAMNHPTETNQLGGVPPAILQSLIDWLMLNDDELVDAI
                     LDFLYQYTAVVSNLDVMLEGTNVEHLVVHLVRLLSHGAKRSQREVVLSEARLAYEPAS
                     EHVIPIPKDLQERLLAMEEPERCYAWLRCFFEEDPEAQITQIAIWQAYNAAFLESLKR
                     MGRTMINAPEFIRHISTVYQNAGAQVVREANGESQKFIMRGIRPRTFPITIDGRGYFQ
                     CQWQPAPGQQHIQCRTWNTTAEKMWQHILADHLGEAPTSEDGKFQNREGTYTCAWDGC
                     AKYPKPTRLQLAQFMTHIKTHLRAEEARRAAETAAVLAQPDIPSTPHGGSTVAASPSK
                     QRGSISGAGAAGGGSIPKGARVIRPATTITLTYEETASARDERNPNAPPQAAGIPLSA
                     ALILRNIARNVVKTAAEERLLASSSSAQQGGGGVEGESNKAKDSGVGIKGGWNERLFR
                     PVMPRLWEVFTENRLLAPYMTSLFQLLEREREEYAFGDY"
     gene            1899515..1902250
                     /locus_tag="MYCTH_2315519"
                     /db_xref="GeneID:11513602"
     mRNA            join(1899515..1899593,1899870..1900990,1901086..1902250)
                     /locus_tag="MYCTH_2315519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664001.1"
                     /db_xref="GeneID:11513602"
     CDS             join(1900620..1900990,1901086..1901815)
                     /locus_tag="MYCTH_2315519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664049.1"
                     /db_xref="GeneID:11513602"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2315519"
                     /translation="MAAAARTARLAPRLASISRPAVARAGVSSVAQRAAFSVSARRTK
                     SEVIKETEVPVTVYSPDHKGVASSNSDHFSIPVKNGAASAPEAAAEDLDAVTPLQDKV
                     YRQMPRTLQKMSVYGKVIIVTGGARGLGNHMARACAEAGAKAIAIFDANQELGDEAAA
                     ELHQKTGLPVSFFKVDVRDGNAINAAVQNVVDLYGAPDVLVNSAGIADSNIKAETYDP
                     AMFRRLIDINLTGSFLMSQSVGRAMMAAGKPGSIILVASMSGSIVNYPQEQSCYNASK
                     AGVIQLGKSLAAEWAKYNIRVNCISPGYMDTALNKVPALDAQKKIWKSLTPQERLGAV
                     DDLNGLCVFLASDASGFMTGSNVIIDGGYTLY"
     gene            complement(1903410..1906506)
                     /locus_tag="MYCTH_2306416"
                     /db_xref="GeneID:11513603"
     mRNA            complement(join(1903410..1904147,1904263..1904597,
                     1904705..1906049,1906109..1906506))
                     /locus_tag="MYCTH_2306416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664002.1"
                     /db_xref="GeneID:11513603"
     CDS             complement(join(1904046..1904147,1904263..1904597,
                     1904705..1906049,1906109..1906399))
                     /locus_tag="MYCTH_2306416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664050.1"
                     /db_xref="GeneID:11513603"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2306416"
                     /translation="MGHSPPALRQSATFPTSDFPTLNEKASAPRSNGAGPHKRYSDEG
                     KESKLPSMLRKKSGFSGFMNSLVGSPKKPQISAPENPVHVTHVGYDSTTGQFTGLPKE
                     WQRLINESGITEKDTREHPQILVDVLTFYKETQEKPQEDQQLEKFHDARAADFRGLAT
                     PLSATALPSPGMLQTGYGAMSPMISPPASPRFPNVAHEGSFENPRAPPPVPKPHIKDL
                     NLMPSRPAPKPPTNHVPRIQPAYPAKDSGIGMPQPGEDASPSYLPPKDNVPMLPEEHR
                     SRSRSNSRANGTPPYQSSHPSPSVTSPVTQTAAYQQQLLQQQQEQAMAQAQAAMTGQL
                     GRQASKRQQPTPPASQHQHLQQQTDPNGANRMPPPQQARVAQPGSRPRHRPRQSNGVD
                     VVAALKRICSEGDPREIYRGFTKIGQGASGGVYTGHERGTNRLVAIKQMNLEQQPKKD
                     LIINEILVMKESSHPNIVNFIDSYLCGGELWVVMEYMEGGSLTDVVTFNIMTEGQIAS
                     VCRETLRGLQHLHSKGVIHRDIKSDNILLSMEGNIKLTDFGFCATINEAQNKRTTMVG
                     TPYWMAPEVVTRKEYGRKVDIWSLGIMAIEMIEGEPPYLTESPLRALWLIATNGTPQI
                     KNEQELSPVFRDFLYFALKVDPEKRASAHDLLRHDFMKACVDLSTLAPLVRAAREARA
                     QEKARKGQ"
     gene            1909808..1914058
                     /locus_tag="MYCTH_2306421"
                     /db_xref="GeneID:11513604"
     mRNA            join(1909808..1909964,1910057..1911813,1911885..1912843,
                     1912899..1914058)
                     /locus_tag="MYCTH_2306421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664003.1"
                     /db_xref="GeneID:11513604"
     CDS             join(1910117..1911813,1911885..1912843,1912899..1913872)
                     /locus_tag="MYCTH_2306421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664051.1"
                     /db_xref="GeneID:11513604"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="JGIDB:Spoth2_2306421"
                     /translation="MSSAAMSSDFPELGSGPKPAANVAPVWLARAPGASAPASGRASG
                     ATTPVPEASTVPSLSIPGQNKEYLLLHPDDILPREQLKRPLPDIVKDFNRKSRAQIKI
                     VPHAENMLRIEATGPKSDSTTQALKDFVGLIGAKLKLELDIHRWARPHIIGKGGATIK
                     AIQEKTGARIHVPKEDGHAAPAGEDDDELIKVVIEGNTQQAAHAQNLIYEIMGERAGT
                     VSLTLKDVPAEFYPFIAGADNSNIKPIEQEFGVQINVPAAQPSSSTPPVPVASGRPEF
                     FAAADSFIQLRGERYAAKAARAKIEERVQELRDQLTVQPVHIQPGRHQFIIGEKGISM
                     EQFFEETGCTIVLPNDEEDDMVRVVGPADQAAVGVQKTVDLAMGMQCSNFDISRFYRQ
                     APGGAAVHARNVTRYLRQKRELERLGNLYSVHFNTPFSEQGALPWELYARDGANIVRA
                     QAEIKALVDAHPPARMATVTVDPFYYQYIRKEVLPHVRQTYGVHLVIPENSEPNAPLL
                     LVYEGPSNPESYEIAREQPKQKDISEMQKGLQDAQSYILGLMSEREPIASKTIEVPVK
                     FHPRLQKFIKNEQDNASNPIRARVSNTGESVHIRGPSSVVEWLVAKCLDFVEREKQDE
                     KERGFTLEFDFPQKFANHLIGKGGSHIRELREKFDVEIQVDDGKVQLKGPKAKAEAAK
                     AHITALARQLQDETTYVLKIDPKFHREIIGAQGSQVNKLQTRYKVLIFFPRNNAKGTK
                     DDESLADSSSDAGKGRRQQAPDEVIVRGPKRGADEAREELLSLLQYLKDTSFTATVTV
                     QKKQLPSLIGSGGAALEQLRQETGAKIDVPSAKESTEDQVDIQIKGTKAQVAAAKKIL
                     EEKKAIFEDTIVKKIDVPRKYHRALIGTGGSTLRDIIVKAGGSSDQREMARTIQFPKQ
                     DADGDTIKVEGRSEIVDKIVARIEAMVAERESQITETLDVPVEKHRSIVGRGGETKRN
                     IEAQFKVSIDVPRQGSGSTSVKIVGQSPDVEKAKAHIEDLVKEQPGETIMVPRALHHA
                     VSNNGQIFRKFKSEYGVTVDHAGQPIPPKPAVATNARANGGSLPLITDDEDAIADAHS
                     WKVVEQASTEEGDIPWVLRGSPENIEKAKNAIKSALDQANKQNATGYLVLPDPKTYRF
                     VIGQGGSKVNSIRKQSGCKITVPRDQTQGDAIEIVGTKEGVEKAKELILAAVKEGLSS
                     RSPRE"
     gene            complement(1914059..1917510)
                     /locus_tag="MYCTH_2306422"
                     /db_xref="GeneID:11513605"
     mRNA            complement(join(1914059..1916631,1916720..1917114,
                     1917174..1917510))
                     /locus_tag="MYCTH_2306422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664004.1"
                     /db_xref="GeneID:11513605"
     CDS             complement(join(1914245..1916631,1916720..1917114,
                     1917174..1917361))
                     /locus_tag="MYCTH_2306422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664052.1"
                     /db_xref="GeneID:11513605"
                     /db_xref="JGIDB:Spoth2_2306422"
                     /translation="MAASGVKETGRPLTIEELCFTSAMSCFEGWLKLDPAIGPRTMAY
                     VTKFISRTLEKTHNLKDVRETLSKSVEVWIWLTRDFAAAIPSLTTRSIGPLSSLNDPD
                     KGVTPLESTALITKNYPSLKEDLQLLIKLMHIARNLLVVPEPEIPQDLCAAAQFDQML
                     YQTIILCINVTSKAYDGDVLEEAARLKLSDITELYKKLLVTCLQQAHNWIAKNDRNKM
                     AFWSTVLFDDDALSDESDGNAYGEFRPDVAKAEVQNWFERNSRFCDKARQLLTEYEKT
                     VASKGLPPGHLPCISPLAWNWLPEGTVRVRADDIGDDTKITPQWKEDEPDKFEQDKAY
                     GRVSREVDTWWLRVRDPNYDEWVVPMPTVEFAQQRTENCKANLVNRYAHPYRPPEHEG
                     SVHSAEGAPAPEGSADQEGKDGGHYVHDYNDDMIEDEDIDDDDSYGEGPMNGLLTEVP
                     NILDPKQIEALHMIVKSCILDNAGLALSRAGENLQKTRCRMFLAMECGRSLLREILVF
                     IAVWEKSEQSLIFQLTTQIVEAIHHSALIPFAWQSLRIPKDIISPAQTVLLRLINNMF
                     RARNNDPPPPDSKEHLRDVKLLHFLFIQIRSRIVPECAALMHLQAQIRNDLCDPADFP
                     VDSWDMERAKDGIQQFLELFTTVNELPETRQYLIEWEATYELLTLLKGLEAGVPKKPM
                     VEMPNRHNKPRQNAQQQQQPPPHPDDPDAGYDSEDRPLAPPPPLEEPAHKYPWAGIKG
                     QILHILAGLLQPPPGRSSPGNPEVQSQILRHNGIISLLNCCVYDDHNRYARERVQICL
                     KWLMDGSEEANKYLRELIAMSPPPDLRAPQQAQGSDGAAAAAPPQPQTTTLRIDGVAG
                     EVKVRLRVPGEPVPPRPIIPSAAAAITTSSSSSTAPGSAAGAADDHSSNNKTNNENAN
                     NALPPIQGSRAGERASGAGPAASSSSSSALPPPRSRPEELLRDIITLADEAARLAMGR
                     PLEGDETEEEGGEDDFM"
     gene            1918027..1919596
                     /locus_tag="MYCTH_2306426"
                     /db_xref="GeneID:11513606"
     mRNA            join(1918027..1918311,1918475..1919596)
                     /locus_tag="MYCTH_2306426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664005.1"
                     /db_xref="GeneID:11513606"
     CDS             join(1918272..1918311,1918475..1919370)
                     /locus_tag="MYCTH_2306426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664053.1"
                     /db_xref="GeneID:11513606"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="JGIDB:Spoth2_2306426"
                     /translation="MTVDVQSLPTVFDRPVHIAVIGGTGLSSLPGYHAVAALSPSTPW
                     GNPSSPILILEHAGVPVAFLARHGLHHQLAPHEVPSRANIAALRSIGVRTVIAFSAVG
                     SLQEHIKPMDFVVPDQIIDRTKGVRPFTFFEGGVVGHVGFADPFDARLAAVVRRCAAS
                     MRGDGVVLHSGGTVVCMEGPQFSTRAESHMYRAWGGSVINMSALPEAKLAREAELAYQ
                     MICMATDYDCWHSTEDVDVAMVMKYMAANSENAKHLVGAVLDELCKQENSDLVLAKHW
                     EGSAQGAVKFMTKPAGRDPEAMKRVEFLFPGFWNE"
     gene            complement(1919757..>1924489)
                     /locus_tag="MYCTH_69563"
                     /db_xref="GeneID:11513607"
     mRNA            complement(join(1919757..1924381,1924451..>1924489))
                     /locus_tag="MYCTH_69563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664006.1"
                     /db_xref="GeneID:11513607"
     CDS             complement(join(1919822..1924381,1924451..1924489))
                     /locus_tag="MYCTH_69563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664054.1"
                     /db_xref="GeneID:11513607"
                     /db_xref="JGIDB:Spoth2_69563"
                     /translation="MDAGEYETNTLLISNLSAISFRIYEPIAAQSSTYTFNASDVEDA
                     LRSDGHLVYMDAVRRGIWCFYLFSGDSTPASHSERLGLHDRMEVCGYPLGVVGDGNLE
                     PVGLLKNRPLGTSTINTPSSSSSNGSALDMTVRGAQSFSFPPTPVVVDGKVASTPVGN
                     AKGYGSVPAREIYQFFITAVLSSLTSYFCRAVGAILLNSRSALLPPQVFNSGDADWGQ
                     APRSSALATFRTYLTTTGSLVISLHVSILQGLVSSADVLRSSLLHAGPTVLAAPFGTF
                     GTLQGVVDTENQVVDSGFGQSPDTQVSRLRSDHSDKFLQLKTTCCKLLQMSGMSPSLL
                     DGCPWLNIHFFQRKPYEQRPDGKRTPLVGSGTTAPWPAVLCFRKRKIETMMDVSLEKA
                     LPATTGTTAHLDPLDQAKLWCQGVSEREDVVSKRKKEKDVASELDHPEPSDMKGNPQT
                     NGFSPMALWRGSANGGPPGATGTMYPTPPDGVQLSGVTPSFDNGQTQSPDGQPTTNAA
                     GNNLTATQRDPPAPDGFNAGWEGADTRLEQPTASFGEDNLFGDLGEDMFEGNELTDAD
                     FNFFDENPGSGEMDLTGLPELETSTMGNQENDNHQFQEQTEGSAGTDSKMDARPISPQ
                     FTKPELRRARSTLAEEHRQLTNIQSSNRNSAIGIKRNPSPFNRETVFKRICASIRPPS
                     LTISKRREPFRRPSLFEKVDFDPALSPAIRKYGERGLFDFTSAALKGRENRLLPPGGP
                     LTPGRGSGSIKQRKNLKELPSDISSILAKLASANSNSSKQQDDSRSESDDDSSPSLDE
                     DAMEQLGRASSPAKSSVLRRRPEDDVISMAASFRELENISADSPGCGPVDLSRLSSSE
                     IPDFSLSKYFADPEPVPLRMSSSDEDFITVAQILTEQAASGFLKLATPRPSSEVQDLR
                     RSLVKATRCSINGLQKALPRSLAAAVGCRLRPLAEVQDVPLLVQPNGRVQVRPAEFPK
                     PSIFLIPTPHVELRRYETQLSVLPSAVSFWDTLGLGPVQGPKSVVAVCIVPQAQGMQD
                     NASAFLDRVQSTYESLHLGPFERLPTIGNIVDGLVLLSSDHDAVSPGLNQPRARSAYT
                     DQMTNLAMSLSGLSMSERNLVVYFAYAPDNPGSIVDSCSAFQELFEQYKRCMADRKKQ
                     VTNELVLQLVPLDAVATETSLVVLSPSDCARLCVETYDRCALFGGPMPSPAIMLERAL
                     PRGIDFKLAATPSPNLLRENSCIHVAYARSVDERWVTAAWTDNRGSTQSMASYCLGRR
                     GRPLSRALGDALHEIWETTHDLISTCKVHWRVVVTKCGPMDQHEMELWTAMAQTESRA
                     NVSLVLLTVETDPSLQLIPPAATIPLSAPSVFYTTPVSTPQPPSVLSPDQSGNPSTPV
                     GNTGTPAGATTPGGDSSQQQQQQQQQPASQTSQSDADGDTTLVDVTETTWGVVVSHRL
                     NNSASLTDLNPALASGYLVKRSGPRQDDAPVAMEVNVVYSDNARAMYDVLLREMLTYF
                     RGLGTLARARGVTERDVDVRPWHVAVVEKAVRALYLLM"
     gene            1925603..1927939
                     /locus_tag="MYCTH_2306429"
                     /db_xref="GeneID:11513608"
     mRNA            join(1925603..1925711,1925785..1925918,1925985..1926868,
                     1926925..1927939)
                     /locus_tag="MYCTH_2306429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664007.1"
                     /db_xref="GeneID:11513608"
     CDS             join(1925680..1925711,1925785..1925918,1925985..1926868,
                     1926925..1927788)
                     /locus_tag="MYCTH_2306429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664055.1"
                     /db_xref="GeneID:11513608"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="JGIDB:Spoth2_2306429"
                     /translation="MKLTNPGPVPVYTVAGPSTARPLPDWLARRRKRSSKYDPENLNN
                     FELLQEFEFEEASNCVRVSEDGNWIMSTGTYKPQFHVHSTQELSLSFSRHTKSENTTF
                     IFLSSDYTKSVHLQNDRSLEFHTPMGCHYEVRLPRFGRDLAYLRQSTEVLVPAVGLSA
                     DGSGFGEVFRLDLERGQFLRPWQVDVGEDEAGSGLQGSIHVGAVNVAAVAEKSHGLCA
                     FGTSISTVEFYDPRTKGRVAVLGGHDGEVTALDYSDDGLSLALGTSTGQIRIFDLRNP
                     RPLMKKDQGMGLPIKNLIHLKTPTEERKLLSADKRIIKIWDEQTGDLWTSVEPLVDLN
                     FVTHVPDSGMILTANEGKQMHCFFIPNLGLAPRWCHFLDNLVHEMENEKQTETYDNYK
                     FLTKPELKSLSLDHLIGKTNLLRPYMHGYFVAAKLYDQARLIANPYIWEEERAKRVKE
                     KIEKERASRIRGVKKVKVNQKLADKILQRQEKRAKVDLEAGILGDSRFGKLFEDEEFK
                     VDETSHEFRALNPSTKVEGAPEQDARFATDSSDEQSDSEAERKPKKPKNDVVMQVSLS
                     TARGGKIRDTAIGEREQKQTRTAKVRTGDVVGEQQITFVPEPKKKNKPQPAPEPSKRQ
                     DRRSASNNTFRRL"
     gene            complement(<1927994..>1928513)
                     /locus_tag="MYCTH_2063330"
                     /db_xref="GeneID:11513609"
     mRNA            complement(join(<1927994..1928244,1928342..>1928513))
                     /locus_tag="MYCTH_2063330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664008.1"
                     /db_xref="GeneID:11513609"
     CDS             complement(join(1927994..1928244,1928342..1928513))
                     /locus_tag="MYCTH_2063330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664056.1"
                     /db_xref="GeneID:11513609"
                     /db_xref="JGIDB:Spoth2_2063330"
                     /translation="MADIDTFPLAADGSDGSDGAFDGSDAGAAGPSTGGVVLSRGALI
                     AIIVVVVMVAILGIATSVLFFIAKKREWTVRETIRRSARKVVTVMTPGRTEFPKSVKE
                     GHSRLADVPPTPKITPEHLDLEKGLEQPKRKRANFSRK"
     gene            1930356..1935510
                     /locus_tag="MYCTH_2306433"
                     /db_xref="GeneID:11513610"
     mRNA            join(1930356..1930831,1930880..1931976,1932030..1932601,
                     1932653..1932884,1932935..1933039,1933092..1935510)
                     /locus_tag="MYCTH_2306433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664009.1"
                     /db_xref="GeneID:11513610"
     CDS             join(1932061..1932601,1932653..1932884,1932935..1933039,
                     1933092..1935171)
                     /locus_tag="MYCTH_2306433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664057.1"
                     /db_xref="GeneID:11513610"
                     /db_xref="JGIDB:Spoth2_2306433"
                     /translation="MVWQRRAKISHEFTTEIAGVINQFTQQQSAAIEEQKAKYHKYIK
                     RLKRELVEESGVITQQMSQIDAQANRIEDLQNSKEHVESQMKEIKAKLEASESRIRRL
                     EEKYRACKTHLNSAIQEQQDLYTRSKKQWEDTIEEVRRIEKSRNLETEMTVRKAEAVR
                     EQMMEKVRQTIAQSKSEAVELYGKINTLTQQVEEKDAELSRERESVRFLTEKLQNIES
                     VSSSFEALSSQGRDILQRIEEEQMRAEERQQQSMKGIRDRIDVVSARLETLSNIMSEQ
                     PDILSSLREVQKDSWDNITGKLDSILELRSAATEATSQLSADLEHQLGKVWQRLDSQI
                     ETLTRQLAEKAEENGMVSTLYKRNDAECEEHLNELAILRATTEKQANQIHELEASLIA
                     SDTVHDENEKTIRLLEARGAEAEKLKRELESKAAAVVELQSKLDAKEGAYVSELQNYS
                     SNIHELAKAFQEKDRSLATVAHQAAETARYETQLKTERIQTKLEQSLQETTLHRDSLI
                     DQLRKLETTIQEKEQNEMRQAETICSLRQRVAVEEAKTQAAAQQLSQQSANLEQVEHR
                     LGSQIKDLETKLRAASDLISGLENENQRQHARSETIAAGLKNWAHKEGVLIDEFDNLG
                     TSDRSEKEISDFLTHTLELVLSARRSQTTSLETNPTGSVLGMENSSFLAGQTAEAPQA
                     ALQDHCQNDRVESDNPSGAMAYQTKREGDAVGRRHVKEPLSHAPTLHNLRRVVVRSPA
                     NVPSEPAAPSIDQEKMRRREAMQPKSIMKRVTRSATSKLRLEDSSFAAEDGTFNINEQ
                     DATQSAVPQKQEDSASYAESMALNTDTPENKEALSRHPKKRRRSRTAGSEDWAGSSTN
                     LGHGGKGESSKHSTELKTERMDSRVYISVATGHEEKGARPRTNKYDSYGEKPVARHPR
                     RHSDSGPQDLPRTLSATNPKRLSQRQTNVRTYGSQRATGDPLELQPLLQSQSESRYWR
                     LRSKAESQEPVTS"
     gene            complement(<1935881..>1936317)
                     /locus_tag="MYCTH_2119125"
                     /db_xref="GeneID:11513611"
     mRNA            complement(join(<1935881..1935927,1936074..1936190,
                     1936305..>1936317))
                     /locus_tag="MYCTH_2119125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664010.1"
                     /db_xref="GeneID:11513611"
     CDS             complement(join(1935881..1935927,1936074..1936190,
                     1936305..1936317))
                     /locus_tag="MYCTH_2119125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664058.1"
                     /db_xref="GeneID:11513611"
                     /db_xref="JGIDB:Spoth2_2119125"
                     /translation="MAKKAKSRIINVRLISMAMTGYFYTFTRPRTALPMSMIKYDPIV
                     RRRVLFLEQKRKGK"
     gene            1938023..1940168
                     /locus_tag="MYCTH_2306437"
                     /db_xref="GeneID:11513612"
     mRNA            join(1938023..1938791,1938862..1940168)
                     /locus_tag="MYCTH_2306437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664011.1"
                     /db_xref="GeneID:11513612"
     CDS             join(1938386..1938791,1938862..1939913)
                     /locus_tag="MYCTH_2306437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664059.1"
                     /db_xref="GeneID:11513612"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2306437"
                     /translation="MASNSGRRLNIDNINPHVRAAKYAVRGELAVKSEEYRAALQNGA
                     TDLPFKQVISANIGNPQQLDQKPITFIRQVLSILENPALLEKGDVLVNHLGYKPDVLE
                     RAKKLLAAVGSVGAYSPSNGAPAIRQSIAEFLERRDGFPANPADIYMSAGASSGVNTL
                     LHIICADEKSGVLVPIPQYPLYTASLSVLNATCVPYYLDEQKNWGTDLATIRAAHEKA
                     KAEGVDVRAIVIINPGNPTGASLPEEDIRAVIEFARQERLVILADEVYQTNVFIGEFI
                     SFKRMLRQMQKEQPGTYDNIELASLHSVSKGMIGECGHRGGYFELVGFDPLVQAEIYK
                     FVSIMLCAPVIGQCLVELMVNPPKPGEPSYDLYIQEYNAIFNGLHERATALHKAFEQM
                     EGVECGVPQGSMYLFPTIKLPPKAAKAAAAEGRTPDEFYCLRMLEATGVCVVPGSGFG
                     QKEGTLHFRTTFLAPGTEWVGSIVKFHKEFMDKYR"
     gene            complement(1940352..1942618)
                     /locus_tag="MYCTH_2306439"
                     /db_xref="GeneID:11513613"
     mRNA            complement(join(1940352..1940820,1940926..1941740,
                     1941806..1942618))
                     /locus_tag="MYCTH_2306439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664012.1"
                     /db_xref="GeneID:11513613"
     CDS             complement(join(1940622..1940820,1940926..1941740,
                     1941806..1942264))
                     /locus_tag="MYCTH_2306439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664060.1"
                     /db_xref="GeneID:11513613"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2306439"
                     /translation="MGSDPQYAKWPLLPLAQDVFTITNPYATKAAQQAAAQHLQDAIS
                     EHKMAPFYRYLAHPIDGILNAVGESGASAPGKPTSRKSSLVGMIATRNPAASINLPWD
                     EALYQSLKAENDKELEQLQKEEDEAAEQAGETEIQAARGKRAEFWAKVGDKEKAIAAY
                     EDVLEKTGILGTKIDLVLAIIRMGLFYGDKHLVKKQVERAKTLVESGGDWDRRNRLKA
                     YEGLHLLTVRSYNLAAPLLLDSLSTFTSYELCTYSNLVVYAVLAGSVSLKRVDFKSKV
                     VDAPEIKAILGDGEDKLLALSGAISAGPGADAEMQDASTAPSAGRVTAVNLTTLGSST
                     DQPEAEVAVDFSPLAQLVSSLYNGRYKLFFQALALVEEQFLTQDRYLHEHKGWFIREM
                     RLRAYQQLLQSYRVVGLDSMANDFGVTVDFLDRDLAKFIAAGRIPCTIDRVAGNGVIE
                     TNRPDDKNKQYQEVVRQGDQLITKLQKYGQAVRLRGSERA"
     gene            1942757..1944732
                     /locus_tag="MYCTH_2306440"
                     /db_xref="GeneID:11513614"
     mRNA            1942757..1944732
                     /locus_tag="MYCTH_2306440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664013.1"
                     /db_xref="GeneID:11513614"
     CDS             1942947..1944431
                     /locus_tag="MYCTH_2306440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664061.1"
                     /db_xref="GeneID:11513614"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="JGIDB:Spoth2_2306440"
                     /translation="MADNDNDELPQPFDAKKLAPAKKRQRSQSPNRSGSAGTSGEPPR
                     KLKRPGQRARITEAEREQIRQRALERERLAREQAAAEELKQRSTINDVVKAHYNSVPE
                     RGREWRKTESRIKGLRSFNNWVKSCIIQKFSPDEDHAPGAMERGISSGNKLLVLDIGC
                     GKGGDLYKWQQAPQTVELYVGLDPAEVSIDQARERYRNMANRGGGGGRGGRGGYYHRR
                     APRLFDARFHVKDCYTESIGDVDIVRQVGFSPSSVSSNRGFDVVSLMFCMHYAFESEE
                     KARQMLKNVSGALRKGGRFIGCIPNSDVISSKVVEFNKRMEERKARAAAAAARKSSSG
                     EQPSSSSTVTAPDGPPPKAEKELEEGEAVEDEKEEGEAEETASWGNSIYRVRFPGPTP
                     ADGVFRPPFGWKYNFFLDEAVEEVPEYVVPWEAFRALAEDYNLELQYHKPFGEVWESE
                     KDDRELGALSERMGVRDRITGKLLVSEEEMEAARFYVAFCFYRV"
     gene            complement(1945084..1947497)
                     /locus_tag="MYCTH_2306441"
                     /db_xref="GeneID:11513615"
     mRNA            complement(join(1945084..1947005,1947075..1947497))
                     /locus_tag="MYCTH_2306441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664014.1"
                     /db_xref="GeneID:11513615"
     CDS             complement(join(1945129..1947005,1947075..1947084))
                     /locus_tag="MYCTH_2306441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664062.1"
                     /db_xref="GeneID:11513615"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="JGIDB:Spoth2_2306441"
                     /translation="MTTAVRICVCGDEGTGKSSLIASLVKDVFVANKIQSVLPQVTIP
                     PTSGSPENVTTTIVDTSARPQDRTTLRKEIRKCNVILLVYSDHYSYERVALFWMPYFR
                     SLGVNVPVVLCANKSDLAGSGNTPQVVEEEMLPVMAEFREIDSCIRTSAKEQHNVIEV
                     FYLCQKAVTHPIAPLYDHKEGQLKPACTAALKRIFYLCDKDQDGYLNDQEMHEFQVKS
                     FDKPLSPGELENIKATVSKAVPTSSTEKGLDLNGFLQLNKLYAEKGRHETIWIILRKH
                     HYTDSLSLEDSFLHPRFEVPDYASAELSPAGYRFFMDLFLTFDKDSDGGLNDQELAAL
                     FAPTPGLPPSWVESSFPSSTVRNEAGHITLQGWLAQWSMTTFLEPKTTLEYLAYLGFE
                     GPNAWDSTTAALKVTKPRKRRRRPGRVERNVVLCYILGSAGSGKSSLLDAFLNRPFDT
                     LYHPTIKPRRAVNSVELHGGKQCYLILEELGELEPAILENQAKLDACDLICYAYDSSE
                     PDSFSHIVDLRKRYPQLDDLPAIYTALKADRDKTTQRSELQPDAYTAALNMAAPLHVS
                     VTWNSISELFVALAEAATNPSTAFPRSEEPPDRTSLYMALAATSCAALAAFMIWRRST
                     SSSV"
     gene            1947782..1950536
                     /locus_tag="MYCTH_2306444"
                     /db_xref="GeneID:11513616"
     mRNA            join(1947782..1948252,1948346..1948485,1948548..1949098,
                     1949154..1949321,1949370..1949740,1949824..1950112,
                     1950239..1950536)
                     /locus_tag="MYCTH_2306444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664015.1"
                     /db_xref="GeneID:11513616"
     CDS             join(1948248..1948252,1948346..1948485,1948548..1949098,
                     1949154..1949321,1949370..1949740,1949824..1950112,
                     1950239..1950526)
                     /locus_tag="MYCTH_2306444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664063.1"
                     /db_xref="GeneID:11513616"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2306444"
                     /translation="MFVLPPPPRYSTGTGHNGLPAGTPLPMIETNNVLTNPSGPEYQF
                     LVGEGLYVLKEDLHLATPPPHPSETPLTNPNPLSTAPQPATAGTRLTLLNLDVNPLSP
                     AVYRTTSRSDGAPGGSQENQDEGHSSTDLRESSSDAGRMSSVDNPLYRANTNTPAFGE
                     GNSLLAPAAQKDAGKRRKPKNNMTKSNSSFISRVINHEALPKRLQERARDGLFAFANI
                     NRAFQWLDLSSPTKAEYLTKILFTKAHCLCHDVNKVTKSATHIDVIMGFSTGEIIWWE
                     PITQRYTRLNKNGLINGTPVSQIEWIPGSENLFLASHMDGTLVVYDKEKEDSIFTPED
                     EGSSRPGGDASGTSRVNYTSRIYVHKSVHSKNQKTNPVAVWKLSNQRINAFAFSPDNQ
                     HLAVVSEDGTLRIIDYLKETLLDLHYSYYGGLTCVCWSPDGKYVVTGGQDDVISIWCP
                     SESPALIARCQGHHSWVTSVAFDPWRCDERNYRFGSVGEDRRICLWDFSVGMLHRPRA
                     ASVRQRGSISSRPGAIPLHRAETSATAGTRGSGRLRSDSNLSSGAPGPADSEREKVLP
                     HPVEPRATTATLPPVLVRFFPPNTVIPRSQDETVHDC"
     gene            1954568..1956579
                     /locus_tag="MYCTH_2306452"
                     /db_xref="GeneID:11513617"
     mRNA            join(1954568..1954775,1954840..1956579)
                     /locus_tag="MYCTH_2306452"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664016.1"
                     /db_xref="GeneID:11513617"
     CDS             join(1954618..1954775,1954840..1956547)
                     /locus_tag="MYCTH_2306452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664064.1"
                     /db_xref="GeneID:11513617"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="JGIDB:Spoth2_2306452"
                     /translation="MNNYRLENDFIVFRGSEHEASPQLLKGTVVLCLSQPLRIEDIHL
                     KLIGTAHYAWTDAKVTATGISTSKVDKTTQIYEHKWPPFAGIGAEDPTDRSGHRIKGE
                     TLQPGNYEWPFEILLEGDMAESVEGLREASITYKLKATVARGKLLHDFHAYKQLRIIR
                     TLEASALEFLHAMSIENIWPNKIDYSIVIPQKAVVFGSSIPVEMRFTPLLKGLELGDI
                     TIKLIEFHDFFITSVGYTAVREYRRERTIDSWIIPVKREEHWQDVIQDSGPDGWEGQE
                     GWVVPATLNLPRKLTQCLQDVNVKGIKVRHKLKLVVALNNPDGHVSELRATLPVSIFI
                     SPNMPLDEAGNLVRQVPTGAPTDVDIAPPAYEEHQLDELYQDIDPVNLHSPIDGRSGV
                     SSPLRGHSRATSTENLPALLQSAPIHPDMLASRLHDMSLEERHRNASWNSNLSGAGAT
                     SRTEGTSHVADESHVSPPRSAPLTRHNSGDRPSGSNTPPEHLDFPDTAELSKVPSYHT
                     AVRTPVRVQAADVYALPDYETALSTPSSPPGTPRLDARSQTMPYHLDAVPRAAQETAA
                     ALGSARVPTTVSAPVTAAASREPSPHATNRRPVMSHRRQFSSSGFLHSLRTQSSH"
     gene            1958024..1961162
                     /locus_tag="MYCTH_2306456"
                     /db_xref="GeneID:11513618"
     mRNA            join(1958024..1958213,1958366..1958495,1958592..1958717,
                     1958801..1960249,1961024..1961162)
                     /locus_tag="MYCTH_2306456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664017.1"
                     /db_xref="GeneID:11513618"
     CDS             join(1958397..1958495,1958592..1958717,1958801..1960123)
                     /locus_tag="MYCTH_2306456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664065.1"
                     /db_xref="GeneID:11513618"
                     /db_xref="JGIDB:Spoth2_2306456"
                     /translation="MALSPTEATAPSRQETLASIASDEAVPDTDPNTTAGLLTQRLQA
                     WKHAVVYLEEYMEAFEKLHKAQAKEYERALKTISKPLREGEHFDQSLGGVAGFFENMR
                     VNTQALINTNLETEKAIKASALPIVERLHKEIKHKAKELAHGAEKSAKEVEKARSVTQ
                     KHIELLGQHTAAFEATGGKHNPSEDPYVIARGVIHRLHKQVTEENNQHNDLVAVQGNF
                     EAFERHIVQVLHQAMETFTNLAGGQALKVQALHADMLGAAQRIPPDFEWKAFTKRAAD
                     KLVNPSEPPRTVEAIQFPNMSHPSTKPLIEGSLERKSRNKLSWGYTTGYYVVTPCKFL
                     HEFKDDDNLRRDPTPELSIYLPDAVIGAPSGDKFSVKGKDRSGHVGAKLAGTSELNFK
                     AHSPAEAEKWFQVIRTVAGTGPGPASPPAVASPVDEKPKPVVAVPAAAAASPQETGIT
                     GGETVASPVALSASGSGAAANPVTAAAGAAGGSTGSGGSLEKKATGNGAVAAAAEPAA
                     AGKGEKA"
     gene            1962477..>1963293
                     /locus_tag="MYCTH_2306461"
                     /db_xref="GeneID:11513619"
     mRNA            1962477..>1963293
                     /locus_tag="MYCTH_2306461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664018.1"
                     /db_xref="GeneID:11513619"
     CDS             1963049..1963291
                     /locus_tag="MYCTH_2306461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664066.1"
                     /db_xref="GeneID:11513619"
                     /db_xref="JGIDB:Spoth2_2306461"
                     /translation="MTKQWDKYREIIIAEYRDQNKPLHEVRRFMMEKHGFRASYVQPP
                     LCWLRVASSAKRPHLLGAGDAGTKWISNTSRKRIAL"
     gene            1963279..1963971
                     /locus_tag="MYCTH_2306462"
                     /db_xref="GeneID:11513620"
     mRNA            join(1963279..1963741,1963815..1963971)
                     /locus_tag="MYCTH_2306462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664019.1"
                     /db_xref="GeneID:11513620"
     CDS             1963294..1963599
                     /locus_tag="MYCTH_2306462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664067.1"
                     /db_xref="GeneID:11513620"
                     /db_xref="JGIDB:Spoth2_2306462"
                     /translation="MPSLTLFSTRAYRSRFDRWGIHKYSRRRRESSASPSRRNSVSGG
                     DTQRSPRHSPDPDGGGSRAATPFPSTSNELFPAEICATIPVAGFRRYGRRSATGWRS"
     gene            complement(1963973..1965966)
                     /locus_tag="MYCTH_2306463"
                     /db_xref="GeneID:11513621"
     mRNA            complement(join(1963973..1964496,1964581..1965966))
                     /locus_tag="MYCTH_2306463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664020.1"
                     /db_xref="GeneID:11513621"
     CDS             complement(join(1964284..1964496,1964581..1965612))
                     /locus_tag="MYCTH_2306463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664068.1"
                     /db_xref="GeneID:11513621"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="JGIDB:Spoth2_2306463"
                     /translation="MPRLLQRTRRPDARAPGAPEVEDGPLELPPYEPPSYPMDASIKQ
                     KLASLSNNRETDSSRRQYEKHLSKSSTYLFESVGSINDILYARKRSLAHMAEKRRARG
                     EEAKNDNEVSLEEYVAELEATINELTDSSEEALRWVIDCRAELEDHQAVLEKVMEGLN
                     AQQPRPEPKQRNTKEKASRRRVVGSDDEDEEAQEPEDDEDGDATPEDGPPLVGVKELL
                     EAARKAKADEYAALSAHQRYALNNDYISFKRAWHDALHPEDQVPLPDPSTWFDEHGRP
                     TKGTVPDANEDDDLVVEREIIDLKCPLSLQIMKEPYSNHKCKHTFEKSAILEFIRSNG
                     GVAKCPVCSKDLRIKDFYLDEVILRKVKRAAEAARRGVDDTSDIEPEDDDSSMIVGKS
                     VNVKKEKDRSRRRMEEIDADDD"
     gene            complement(<1967106..>1967560)
                     /locus_tag="MYCTH_95095"
                     /db_xref="GeneID:11513622"
     mRNA            complement(join(<1967106..1967131,1967200..>1967560))
                     /locus_tag="MYCTH_95095"
                     /product="glycoside hydrolase family 7 protein"
                     /transcript_id="XM_003664021.1"
                     /db_xref="GeneID:11513622"
     CDS             complement(join(1967106..1967131,1967200..1967560))
                     /locus_tag="MYCTH_95095"
                     /note="CAZy_ID 270035"
                     /codon_start=1
                     /product="glycoside hydrolase family 7 protein"
                     /protein_id="XP_003664069.1"
                     /db_xref="GeneID:11513622"
                     /db_xref="InterPro:IPR001722"
                     /db_xref="JGIDB:Spoth2_95095"
                     /translation="MHPNILTLVATVFVGKAAAQQVGTYTTETHPRMTWQRCSSGGSC
                     TSVKGELVIDSNWRWVHDKNGYTNCYTANEWNSTICADNQSCAANCALDGADYSGTYG
                     ATTSGNALTLKFVTKGSYSTNICSRS"
     gene            complement(1968664..>1970407)
                     /locus_tag="MYCTH_2139555"
                     /db_xref="GeneID:11513623"
     mRNA            complement(join(1968664..1970003,1970065..1970114,
                     1970162..1970336,1970389..>1970407))
                     /locus_tag="MYCTH_2139555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664022.1"
                     /db_xref="GeneID:11513623"
     CDS             complement(join(1969072..1970003,1970065..1970114,
                     1970162..1970336,1970389..1970407))
                     /locus_tag="MYCTH_2139555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664070.1"
                     /db_xref="GeneID:11513623"
                     /db_xref="InterPro:IPR012319"
                     /db_xref="InterPro:IPR015886"
                     /db_xref="JGIDB:Spoth2_2139555"
                     /translation="MPEIAEIARVVHYLRLHLVGKKIKTATAVEDNNVFGKVGTTGAE
                     VSRALTGKKVLSAGTQGKYFWLVLDQPPHPVMHFGMTGWIHIKGDRTAYTNYYKKMKP
                     EEMDLWPPKYWKFHLITENPAVEVAFTDPRRFGRVRLVDCPGESIRKFSPLVENGTDP
                     VVDTDVFTEDYLREKMRSRHVPIKALILDQTIISGIGNWVGDEVLYQAKLHPEQYCDD
                     FSDEQITRLYKSIRHVCQFAVDKLGDSDQFPEDWLFHYRWEKGQKGGVGHLPSGEKLA
                     FLTVGGRTSCYVPEIQKKSGRIVPGVKEEPIESDLEKEKPKKVVRAKDAIAEDAMPKS
                     KKRKAEKDEIPAKRSRATPKKSATSESQATKGEVAERIGSNVEHGRRRSSRLQRKTA"
     gene            complement(1971648..1973814)
                     /locus_tag="MYCTH_2306466"
                     /db_xref="GeneID:11513624"
     mRNA            complement(join(1971648..1972463,1972557..1973814))
                     /locus_tag="MYCTH_2306466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664023.1"
                     /db_xref="GeneID:11513624"
     CDS             complement(join(1972232..1972463,1972557..1973629))
                     /locus_tag="MYCTH_2306466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664071.1"
                     /db_xref="GeneID:11513624"
                     /db_xref="JGIDB:Spoth2_2306466"
                     /translation="MANPARPAEWKKAVADVMPHVNPDSLSISDLPSTESASELTFAH
                     FLCLRILWKTYTSKRFKLDEYVDQVSAAKAAQRLETPKSKAFFDSVQQMHTGYPEDSI
                     FSLVRLYFDMVYKLDATMDISSLKVVLTPQPVRFGRHREWIPESPLARKGSPSRMDLD
                     LDYSPPDKPSPAQARLAEEARLAEELAAHHGASTPPTRAESPVSDTSAHPDGSSPARP
                     SEFSPTEDEIIVNMALLLLLNSLTEPEEALRARGYRWIPNRELLRILKSLPAGNAATT
                     ASGRNTAKYLEARTDGCLRHTEHQLAAALIEVKPCARSKKLGRIQWQEGAQMAAYIYK
                     LLYLEKPPSSDFGLLRCRKAGVKRRLLVSQDHGEIYITIAEYDSTYERFLGLHHSANP
                     SGKISDTSFLKMHCYGPWNTKSKNDLRHVCRILMALSFYLAK"
     gene            1975106..1976660
                     /locus_tag="MYCTH_2306472"
                     /db_xref="GeneID:11513625"
     mRNA            join(1975106..1975462,1975518..1976660)
                     /locus_tag="MYCTH_2306472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664024.1"
                     /db_xref="GeneID:11513625"
     CDS             join(1975295..1975462,1975518..1976261)
                     /locus_tag="MYCTH_2306472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664072.1"
                     /db_xref="GeneID:11513625"
                     /db_xref="JGIDB:Spoth2_2306472"
                     /translation="MVVKKTREVNHIVCPIADNVSHKLNPDHALRSEITAGVSMIRRR
                     ITVTHDTYSPIPVLLLSFYHNETVRITQMCWNGERNPITIRQSRLINIVSNSFKREEI
                     YLLLRWMCCIPLREPKVRRKQSTTGEPGRPATPLRTGTGSNSSAASKSKPASTPVVTH
                     PAVANAPTPTGTPTQKTSGAVSSNNSPARSEAPTSARRTTNKDTNASPPRPTTNLPLR
                     PTTPPTASAPSKKAAGNTTARTTPGGNGAAHLPGHHATSLGDNSPPRAKSAPSAAKQI
                     AGLPVRGGSTSGNGGTSSNAGVSHAKH"
     gene            complement(1976672..1978244)
                     /locus_tag="MYCTH_2306473"
                     /db_xref="GeneID:11513626"
     mRNA            complement(1976672..1978244)
                     /locus_tag="MYCTH_2306473"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664025.1"
                     /db_xref="GeneID:11513626"
     CDS             complement(1976950..1977993)
                     /locus_tag="MYCTH_2306473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664073.1"
                     /db_xref="GeneID:11513626"
                     /db_xref="JGIDB:Spoth2_2306473"
                     /translation="MPQDPNLYGQRPPKRQKKEMAISGSVAFASQLSSLLAESSTNSA
                     TSSSSSTAVNGRTRSSKLKTDDLSKTKVKRKEGPDGESKPSSKLTLKSPSGTEETKAE
                     RDFIRRKMESKARLYAAMQRGDYIGREFGLVDFDRKWAETQANKDKTAGSPSSDSDSE
                     DDEEEEEEAGNGDDVDTTLHEYTDEFGRVRYLTRSQILRLQRSTASAAELENMSARPK
                     APETLIYGDAIQTEAFAARDGAEAMEALARKRDRSPTPPEATHYDADREIRTKGVGFY
                     KFSKEEEKRQEEMRALEEERARTEALRREREEKARKRKQEIEERRKEILERKTKKLAD
                     SFLEGLEKDLVGG"
     gene            complement(1979132..1980662)
                     /locus_tag="MYCTH_2306475"
                     /db_xref="GeneID:11513627"
     mRNA            complement(join(1979132..1980354,1980423..1980662))
                     /locus_tag="MYCTH_2306475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664026.1"
                     /db_xref="GeneID:11513627"
     CDS             complement(join(1979294..1980354,1980423..1980465))
                     /locus_tag="MYCTH_2306475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664074.1"
                     /db_xref="GeneID:11513627"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="JGIDB:Spoth2_2306475"
                     /translation="MAAASARQVNIAIIGVGGVGKCFLSQLEQLAARRPNPKLVLTYI
                     CTSKKALYSTDHVAIPINTAISTLSSSDQTPLPLPKLVDFLGTSGSKTVLVDNTSSQE
                     VAEAYPLFLSRGISVVTPNKKAFSSSYKLWQDIFSAAEQSGAKVYHESSVGAGLPVIS
                     TLKDLVDTGDEVTKIEGVFSGTMSFLFNSFAQTSGAGGKWSAEVKKAKQLGYTEPDPR
                     DDLNGLDVARKLTILARLAGLPVESPTSFPVQSLIPRELESVATGDEFLEKLPAFDAQ
                     MEETKAEAEKEGKVVRFVGSIDMATKQVKVGLEKFDLSHPIAALKGSDNIISFYTKRY
                     GSNPLIVQGAGAGGDVTAMGVTSDLLKVLSQIA"
     gene            1980737..1982183
                     /locus_tag="MYCTH_2306477"
                     /db_xref="GeneID:11513628"
     mRNA            join(1980737..1981034,1981098..1982183)
                     /locus_tag="MYCTH_2306477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664027.1"
                     /db_xref="GeneID:11513628"
     CDS             join(1980883..1981034,1981098..1981818)
                     /locus_tag="MYCTH_2306477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664075.1"
                     /db_xref="GeneID:11513628"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="JGIDB:Spoth2_2306477"
                     /translation="MGGDKIKKDRRQKREAYRAAMREEGISELPRKKFYRQRAHANPF
                     SDHRLIYPPHPDQMDWSSLYPDYVVDEPQDQQSPAAPETPSDNNDSAPLKPKRISKDV
                     EVADIGCGFGGLLVALAPLMPDTLILGLEIRVSVTQFVEDRIKALRAQNPDSRLYRNV
                     GVLRANTMKFLPNFFRKGQLTKVFICFPDPHFKARKHKQRIVSTTLNSEYAYVLRPGG
                     IVYTITDVLDLHEWMVQHFNAHPSFERVGEEEQEADPCVGIMRTETEEGKKVERHKGQ
                     KYVALFRRLEDPAW"
     gene            complement(<1982545..>1984702)
                     /locus_tag="MYCTH_2119140"
                     /db_xref="GeneID:11513629"
     mRNA            complement(join(<1982545..1982746,1982903..1983996,
                     1984046..>1984702))
                     /locus_tag="MYCTH_2119140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664028.1"
                     /db_xref="GeneID:11513629"
     CDS             complement(join(1982545..1982746,1982903..1983996,
                     1984046..1984702))
                     /locus_tag="MYCTH_2119140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664076.1"
                     /db_xref="GeneID:11513629"
                     /db_xref="InterPro:IPR005550"
                     /db_xref="JGIDB:Spoth2_2119140"
                     /translation="MFQRSSSGTNLADIGLSSVKRASVAGYNPNTTASLKPYHTPGPS
                     ADNDRRSSVYRARPSAVAGPMSGHQSFFQQAPQAAGVPRDPRPLKDRSYQNRIGQELI
                     DYLAKNNFEMEMNHKLSDNFIKSPTQKDFNYMFQWLYRRIDPGYRFQKNIDQEVPPLL
                     KQLRYPYERSITKSQIAAVGGQNWSTFLGLLHWMMQLAQMLERYALREYDDACLEAGV
                     DDWLNMDDDAGDEDVEKALAPHVQAMARDFERANAKYIQEMEMLEGENARLLKEIEEL
                     EKSTPDPAVLDNHFKIMEEDKAKFEEYNTLALQRSEKYEGRIQVLQEELDKLQGELKE
                     AEDERRRLKEAVDDQGISMQDIDRMTAERERLQKSIESAEQRLEDVKRKVTEREMEAS
                     QRLDDLERAVDRYNTVAYQIGLIPSTAVNAKGRDYELQVTVNGGSNFTSSQLQGSYSA
                     GDGDRLLADPVTGYQPAHVLNLDLRGQVKSSFLALRKEVSERRKAAIDAMMEDHDLLD
                     RAKEAIEDKRNEVEALEHRVRAAEEEYERTKEVTTAQKLASDAQIEKMEKELAKMRAQ
                     LTESVQLMEQREMNTNIEYEQLTLRANALREELHTETMRMLNDVIKFKMHIQKSLEEY
                     ETFVADELEKELGSDEMRDDTQSLDM"
     gene            1985505..1987036
                     /locus_tag="MYCTH_2093808"
                     /db_xref="GeneID:11513630"
     mRNA            join(1985505..1985622,1985682..1986007,1986067..1987036)
                     /locus_tag="MYCTH_2093808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664029.1"
                     /db_xref="GeneID:11513630"
     CDS             join(1985583..1985622,1985682..1986007,1986067..1986774)
                     /locus_tag="MYCTH_2093808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664077.1"
                     /db_xref="GeneID:11513630"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="JGIDB:Spoth2_2093808"
                     /translation="MTIREDLVASAAKFLQDPSVASSPVEKKVAFLQAKNLTQDEINA
                     ALARAGTPAPAQAYPPQPQPASAVAQPPQYYGQYPPQYPPYGWQQPVPQPLPRRDWRD
                     WFIMATVVSGVSYGLYSLGKRYVYPLIAPPTPERLEQDKKSIDEQFEKTFALVEQLAK
                     DTETLKAAEKERTERLDTALAELETTISELKSANKRRDDEAQRMRDDLQNLKDSIPRG
                     LNNQKDLTDTRLREVNAELKSLKTLITQRMNPTATSSTISSYLRPQASGSATPSSPAA
                     TPAPGENASTDAKEEPKPAGQSTPLNGARPSPFNSGIPGKASIPAWQLMASKSAEPSS
                     KPTANGTGSEGSSGAQEEASGSA"
     gene            1987670..1989679
                     /locus_tag="MYCTH_2306484"
                     /db_xref="GeneID:11513631"
     mRNA            join(1987670..1988582,1988777..1989679)
                     /locus_tag="MYCTH_2306484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664030.1"
                     /db_xref="GeneID:11513631"
     CDS             join(1987876..1988582,1988777..1989509)
                     /locus_tag="MYCTH_2306484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664078.1"
                     /db_xref="GeneID:11513631"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_2306484"
                     /translation="MMLALLPRVPLMMRVALLHMLRLTPQSKYLDLRTEVAIAILRSF
                     TNPSSPRSITATQRMAAQAPELKGRIWVSTYACPPPPAEERGLQDAIAKAIDELRDPR
                     VPTPTYEMPEPAHVEAEWTGYRADATPNSRLPDLPERDLYAEMMKEVKSPATVLYFHG
                     GAYYLLDPANHRPTTKKLAKLTGGRVYSVRYRLAPQNPFPAALMDALMSYLALLYPPE
                     GAFHEAVKPEHIVFAGDSAGGNLSLALLQLILHLHRNSHTVLWHGAARAVPLPGGVAV
                     NSPWLDITHSSPSCTANAAFDYLPTLDQQLAAEARRPPCPAWPASPPRRHLYAPDSLL
                     GHPLVSPVTARSWAGAPPVYVCAGWELLADEDKFAAHKMWREGVAVVWEEYEAMPHCF
                     AIVFPYLREARRCLEGWAAFIKAVAEGGPTAAAATPESRFLTIRAMSLEEVAVEPDSL
                     WTDGEEVVAERVWRKVRERLVPEESVAKL"
     gene            1990080..1991872
                     /locus_tag="MYCTH_2306485"
                     /db_xref="GeneID:11513632"
     mRNA            1990080..1991872
                     /locus_tag="MYCTH_2306485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664031.1"
                     /db_xref="GeneID:11513632"
     CDS             1990141..1991721
                     /locus_tag="MYCTH_2306485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664079.1"
                     /db_xref="GeneID:11513632"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_2306485"
                     /translation="MDRHKAAVAKIAATVRSFYAAREPYRIFHGSTNSTRPRPSASQT
                     KTVDISALRNVLSVDTARRVALVEPNVPMDRLVEATLPHGLVPPVVMEFPGITAGGGF
                     AGTAGESSSFRHGFFDDTVRRVEMVLADGEVVEATRGGGEGEEEGGVRADLFRGAAGA
                     VGTLGTTTLLEVQLMEARRFVRTRYRRTRSVAEAVEAVREEVRREENDYVDGILFSKD
                     HGVVVTGQLTDEAPPAGQKVQTFSGPWDPWFYLHAKERTAPERGDEGAAPVDHVPLAE
                     YLFRYDRGGFWVGAAAFEYFGFVPFNRFSRWFLDDFLHTRMMYRALHGSGESARFVVQ
                     DVAMPFETTERFVDYTSSELGIWPLWLCPLKRRRPPTFHPFTTLPEGVRKEPGDDDDD
                     DDAGDADMMLNVGVWGWGPSDPAEFVRKNRELENKVRELGGMKWLYAHTYYPEDEFWS
                     MYGGRGWYDELRDKYNAKTLPTVWDKVHVDPDVARAKKRHWLKRLPPLGGFYGIYKSI
                     QSKDYLLHRHAKWKWKGE"
     gene            complement(1992216..1994267)
                     /locus_tag="MYCTH_2306486"
                     /db_xref="GeneID:11513633"
     mRNA            complement(1992216..1994267)
                     /locus_tag="MYCTH_2306486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664032.1"
                     /db_xref="GeneID:11513633"
     CDS             complement(1992248..1994194)
                     /locus_tag="MYCTH_2306486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664080.1"
                     /db_xref="GeneID:11513633"
                     /db_xref="JGIDB:Spoth2_2306486"
                     /translation="MPREYEQYRLQLIIEYNRLLAWGKAAGLVDVPEGSTLGTTLGAD
                     GIELVAIVARIQWLLSEFRELNARYGNELPQSSRYGGEGDDKGADEQPTDIDILKEVS
                     SLAVSYEAKKKERRHLRGTNHIREFFEKAGRNTKDIVTHPARVRWIAIDKEAFGALLE
                     DLHALTERLHELMRTYREKQIDDIMAKTYREMILTRNDVQDLRDMLAAVTSLISTSAV
                     TRKNKEAHPNDRTLQGLVQLKKLSRTSETILAQLKRDTKFDIHQTRSDLGITVRQYTE
                     SDLSEEFTWNETEVENPEFLPRPRGILVTSEGDIPVWLEWKGLGDVPPNSLKDKESAL
                     RTVALAEMLHLPKPPSLHVPDCVGYFDDRDVSGAERYGWFFKMPEGSDYDTRVVSLYE
                     ILGNARLKPSLSQRVAMASKLCSTVLNLHAVNWLHKGIFSDNVVFFFDGEQDEGKEGE
                     GGVSKRATGRAGLDYEPEKPILSGFEFSRPDGTETTARDVDIVWDLYRWPGIQRQTPT
                     ERNSKKTYDLYSLGLVLLEIAHWEKLGTLMHLGVKARGSKEGEKLPNIPLEESKAVRD
                     WLLEVKSGAPFEAAGRPNPLKELRNIAGDRYWKVVERCLWAHGERGFGVEERADQSND
                     SEVGVLLQEAFTKQVVEELEALQL"
     gene            1995708..1997770
                     /locus_tag="MYCTH_2306488"
                     /db_xref="GeneID:11513634"
     mRNA            1995708..1997770
                     /locus_tag="MYCTH_2306488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664033.1"
                     /db_xref="GeneID:11513634"
     CDS             1995860..1997425
                     /locus_tag="MYCTH_2306488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664081.1"
                     /db_xref="GeneID:11513634"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Spoth2_2306488"
                     /translation="MTDVASPPAEPHSLIQEPASALRSSKPKPKRAPTRVSIVAPKGS
                     TDPVVTSPRSGSSSTPPGLNVTSTTWKKLILTIDGGGIRGYSSLIVLRALMHEIERIE
                     QSLKPPASASTHTDRIPREQIPDEVFREGKYLPCHYFDYIAGTSVGGLIAIMLGMFGN
                     SVDDCVNEFHRQNKAIPLTDDASVVSSIDFPLVYRRSTWPTKRTRSFFDTFARFTVTA
                     TGRTLPGSPAAPSVSRTSSQASAASSEFRKDTYQCQTLAWCAEVETRRSRRPYAFCTY
                     AEEEGDPEQLISIPEVAKAITTPSRYSFKPFKLGSGQFVDGSKLIRDPTLEVIKEITS
                     LLDESEPPIDLLLSLGTDEHHAWFYEKLRSLATSRGSPASAAKDKPAIGEEEGRSYIH
                     YHRFEVPGIRLGWRKRFFLRQIEEATEEWLSRPEQKERVAKYAQMLVERRRARAATAR
                     WETFALGVRYVCFHEECAGEGEKSAENNRLFTGRGDFFDHLDRRHNLTKRAARGLVDV
                     EQELDKGRRFGWC"
     gene            1999305..2001776
                     /locus_tag="MYCTH_2306489"
                     /db_xref="GeneID:11513635"
     mRNA            join(1999305..1999438,1999813..2000094,2000159..2001124,
                     2001196..2001281,2001332..2001776)
                     /locus_tag="MYCTH_2306489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664034.1"
                     /db_xref="GeneID:11513635"
     CDS             join(1999435..1999438,1999813..2000094,2000159..2001124,
                     2001196..2001281,2001332..2001403)
                     /locus_tag="MYCTH_2306489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664082.1"
                     /db_xref="GeneID:11513635"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="JGIDB:Spoth2_2306489"
                     /translation="MFNLKTRDHLRRIETGKITSTANGNGSTSFAGFGDMDGERRPLL
                     GHQATSTLHAEPGFWRHLLIHAESTPGIDSPNPFVRWPAQVWNVTKITLFSSWINLLL
                     VFVPLGIVAGELKWSAPWVFTLNFFAIIPLAAVLSFATEEIAGRLGETLGGLVNATFG
                     NAVELIVSIVALRAGEIEVVQSSMLGSILSNLLLVLGMCFFLGGVYNMRGRDGHGQEQ
                     SFSTATAQTTCSLMTLASASMILPAALYGILSQAEERNKQASILVLSRGTSIILLFLY
                     CLYLYFALRTHKKLFEPEANEITGDDSEEEHQPLLGPWAAALVLVVTTLIISVCADYM
                     VDSIDALVATGKISKTFIGLILIPIVGNAAEHVTACVVAVKDKMDLAMGVAIGSSIQI
                     ALLVTPALVMLGWAIGQPMTLHFETFETVAFALSVLVVTYTVQDGKSNYLEGAMLLGL
                     YIIIALAFWVSPTDALGKI"
     gene            complement(2002903..2005095)
                     /locus_tag="MYCTH_2306491"
                     /db_xref="GeneID:11513636"
     mRNA            complement(join(2002903..2003856,2003912..2004051,
                     2004104..2004612,2004979..2005095))
                     /locus_tag="MYCTH_2306491"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664035.1"
                     /db_xref="GeneID:11513636"
     CDS             complement(join(2003071..2003856,2003912..2004051,
                     2004104..2004554))
                     /locus_tag="MYCTH_2306491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664083.1"
                     /db_xref="GeneID:11513636"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2306491"
                     /translation="MSQSPSSTGAMGIGNVLNIKAESGGQQASQQGATSELQQQRPPQ
                     QLQQLQVDRQGSPQGSEQPRYSGPMSASYPSPTAMAPAPLPPVPNANMAPAPMVPHEM
                     QQNIGIVHPAYQQTQQPPQAPAHQPPAKQFPCSTCGKPFARRSDLARHERIHSGIRPH
                     VCDYPGCGKQFIQRSALTVHSRVHTGEKPHRCERCGKPFSDSSSLARHRRIHSGKRPY
                     KCPYADCQKTFTRRTTLTRHQNHHVGTVEDSARARAEALAQGANAAAAAAAAAAAARN
                     KSQSASEQASNHESPITTPSPGQRPISMSPGAELAGMNNMQYLSNSIPAHLRGDVHVG
                     SPSPTASTGYNNGMRPTSHPTGYAPPQTLEPSIEQPQQGPGSAVGSPHIGSVGWASPG
                     PVGSPTQSPNGNGYVYPDPESYPSGTPIAQMFYNNAVATRRPESAEPANPSFDAKGRQ
                     GELWTNAQ"
     gene            <2006985..>2008089
                     /locus_tag="MYCTH_2111103"
                     /db_xref="GeneID:11513637"
     mRNA            join(<2006985..2007089,2007311..2007313,2007390..2007408,
                     2007528..2007553,2007659..2007882,2007990..>2008089)
                     /locus_tag="MYCTH_2111103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664036.1"
                     /db_xref="GeneID:11513637"
     CDS             join(2006985..2007089,2007311..2007313,2007390..2007408,
                     2007528..2007553,2007659..2007882,2007990..2008089)
                     /locus_tag="MYCTH_2111103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664084.1"
                     /db_xref="GeneID:11513637"
                     /db_xref="JGIDB:Spoth2_2111103"
                     /translation="MFPRSFQKAISGPPAQQRRTRISVLLVGSKHEVPSCCMNVHTGR
                     RGPIPKLLCVKWFMYGVLGKDVQRVLRAASVSRSAPTPLPPSLMVPSDRGLATSSIVI
                     WQVPVSLVARKSPEQSSRVPAHIHPCGTQGGSGLAEKARAQHWPISAIGSALSNVE"
     gene            2008764..2009481
                     /locus_tag="MYCTH_2306494"
                     /db_xref="GeneID:11513638"
     mRNA            2008764..2009481
                     /locus_tag="MYCTH_2306494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664037.1"
                     /db_xref="GeneID:11513638"
     CDS             2008965..2009471
                     /locus_tag="MYCTH_2306494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664085.1"
                     /db_xref="GeneID:11513638"
                     /db_xref="JGIDB:Spoth2_2306494"
                     /translation="MARSGRVPKQSRQRLMSFVKYISKKPQKLQNRQQSKNCRSTGRG
                     GGVAAVITPLPTNLDTKPSGSTVLFWLSRFFGSTTTELEARDARECSPSPLHQPQLRV
                     EPRRTDDPPGPLPFGLAFPHGDLPMAKVLHATGASPSPRASNNGEVPRMLRLCRSEPL
                     PPSSTSHA"
     gene            <2010314..>2010815
                     /locus_tag="MYCTH_2035523"
                     /db_xref="GeneID:11513639"
     mRNA            join(<2010314..2010488,2010634..>2010815)
                     /locus_tag="MYCTH_2035523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664038.1"
                     /db_xref="GeneID:11513639"
     CDS             join(2010314..2010488,2010634..>2010815)
                     /locus_tag="MYCTH_2035523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664086.1"
                     /db_xref="GeneID:11513639"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="JGIDB:Spoth2_2035523"
                     /translation="MARFTIEIEVYSDLICAWCYIGKRALDKAIHLYKTEHPDVEFRL
                     TWKPYMLWPNAGVSAYRKWAILEHIFGPRALSIRSRIDQLGERYGISFRWEGRSGNTR
                     DAHKLILLAMERDAAAA"
     gene            complement(2011370..2012999)
                     /locus_tag="MYCTH_2306496"
                     /db_xref="GeneID:11513640"
     mRNA            complement(2011370..2012999)
                     /locus_tag="MYCTH_2306496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664039.1"
                     /db_xref="GeneID:11513640"
     CDS             complement(2011895..2012803)
                     /locus_tag="MYCTH_2306496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664087.1"
                     /db_xref="GeneID:11513640"
                     /db_xref="JGIDB:Spoth2_2306496"
                     /translation="MSNSFDRQQASFLSSMSAAASKLGSGAGTKRSLAPPSPSPSVGS
                     TTSAPAPGSLTPRREREAPGNVVYSQPALTGTGDSIISQMAYAVSWLRTKDEPQTCAD
                     VLGYLSATSRPEKEQEFFVEQMRRHPQIQWIPDPSLSEQTWRSGTYVHRPIIPNVKSK
                     TQLLAYLQKKTDASGVSVKDLKDGWPDCEAAINELEAEHKLLVVRAKKDGAARMVWLD
                     DPSLFHEVDPQLKLLWSRVELPSVENIVQKLLAAQQKPASEDPRLKAAQAPKAEKKKK
                     KTQRRTGKSTNVHMEHLLKDYSHMKR"
     gene            complement(2013428..2014865)
                     /locus_tag="MYCTH_2081200"
                     /db_xref="GeneID:11513641"
     mRNA            complement(join(2013428..2014147,2014228..2014354,
                     2014495..2014664,2014750..2014865))
                     /locus_tag="MYCTH_2081200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664040.1"
                     /db_xref="GeneID:11513641"
     CDS             complement(join(2013977..2014147,2014228..2014354,
                     2014495..2014613))
                     /locus_tag="MYCTH_2081200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664088.1"
                     /db_xref="GeneID:11513641"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Spoth2_2081200"
                     /translation="MASTKELTYQDVAEHNTKKDLYVVIHDEIYDCSKFVDEHPGGEE
                     VLLDVAGQDATEAFEDVGHSDEARETLKQLKVGTLKRGPGDPKPKTPAPGAVAPAANN
                     TTAGFGVGLYAIILIGGLIGYAAYTYLQQQQAAAQA"
     gene            complement(<2015619..>2016706)
                     /locus_tag="MYCTH_2063277"
                     /db_xref="GeneID:11513642"
     mRNA            complement(join(<2015619..2015967,2016039..2016176,
                     2016240..2016498,2016549..2016555,2016650..>2016706))
                     /locus_tag="MYCTH_2063277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664041.1"
                     /db_xref="GeneID:11513642"
     CDS             complement(join(2015619..2015967,2016039..2016176,
                     2016240..2016498,2016549..2016555,2016650..2016706))
                     /locus_tag="MYCTH_2063277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664089.1"
                     /db_xref="GeneID:11513642"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="JGIDB:Spoth2_2063277"
                     /translation="MSSHKAIVSSFVEGAPPGEARNIKALTISSPGLVNELGPAFQKY
                     NEEQFTTVKLPGGSQPVIISSHSALGNGRYYDLESSCSFAFDHITQKASAVESYVPEG
                     DGVDLAKSILKGLSTYVNEHFTNAAYGAYPIENGSKIAIIIVANKYSPNNFWNGRWRS
                     LYIFNPASSALEGSIKVDVHYYEDGNVRLLTNKSATATVPSGTGAAIAKEISAGERKY
                     QEELNRSFTSLSEGAFKALRRQLPVTRQKIEWDKVASYRLGQDIGGGSSRR"
     gene            complement(2016873..2018905)
                     /locus_tag="MYCTH_2306503"
                     /db_xref="GeneID:11513643"
     mRNA            complement(join(2016873..2017250,2017367..2018905))
                     /locus_tag="MYCTH_2306503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664042.1"
                     /db_xref="GeneID:11513643"
     CDS             complement(join(2017213..2017250,2017367..2018546))
                     /locus_tag="MYCTH_2306503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664090.1"
                     /db_xref="GeneID:11513643"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="JGIDB:Spoth2_2306503"
                     /translation="MKHSSFRTLSRALARGSPLSPSAPALVCSQRRRQYSTHPPNARL
                     NLPIDYSTTPLLSHTSQSALSNPELPPEVRNGTTKRLNLFQAINDALSIALAEDESVM
                     IFGEDVAFGGVFRCTGKLAETYGADRVFNTPLTEQGIVGFAIGVAAEGMRPVAEIQFA
                     DYVYPAFDQLVNEAAKFRYRDGACGRSVGGLTVRMPCGGVGHGALYHSQSPESLFTHI
                     PGLRVIMPRSPLQAKGLLLSAIRSNDPCVFMEPKILYRAAVEQVPTAAYTLPLSKAEV
                     LKEGSDVTIVSYGQPLYKCEAALKQAERDLGISVELIDLRTIYPWDKETVFKSVRKTG
                     RCLVVHEAMINAGVGAEVAAAIQEDPDTFIRLEAPVARVAGFSIHTPLMYEAFNAPDV
                     ARIYDNIKKVLEY"
     gene            <2019318..2022116
                     /locus_tag="MYCTH_82558"
                     /db_xref="GeneID:11513644"
     mRNA            join(<2019318..2020080,2020144..2021614,2021782..2022116)
                     /locus_tag="MYCTH_82558"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003664043.1"
                     /db_xref="GeneID:11513644"
     CDS             join(2019318..2020080,2020144..2021614,2021782..2021905)
                     /locus_tag="MYCTH_82558"
                     /note="CAZy_ID 268045"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003664091.1"
                     /db_xref="GeneID:11513644"
                     /db_xref="JGIDB:Spoth2_82558"
                     /translation="MARDPPSATRRSRSRHPDPDPDPDRDGYREQRRHRRHSSSAADG
                     SQHQRRTKRRPTSTPRAGVAGVAAEYHASEEEGGSSPSSQVLSAAALARLNRENAAAA
                     RGGGGGRRGERERARGRERQGIAREAEAERERERELRRERRREREREQERERARRRER
                     SRGYEIVEVSPTRGNWKSGDREAGGTRRRVVSGPALEEGRSGGGGGGSSGAGAGGKAW
                     GGLRGGWRGSQDSVTLEKEALWKGKKVPWYQQKKKLWILIGVCSVLLIIIIIVAAVVV
                     PKAGSGEEKRDDESSESSDGNLAGISPDSIPEGAPSWLNPFVWQDTTDFNLTYTDEMV
                     GDLPVMGLNTDWDDSARANENVPALDEPWGDYAKRPARGVNIGGWLSLEPFITPSLFE
                     YDLRMGIVDEYTLCKYLGRRCESVLEKHYATFVTEDTFREIRDAGLDHVRIPFSYWAV
                     QTYEGDPYLFRTSWRYLLRAIEWCRRYGLRVNLDLHGLPGSQNGWNHSGRLGAIGWLN
                     GTNGDVNARRSLEIHDRLSKFFAQPRYRNIISHYGLANEPRMTFLDTGKVLQWTADAY
                     ALVRRNGVSDAVVVFGDGFRGLGNWQGELTGLDRAALDVHQYVIFNTNQIVFNHSEKV
                     RYACEGWTEQTLESMDRATGFGPTLIAEWSQADTDCARHLTNVGWGNRWTGTYVTPDG
                     DGDVTTPRCPTMDSSCSCDQANSPASQWSDPYKRFLKLFAEAQMSSFEKGWGWFYWVW
                     DTEDAPQWSYKKGLAAGVLPAKAYERDFDCDLSKIPSFSDLPEYY"
     gene            2024753..2027188
                     /locus_tag="MYCTH_2306507"
                     /db_xref="GeneID:11513645"
     mRNA            join(2024753..2025807,2025981..2026480,2026593..2027188)
                     /locus_tag="MYCTH_2306507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664044.1"
                     /db_xref="GeneID:11513645"
     CDS             join(2025170..2025807,2025981..2026480,2026593..2027122)
                     /locus_tag="MYCTH_2306507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664092.1"
                     /db_xref="GeneID:11513645"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2306507"
                     /translation="MDEKEESEARSGRDPSRSDAEVGEEEGTETATESQTVVTAATPP
                     SIDDTEKGLLSSTTSSSHPNPHEPIRTAVPAAATTPTTEAAAAAPAPAARPKSPPSPA
                     AGRRLSDETVATLRRERSHNGWGCDGDVEAGGATATESDGGEKGLPQTQTQTQKQQQQ
                     QQQGEGEGSEQEEKDPFEVGWDGGDSDPMCPRSFATWRKWLIIIITSVGSFCVTNASA
                     SYTATYAQMDAEFGNSRLVATLGLSFFVLGIALGPFWSPLAEFYGRRPIYLCSFAGFI
                     IWLIPSAVAKNIETMIVARFFQGLAGSAFLSVSGGTVGDLFTRDTMLAPMSVFALAPF
                     VGPSLGPLVGGLINMYTNWRWTHYVLLIWAGVLLLTIALFVPETYHPVLLKRKAEELR
                     KSTGDQRWRAPIEKMTRSVSRTVAYSLLRPFQILFFEPMALILNIYTAILLGMLYLFF
                     GAFPLIFRTNHGFNLWQVGLTFMGLLVAMITACLSTPFWSRLRQNMVAKRHKETGVLK
                     TEPEDQLPPVIVGAPLITGGLFWFGFTTYPEVHWIVPIIGSGVFGLG"
     gene            2031249..2033962
                     /locus_tag="MYCTH_2306512"
                     /db_xref="GeneID:11513646"
     mRNA            join(2031249..2031757,2031924..2033680,2033757..2033962)
                     /locus_tag="MYCTH_2306512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664045.1"
                     /db_xref="GeneID:11513646"
     CDS             join(2031505..2031757,2031924..2033680,2033757..2033801)
                     /locus_tag="MYCTH_2306512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664093.1"
                     /db_xref="GeneID:11513646"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2306512"
                     /translation="MAEDNGNTVREASGAMSESENEYEETEQLVKDEDEKMSDQRLAS
                     EGADTSGEAKKKFDPKDPLRPRRKKARRACFACQRAHLTCGDERPCQRCIKRGLMDSC
                     QDGVRKKAKYLHDAPPEALRPVLGPNYNPNPTPSRQNGHRNSTVSNSETSSNQGTFFS
                     QSTATQFPMFSASQTPIGSMSESLPFASQQSPVSPSFQASGNQQISGMTVPQVSSPMA
                     NFGALPFDPSDPNIFNFNLEGLNFGSQYGAMEFGMLGHMSSGAAETPPQDNNTMPRSA
                     SGSLSFGPGVFGNGVNQVYEGSVLEGFLGLDANHNGVYSQGNLQHGLPHAYAIAAGPT
                     SVQSPSTDTNSPQPTPLGFEGSPTTTTYSSAPANKSANQRSATRQSNALSKLGQQSIL
                     GKRQRDPSFIYDSVKEPFGYVASFHKLFGLIQSRFSAAHTSRIAKSLASIRPSLMAST
                     RNLTRQDLVFMEKYFQRSLFEYEEFMHQCSSPTLACRRTGEVAGVNKEFTALTGWTKD
                     VLLGKEPNRNVNLGGSAAASSNAKGRVGLATPRLKSLNTESLGSADGPQPVFLAELMD
                     HDSVVEFYEDYSQLAFNDSRGHKTRKCRLLKYRPPEKEDGATEGNADEPTPQKDPRSS
                     ILSNRVAKIDGEHGISRLERDGKLECSYTWTIKRDMFDMPMLFVINFLPCYYRSNNQL
                     AV"
     gene            complement(<2034123..>2035034)
                     /locus_tag="MYCTH_53055"
                     /db_xref="GeneID:11513647"
     mRNA            complement(join(<2034123..2034620,2034792..>2035034))
                     /locus_tag="MYCTH_53055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664046.1"
                     /db_xref="GeneID:11513647"
     CDS             complement(join(2034123..2034620,2034792..2035034))
                     /locus_tag="MYCTH_53055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664094.1"
                     /db_xref="GeneID:11513647"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="JGIDB:Spoth2_53055"
                     /translation="MAAPTPNRPAVVGDPSGPEAPYPLQMSGLVISGFGRGSKELGIP
                     TANLPVDDTKTPWISSTPSGVYFGWASLRLPPSHPDYDQQQQQQQEEEEEEEGLNGSV
                     TGKKGPRLRGRNGFTVYPMVMSIGYNPFYKNTVRSAEVHVLHGFSADFYGVEMRLLIT
                     GFIRDEKDYGGLDALIADINFDCDVAKRSLAREAWAPSGLDVEVDLPGNGAGDGAGEG
                     VGGAKVLRGTLDCDWLIRPSELVEGKGE"
     gene            complement(2035357..2036648)
                     /locus_tag="MYCTH_2306514"
                     /db_xref="GeneID:11513648"
     mRNA            complement(2035357..2036648)
                     /locus_tag="MYCTH_2306514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664047.1"
                     /db_xref="GeneID:11513648"
     CDS             complement(2035688..2036392)
                     /locus_tag="MYCTH_2306514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664095.1"
                     /db_xref="GeneID:11513648"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_2306514"
                     /translation="MTSTLLFGGTGAVGSHILSTLLGDSAVTAVHTISRRAPKSTGPT
                     LQATVEADTTQWAARLKAIQPVPSTVFSSLGTTRAQAGGIANQWKIDHDLNVELARAA
                     KEAGVRRFVFVSSAGTGGLVARMLPYSKMKRGVESTIRELGFETAIILRPGLIIADRE
                     VPHQGGPLLVGAARALGRWFGPSKGYDWWAQESEVIARAAVHAAKIAEEGKAPEKVWV
                     LEQSDIVRLGRTEWKN"
     gene            2036650..2038000
                     /locus_tag="MYCTH_2306516"
                     /db_xref="GeneID:11513649"
     mRNA            2036650..2038000
                     /locus_tag="MYCTH_2306516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664048.1"
                     /db_xref="GeneID:11513649"
     CDS             2037642..2037986
                     /locus_tag="MYCTH_2306516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664096.1"
                     /db_xref="GeneID:11513649"
                     /db_xref="JGIDB:Spoth2_2306516"
                     /translation="MLDEFEVNVDDDSAFEVAEQVVRLRGECLRGKFDGVEALRRRWE
                     SRKGNKVVFKKAEDQDDETDWDSDDDGADGDEDEDVEMDDAPPVAAPPRRERQEPEVD
                     EDGFTKVTRKKR"
     gene            complement(2038002..2040272)
                     /locus_tag="MYCTH_2306518"
                     /db_xref="GeneID:11513728"
     mRNA            complement(join(2038002..2038578,2038640..2039387,
                     2039474..2040272))
                     /locus_tag="MYCTH_2306518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664049.1"
                     /db_xref="GeneID:11513728"
     CDS             complement(join(2038256..2038578,2038640..2039387,
                     2039474..2039662))
                     /locus_tag="MYCTH_2306518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664097.1"
                     /db_xref="GeneID:11513728"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="JGIDB:Spoth2_2306518"
                     /translation="MDIAYDHIQESNFPEEHSDSPSADKKPAAQTSLNADLQDAYRAF
                     SSSPWGARIGGFLGTVVKQGESVYRGAQQELSAVGQDATRGLTDLRQSIINHTRNLSL
                     NTSPFAAGSSADQASRETGDNNETTPTTASRNISSEDALKESETVLSRLRGEAAKRLK
                     DLQRAEDAADEALLRFGSNLRDFFRDAITIAPPAGDEADNQGSTVLFESKDAHGKRVI
                     HTSRFDAQLHVIHTSPERFTKDGTGAEFEAWAKDFDVDKKTADISSDLEKYLELRATM
                     EKLVPDKVPYADFWRRYYFFRHGIETAEARRKDLLKAAAAEEEVGWDEDSDDETEDGS
                     SDASAAPNRPRSTGSSGTIQPPAPAPDQGLLKPSEPRKSNDEKSQAGSDASYDVVGAT
                     SGVPSQAPSSPKEARKVDDDSDEEDWE"
     gene            2041100..2043339
                     /locus_tag="MYCTH_2306522"
                     /db_xref="GeneID:11513729"
     mRNA            join(2041100..2041680,2041746..2042499,2042563..2042866,
                     2042924..2043339)
                     /locus_tag="MYCTH_2306522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664050.1"
                     /db_xref="GeneID:11513729"
     CDS             join(2041237..2041680,2041746..2042499,2042563..2042866,
                     2042924..2043140)
                     /locus_tag="MYCTH_2306522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664098.1"
                     /db_xref="GeneID:11513729"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="JGIDB:Spoth2_2306522"
                     /translation="MTSSQNPLNGLVLTPQQQSLLFAALNSKRPSNGLSNNNFNNMPL
                     FDGSPLQGDGLSSFQTSPDLDYDYDFPGPDATLDFSFDDTNQPKMIGDLPGTKRALNS
                     DSGDAESPEKRGHPDDGENPGAKRRESEEKVAKKPGRKPLTTEPNSKRKAQNRAAQRA
                     FRERKEKHLKDLENKVQELEKLSEAANNENEALRAKVEKLTVELNEYKKRLSALTGGR
                     PVQQGVAAHFGNLLLNNLNDVSFQFEFPKFGSLPGPPANSAKKPSATPSQPPKQNSAD
                     HQSPSVNSQDGVSPGNSSSYSQGGLDSQTKQDLANTSSGSFNPPTSNDKRTNGSSTST
                     DSHYNTGGATTTSSPSAFSNSNAGVPSSSCGTSPEPSTQSPAASKPVDTLSTIGEEQP
                     SLNNQSQDLGHFANAGTDDFSHWLPQTDFQFDPQLFGGYRDPQETVLSQTFDDSFFND
                     ALDMDFFTPYNLPIPSPVPPKKDLISQIDAAKENDEPAGKAGQLLKCNEVWEKIQNCT
                     EIQGSDFDLDGLCADLQKKAKCDGCGPVVSQEDFQETLNKYFGKDKDELSKTIQEHVR
                     VEKKQP"
     gene            2044110..2044701
                     /locus_tag="MYCTH_2306523"
                     /db_xref="GeneID:11513730"
     mRNA            2044110..2044701
                     /locus_tag="MYCTH_2306523"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664051.1"
                     /db_xref="GeneID:11513730"
     CDS             2044329..2044532
                     /locus_tag="MYCTH_2306523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664099.1"
                     /db_xref="GeneID:11513730"
                     /db_xref="JGIDB:Spoth2_2306523"
                     /translation="MHPCSIQPKASKTKEVGGNAAHCDPVPSQKSPNRAISSQRTPPF
                     PLPIHSTCASLSTPNSSAAQARP"
     gene            complement(<2044821..>2046976)
                     /locus_tag="MYCTH_2063736"
                     /db_xref="GeneID:11513731"
     mRNA            complement(join(<2044821..2045387,2045499..2045954,
                     2046054..2046209,2046262..2046466,2046522..2046633,
                     2046702..2046824,2046934..>2046976))
                     /locus_tag="MYCTH_2063736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664052.1"
                     /db_xref="GeneID:11513731"
     CDS             complement(join(2044821..2045387,2045499..2045954,
                     2046054..2046209,2046262..2046466,2046522..2046633,
                     2046702..2046824,2046934..2046976))
                     /locus_tag="MYCTH_2063736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664100.1"
                     /db_xref="GeneID:11513731"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2063736"
                     /translation="MGNSQGKPVELDGEVNLNHFRLLRVVGRGAFGKVRIVERKDTNL
                     SFALKYIRKDEVVRSESVRNIIRERRMLEHVNHPFICNLRYSFQDIEYMYLVVDLMSG
                     GDLRFHISRKTFTEEAVRFWIAELGCALRYIHGQGIIHRDVKPDNVLLDADGHVHLTD
                     FNVASDIVQGKVLTSKSGTLAYLAPEVYAGNGYDVRADWWSLGVLFYECIYNKRPFEG
                     NSEASLSAVIQAAKPRFPVTNPPVSLPCMYAIKSALEADPNKRLGSTWESFTQHEFFS
                     CIDFEALERKEIEPVFVPSSEKTNFDATYDLEELLLEEAPLEARARRQKPREKLKEDA
                     TDKEIREDELYRMIETDFRPFDYTVAAYKKYALAGGQNSAAHGANLQPQALTTDEATP
                     SPATNGATPNQSLNKQQQQRQSSGNYQQQQQQQQQQQQQQQQQQRRAGAPSRPPPLAP
                     YPQSYSPNAGSSNRGNRGGMIVGSPTGGVQVTLDGGSSWSDLARQDATLPADASGANN
                     ALGGKPESSGGGVFGFLRGKKGRGNSPKPKERGVLGKEGARVILG"
     gene            <2051180..>2051407
                     /locus_tag="MYCTH_17585"
                     /db_xref="GeneID:11513732"
     mRNA            <2051180..>2051407
                     /locus_tag="MYCTH_17585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664053.1"
                     /db_xref="GeneID:11513732"
     CDS             <2051180..>2051407
                     /locus_tag="MYCTH_17585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664101.1"
                     /db_xref="GeneID:11513732"
                     /db_xref="JGIDB:Spoth2_17585"
                     /translation="LSYKDDQDRRSLKPRSSEGTKSGSDDQVAENTEAAFNPNMTSPE
                     EAKESAAKHSNGNPLEASGANQEFSKPRAPEE"
     gene            complement(2051592..2052849)
                     /locus_tag="MYCTH_2306528"
                     /db_xref="GeneID:11513733"
     mRNA            complement(join(2051592..2051631,2051722..2052444,
                     2052511..2052849))
                     /locus_tag="MYCTH_2306528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664054.1"
                     /db_xref="GeneID:11513733"
     CDS             complement(join(2051789..2052444,2052511..2052529))
                     /locus_tag="MYCTH_2306528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664102.1"
                     /db_xref="GeneID:11513733"
                     /db_xref="JGIDB:Spoth2_2306528"
                     /translation="MATQYEVEHNIKPAATAPRRRRQIDMSTFNAHLHNLLPDSSSSA
                     SQTAQAGDRQEQQHPRHHNPHAVPNPSDTSALFRLIQDQMGTLATTAPTESNRAFLQS
                     LVEALELDVAHPPRQIEGVSQEFLDGLDRVPRRALRDDDVCPICAERYLDDPYCLVVE
                     LPCHASHRFDLECVGPWLRGKGTCPMCRKELGKRKEVVVAPKRDGEGGEEDEDDEDDD
                     MNGLYA"
     gene            2053102..2056528
                     /locus_tag="MYCTH_2306532"
                     /db_xref="GeneID:11513734"
     mRNA            join(2053102..2053268,2053351..2053510,2053585..2054553,
                     2054611..2054919,2055003..2055146,2055222..2056528)
                     /locus_tag="MYCTH_2306532"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664055.1"
                     /db_xref="GeneID:11513734"
     CDS             join(2053448..2053510,2053585..2054553,2054611..2054919,
                     2055003..2055146,2055222..2056421)
                     /locus_tag="MYCTH_2306532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664103.1"
                     /db_xref="GeneID:11513734"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_2306532"
                     /translation="MHTASVGLAVTPTIISTFLSHYLHRKPLAHKPAAHLSYDEGLHL
                     IRSFLVHASRHTVEELQAFTSQWVPHPRWVRVDHVTIPEQDLARAAQLLVEQLGPEGI
                     RQVGGREWWQWRKPKSPLKAEWIEMKADYQKRKKNADPGNRVMLYIHGGAYYFGSVDE
                     HRYQIQRHARKLKARALAPRYRLAPQFPFPCGLQDCLATYLYLISQQRPNTIILAGDS
                     AGAGMVLSLMVILRDRGIPLPAGAVLISPWVDLTHSFPSVAGDCPLDYLPPSGFHHKP
                     SLAWPPPDEEELEALKKAASVQKKSIVAQEGRHAEESGMPTVQDVAKTTHRMTFVIDG
                     EQVEIKEQIQMYTTNELLAHPLVSPVMQPTLGGLPPLLIMVGGGELLRDEQIYLAHKC
                     ANPAQYLPPEALMNEEAKALVDRYKPTDVQLQVWDDLCHVAPTLSFTRPAKYMYRSVA
                     QFSAWALARAQNTEVDILCDDEISVISSSSSSSSSSSGSQEKKVSKRAPQNSSKEKAD
                     YHASIGKAGDPLPAFENHMIRQRVTHHGAILPLPEPAELPGCRMARDLVGVVKVGTVR
                     KWLEHKRRWDARFQHTKARVHRRRLRDVERGGYEVFGEGEVPPPSALAGRRKVGEALK
                     QDREAKRKRARNFGMSLWALWGSKHDEATMHREALAAKAPEVGVAVPGQGEGARTFSD
                     LEKQEEELAREDGEAPPSQTGRVPSWRELVGEKQVESAGGAPASSAEGGLDLRPAGPV
                     GDGDAGEEGGAAAGAAPSESARLLSQDDAALHTGVTGKRVMIGGLATPFSLRREPETA
                     SMVTLATPMDQRSTRLSTADSSSFVAAPSVKTTEGQEENAEDSGVALHEGSGVDPGET
                     PGSATPFATPFLSPTTPGERPGLERFVTAEEDVAKANS"
     gene            complement(2056645..2057358)
                     /locus_tag="MYCTH_88392"
                     /db_xref="GeneID:11513735"
     mRNA            complement(join(2056645..2056984,2057061..2057358))
                     /locus_tag="MYCTH_88392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664056.1"
                     /db_xref="GeneID:11513735"
     CDS             complement(join(2056862..2056984,2057061..2057249))
                     /locus_tag="MYCTH_88392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664104.1"
                     /db_xref="GeneID:11513735"
                     /db_xref="JGIDB:Spoth2_88392"
                     /translation="MQPTRVLQALRYRRLRLTTKDVNKGYYKGTGTGSMGRHTKRGGY
                     IIEWNKVRTYVCPPLDGFKLTPFVARTIAPTHGVYEGVPLGPKDPAMYLSRWKAENGL
                     D"
     gene            2057573..2061089
                     /locus_tag="MYCTH_2306539"
                     /db_xref="GeneID:11513736"
     mRNA            join(2057573..2060487,2060579..2061089)
                     /locus_tag="MYCTH_2306539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664057.1"
                     /db_xref="GeneID:11513736"
     CDS             join(2057758..2060487,2060579..2060761)
                     /locus_tag="MYCTH_2306539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664105.1"
                     /db_xref="GeneID:11513736"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="JGIDB:Spoth2_2306539"
                     /translation="MPGRQAHGRPLLPTSGGGSGSGSGSKFGKLHARTVKKSRAKATA
                     RALDAFATAAEQIPESTGGVRTRGLEDGPHPAAQKKRQRRDEDGDDGDGLGFDDGDDG
                     YGDGDGVHGDGAGSGHPKKRARRDADEDGFDGFSDGEGGGGGSDSEEWHVGVAGEDDD
                     SELDSDEAFGESDEEHFQGFAFGGSRSKGKQAKKKRSRDGDEDDEQDEGEAEEDSESL
                     GSDAIDLATALDQFSEDEEEGGEEEEEEGSEESGSEDDDESTDADDESEEDEDLDDPS
                     KMDALQSMIAGFAGEDEEDEKPAATQNKTKLSLKDLGLAGVKDPHMKRSLRLMNKEEK
                     AVKPGSSKKLDVPLAKRQQDRLLRSAAYQKTNETLDRWIETVKHNRRADHLVFPLAQN
                     AHDRGLDSGELMPINQKTSGTELEQTILTIMEESGLGPTAKPEKKEGDEAKKAELSKE
                     EQREIARQRRRERELHSREVARAKRIKKIKSKTWRRIHRKELAREQEAEFQEKLAAGE
                     LDSEDEREALDRRRALERVGTRYKESKWAKLGKKAGRAVWDENFRAGLTEMARRKEDL
                     RRRIEGRGGDGSDDDDDDGSDVSDGSAEGDPRRRLLAELDRAAAYDDDDEPQSKLFQM
                     KFMQRGEELRKKENDEAVAALRRELESDGAAASEEEEVEIGRRQFGMGDAAAAARAAS
                     QPKKAKATELRGPTKPSAAAAEPSSQSHSEPQTSAPGAAGAWSAESATSAAPAAVPSA
                     SSAAGVWSQAEPSGGKSKKGVKAKVEDLDVSSAAIASIKTSKPRPKPQPREAAQNGVV
                     VPADGEQDSDDEAALHLPLAIRDQKLIERAFAGEDVHGQFEEEKAEIEREDDEKEIDN
                     TLPGWGSWVGEGVSNREKKKHQGRFVTKVEGVKKKDRKDFRLKDVIISEKRIRKNDKY
                     LASQLPHPFETQQQYERSLRLPVGPEWSTKETFQDATKPRVIIKQGIIAPMSKPMY"
     gene            complement(2061086..2062639)
                     /locus_tag="MYCTH_2306540"
                     /db_xref="GeneID:11513737"
     mRNA            complement(join(2061086..2062051,2062198..2062639))
                     /locus_tag="MYCTH_2306540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664058.1"
                     /db_xref="GeneID:11513737"
     CDS             complement(join(2061417..2062051,2062198..2062270))
                     /locus_tag="MYCTH_2306540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664106.1"
                     /db_xref="GeneID:11513737"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="JGIDB:Spoth2_2306540"
                     /translation="MPSTAADQIPASQFDSVPDTVEAFRNGEFVVVLDDPSRENEADL
                     IVAAESVTTEQMAFMVRHSSGLICAPLLPHRAAALELPQMVARNQDPRATAYTVSVDA
                     AHPSVTTGISAHDRALACRVLADDAAGPDSLRRPGHVFPLQAKPGGVRQRRGHTEAAV
                     DLCRLAGKKPVAVICELVDDGAEVPGRAIRQDPGMLRGDACVAFARKWGLKVCTIADM
                     VDYLEKVEGKIEVNGSS"
     gene            2063137..2064466
                     /locus_tag="MYCTH_2306542"
                     /db_xref="GeneID:11513738"
     mRNA            2063137..2064466
                     /locus_tag="MYCTH_2306542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664059.1"
                     /db_xref="GeneID:11513738"
     CDS             2063258..2064292
                     /locus_tag="MYCTH_2306542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664107.1"
                     /db_xref="GeneID:11513738"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2306542"
                     /translation="MRPSLVRHVPSALRTSRRAASRAPAAAIRFQQPWLQFFPSRALS
                     TTSPARHDPHLSSASSFSSAASSSSVNETEISHFSALASSWWDPHGPSRPLHLMNPLR
                     HEFIQSCLASSSSPSTSSSTQTSDDGSSSSSSSSSNRDRGASGLRYLDVGCGGGIFAE
                     SAARLPSTASVTAIDPSPTILAVARAHAKRDPALAGGGGGGKLTYLSETVESLALPAD
                     PAARFDVVSVFEVVEHVDYPAAFLDRVGEFVRPGGWLVLSTIARTWTSWLTTNLVAED
                     ILRVVPRGTHDWHKYINEDELRAYFAAKAGVWGVPRVMGVVYVPGLGWKEVKGSEKIG
                     NYFFGVQKVG"
     gene            complement(2064468..2066997)
                     /locus_tag="MYCTH_2306544"
                     /db_xref="GeneID:11513739"
     mRNA            complement(join(2064468..2065038,2065146..2066997))
                     /locus_tag="MYCTH_2306544"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664060.1"
                     /db_xref="GeneID:11513739"
     CDS             complement(join(2064614..2065038,2065146..2066502))
                     /locus_tag="MYCTH_2306544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664108.1"
                     /db_xref="GeneID:11513739"
                     /db_xref="JGIDB:Spoth2_2306544"
                     /translation="MTQAVLGVLPILYNTVATLVALSRVRRMLRHSKLTALTRSDVVN
                     RVIEVELPRYAVRPMDRFADREQYWSLSRHPSNIPGGSWTTFNWRMNVIGLSTQRIEY
                     ADQLRQPQVEVAFDHLVCYLLDLGAHPDPHGWRLLRSSGLWTPVGCTLMRAPDGLNSA
                     LTIAPLDGSDGHLSLAVTWAGPWTTRDHSHLPPYWVRLNPAPSRQPGLELAATDGGEQ
                     HEEDYSKSHADGEGPSEPLQNSESSSTRKPSPGLPCAEKTTTTTTTTSHSSSHSHSLS
                     LSRHPITVQISADGIVTAISNSQPPAAPSPHAAAHGSANEGGNGNDNDNGSLYIDHLR
                     VRPSSSAGAWFASAATAYGTSSQTILWNYKIPDDILAFARRETVPCGVLVLLGVVDEA
                     ATPQWATAYPDDHGRQLDAFMRRTMAQREALAAEARLPPAQRAIAERERIAREGSERM
                     REMREKLRIQAERQETRLMEALQSPKWDTKLVAEHNLAWLVSKGEVDERVQGVKEAVG
                     NVLHRMVLDGEFTSRLCRMLDLWKAWAENGGMRKSDLAALQEDQVTFAYATLLVAIIK
                     DTSTALEGTVSMDLQECLRLWRTVRLG"
     gene            complement(<2067717..>2070245)
                     /locus_tag="MYCTH_2111125"
                     /db_xref="GeneID:11513740"
     mRNA            complement(join(<2067717..2068989,2069050..>2070245))
                     /locus_tag="MYCTH_2111125"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664061.1"
                     /db_xref="GeneID:11513740"
     CDS             complement(join(2067717..2068989,2069050..2070245))
                     /locus_tag="MYCTH_2111125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664109.1"
                     /db_xref="GeneID:11513740"
                     /db_xref="JGIDB:Spoth2_2111125"
                     /translation="MAPKDSKAGELERKASTRRSARVSLDDGNDGDDLALESTIADGF
                     RPTHASGSGTPSVTSGTSARSAPSTPPLTSASSTTLVSREDPASPATSGGSSSTGKPQ
                     APQFSLLVQGEANSLNRQITNSTGSSVYIPHDGPYRGPSAASHPYHLYTQSVRPARTL
                     SMGTSSTVPLSESSYRGPTGPSHPYGLYPQVDSIEADAAQAAIPLGFRGLPDQYQRRV
                     GPEGEEIGDIIGPDGHTEQLPPYTRYPDEAYVRKAAAVEGCPGLVHGAATALPPILTS
                     SASTIPPLDGAGGIGLATRNPEFESTDDPGSPGSRHSTRSFRSDDSRRGIRMDDEGLS
                     EKREPPKKWQAWMRRKACGIIPYWAICLTAIILLVMLVALGVVVGTVLSNNNKQKPPP
                     PWEQGDWKPPSDVTPIPTPTDLQPLATGTFGLPLLTNRVSNTCLKNPTLSMAWNCHIV
                     LSGMTLNVTKENKDYRASLDCNHALTSKGNTYAYGEQPPLLEKPVKLKLVQDNFEAGR
                     GPAWYKRVKYTKTVILPEGWLESDQDPIALKRAPYTATIGASMPDFKRKGIAQPGDKP
                     WICTWPDTWLELFIYAQQNSSFANWPPEPPPPSSTAGNSSSTPSTPPPSSSPSTSTDG
                     PDSSSEKGSHRFQDGHKTDDADSWDMSYHSLEIHARSEGAGPTTPPPDTASTTVEATS
                     TWNTATASDPFGPIDTGSDFPHIAQPYPRVVKLEERRMWTKDAPRAQCTQVQIMGPGQ
                     EAQPLQRPDGKLVVMDIEEVGPFGGGSPEGEFPDKKMTDGVWERSDWEEDEDDWEQAV
                     GDGEEFGIDGLPDISPCGCMWFLT"
     gene            2074143..2075277
                     /locus_tag="MYCTH_2306548"
                     /db_xref="GeneID:11513741"
     mRNA            2074143..2075277
                     /locus_tag="MYCTH_2306548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664062.1"
                     /db_xref="GeneID:11513741"
     CDS             2074358..2075140
                     /locus_tag="MYCTH_2306548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664110.1"
                     /db_xref="GeneID:11513741"
                     /db_xref="JGIDB:Spoth2_2306548"
                     /translation="MSGRPSSSSSSRSSSGSHASGDYEELRLPNSKAIKALIYFCGRD
                     PRKVKSVRRYYDDDFDDRSSGSGSGGSMFSRSSGTSHVYLVESTHPYWYQDGHPDAAS
                     YSFSARKRKLSKKGRHADVFPRSPRTSTWNRHARVDDDADYDDDDDDSSSEGSAEGYG
                     GQYAGPYPPHPGNTPSQGVPPPPPHPHPPPHHHPGFQGPPPGAFQPVYSYPPRTTPQP
                     TPVASYPVPPPPPPAAAGGMPPPPPGGHFVPGRGGVQVFVDG"
     gene            2078132..2079045
                     /locus_tag="MYCTH_2306552"
                     /db_xref="GeneID:11513742"
     mRNA            2078132..2079045
                     /locus_tag="MYCTH_2306552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664063.1"
                     /db_xref="GeneID:11513742"
     CDS             2078479..2078682
                     /locus_tag="MYCTH_2306552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664111.1"
                     /db_xref="GeneID:11513742"
                     /db_xref="JGIDB:Spoth2_2306552"
                     /translation="MDALPFSAEGGEANVTRFSQQQLLDFFFPGFSGVSWTGFYMPSC
                     REQSCFQGPQGGLNSTPRDRVLI"
     gene            2079046..2081155
                     /locus_tag="MYCTH_2306553"
                     /db_xref="GeneID:11513743"
     mRNA            2079046..2081155
                     /locus_tag="MYCTH_2306553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664064.1"
                     /db_xref="GeneID:11513743"
     CDS             2079408..2081120
                     /locus_tag="MYCTH_2306553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664112.1"
                     /db_xref="GeneID:11513743"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="JGIDB:Spoth2_2306553"
                     /translation="MTASEREEISISCFGRNPWILKELLHEARDAYLKKDEAKTAIYR
                     GTTRSGTAEPHWQRCMSRTVRPFSTVILNDEAKKTLIDDVTDYLNPATRRWYANRGIP
                     YRRGYLLHGPPGTGKSSLSLALAGFFKMRIYIVSLSSVTANEENLATLFAELPRRCVV
                     LLEDIDTAGLTHTREGGAQDSVADGADNGADASTNTAVPNGHPQPPNQNANGRLSLSG
                     LLNILDGVASQEGRVLIMTTNHIEKLDKALIRPGRVDMIVKFDRADTSMTAQIFRAIY
                     APLEADEMPSSLSSSSTTTTTAAAAAAATTSSVSPGLWWLERGTKSTVPLLTPEEEQR
                     RDAAAAEVARKKDETIARVNELAEQFAAKIPAHEFSPAEIQGYLLKNKRDPEKAVAGA
                     EDWVVATRKEKKEKELKEAEEKRAKEEKEKKEREEKEEKEKEKKKKKRKDKGRKKSSK
                     KTKKSKKETESESESSTLESSSSAAESDASESEREEKERSKKKRKPAASAPTPASPAE
                     GGASDASAPVELRREEEEAGSEAKAQPGDVIPTIAVDTVKSKEAAERPPQTPGADSGY
                     GTPS"
     gene            2082902..2085489
                     /locus_tag="MYCTH_111934"
                     /db_xref="GeneID:11513744"
     mRNA            join(2082902..2083179,2083295..2083397,2083613..2084709,
                     2084794..2085489)
                     /locus_tag="MYCTH_111934"
                     /product="hmg-CoA synthase"
                     /transcript_id="XM_003664065.1"
                     /db_xref="GeneID:11513744"
     CDS             join(2083120..2083179,2083295..2083397,2083613..2084709,
                     2084794..2084931)
                     /locus_tag="MYCTH_111934"
                     /EC_number="2.3.3.10"
                     /note="orthologue of Saccharomyces cerevisiae HMG-CoA
                     synthase (Erg13)"
                     /codon_start=1
                     /product="hmg-CoA synthase"
                     /protein_id="XP_003664113.1"
                     /db_xref="GeneID:11513744"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="JGIDB:Spoth2_111934"
                     /translation="MASRPQNIGIKAIEIYFPSQYVEQSELEKFDGVSAGKYTIGLGQ
                     TKMSFCDDREDIYSMSLTVLSKLLKNYNVDVNSIGRLEVGTETILDKSKSVKSVLMQL
                     FGSNTSVEGVDTVNACYGGTNAVFNTINWIESSAWDGRDAIVVTGDIALYAKGNARPT
                     GGAGAVALLIGPDAPLVFEPGLRGSYMEHAYDFYKPDLTSEYPYVDGHFSVTCYTKAL
                     DAAYRAYCKREAQIANGVNGDVNGHANGNGTAELAVPKTPLDRFDYVAFHSPTCKLVQ
                     KSYARLLYHDYLADPENKAFAEVPPEVRDMDYTKSLTDKVVEKTFMALTKKRFQERVN
                     PSIQVATNCGNMYCASLWGGLASLVSHVDDAALQGKRIAMFSYGSGLAASFFSLRVKG
                     STEKIAQVLDIPNRLAARRQVPPETYDAMCDLRKKAHLQKDYTPEGDVSTIAPGTYYL
                     TKVDDMFRRSYEIKQ"
     gene            2086312..2089309
                     /locus_tag="MYCTH_2306562"
                     /db_xref="GeneID:11513745"
     mRNA            join(2086312..2086500,2086561..2086994,2087051..2088443,
                     2088497..2089309)
                     /locus_tag="MYCTH_2306562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664066.1"
                     /db_xref="GeneID:11513745"
     CDS             join(2086408..2086500,2086561..2086994,2087051..2088443,
                     2088497..2089120)
                     /locus_tag="MYCTH_2306562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664114.1"
                     /db_xref="GeneID:11513745"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="JGIDB:Spoth2_2306562"
                     /translation="MADDNERPGLLSSCSIAFVQSKSLSSTLISQLSQVVKDHGAEVL
                     EPGRKGEIRVPQATHIISNTIDFDQYAEAQALMIPVVKSDWIKATIARNKLAQVRPFS
                     PDPRMIFSNVVLTCADIPPTDKEAIAGAIMALGGMESKDLSRQTTHLCALSLDHPKCI
                     EAKKKNPKCKIVLPHWFDDCFRLGKRIDEGPYLLPNPEILTKAPEDAVKVPASQQLDG
                     AVSTVPTGPYETSGSEKLVVFAQKKVMLSEDLPINAMLRKTITDKIIKGDGEIVDVVE
                     DCDMFVCQYRDGEQYIRASQLGKDVGNLAWLYHMMVYNEWTSPFRRLLHYPVPRDGIP
                     GFKDMRITISNYGGEARIYLENLITAAGATYTRTMKAENTHLITARMHSEKCEAAKDW
                     NIEIVNHFWIEESYAACQVLPLNNPKYRHFPPRTNLGEVIGQTSFDEPTLREKYYPGG
                     EERMTEAAKRKRKINERAQKNALNVGLDRDFSVMQDSSPGAQGNSAGKAAATPALGTF
                     ATPAKTRHIRSGKENDTPSVISSASRSAKAQALSKLQDLAPDIALYEKEKKRVAKDGH
                     GIWGGKRAADQLDKQRADRGSSPASKAADDAEDEPENKRPAKRAKVSLPEVDMRICLT
                     GYKRWVENKGAEEADRRKLRSLGIQIVPENAPCNYLAAPGMVRTMKFLRCLAKGPDVI
                     NSSFITACIETGKRPPIKDHLLVDKANEARFGVTIDKAVRRARANRGRLLWGVPIYCT
                     ADIPNGVDAYKNIAEANGAIFKVYRARSGSTIRPTTEEEDGGAEPDPVYLLTGSSPAE
                     RQLWPRFQEMAHRGHMEPRIVMADWLLDVAMRQELSFDPKYLMTNRVWE"
     gene            complement(<2089306..>2090084)
                     /locus_tag="MYCTH_2063758"
                     /db_xref="GeneID:11513746"
     mRNA            complement(join(<2089306..2089418,2089502..>2090084))
                     /locus_tag="MYCTH_2063758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664067.1"
                     /db_xref="GeneID:11513746"
     CDS             complement(join(2089306..2089418,2089502..2090084))
                     /locus_tag="MYCTH_2063758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664115.1"
                     /db_xref="GeneID:11513746"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="JGIDB:Spoth2_2063758"
                     /translation="MSAPPPRSTAEDPNATSSSSSFTFPPEYSFPPFFTRQTNLTTHH
                     AQLTKWASLVLAYCRHHRIFKLSLSGDPTTTTTTSSSSSETTGGDGGEAAGPDTTELF
                     YNRRINRRLSLADIREVIDFLRRDGRAEYVTTAKGGSAEGGGSGGGGDVAWIYWRTPE
                     EWASLVEGWVDATGQRGSVLTVYELVEGEGTRGSEFHGLDQELLLKALNVLVKRGKAQ
                     IFGHEDSLGVKFF"
     gene            2090411..2094887
                     /locus_tag="MYCTH_2306564"
                     /db_xref="GeneID:11513747"
     mRNA            join(2090411..2094370,2094511..2094887)
                     /locus_tag="MYCTH_2306564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664068.1"
                     /db_xref="GeneID:11513747"
     CDS             join(2090502..2094370,2094511..2094568)
                     /locus_tag="MYCTH_2306564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664116.1"
                     /db_xref="GeneID:11513747"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="JGIDB:Spoth2_2306564"
                     /translation="MALRGRDIALAGVACFIAWGYAVNWFPALRWAGHAFVGGVLLAV
                     AGLLALVLLTSRGPRHRQLRQSHRPRAAAFLAPDAWKTEVAALRRRQAYTKTPLCPEY
                     PKLSAALDEVLECIIRDFIRSWYSHISKNPVFTDEVDKAIRCALLRVRDRLQRLDLAE
                     VLTTRFVPILTAHFRDFYDAERSVRGRKLNRSVTETEELDLAIASKYREGKLHPAASL
                     AFSDTKTIQQDYLRQTMSKILPVVLPENMLASRAVSILIREITSCAVMFPVMQMLSDP
                     DTWNQLMENYGRATLQDRSTVRRLRAALDEHASPAPKAGKPVAFPRLMPGDSERRFEK
                     FIRVIRKVNNLSDARRFRSEVASQLKRDSQQENADHVYLRRLELGKRMLDQRVQHLAA
                     GGGRRPPLQQPAELAVPSESRLQNAPLVEVLRDPSTLSYFMEYMDRQRLMPLVQFWLV
                     VDGFRNPLEDDGPEGEELPLQLPPWTESDRLDLAQIDAAYLSRPELNVPASSKLVIQE
                     FLRAGKRATPEQYYRARRAILRAQSAVLEEMRAKHFQNFKQSDLFFKALAAEEASKRT
                     TLANARPRSGSSLPRSTTYGPSSRPTPVARLGSRLQAGPNNRRAGSTSDLKALNTNGG
                     NDFDPRRPAGEPHSPPPLPDADEEVGDDTLADSMASLDQDVSAAQPMLDTKVVQAMEQ
                     ALNHILEESKPSTAEDLRASLFGDDDAGSSIFSPLSDAPKQRASPAPASRSNRGSVDL
                     TRSSRSSLDVPRPAEQPRSSRGSFDARRSGELPRSGRASLDAERPAKGQEKPSLASLG
                     LVSAASRIGVFEDDDLFEDENRYLSDEPSDLDDDADADDADAVHEAAPGDLGLAEAIT
                     ALTNDIDKLIAQEAVVDSLLKKAELTNNTAELRVLRKSKASLQREIRRKELQRQQYVI
                     QESDNSLYGRSTIKIKSIQLGREDDGKEVAFYVIEVSRNAGERMPAATWVVTRRYSEF
                     LELHQKLRSRYPSVRNLDFPRRRVVMKLQNEFLQKRRVALEKYLSELLLLPEVCRSRE
                     LRAFLSQSVIHPAQGGASDQNDAANSSSSSKKDMITRIYDSVADGMEDILGSIPVLDQ
                     LSLAGQSLIAAAAGQLGNVPLAALAEGDAAAASAEGGVMMNAAEAEAELNAFEESKGQ
                     GEAEPFVKPICDIFLEIFELNRGNNWLRGRAVVVVLHQLLGGTIERKLRENVRLLLVR
                     EDALLRYVGLLRDALWPGGGPNDDGSARTNKAPRTRTEAEKARTRSEAGLMLATLVPD
                     LVGSVVGRVNAQAASRRVFAAFNNARLNAHLAFTLLDEIVDVLFGE"
     gene            2095645..2097692
                     /locus_tag="MYCTH_2306567"
                     /db_xref="GeneID:11513748"
     mRNA            join(2095645..2095778,2095890..2096018,2096098..2096103,
                     2096184..2096338,2096791..2096867,2096923..2097019,
                     2097071..2097218,2097270..2097500,2097561..2097692)
                     /locus_tag="MYCTH_2306567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664069.1"
                     /db_xref="GeneID:11513748"
     CDS             join(2095727..2095778,2095890..2096018,2096098..2096103,
                     2096184..2096338,2096791..2096867,2096923..2097019,
                     2097071..2097218,2097270..2097496)
                     /locus_tag="MYCTH_2306567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664117.1"
                     /db_xref="GeneID:11513748"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2306567"
                     /translation="MTEVSSTRLYLGNLPRHATKADVEAHFATHGTGEITEIKLMNGF
                     GFIEYKDAMDARDVVPAFHGSDFMGERLTVQFARGSRHREHGHDRNSAPRPRRTPHRM
                     QITGLPNDTSWQDLKDFARQSGADVVYSETNRNGGTEGFVEFETAADLRTAVEKLDGR
                     EFKNVRVTCIAATQPDYPRGDRGRSRSPRRYLPPPPVDDYDRRGPPRGYSPRRDGYRE
                     PTYRYRSPPRRGPPIDDYPRGRYDDPYRGGPRDYPPPDPYMNGRGYHDRRGPPPPDFP
                     PRDPYARDPYPPPRDYERRY"
     gene            complement(2098200..>2102329)
                     /locus_tag="MYCTH_2081249"
                     /db_xref="GeneID:11513749"
     mRNA            complement(join(2098200..2098594,2098703..2098790,
                     2098888..2099106,2099250..2099454,2099524..2100207,
                     2100348..2100668,2101246..2101255,2101369..2101803,
                     2101877..2102198,2102275..>2102329))
                     /locus_tag="MYCTH_2081249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664070.1"
                     /db_xref="GeneID:11513749"
     CDS             complement(join(2098312..2098594,2098703..2098790,
                     2098888..2099106,2099250..2099454,2099524..2100207,
                     2100348..2100668,2101246..2101255,2101369..2101803,
                     2101877..2102198,2102275..2102329))
                     /locus_tag="MYCTH_2081249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664118.1"
                     /db_xref="GeneID:11513749"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2081249"
                     /translation="MAEPTGLVAKSGIELLTFGTPNGFKASILLEELKEAYGKEYTYQ
                     SINISKNTQKEPWYTALNPNGRIPTIIDHDRNGFAVFEGLAILTYLTRHYDPEYKFSF
                     PVDSDDYSVAEQWISWQHGGIGPMQGQAGHFLRAAPEKIAWGITRYVGETERLYGILN
                     ARLADRDYIVGPGRGKYSIADISLIGWVNASLYAGIDLASQFPNVRAWLDRLLARPAV
                     QKGLTVPSGQPSRFSVPTAERALKGEPGLEDVKDSLEATKKLVADAKEKYNYKLSERK
                     LDKNDEPVAAAPEPETETEPKTESKPSQPEKQAAETEPSFAELGLDPRLVQAIAKQNF
                     EKPTLVQRKAIPLALKGQDVLCKAKTGSGKTAAYVLPVLSTILKRKAVDPTPFTAALI
                     LVPTRELADQVFKAIEQFSAFCAKDIHAARLTENVSDAVQRSLLANVPDVVVSTPARA
                     WHSVSSSALSLAKLQHLVLDEADLVLSYGYDEDMENISRSLPKGVQTIMMSATLSAEL
                     DALKGIFCRNPTVLDLHEEFGAEDEKLTQFYVKCSEEDKWLISYLIFKLQLIKGPCLI
                     FVADIDRSYRLKLFFEQFSIRSCVLNSELPINTRIKIIEEFNRGIYDIIIASDEKSEL
                     FGDEAADAEEEKKKKKQKQKSNSNDEAEKKDEGAEQPKKKRRYKKDEEYGVSRGRTAR
                     AGRAGIALSFVVPKELHGKHKPTTIKSTEKDEKVLAKVMRQQAKLNRKLEPYNFNKSQ
                     MEAFRYRMNDALRAVTKVAIREARTKELRQELLRSEALKRYFEENPTELAHLRHDGEL
                     GHATRQQPHLKHVPDYLLPKEGKKALASEQIGFVPLKKLDGKDRRHRKGKPKGRSFKV
                     GGKKDPLKTFKVRRKAR"
     gene            complement(2103856..2106712)
                     /locus_tag="MYCTH_2139585"
                     /db_xref="GeneID:11513750"
     mRNA            complement(join(2103856..2104211,2104277..2104612,
                     2104673..2105163,2105248..2105835,2105894..2106066,
                     2106263..2106712))
                     /locus_tag="MYCTH_2139585"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003664071.1"
                     /db_xref="GeneID:11513750"
     CDS             complement(join(2104523..2104612,2104673..2105163,
                     2105248..2105835,2105894..2106066,2106263..2106486))
                     /locus_tag="MYCTH_2139585"
                     /note="CAZy_ID 267834"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003664119.1"
                     /db_xref="GeneID:11513750"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Spoth2_2139585"
                     /translation="MRGLSVAGASAAASPLLLGLAAAAPHKQRAPQYVVNKQRADEVK
                     EAFQVSWDGYYKYAFPHDSLRPVSNTFADDRNGWGASAVDALSTALVMENWDVVNQIL
                     EYIPTINFDNTTTEVSLFETTIRYLGGLVSAYDIITNSLSLGIQKQPDVEAILTQAKR
                     LADNLKVAFDTPSGVPDNSLYFNPPRKGGSTTNGLATTGTLILEWTRLSDLTGDSEYA
                     ELTQKAESYLLHPEPALGEPFPGLLGTNIRIEDGKFEDGNGSWGGGTDSFYEYLIKMY
                     IYDPERFAEYRDRWIAAADSSIKYLVSHPTTRPELTFLALWRGKELRFSSQHLACFHG
                     GNFILGGLTLGEQAYTDLGLALVEGCHATYVGTATGIGPEVFAWQDSQLPLNASNNQP
                     PPEDQTAFYEKSGFWITNGHYVLRPEVIESYYYAYRATGDTKYQDWAWDAFQRINKTC
                     RVGSGFSSIKDVNAPDGGGFDDFQESFWFAEVLKYSYLIHAEDAPWQVKADNTNEYVW
                     NTEAHPIRVAGGK"
     gene            complement(2108533..2110012)
                     /locus_tag="MYCTH_2306581"
                     /db_xref="GeneID:11513751"
     mRNA            complement(join(2108533..2109473,2109608..2110012))
                     /locus_tag="MYCTH_2306581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664072.1"
                     /db_xref="GeneID:11513751"
     CDS             complement(join(2108690..2109473,2109608..2109969))
                     /locus_tag="MYCTH_2306581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664120.1"
                     /db_xref="GeneID:11513751"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="JGIDB:Spoth2_2306581"
                     /translation="MDDDEYGDAYDVLVALATQAGPSRAPQQPQPQAAPRIQQPTPQR
                     LDRAPPANRTSSGSGPPKVVQPAPQALPARGSGSTILVSPRQKGNPVLACLKSVPWEY
                     SDIPADYGLGLTTCALFLSLKYHRLHPEYIYTRIRNLRGKYNLRILLTLVDIPNHEDA
                     LRELSKTSLVNDVTVILAWSAAEAARYLELYKSYEHAGFAAIRGQQATSYAERLVEFV
                     TVPRNVNKADAVALVSAFGSLRHAVNADPEQIGVVGGWGEKKVRAWCRAVREPFRVQK
                     AGRRRGGAGVGTGVGARAASGKGALGEGSTGRKEEDEIEAGTEAAVAESRVDAEAASR
                     NGRPDPTVPVRTPSVTATSSSAAAPARKDDELSDGVAAALAKLREKG"
     gene            complement(<2110578..>2111420)
                     /locus_tag="MYCTH_2127928"
                     /db_xref="GeneID:11513752"
     mRNA            complement(<2110578..>2111420)
                     /locus_tag="MYCTH_2127928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664073.1"
                     /db_xref="GeneID:11513752"
     CDS             complement(2110578..2111420)
                     /locus_tag="MYCTH_2127928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664121.1"
                     /db_xref="GeneID:11513752"
                     /db_xref="JGIDB:Spoth2_2127928"
                     /translation="MKRYATNHGLSVSPPKDVRRPTHFLSRTSSVDLIAEQYRAVLES
                     RHASVHSGGEEEKEEEGWEPALSSGGDNDDSTGSRCFLSHEVTFEDPSRMVAEFPDPS
                     PASEDGTLVSFKGDTVYFKPVSFSPVPSPVPAPAPNSNYDREPEAEAEIELEPELEPE
                     WPHAAADAAAAHPLSRQKSPENNVSLQICLDLLTRELSSAMPAAGHCTGGRSSAPDAG
                     MSALQVWVMIEAYERLRDHMAELSSSNEQARSMERMFDMWLRALYSIHDAMAEKAKAQ
                     AGRR"
     gene            2113624..2115345
                     /locus_tag="MYCTH_82505"
                     /db_xref="GeneID:11513753"
     mRNA            join(2113624..2113917,2114017..2115345)
                     /locus_tag="MYCTH_82505"
                     /product="mandelate racemase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664074.1"
                     /db_xref="GeneID:11513753"
     CDS             join(2113762..2113917,2114017..2115210)
                     /locus_tag="MYCTH_82505"
                     /codon_start=1
                     /product="mandelate racemase-like protein"
                     /protein_id="XP_003664122.1"
                     /db_xref="GeneID:11513753"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="JGIDB:Spoth2_82505"
                     /translation="MGEITITGWTTRDVRFPTSLDKTGSDAMNAAGDYSAAYCILETD
                     SSYTGHGMTFTIGRGNDIVCAAINHVAERIKGRTLSSLVAHWGRTWRHLVNDSQLRWI
                     GPEKGVIHLALGAVVNALWDLWAKTLNKPVWRIVADMTPQQFVDCIDFRYITDAITPE
                     EALAMLTESEAGKAERIRDAENNRAVPAYTTSAGWLGYGEDKMRALLQDTLAKGYRHF
                     KLKVGGNVEADRRRLTIAREIIGYDRGNVLMVDANQVWSVPEAIEYMKQLAEFRPWFI
                     EEPTSPDDVLGHKAVREALRPYGIGVATGEMCQNRVVFKQLLMAGAIDVCQIDACRLG
                     GVNEVLAVLLMAKKFGVPVVPHSGGVGLPEYTQHLSTIDYVVVSGKRSVLEYVDHLHE
                     HFRHPSVIKDGFYQTPTEPGYSVEMKPESMDRFEFPGGEGSWWRSEEARPILEGEKI"
     gene            complement(2116015..2116086)
                     /locus_tag="MYCTH_t125"
                     /db_xref="GeneID:11513754"
     tRNA            complement(2116015..2116086)
                     /locus_tag="MYCTH_t125"
                     /product="tRNA-Met"
                     /note="Anticodon: CAT"
                     /anticodon=(pos:complement(2116052..2116054),aa:Met,
                     seq:cat)
                     /db_xref="GeneID:11513754"
     gene            complement(2116198..2117146)
                     /locus_tag="MYCTH_2306584"
                     /db_xref="GeneID:11506438"
     mRNA            complement(2116198..2117146)
                     /locus_tag="MYCTH_2306584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664075.1"
                     /db_xref="GeneID:11506438"
     CDS             complement(2116586..2117089)
                     /locus_tag="MYCTH_2306584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664123.1"
                     /db_xref="GeneID:11506438"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Spoth2_2306584"
                     /translation="MTAISPGDHEGYMRLALEQAQKSPPKPTNYRVGAVLVDSAANEI
                     LATGYTLELPGNTHAEQTCFTKLARKHGVPEESLGEVLPAELALYTTVEPCSKRLSGN
                     LPCVERVLRLAGSIRAVYVGITEPDTFVAENTGKRTLEAAGIPVIHVKGFEREILEVA
                     TAGHVKE"
     gene            2117302..2118652
                     /locus_tag="MYCTH_2306585"
                     /db_xref="GeneID:11513755"
     mRNA            2117302..2118652
                     /locus_tag="MYCTH_2306585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664076.1"
                     /db_xref="GeneID:11513755"
     CDS             2117445..2118326
                     /locus_tag="MYCTH_2306585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664124.1"
                     /db_xref="GeneID:11513755"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2306585"
                     /translation="MSAHDDLTEGEPPAIDPYEVLGVERTASPDEIKSAYRKKALRTH
                     PDKAPDGKKEEAKEKFQQVAFAYAVLSDPARRKRYDETGSTSEAVVDSEGFSWSDFYR
                     EQYRDAVSEEAIEKFAAQYKGSEEEKDDVLAAYEEFEGDMDGVYESVMLSSVLEDDAR
                     FREIIDAAIESGRVPRFDAYVRESKKSRQARVKAAKKEAQEADELAKELGVYDKLRGG
                     GNKKGKKDSEAALAALIQRNQASRASALDKLAEKYGAVSKAGKGKKRGAKDLEEPDIS
                     EEQFQAIQAGLMKKKRK"
     gene            2118826..2120040
                     /locus_tag="MYCTH_2306586"
                     /db_xref="GeneID:11513756"
     mRNA            join(2118826..2119173,2119269..2120040)
                     /locus_tag="MYCTH_2306586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664077.1"
                     /db_xref="GeneID:11513756"
     CDS             join(2119047..2119173,2119269..2120017)
                     /locus_tag="MYCTH_2306586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664125.1"
                     /db_xref="GeneID:11513756"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2306586"
                     /translation="MTDATKPKPYPQYCFHLSPTINRWCHFRISDIVALKSHPGFRGQ
                     DVYFYINHPVKWVRISGMVVAVDERETRHFYVIDDGSGATLECVVSVAPRTNAPAATA
                     TATTNSSSGIAGSIPIVDAPIDVGHVLDIKGSVGIFRGSWQIRAEKIVHLRSTEQEVA
                     FWEKVAQLKTDVLSKPWVLDEKEVRRCRKEEEEEEQGRHSGRRHRSAGERRGSKRGGK
                     TGLEKVKSGLEKAKAPHTEEARALYEDAEGKNGRETKTLARRPIRVTGLEKRKSAKPV
                     TRVIPMTGKYDALGL"
     gene            2121062..2124129
                     /locus_tag="MYCTH_2306588"
                     /db_xref="GeneID:11513757"
     mRNA            join(2121062..2122682,2122752..2123374,2123461..2123885,
                     2124022..2124129)
                     /locus_tag="MYCTH_2306588"
                     /product="glycoside hydrolase family 81 protein"
                     /transcript_id="XM_003664078.1"
                     /db_xref="GeneID:11513757"
     CDS             join(2121225..2122682,2122752..2123374,2123461..2123885,
                     2124022..2124038)
                     /locus_tag="MYCTH_2306588"
                     /note="CAZy_ID 268046"
                     /codon_start=1
                     /product="glycoside hydrolase family 81 protein"
                     /protein_id="XP_003664126.1"
                     /db_xref="GeneID:11513757"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="JGIDB:Spoth2_2306588"
                     /translation="MGRPWEVVFTLLIALQGVLSLPTRVITSPGRSDNTAWIVASEKH
                     PAGGVIPPILETETAKRVTPVSNLTTSVPKPTPLLVTASAVASLHLSLPTGAVNMPGQ
                     DIFADPISTDAPPATFGKKGDHPVPRLGVRGNGPFETNKFYGSLQLGTQTSPVFLHPY
                     SVVWARGEGSSKSWGLAISHVEASQRVYGETNQSTGAAEYFLNPVGIHSVCLSAKELG
                     NDTALTTEELTDFSVRVGLRPSAEAPPAVQFPLVQGLGFITAIYDGATPVLQTGERFK
                     AVTRASADPKDGVVKYKLELESGTIWLAYAHHTEGDPLDLESTDTGLAQAKGPFRGFI
                     QVAKDPGDGEKVYDQAAGAYATGVQLSGSVDGARGTYTFSFKKAGIEGTTLVMFALPH
                     HVGSFDDATKAKVTDLKLQTTTKGVGAAVVADSWTMVEDNLPTNIGFLPWSPEAGSAA
                     NISDGTKQAIHGVAQAEVSQDIKQLSDVDSMYFAGKALAKYATLVLAIREMLGDQAMA
                     QTGLNQLKEAFARVAQNQQKHPLVYESKLPCRRPEMSLPRIPRGSVRATDAAKNKQGA
                     WGGVVSSATYDTGDTGLDFGNTLYNDHHFHWGYFIYTAAVIGHLDPSWAEENKAYVNT
                     LVRDIANPSSNDQYFPLWRSFDWYHGHSWAHGLFDALDGKDQESSSEDTMHTYALKLW
                     GSVIGDTNLEARGNLMLAVQSRSLRSYYLYTSDNTIQDPKFIGNKVAGILFENKVHHT
                     TYFGNNTEYIQGIHMLPLLPQTPYVRTPAFVREEWETYFSNGRADAIAGGWRGVLLGN
                     YATVDPKAAYDFFARSDFDSSWLDDGATRTWYMCYAAALGKL"
     gene            <2125949..2127974
                     /locus_tag="MYCTH_2144279"
                     /db_xref="GeneID:11513758"
     mRNA            join(<2125949..2125999,2126033..2127974)
                     /locus_tag="MYCTH_2144279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664079.1"
                     /db_xref="GeneID:11513758"
     CDS             join(2125949..2125999,2126033..2127295)
                     /locus_tag="MYCTH_2144279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664127.1"
                     /db_xref="GeneID:11513758"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2144279"
                     /translation="MSFESNGSQSSQSQPIPHFVWDDADREVSDEWLEPVRTALLDPK
                     KHKVFHHCSKEYLKPPSPFVQQGPELGESGSTIVYRVTPPEGHPYRRPLALKVIVCKE
                     KTRPPGPDSKARSNALKEVKTMSSLRHPHIVVYVASFEDYCIQTREIGRRPRGRDSTT
                     LFRVNQRIKKHILGIAMYPPAVCNLHTLMDEVFQNPRGSDWIIRHLHTYFGCLAQAVA
                     YLHRKSVQIRHKDIKPDNIVIDDFGLPVLTDFGLSKHFETGQDSVGPTPKTLKYADPE
                     AMHEERRDERSDIFSLGCVFLEMATVLLGQPPRFAEDQLSANRNGDGHSVSSSGSGGG
                     SEADFNYSESLHNLDAYLTTLSRLSRNVIASEPAREPSIHAVLAILPHIRRMMSETQA
                     SRPRAHELYPWFRHLYDVYDTPGPCANCEEERRSGRAIASSRRRS"
     gene            2128345..2128437
                     /locus_tag="MYCTH_t113"
                     /db_xref="GeneID:11513759"
     tRNA            2128345..2128437
                     /locus_tag="MYCTH_t113"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:2128378..2128380,aa:Lys,seq:ctt)
                     /db_xref="GeneID:11513759"
     gene            <2130206..>2132123
                     /locus_tag="MYCTH_53508"
                     /db_xref="GeneID:11506426"
     mRNA            join(<2130206..2130531,2130627..2131627,2131705..>2132123)
                     /locus_tag="MYCTH_53508"
                     /product="glycerol kinase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664080.1"
                     /db_xref="GeneID:11506426"
     CDS             join(2130206..2130531,2130627..2131627,2131705..2132123)
                     /locus_tag="MYCTH_53508"
                     /note="glycerol kinase"
                     /codon_start=1
                     /product="glycerol kinase-like protein"
                     /protein_id="XP_003664128.1"
                     /db_xref="GeneID:11506426"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="JGIDB:Spoth2_53508"
                     /translation="MVQAREPNSVRFEDTLIDGGPSLNLDGLLMKPTAATPRRLPDIT
                     ANLDTHQEAHLPQGIRETDEEKRQHWFVGSIDQGTTSSRFLIFNGEGEPVASHQIEFE
                     NLYPKSGWHEHDPHVLVSSVEECIEGAMRKFVDLGYSKSDIRAIGITNQRETTVVWDS
                     VTGEPLHNAIVWPDTRTSALVRELKAREGADGLTELCGLPLSTYPSSVKLLWLIQNVD
                     AVKQAYEQGRLAFGTVDSWLIYRLNGGAKAERPVHVTDSTNASRTMFVNIRTLQYDDK
                     LLAFFGIDKAKVQLPKIVPSSDPECFGKVASGPLENVPIAGCLGDQSSALVGQCGFSP
                     GQAKNTYGTGCFLLYNVGTEPVISKYGLLATVAYDFGRGRKPVYALEGSIAVAGSGVK
                     FLMDNLGFIKNSSEISALAESVPDNGGVVFVTAFSGLFAPYWIDDAKGTLFGITHHTN
                     KGHIARATLEATCYQTRAILEAMEKDSNHKLESLAVDGGLSNSDLCMQTQADITGIPV
                     DRPRMRETTALGAAIAAGLATGVWRELEDLKQVNRNGRKVFYPQMERAKAEKMFKKWE
                     QAVEMSRGWCQDQDQ"
     gene            complement(2133664..2135257)
                     /locus_tag="MYCTH_2306594"
                     /db_xref="GeneID:11513760"
     mRNA            complement(join(2133664..2134828,2134939..2135257))
                     /locus_tag="MYCTH_2306594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664081.1"
                     /db_xref="GeneID:11513760"
     CDS             complement(join(2133932..2134828,2134939..2135040))
                     /locus_tag="MYCTH_2306594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664129.1"
                     /db_xref="GeneID:11513760"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="JGIDB:Spoth2_2306594"
                     /translation="MILHQIEALADAGVTDIVLAVNYRPEIMEKYLAEYEKQFGINIT
                     ISIENEPLGTAGPLKLAENILRKDDSPFFVLNSDITCEYPLKELAAFHKAHGDEGTIV
                     VTKVEEPSKYGVVVHKPNHPSRIDRFVEKPVEFVGNRINAGMYIFNTSVLDRIELRPT
                     SIEQETFPAMAADGQLHSFDLEGYWMDVGQPKDFLTGTCLYLSSLAKKGSKLLAPSTE
                     PYVYGGNVLIDPSAKIGKNCRIGPNVTIGPDVVVGDGVRLQRCVLMAGSKVKDHAWVK
                     STIVGWNSTVGKWARLENVTVLGDDVTIGDEVYVNGGSILPHKTIKSNVDVPAIIM"
     gene            complement(<2139944..>2140839)
                     /locus_tag="MYCTH_2063165"
                     /db_xref="GeneID:11513761"
     mRNA            complement(join(<2139944..2140296,2140809..>2140839))
                     /locus_tag="MYCTH_2063165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664082.1"
                     /db_xref="GeneID:11513761"
     CDS             complement(join(2139944..2140296,2140809..2140839))
                     /locus_tag="MYCTH_2063165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664130.1"
                     /db_xref="GeneID:11513761"
                     /db_xref="JGIDB:Spoth2_2063165"
                     /translation="MGGFYMQYLESLCRRRGWHDPRYECYRDGNGYTCLVLVNGREYQ
                     TDLAYESGSLAQENAAMRAFMVCRNFSVNGGMLARNGIVQGLPADESSRRARKGSRHA
                     YSSSSHGHRSRSSHHSSSSSTTSLE"
     gene            complement(2145836..2148283)
                     /locus_tag="MYCTH_2306596"
                     /db_xref="GeneID:11513762"
     mRNA            complement(join(2145836..2146198,2146502..2146846,
                     2146968..2147085,2147147..2147277,2147358..2148283))
                     /locus_tag="MYCTH_2306596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664083.1"
                     /db_xref="GeneID:11513762"
     CDS             complement(join(2145901..2146198,2146502..2146846,
                     2146968..2147085,2147147..2147277,2147358..2148010))
                     /locus_tag="MYCTH_2306596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664131.1"
                     /db_xref="GeneID:11513762"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="JGIDB:Spoth2_2306596"
                     /translation="MAAAQQRRPSASPSPALRSSESEREEEEIEFDRKAAGIMIPDLF
                     TQFPPVRDPLVTATSTVQDETIEACLPFLSGEDENLQYNEHGVPRLDRDRHVRFLHQC
                     LRRLPGRFVAADASRPWFLYWCLSALTMLGEDVASYRDAIVATARSMQNDSGGFGGGG
                     GQLSHLATTYAVVLSLALVGGQEAYEVVDRKAMWRWLCSLKQPDGGFQVCLGGEEDIR
                     GAYCAAVIITLLRLPLDLTPESPAYTGDSSVNLFTGVADYVQRCQTYEGGISGQPNAE
                     AHGAYAFCALGCLALLDHPGRSISSYLDVPRLIAWLSARQYAPEGGFSGRTNKLVDGC
                     YSHWVGGCFPLVEACLNSSSSSSGPMAAGGPAATITTTTITDRHRPPPADESLFNREG
                     LIRYILCCCQDQTKRGGLRDKPGKMSDAYHSCYVLSGLSSAQHQWELDELNDDNDGDD
                     DSNELKKEGAAEGAMEAAWAVLPYLDGPQVFDSKDRVRPIHPVYAIPQPCVRAMKEYF
                     DRKQGF"
     gene            2152024..2155251
                     /locus_tag="MYCTH_2306599"
                     /db_xref="GeneID:11513763"
     mRNA            join(2152024..2154865,2154923..2155251)
                     /locus_tag="MYCTH_2306599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664084.1"
                     /db_xref="GeneID:11513763"
     CDS             join(2152453..2154865,2154923..2155023)
                     /locus_tag="MYCTH_2306599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664132.1"
                     /db_xref="GeneID:11513763"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2306599"
                     /translation="MSYDFNATGGEAALLEQLVFDHRERYSYPAVSSAAPSQDLVSTA
                     LATTTTMSHPNRQSLSPVTSWLPLDPASTMSAPMSMHSPNSASGVPSSPDDQSAGSPG
                     HQSSTMSSPLQQSSPYQTAAHSQPAGLVPDWSLPLQAQQQPAADLSQFIQDSALMSFN
                     PYTSNFQPAPVEYLPATTQATLDAGLQLESAFPTMSPMDPTSRVMQWGGANWQDFDQS
                     LNFQTDSLPRVRSIGSHSPTGTFLEVLSLGSSSDNGWTSVDMYPSCDTFTHSQTQHTQ
                     NQAIFNPSQTLHLRTNSDSSDANSLEFGSYEEITFPYSPFSPCSDGFVDTANNHRNCM
                     PGEHHHHASTSPELISPTAAVAPLPINNKAISASRPVVGSGSSGSGCTSPPARRNSGT
                     RKSPIAKATKPVIRRTSTGKKDGTGEKKVGRRRGPLLPEQRKQASEIRKLRACLRCKF
                     LKKTCDKGEPCAGCQPSHARLWQVPCTRIDIKDIGYFMKDWKADYERHLGRGMSVFNV
                     KGFAQKETLMWITHGYGFCLPVMVREVYVADESCFQLDWVESSLQDQDPIDFEIRTER
                     LDVGQDGISMEALNEYIDKHVDEGFEQFIDDHFEGTPFITEIFKTAYRFYTKERLPVI
                     RKALKLVVAYNLTLHITMVEQPPTEEPMEGQIDDEDSKYYGKVVAPVMINFQIKCAMA
                     DMWRELQKDILEELSALYSSVYSGERLKNWPTIFMLASILLAVWEEIQFDCHYRVPDP
                     VAVEKFCNDMETVPVGVIVGLFHAISQKLPAFTEWDTRRHGQLLNNNPAVCEAMTEVR
                     QHVLKHEAYLRTRSETKFDRYDFDSLSNKLLSKLVIRSN"
     gene            2157775..2159298
                     /locus_tag="MYCTH_2315548"
                     /db_xref="GeneID:11513764"
     mRNA            join(2157775..2157898,2157975..2159298)
                     /locus_tag="MYCTH_2315548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664085.1"
                     /db_xref="GeneID:11513764"
     CDS             join(2157877..2157898,2157975..2158870)
                     /locus_tag="MYCTH_2315548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664133.1"
                     /db_xref="GeneID:11513764"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Spoth2_2315548"
                     /translation="MQIFVKTLTGKTITLEVESADSIETVKNKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESADTIETV
                     KNKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESADTIETVKNKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESADTIETVKNKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGQ"
     gene            2159362..2161996
                     /locus_tag="MYCTH_2306607"
                     /db_xref="GeneID:11513765"
     mRNA            join(2159362..2160543,2160606..2161996)
                     /locus_tag="MYCTH_2306607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664086.1"
                     /db_xref="GeneID:11513765"
     CDS             join(2159476..2160543,2160606..2161859)
                     /locus_tag="MYCTH_2306607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664134.1"
                     /db_xref="GeneID:11513765"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="JGIDB:Spoth2_2306607"
                     /translation="MPPYYHLIFELYATPDPTVTSPASTGKGSTSTHDDIWIPSPGAS
                     IFDELPSHPRTKAHTRQQQQQQQQQQRRLPEHWLQRRPELDGYYDYGLDRSADGENYR
                     CEESSSISVAAVAAAAANTRVIDCGAQRGTTHDTTSDGTSYRAPLNERQSRAIHEAES
                     APRVEDGFGPDKAVRDWRFGRVRIESFDSSVDEEKTGKMAGGQETGDAAATAAAAATP
                     AASLGPNLGGMGLATKARYVPLETKNTEAGWGIVHLYREGNESGVVNGQSGVSDGPSQ
                     AQRGGDEEGTILCIPAVPSYMSPSDFLGFVGEKWRGYVSHYRMVMTSTMSRYMVLMKF
                     RDSGRAREWRKAFDGKPFDSVETEICHVTFIKSITVETPNQADPQRRYSEGNKDRFSP
                     TSPLVNSLKPFPPPTPNLIELPTCAVCLERMDDTTGLMTILCQHVFHCTCLQTWKGSG
                     CPVCRATNPKPAQNYDPDDPYSQPFGSGVANICNNCNCTDDLWICLICGNVGCGRYNG
                     GHAKEHWKMTAHSFSLELETQHVWDYAGDMWVHRLIRDKGDGKIVELPRNNGNDQRPA
                     APGGGGVASQEDVVPRAKLDSIGMEYTHLLTSQLESQRLYFEEMVNKAADKAAKASAA
                     AESASRQAAEALSELAALREEHRVLKDETVPSLERELSKEKNRAAKSAELARNLSKAL
                     QEEKEVSAGLMKRIEHIKTQSEGTEKLVEQLRAENEELKEMNRDLTMFISGQEKLREM
                     EKEGMVEQGELEEGIVGVAEGSKGRRKARGKKK"
     gene            2163214..2166337
                     /locus_tag="MYCTH_2306608"
                     /db_xref="GeneID:11513766"
     mRNA            join(2163214..2164008,2164069..2166337)
                     /locus_tag="MYCTH_2306608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664087.1"
                     /db_xref="GeneID:11513766"
     CDS             join(2163793..2164008,2164069..2166228)
                     /locus_tag="MYCTH_2306608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664135.1"
                     /db_xref="GeneID:11513766"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="JGIDB:Spoth2_2306608"
                     /translation="MSSEAAKQAPQGAKSSAPSKELYPMSNWKYDGFLWTMSVLVDLF
                     FREVHPRGAWKVPRHGPVLFVAAPHANQFVDALILQRTLKMEAKRRVSLLIAQKSVHG
                     FIGWASRQVGSVPVGRAQDSARPGQGTIYLPDPINDPTLIRGVGTDFEKDAEVGGMLF
                     LPSAKGQSGASVDIAEILGPQEIRTKRPFKGKLAMAQLTARDDIDQNGNLTNVDVHGP
                     APGYQGTKYKIAPHIDQSKVYQAVFDRLKSGGCVGIFPEGGSHDRTELLPLKAGVAIM
                     ALGTLAEAPNCGLKIVPVGMNYFHAHKFRSRAVVEFGPPFEVPPELVEMYKNNRRRDA
                     IGQLLDMVHSALSAVTVSTPDYDTLMVIQAARRLYNPTGKKLPLPVVVELNRRLAMGY
                     ERYKDDPRVIKLKDSVTEYNRQLRYLNIRDHQVEYARLSWHIVVLTFVYRLIKLIILS
                     AGVLPGLILFAPIFIATKYISRQKAKTALAGSSVKIQGKDVIATWKLLVSMALAPVLY
                     GAYTFLTMYWVYMDRLGGLVPEWVSLWMVFWACWIIFPSITFAALRFGEVGMDILKSL
                     RPLALCINPSSSYSISQLRERRAELSAQVTSIINAIGPEMFPDFEHTRLVFDAYSRGV
                     SNDVSNAFLNNTGSGPGSPTHSRDQSGASSPNVDGAASPGISRRNTTQSSRAIPRNES
                     FSNIGQAPIFATRPPSRSRSRSSSAGGGLGMAGFPVSGFTSLDSKEGFDQANRKIREA
                     MRERGELRRRQREKRRMSLADEDGLTSDEEESAESASGSALTDYEEARKAK"
     gene            2167433..2169006
                     /locus_tag="MYCTH_2306610"
                     /db_xref="GeneID:11513767"
     mRNA            join(2167433..2167936,2168047..2169006)
                     /locus_tag="MYCTH_2306610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664088.1"
                     /db_xref="GeneID:11513767"
     CDS             join(2167610..2167936,2168047..2168856)
                     /locus_tag="MYCTH_2306610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664136.1"
                     /db_xref="GeneID:11513767"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="JGIDB:Spoth2_2306610"
                     /translation="MSGALKSLINGAKALAIGRSGSKARIDELFPKVNKAVDGEDCDR
                     DCESCSVQYPRGFKIDESDDLYGFVKGWSTHVLVATGKTDWVRDVANEKGSVMQAIAN
                     TKGPTNGRLMLSASNMPTPHNTTSYSEPTTVLLLPAFVLIDNVTPATVPTLIDSIVSQ
                     APTTTSPLRPFSLPRSLPAPLPESTPAAIRDLTTRPCPHRALILLCSQKTRDARCGQS
                     APLLRKEFQRHLQPLGLYRDLDDERPGGVGIYFISHVGGHKYSANVIIYRRARFDEEG
                     PGGQKKKEEEEEEEEEEEEEEEEEEEEEEEEKNKEKDGKSENKEGREQEEGDLGAAQC
                     IWLARVRPEDCEGIVKFTVLQGKVVKPERQLRGGFDREKGLLSW"
     gene            2169696..2173110
                     /locus_tag="MYCTH_2306612"
                     /db_xref="GeneID:11513768"
     mRNA            join(2169696..2171515,2171819..2173110)
                     /locus_tag="MYCTH_2306612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664089.1"
                     /db_xref="GeneID:11513768"
     CDS             join(2169804..2171515,2171819..2172998)
                     /locus_tag="MYCTH_2306612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664137.1"
                     /db_xref="GeneID:11513768"
                     /db_xref="JGIDB:Spoth2_2306612"
                     /translation="MSSSLAGINTTYALPASVGLQQEASGAAPPRHHQRSKSSVLRSL
                     MGGGHKRNNSDGSALPSAPLVAPLGTTPAFHMSQQNLAPSSRHSGVFHVGFDAAAAAA
                     MEPQRYAHALGELQQNRQERSPERRGCERADQAPPSPTKTAFSSISLRPFGRDRDSSK
                     PPKSRDTSPTKPKKAKSATNLAVLLRPKSIKNLKQLLTEDGDGGAKEKEKDKENRSPS
                     DFPGNDLHVSSLLPPNPIYAQFASQNFGQHSPQLESPLDVSFKRSGNDPTAERPGAVA
                     ASLDNKKPRPKSFQPHIGRRDDGTGGSRGSSGSENRAKRMTWGKDSTPAAAARPAIGS
                     RSTSSATLTAGAAPEMPAIDTKDIDKHLEAMLDRRNIPENQRYKMRNLSDTIKMELIR
                     QDWAEMQAKPDRPVSHDGHHPQPGGGTAVPPDQQDENSMGSRAKKDKKRHSRGLSLTI
                     VRGGGNKSNPSSPAKKKGDSSLGRHFRTKSSESVVSEPPLPYAPGYGASFLAKVKGQQ
                     LPGDFVAYLQKVPQPELVEVGKLHKLRLLLRNETVAWTEEFIRQGGMKEIVELLHRIM
                     AVEWREEHEDALLHENLLCLKALCTTDMALQYLHSIHATLFPALLHMIFDPEKKGPSE
                     FTTRNIITSLLLTYIECATPQERVHRARAVLGFLRDPEPREEDRPVDFVLEMRRERPY
                     RVWCKEVVNVTKEVFWIFLHNLNIIPLPSADNKQGQSSSTDQSGCEGATTTTTTTTTS
                     TTNNTTAANGNNNHNNNNNNNNNSSSSPDPSHHISYLIRHFPQERPPVPAAPYVGGVE
                     WDATNYLASHLDLLNAIIACTGPTAAERNALRAQLRISGWERCLGGSLRLCKEKFYGS
                     VHDGLRRWVAAAAEDGWDVRDVRYGPPPPEGRANANHNKRGGAASPAKKLNGPAAAGK
                     EGGQQKQQQQQQQPPRIEMPRLDFGGPVVVGIGPGLGSGAVRANEPWLS"
     gene            complement(<2175409..2176273)
                     /locus_tag="MYCTH_2306613"
                     /db_xref="GeneID:11513769"
     mRNA            complement(<2175409..2176273)
                     /locus_tag="MYCTH_2306613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664090.1"
                     /db_xref="GeneID:11513769"
     CDS             complement(<2175712..2176063)
                     /locus_tag="MYCTH_2306613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664138.1"
                     /db_xref="GeneID:11513769"
                     /db_xref="JGIDB:Spoth2_2306613"
                     /translation="MFIHPGKLAAPPRLRRVVAYQWAHSAHRVLGAAEHLPEASGSSR
                     SLDGSPPGNYHEASKGKLPAPPPGAVPIPPAHHEKGSFGRRAETLSGGTCHVRCRLYS
                     RMLTSSYYNWKSHPV"
     gene            <2178755..2179877
                     /locus_tag="MYCTH_2306615"
                     /db_xref="GeneID:11513770"
     mRNA            join(<2178755..2179003,2179151..2179877)
                     /locus_tag="MYCTH_2306615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664091.1"
                     /db_xref="GeneID:11513770"
     CDS             join(2178758..2179003,2179151..2179663)
                     /locus_tag="MYCTH_2306615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664139.1"
                     /db_xref="GeneID:11513770"
                     /db_xref="JGIDB:Spoth2_2306615"
                     /translation="MADQFLAEQHTWTLFRNSQSDEADSWVMLTRDGQIVPIPGEKIL
                     HTSRPRVSLDISTPRELQIADPFSLKCDNGIAYITNERVIFLPARPTEDFKSFFTPVL
                     NFTDTHVHSSWIGPWSWGGTVRPVPGGGIPMHIPRVEVRFTFRDGGHSDFQAKFEWLK
                     ERLQHAQELGLVPGQNLEPPPPYEPSAPGPSPSSGDPSTARTGPQLEQEQQQQEQQPP
                     QPAPDEPPPDYVQAQAQAISMQYEERTRAEAERY"
     gene            2180252..2181602
                     /locus_tag="MYCTH_2315552"
                     /db_xref="GeneID:11513771"
     mRNA            join(2180252..2180407,2180587..2180764,2180989..2181102,
                     2181165..2181602)
                     /locus_tag="MYCTH_2315552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664092.1"
                     /db_xref="GeneID:11513771"
     CDS             join(2180321..2180407,2180587..2180764,2180989..2181102,
                     2181165..2181229)
                     /locus_tag="MYCTH_2315552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664140.1"
                     /db_xref="GeneID:11513771"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="JGIDB:Spoth2_2315552"
                     /translation="MGFWDTITDLVEAATPWATADAEAPAKELPEETTAETTQEKSAE
                     AETTAAEEPAAAEEPAAEEEQEEESAEEEEEEEELVDPKEKLEEECRNSKQCSPAKHH
                     FDECVERVTKAQAEGNAKEDCVEEFFHLAHCATECAAPKLWSILK"
     gene            2182272..2182657
                     /locus_tag="MYCTH_2306619"
                     /db_xref="GeneID:11513772"
     mRNA            2182272..2182657
                     /locus_tag="MYCTH_2306619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664093.1"
                     /db_xref="GeneID:11513772"
     CDS             2182404..2182607
                     /locus_tag="MYCTH_2306619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664141.1"
                     /db_xref="GeneID:11513772"
                     /db_xref="JGIDB:Spoth2_2306619"
                     /translation="MTHPETAKAGHVHAVLAKGRVSTVTGPKGRQALTGRYFTFADQL
                     LPLFLLLLLLPLLLLLRNTLEVR"
     gene            2183830..2185970
                     /locus_tag="MYCTH_2306621"
                     /db_xref="GeneID:11513773"
     mRNA            join(2183830..2184307,2184527..2184988,2185053..2185970)
                     /locus_tag="MYCTH_2306621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664094.1"
                     /db_xref="GeneID:11513773"
     CDS             join(2183951..2184307,2184527..2184988,2185053..2185826)
                     /locus_tag="MYCTH_2306621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664142.1"
                     /db_xref="GeneID:11513773"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2306621"
                     /translation="MGGHSRSWNELRGEEASEVEKAATRSIGGSDHGLGDSDAAHKSG
                     ADDRLSIEMGTVTARTTDPALESGRLSRPASAGTECSRGATQGERGTAGVEYKVYRRR
                     WFGLLQLTLLNIIVSWDWLTFSPVASHAARYFHTTETIINWLSTAFLFAFTFATPAVI
                     YVLHLGPKKSIVTAAALLLVGNWIRFAGSHSSSKGLFGVVMFGQVLTGLAQPFVLAAP
                     ARYSDLWFTNRGRVAATALTSLANPLGAALGQLIVPFWVNQPSDISRMVLYVSIISSV
                     CAVPAFFIPSCPPTPVAPSAETPKLSLSASAKILFNQLEFWLLLVPFAVYVGLFNSIS
                     SLLNQIFLPYGYSDEEAGIAGALLIIVGLVASAVTSPIIDRTKSYLLAIRIAVPLIGL
                     CYLVFIWMPGTRDGGGVAGPYVVMAVLGGTSFSLLPIVVEYLVELTHPISPAVTSTLS
                     WSGGQLLGGILIVVSGALKKGEEGDPPGDMTNALILHAVLALVAVPLPLCLGLFGRKE
                     KLLLRRVRSDEEGRDDTGPGQA"
     gene            complement(2186001..2187874)
                     /locus_tag="MYCTH_69410"
                     /db_xref="GeneID:11513774"
     mRNA            complement(join(2186001..2187441,2187508..2187874))
                     /locus_tag="MYCTH_69410"
                     /product="3-keto steroid reductase-like protein"
                     /transcript_id="XM_003664095.1"
                     /db_xref="GeneID:11513774"
     CDS             complement(join(2186115..2187441,2187508..2187581))
                     /locus_tag="MYCTH_69410"
                     /note="orthologue of Saccharomyces cerevisiae ERG27p;
                     orthologue of S. cerevisiae ERG27p"
                     /codon_start=1
                     /product="3-keto steroid reductase-like protein"
                     /protein_id="XP_003664143.1"
                     /db_xref="GeneID:11513774"
                     /db_xref="JGIDB:Spoth2_69410"
                     /translation="MSAKAPWEAIPPEHTLFVLVTGGNSGIGFGIGERLIDEYLTTRS
                     LSSHLVLIPTTRSAKKSRETVDGLRQHTKEFAATSKVLRARAGPNYDPKQTTKRVHIL
                     SVQLDLCSLPSIRQAAHQLVSGTLSSPSDDDDFVSLTDVTIPRLDSVIFNAGMGGWYG
                     LDWPKVFHNIFTKGLVSATTWPTFKGALAGHVIDPIKGAKGEEGTPQMGEIFCANVFG
                     HYVFAQRLVPLMSRPAGSALPPGRIIWESSVEGEWDSLSLDDFEAVTIPAAYESSKRL
                     TDVLALTATLPASRPYVDRFLNIANNTATTPPKIYVVHPGIVQTTLFPLNAFMFFWYN
                     VVLYVARWLGSPWHVITAYNGACAAVWLALQEQGWLDGARAERVKWGSSTDRWGGCRV
                     KKTEVDGWGWEGRVEEMRELRQEHKLAGRRPGAVDVTEEKLVEFKELGAECWKRMEEL
                     RERWEAMVDAAEAGRS"
     gene            <2188283..>2189356
                     /locus_tag="MYCTH_2119212"
                     /db_xref="GeneID:11513775"
     mRNA            <2188283..>2189356
                     /locus_tag="MYCTH_2119212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664096.1"
                     /db_xref="GeneID:11513775"
     CDS             2188283..2189356
                     /locus_tag="MYCTH_2119212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664144.1"
                     /db_xref="GeneID:11513775"
                     /db_xref="JGIDB:Spoth2_2119212"
                     /translation="MLNKILIFTGAPEKHALDWSASGLLTEFEDAIARFVGLHSEHRP
                     PSTTPTPKHAAWRSLPLANAKIGTGFSQHYGTIFDDGLDESASESGLEFLDTVTLPLA
                     SGGGDSEHDPARSQFYEHSMAAHDGFTPSQLISQSTGQETTSFISDRTSSFLSGDGSH
                     AGPIKEPLLVRGSDLVSDLRNIPSATYLLRIQPQTFTCNLIVGIISISQPRAVKTRWG
                     ATKYLVELLVGDETKAGFAITYWLPSDNLDDSPLAGLRVRDIILIQNVAFNVFTNKVY
                     GSSVRKNWTKVHLLYRMKLDSRDPGGYYSASDLAGTGTVHPQLDKTRRVRDWVLNFVG
                     RETRTGTNRQARWNQPPADDTQL"
     gene            2189945..2192366
                     /locus_tag="MYCTH_2081294"
                     /db_xref="GeneID:11513776"
     mRNA            join(2189945..2191020,2191094..2191118,2191307..2191720,
                     2191983..2192366)
                     /locus_tag="MYCTH_2081294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664097.1"
                     /db_xref="GeneID:11513776"
     CDS             join(2189992..2191020,2191094..2191118,2191307..2191720,
                     2191983..2192245)
                     /locus_tag="MYCTH_2081294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664145.1"
                     /db_xref="GeneID:11513776"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Spoth2_2081294"
                     /translation="MTVDRKCQYSSPWSSTTRSPSDRSTSAGPVSTPAPAPAPAPAPA
                     SFPGLQPSHQVEEPHSRVDMVHMQLLHHYMTNASLYPLFENCMKDIVINVALREPYVM
                     YSLLAISAHHLSIFRPEQQQFYRHLAIRLQTEGLSIFNSIDVSFYGDSVEKRIPAFIF
                     SSLIGIHALCDMLLHRDTDPDSAIAGFLKYMSLHRGMLTVMHGYWDELKKSELRVLFE
                     ELVPQWFSLTSEGRDCDDIRKRLTAAGLGTDELEDALHAVDLIQCVLDAKPNAESRAY
                     ILCSWVAMLRPAFVPMLENARPEALAVLAYYFLAMHHCRGLWMMGDAGQHFLTLLAEH
                     FRGGEWYAWQALSPSTPLTTARRTVPMARNFVVTRPQEADAPRIAEIHLAAMDANPLL
                     HAQFPASESLKSLQQFLEADTAEQLRDPSSGVLIARDPETGVIAGFAKWNSPSHPEEV
                     KLESGSLRDLEGCRREFLDRYVSLAEEARKRCFGDQPCYCISFVCTDPAYQGQGVGTL
                     LTRKVLELAKTDGLQVYLESTDVAIPMYQKLGFRVIDEFQMKIPGLTSDEITVSYREV
                     CMVWQPGSMT"
     gene            2195535..2198998
                     /locus_tag="MYCTH_2306627"
                     /db_xref="GeneID:11513777"
     mRNA            join(2195535..2196360,2196627..2197422,2197481..2198998)
                     /locus_tag="MYCTH_2306627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664098.1"
                     /db_xref="GeneID:11513777"
     CDS             join(2196035..2196360,2196627..2197422,2197481..2198770)
                     /locus_tag="MYCTH_2306627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664146.1"
                     /db_xref="GeneID:11513777"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2306627"
                     /translation="MSTPCAVPRTAPIAIAPKPPRFPPSRQSSIHLDSFRSGFNSPDS
                     DSVSGFPAHPCEACLNRKTDCAMGDDEESCVACLVAGTECSLIDSPAPRKRKLNGDVE
                     TSSSKRSSPGRSDIRRRRHQQQSFSCTTTSSSLTEDMANFGGPTLLKRTLGLQADRYS
                     QYIGPTTDFEPSLINLSPFDPHDESLLARGTLRRVSDNDTFLLLPDHNTPGYDHILED
                     ADEIENIVAPHGRKLIDLYFRVVHPAFPIIQKGVFLEKYERSHREISPPLLSAIYILA
                     INWWEHSEDLAGLPRPNVRELERLVRTTLADAMYRPKLSTIQAGLILSQRPEGDQWAP
                     TAQLVAIGQELGLHLDCTHWKIPPWERGLRKRLAWALYMQDKWGALVHGRPSHIFASN
                     WAVQNLNPNDFPDVEWDENDVEERLEIERGRVVFGQMVRLSQILSEILETFYTLEASR
                     ATANAGAQATQLILSLAKPIQLKLKDWYSGLPAVVRMDSSLQSSLHQPNRLSSIGYLH
                     LAYFATEITLHRRIIRSMDTAASAAAAASTPSSSATSPGVNPPPAGGSSGGVDPYIQH
                     ICRSAAKARLISAMDFVNRLTPSHLRAFWYFASKTNFALIGTFGSLLWATSPGREEGE
                     WYRRRLGEYRWTLSVSSKPGEGKGLTEFAMGMLDISTGLLKKLPEKPLLSRSESGVDI
                     DAARRQSLLALGGTGISASDSGGGGVGGSSFGSAGRSGLTMGMGMRSGAVGGGAGGGG
                     STRAAAASGAFGGRGMPGPESSSGMHSAEASGVQSPLSEESESEDEETYGNFSATAGM
                     AGLAD"
     gene            complement(2199751..2202243)
                     /locus_tag="MYCTH_2306629"
                     /db_xref="GeneID:11513778"
     mRNA            complement(join(2199751..2200473,2200624..2200863,
                     2200992..2202243))
                     /locus_tag="MYCTH_2306629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664099.1"
                     /db_xref="GeneID:11513778"
     CDS             complement(join(2199983..2200473,2200624..2200863,
                     2200992..2202072))
                     /locus_tag="MYCTH_2306629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664147.1"
                     /db_xref="GeneID:11513778"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2306629"
                     /translation="MLDKDNMTTDTEADKATPPGAQSPKVREEETAGDGGKGKDGDDP
                     FGAAKAGRDNADVVYPTGIRLFLIIGSLCLAVFLVALDQTIIAPALGAITDEFGSVKD
                     IGWYGAAYLLSTTALQPVYGSIYRMFSVKWTYLTAVFVFEVGSLVCALAPSSNAFIAG
                     RAIAGLGTAGLFSGGVVILSYTLPLRQRPVAFGLIGAMWGIASVAGPLLGGAFTDHVT
                     WRWCFYINLPIGGAAMLAIFTFLRIKQAADEQGLPTNPPPRPTLVRRILRLDLLGTLM
                     LVSFIVCLLLALQWGGTEYAWDSSVVIGLFVGFALMAIIFAAIQIWRGDRGTLPPRLF
                     KNKDVVCAMFFSFFFGAGFFPLVYYLSLYFQAIQGDSAVTAGIKLLPLLISVVVTSVS
                     AGGLITAVGYYNPFVLPCMVLFTVGAGMITTFDLDSPLRVWFGYQVIAGLGIGIGFQT
                     GALVVQNSVSHEWIPQATACVQFFQAMGGAVFIAVAQAVFQNGLADEMERTVPGLPPQ
                     VLIHSGASEIPRVLERMHASRYLTAVLTAYMHGLRNTYYITVACAGAAFLAACGLSWK
                     KIQKRRPAPAAAPAEGEAEEGEAKGVDVTNNGSESAN"
     gene            complement(2203082..2205051)
                     /locus_tag="MYCTH_2306632"
                     /db_xref="GeneID:11513779"
     mRNA            complement(join(2203082..2204360,2204799..2205051))
                     /locus_tag="MYCTH_2306632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664100.1"
                     /db_xref="GeneID:11513779"
     CDS             complement(join(2203261..2204360,2204799..2204874))
                     /locus_tag="MYCTH_2306632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664148.1"
                     /db_xref="GeneID:11513779"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="JGIDB:Spoth2_2306632"
                     /translation="MSTQQQALILDTILALRRKLKRKAYEILAPLTSVTDLPSHPTFS
                     RPFTSRALNELIEQGRSLMQKENKALWKAKPLLTKLVGDNTWAPCGLMTAPDDRDALL
                     FSDTVSFFNRPASRVPTGPSAPGVNGSHKNTCTESAMRGTAQGAPAAGSTRQQDKEPG
                     SEAAANEGTLSDGHTNANGDGNTGGGSGTAESADRDGQVNGKTDHETEGKDGPAAAGG
                     SSGKPDAAAGVADVEMAEAPGAGREGPTLPSGLPPPKVQTAPSPVLPAEPLDELFIHP
                     LFKLPPAARQDRDLGLPEQEAEEVRRLLLLYVQKQEEICRNTKRLYEGLLKADRLRRT
                     VWQWAKAEAHCGPNRDMSDGEDWYDKEEWGLTEDLKKGEDEVEEETAQTQKKTRNRK"
     gene            2205297..>2208406
                     /locus_tag="MYCTH_2144292"
                     /db_xref="GeneID:11513780"
     mRNA            join(2205297..2206513,2206803..2206871,2207257..>2208406)
                     /locus_tag="MYCTH_2144292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664101.1"
                     /db_xref="GeneID:11513780"
     CDS             join(2205450..2206513,2206803..2206871,2207257..2208406)
                     /locus_tag="MYCTH_2144292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664149.1"
                     /db_xref="GeneID:11513780"
                     /db_xref="JGIDB:Spoth2_2144292"
                     /translation="MSWPGADDSPGDYGADQHQPDRPTDIASLGVFRNNRLVELTPSQ
                     VERALKLMSRPFEDLPQLPFFAPLFSYTTDWQKMEIAYPLVDASFHVGRLLTPPEADA
                     LAYYRAKFCSRAAWAPPAVLLTAAYLTHRGRSTFRFPFYTPKPASFNPMSFPSASMPF
                     ISGPAAVRLWHLLRFAAYGLMSQLVVKNIIYSYAQTSTLVGALRDDRLKVLRETMPQR
                     RQGTVRPHSPATANPAEPERTTASSTPAPPTDFSGAPQQARQQPRWAQQAPESQSAPQ
                     DDDSYLFDDASPVAPSQRQTPPSGSRPSSGGGSAWDRIRERARSEEGAAWNPGQQQDR
                     TPAGRQRGEQYTYTHADQEKAHLSGRETAMNDPWALPRQKSEPEGASSDANANANGQS
                     LQLAMASETSSLPSTATPPPVAVREATEGRIPLTTTFTPSATDCGGIYLPSSLMVYVI
                     DNEPSCLPTGFSTSDSSFFYSPGIACPSGYWTACHDTTGASSITTVTCCPTYGDISLS
                     CVPNPEDLRHVWETLFCTWIAPASPGTVITVTESFNGGRTSTVTESVTSPGGVNAYGV
                     RMLYQASDLQTSTSTTSTTSTATTSTASTSTATASTDGASTASSPIVSGNPSQTTTPD
                     AGSTGGLSEGAKAAIGVVVPVVVLGAVLLGLALWWRRRKRAQQQQREQYPSQYPPPNA
                     LVEMPGYKQQQELQQQQHGAPPPGSGGGWNKPAEYYYYYGGGAPPQGPHELPGSRDQP
                     SEMPSTMQAVELPSSQTYPK"
     gene            complement(2209387..2211874)
                     /locus_tag="MYCTH_2315557"
                     /db_xref="GeneID:11513781"
     mRNA            complement(join(2209387..2211424,2211498..2211874))
                     /locus_tag="MYCTH_2315557"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003664102.1"
                     /db_xref="GeneID:11513781"
     CDS             complement(join(2210349..2211424,2211498..2211585))
                     /locus_tag="MYCTH_2315557"
                     /note="CAZy_ID 268047"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003664150.1"
                     /db_xref="GeneID:11513781"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Spoth2_2315557"
                     /translation="MLSKVFATVALAASLVSAQTFTDCDPTKRDDCPNPKAVGSKPVD
                     IDFRQGPNSFFKLADGTSLKYDKDLGAVFSISKETDAPTISSNKYIFFGQVDVTVRAA
                     RGTGVVTSFVLQSDDLDEIDWEWLGGDATQVQTNYFSKGCTETYDRGGFSPVADPINQ
                     FHTYTIKWTPEQLDWIIDGNVVRTLKNTGVEGCSGYPQSPMQIKLGTWVAGRKDAPQG
                     TIDWAGGLTDFSQAPFDGYYQSLHIVDYMGGRGAKEATEYHYTDRSGKWESIEVINDG
                     KGSDDDTTTSSKTSATSTKATSTSKPSSSSSPSSSHIGHTLTTLTTVSSSATRSASST
                     DGAASTSGPTSTSGNEVDPTSTASQTVSTGAAPSMAGNLAAVGAAALFGYLAL"
     gene            complement(2214086..2214183)
                     /locus_tag="MYCTH_t124"
                     /db_xref="GeneID:11513782"
     tRNA            complement(2214086..2214183)
                     /locus_tag="MYCTH_t124"
                     /product="tRNA-Asp"
                     /note="Anticodon: GTC"
                     /anticodon=(pos:complement(2214148..2214150),aa:Asp,
                     seq:gtc)
                     /db_xref="GeneID:11513782"
     gene            complement(2215318..>2217831)
                     /locus_tag="MYCTH_2134674"
                     /db_xref="GeneID:11506437"
     mRNA            complement(join(2215318..2215746,2217183..2217359,
                     2217422..2217510,2217667..>2217831))
                     /locus_tag="MYCTH_2134674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664103.1"
                     /db_xref="GeneID:11506437"
     CDS             complement(join(2215662..2215746,2217183..2217359,
                     2217422..2217510,2217667..2217831))
                     /locus_tag="MYCTH_2134674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664151.1"
                     /db_xref="GeneID:11506437"
                     /db_xref="JGIDB:Spoth2_2134674"
                     /translation="MPAPTATLVPVVRIEMGINKNTGQAPATFNTSTLWMRVGGPVEL
                     FTPPQQQAEGLLIRSSWIASQCVERCCHVDGASITGSAVTANLRLHLSTGHTWPLSMF
                     ERRTLRGLTDRRPMSPGQGFGFCCAEDAGRNPGQYLPDLQSEARAPSAVITDSGLQLE
                     VQSTGYIPRVH"
     gene            complement(2220187..2221960)
                     /locus_tag="MYCTH_82456"
                     /db_xref="GeneID:11513783"
     mRNA            complement(2220187..2221960)
                     /locus_tag="MYCTH_82456"
                     /product="Dihydrodipicolinate synthetase-like protein"
                     /transcript_id="XM_003664104.1"
                     /db_xref="GeneID:11513783"
     CDS             complement(2220552..2221766)
                     /locus_tag="MYCTH_82456"
                     /codon_start=1
                     /product="Dihydrodipicolinate synthetase-like protein"
                     /protein_id="XP_003664152.1"
                     /db_xref="GeneID:11513783"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="JGIDB:Spoth2_82456"
                     /translation="MAPHNDAPSFSSGYTSGFNRAQYRPVITSGLMTGHLGTGEPHSP
                     LSSSFSTSSEASDFHHIHRPLVPGVYVPTMCFFEESTEDVDTDTIARHAVRLARAGVT
                     GLATQGSNGEAVHLTHAERQLVTATTRKALDEAGFGHMPIIVGCGSQSTRETIQLCRE
                     AWEAGGDYALVLPPSYYAPLFAPASETVISFFTAVADASPIPIIIYNFPGAVGGLDLS
                     SDVIVQLARHPNIVGVKLTCGNTGKLARVAAATRNLNKHAGDESSSSSSSSSSSSSSS
                     SSSSSARQQQQQPDFLVLAGSADFTLQSLIAGGHGILAGLANIAPKACVRTVELFGQG
                     KLAEAQALQEVVAQGDWTAIQGGVVGVKSGLQGWMGYGGYARSPLPRPTPEQARKWKE
                     GFRDLVLLEKSL"
     gene            complement(<2231817..>2234529)
                     /locus_tag="MYCTH_2144295"
                     /db_xref="GeneID:11513784"
     mRNA            complement(join(<2231817..2234044,2234136..2234269,
                     2234375..>2234529))
                     /locus_tag="MYCTH_2144295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664105.1"
                     /db_xref="GeneID:11513784"
     CDS             complement(join(2231817..2234044,2234136..2234269,
                     2234375..2234529))
                     /locus_tag="MYCTH_2144295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664153.1"
                     /db_xref="GeneID:11513784"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="JGIDB:Spoth2_2144295"
                     /translation="MPSLRSRFGRAAREEQKTSARRMFRYWIKPPRIPEKNDHALKFG
                     ILGSASSVYTILIQPAVYHADVKVHAMACDNRRTCQEWRRRYGIRRAYTSYQVLLDDA
                     EIDAVLIALEPPLCLEWTIRALAKGKHVLLDAPGTSNVADAERLFSGPFLGSANCPVL
                     LECSPYRFHPSWLEFERVISRRNVARVKILVVLPATVDKDKDLRFRLEHSGGAGLDMG
                     YATSLMRAIYGVDPVTCLRSEVDVANPADSYGEYTQYDLTWLFPGGAVGEMRGVVALG
                     KRMGVPVSSRDAGVTIEVLHRRLEVPVGETAAVAAAAAATSPSDALADRRMQVTRRVT
                     LRYRDGPPSRHRLTIEEEAVFCDRETGRVVHRTRGGKSLSASTLRAADRANRFLPESK
                     PYWTAPLYQLDGFVNRVRRTSPLSPPGAWVSPADSLASARAMDDGLRAAGIVPPPPST
                     FRLEDLQLTPQELERFAAPPPPQAESSGRAGGSHQAEGSHQAEGSHQAEGSCQPQEPA
                     QTEGLFHQPQQQLPTRTGDRVRPRPSGRSSRFIRAWLDALSPRGEQEETPAVSGSGAH
                     SDVPSRQGNGSGSGSALAHGSRQTQSNNTHGEEVPIVLRTSLPDGRPTEAHETAEARP
                     PPSSSLRSRSSARARRSVHDRFSVRVSRLAQVLGPNHIRVRALRYFQSLKAAQSQCIP
                     QGPRGQGQGQGQGQDEDENGVELARMPGVEAAYEPPQERGSSPSQRSARSRSRQSGRS
                     QMSARAHHRLARASGRGRARGVSPGPEEASDDGPRDTDAAQAEDGNARGRGEEGMPSP
                     VPAQQEDRPRGGAQPTGPSFRAWNAGRGPRGREGQHDSQG"
     gene            complement(2235880..2238255)
                     /locus_tag="MYCTH_2306639"
                     /db_xref="GeneID:11513785"
     mRNA            complement(join(2235880..2236014,2236084..2237538,
                     2237610..2238255))
                     /locus_tag="MYCTH_2306639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664106.1"
                     /db_xref="GeneID:11513785"
     CDS             complement(join(2235913..2236014,2236084..2237538,
                     2237610..2238041))
                     /locus_tag="MYCTH_2306639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664154.1"
                     /db_xref="GeneID:11513785"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="JGIDB:Spoth2_2306639"
                     /translation="MSTKRIPLSSSNPNVANSPMRAASGAGSAKKARALTDLLEEPYG
                     KPPPAKRQMIDRGVASPSRASKTTRTIVQRSASRAATTTATTGTKASAATLYTPTEEE
                     LVNLRTWHAQIRSRFPKMVFYFESIPDEQRSKLAKQVGRLGAREEKFFSIDITHVVTT
                     RPIPPEKPKEEREGRPVAPASQEDNEQPKTIDPSLLNRTVDPTRRKLVYDTVPGRRPA
                     IPSQDDPLRRTKTRTDVLDKAREMGKKIWSLEKLQKILEIALNPEQYMNAGLSRGNTQ
                     SASKASKDERNLALLLQNERVNGPSDRDPTVASQDTYRFRGPYIYVYDVEEKTRPIMV
                     REYMKASDPKDQEWPQFRIVSQGRCPFVLDESYDPQERENRDRDRGREKDRNRDKGRD
                     RDRDRERTPSKTRVAKAEEAEEAAEPAAPTPLTADAPPKAATGKRTLAQMEDGHNRGI
                     ADGGASQTFDRSRVSNPPTFEFRSQNAFISHAKAGRLLAGEPVASGMQPSNVTSAIRS
                     QMVSSTTGGVLGAKAGTSKEIHGLQRKVVLQKASTPGLSLDPSSRQVAGICHDGNTTF
                     VRSASAGQITQRKLDVANEEGSSRQREKLRRTASVPVSQSKPRRDPKPGYCENCQEKF
                     ADFEEHIVSRKHRKFAENDENWSQLDALLSQLAREPRR"
     gene            <2239101..>2240684
                     /locus_tag="MYCTH_2127963"
                     /db_xref="GeneID:11513786"
     mRNA            join(<2239101..2239287,2239366..>2240684)
                     /locus_tag="MYCTH_2127963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664107.1"
                     /db_xref="GeneID:11513786"
     CDS             join(2239101..2239287,2239366..2240684)
                     /locus_tag="MYCTH_2127963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664155.1"
                     /db_xref="GeneID:11513786"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="JGIDB:Spoth2_2127963"
                     /translation="MKVQLLRPDLRQIYRPLQVHTQWPPSRRAWNRSYATTSISAAEL
                     EFGQPVYETHPHILKPGEITPGITAQEYADRRAKLAHSLPDGAVAVLPSAEVKYRSGA
                     VFYPFRQESNFLYLTGFSEPQSLAVIRKTGPSLGDYTFHLFCRPKDALAEQWSGPWSG
                     LRAAEDVFNADEAGDINALHTLLPPLLRSASRIYTDAIPSSSSSSSSSSSSPSSSLSS
                     IFSSLPSKAPTAPLSPLVNAHRAIKSPAEIGAMRHAGRVSGRAFTSAMRRPWASEPEL
                     HAYLAHAFARDGLSGEAYVPVVAGGPRGRMIHYTHNTALLRDGETVLVDAGGEYGWYI
                     TDITRVWPVGGRFSAAQRDLYAAVLRVQRMAVGLCTERNGLSLDEIHRATEAALQDEL
                     ERLGFEFGRGMRMFPGGGEAMGILFPHHVGHYIGLDVHDVPGYPRSTPLRAGHCVTIE
                     PGVYVPDDDRFPKHFRGLAVRIEDSVCVDKDAPLVLTPEAVKEVEDIEALR"
     gene            complement(2241463..2243929)
                     /locus_tag="MYCTH_2144297"
                     /db_xref="GeneID:11513787"
     mRNA            complement(join(2241463..2241944,2242000..2242690,
                     2242777..2243216,2243263..2243929))
                     /locus_tag="MYCTH_2144297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664108.1"
                     /db_xref="GeneID:11513787"
     CDS             complement(join(2241753..2241944,2242000..2242690,
                     2242777..2243216,2243263..2243316))
                     /locus_tag="MYCTH_2144297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664156.1"
                     /db_xref="GeneID:11513787"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Spoth2_2144297"
                     /translation="MDSGPLRNAEFFSMPNNQAVDPIDQRSVARTSVQQPSLWDTAGL
                     KLNAGLTMSPSAGTTLSLDSLPRPSPSTGLTTVSPSLSTASQTPAQGIRSGPGFPTRR
                     RLRTRDGHERKRSRLSMDEESPLESVDYWLNFDKEDGLPSVSETAGPRRPDLDSKNKI
                     PTTDGASESIPAPSANDVDEFLDDSALDNALSDDDGFSSINLTDQLSKVDTAPPQDVP
                     PREGLYSTPLSWERPQPGIRMDPLVGLNTTSLNEAEQRRLIAIAMNPGSRMGGLGSNI
                     NFNFTGMSATMPMSFGATLGGTSTPQGPKPVSPPQPPAAQPRAGQSTAPKKQASTGEK
                     SKEKPKTGERAAHNDIERKYRTNLKDKIAELRNAVPSLRTVSEEGGDDDETQQSRAAK
                     VSKGTVLAKAIEYIHQLERRNKEIVEEHRELSRRLQAFEQLLSAAAQQAYTMPAYSRT
                     LFDPRGFC"
     gene            2244857..2245808
                     /locus_tag="MYCTH_2306649"
                     /db_xref="GeneID:11513788"
     mRNA            join(2244857..2245562,2245640..2245808)
                     /locus_tag="MYCTH_2306649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664109.1"
                     /db_xref="GeneID:11513788"
     CDS             join(2245194..2245562,2245640..2245702)
                     /locus_tag="MYCTH_2306649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664157.1"
                     /db_xref="GeneID:11513788"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="JGIDB:Spoth2_2306649"
                     /translation="MASPENNGPSAPESPVLEGRDSPDLPLTMTASTMLMALPRDATA
                     ALAAAGGFPHEKVVVRFKPVGSAPPIRRDLVKVQSTHKFENVVAYLRRTLKIAETESV
                     FLYVNSTFAPALDEVVGNLWTCFKDSSGHLNVSYSVTPAFG"
     gene            complement(2245770..2246682)
                     /locus_tag="MYCTH_2306650"
                     /db_xref="GeneID:11513789"
     mRNA            complement(2245770..2246682)
                     /locus_tag="MYCTH_2306650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664110.1"
                     /db_xref="GeneID:11513789"
     CDS             complement(2245915..2246586)
                     /locus_tag="MYCTH_2306650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664158.1"
                     /db_xref="GeneID:11513789"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="JGIDB:Spoth2_2306650"
                     /translation="MMPKSALSFPSSAANTVLLQIGDLPMGSYEIAPAQALETAIRFK
                     KEGRMQGVKLEGGKEMVPTIEKIVGVGIPVLGHVGLTPQRRDILGGFRVQGKTAASAA
                     KILDDALALQAAGCFAIVVEAVPAEVASFITQKLSIPTIGIGAGNGCSGQVLVQVDMT
                     GNFPPGRRIPKFVKQYGNVWSESFRAIETYRDEVRSRQYPAPEHTYEMPRQEFERFVE
                     TAKDV"
     gene            <2249103..>2250270
                     /locus_tag="MYCTH_2111167"
                     /db_xref="GeneID:11513790"
     mRNA            join(<2249103..2249135,2249198..2249208,2249272..2249312,
                     2249409,2249482..2249519,2249644..2249758,
                     2249883..2250064,2250128..>2250270)
                     /locus_tag="MYCTH_2111167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664111.1"
                     /db_xref="GeneID:11513790"
     CDS             join(2249103..2249135,2249198..2249208,2249272..2249312,
                     2249409,2249482..2249519,2249644..2249758,
                     2249883..2250064,2250128..2250270)
                     /locus_tag="MYCTH_2111167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664159.1"
                     /db_xref="GeneID:11513790"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2111167"
                     /translation="MSSPRRRIETDVMKMLMSDYEVTLVNDNMQEFFVKFKGPAETPF
                     EGGIWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMYDMINI
                     FEAFLPQLLRYPNPSDPLNGEAAALLLRDPSLYDAKVKDYVQRYASKNAVDDAGAESE
                     DDDDLSSVGSYNDDEEEAQPAGQMDDV"
     gene            complement(2250272..2252086)
                     /locus_tag="MYCTH_2306658"
                     /db_xref="GeneID:11513791"
     mRNA            complement(join(2250272..2250323,2250626..2252086))
                     /locus_tag="MYCTH_2306658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664112.1"
                     /db_xref="GeneID:11513791"
     CDS             complement(2250841..2251959)
                     /locus_tag="MYCTH_2306658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664160.1"
                     /db_xref="GeneID:11513791"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="JGIDB:Spoth2_2306658"
                     /translation="MQGFNMGRYIPPSAAGTTTSGNRLHKKHPLGSRASKLASHGILI
                     VRFELPFAIWCAHCPRPTTIGQGVRFNAEKRRAGSYYTTPIWSFKIRHGACGGEIEIR
                     TDPKNSEFVVVSGARRRDYGADPERDDSLVKSDFVIPTPRERAEQRESAFGKLEKTIA
                     DREQLESANQRIGELLEAAERQWEDPYALNQRLRKAFREGRHKREREAARAEELKERL
                     GLGIELLPETEEDARRAKLVDFGSVDVEGSSAGGVDKALAKPLFDRGPDRTEKGEGVG
                     GPARGSRRLKSEIEAARRRDYLASEIVSNTRAAKDPFLDFSSREGTPKGPVRLPGLKR
                     KRPAEEASDTPQTASGTGGTPNKVVPTTALVNYNSDSE"
     gene            <2252824..>2255361
                     /locus_tag="MYCTH_2064169"
                     /db_xref="GeneID:11513792"
     mRNA            join(<2252824..2253116,2253179..2253284,2253394..2253536,
                     2253594..2253678,2253742..2253802,2253860..2253973,
                     2254026..2254074,2254152..2254331,2254447..2254835,
                     2254902..2255147,2255258..>2255361)
                     /locus_tag="MYCTH_2064169"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003664113.1"
                     /db_xref="GeneID:11513792"
     CDS             join(2252824..2253116,2253179..2253284,2253394..2253536,
                     2253594..2253678,2253742..2253802,2253860..2253973,
                     2254026..2254074,2254152..2254331,2254447..2254835,
                     2254902..2255147,2255258..2255361)
                     /locus_tag="MYCTH_2064169"
                     /note="CAZy_ID 268048"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003664161.1"
                     /db_xref="GeneID:11513792"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_2064169"
                     /translation="MFFASLLLGLLAGVSASPGHGRNSTFYNPIFPGFYPDPSCIYVP
                     ERDHTFFCASSSFNAFPGIPIHASKDLQNWKLIGHVLNRKEQLPRLAETNRSTSGIWA
                     PTLRFHDDTFWLVTTLVDDDRPQEDASRWDNIIFKAKNPYDPRSWSKAVHFNFTGYDT
                     EPFWDEDGKVYITGAHAWHVGPYIQQAEVDLDTGAVGEWRIIWNGTGGMAPEGPHIYR
                     KDGWYYLLAAEGGTGIDHMVTMARSRKISSPYESNPNNPVLTNANTTSYFQTVGHSDL
                     FHDRHGNWWAVALSTRSGPEYLHYPMGRETVMTAVSWPKDEWPTFTPISGKMSGWPMP
                     PSQKDIRGVGPYVNSPDPEHLTFPRSAPLPAHLTYWRYPNPSSYTPSPPGHPNTLRLT
                     PSRLNLTALNGNYAGADQTFVSRRQQHTLFTYSVTLDYAPRTAGEEAGVTAFLTQNHH
                     LDLGVVLLPRGSATAPSLPGLSSKEEEGGQDLMIPHVRFRGESYVPVPAPVVYPIPRA
                     WRGGKLVLEIRACNSTHFSFRVGPDGRRSERTVVMEASNEAVSWGFTGTLLGIYATSN
                     GGNGTTPAYFSDWRYTPLEQFRD"
     gene            complement(2255576..2257597)
                     /locus_tag="MYCTH_2306662"
                     /db_xref="GeneID:11513793"
     mRNA            complement(join(2255576..2255792,2255854..2257088,
                     2257161..2257597))
                     /locus_tag="MYCTH_2306662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664114.1"
                     /db_xref="GeneID:11513793"
     CDS             complement(join(2255621..2255792,2255854..2257088,
                     2257161..2257391))
                     /locus_tag="MYCTH_2306662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664162.1"
                     /db_xref="GeneID:11513793"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2306662"
                     /translation="MASIISSQVIESLTPGRFIAALILLTISSFVVDFARKPLYSKAL
                     PRVGPGGSFLGTLKSWAYFLTRYHTWVAEGYEKYSKQGRAFVVPSAPYRPQEIVIPRS
                     QAAWMLEQPDRVLSTKEAHRDTLHNDYQFFGVDDEFPIRTIHKHLARNIASLIPAVQE
                     EVHAAIDDTFGKDVENWTSLNLWEAWLGIIPRVTNRILVGAPLCRNQEFLDCQVGFAN
                     DVVRNGFLLDMVPHIFQPLVAPFIVLPNWWHWRKSYSHARPVIEQRLYDLERQESGDD
                     PAGDDWKAPEDMLTWLIRQAKAEGLTSELNPEMLSKRILPVEFAAIHTTVTTGFNLIL
                     DLLSSDPSLGYIDTIREETSRVFAEENGAWTKQGLARLHRTDSAIKESMRFSHFARAL
                     THRKVVAPEGVTNPVEGWHAPYGAFLMLDLAGTHRDPELYPEPDKYDAWRFSRQREAY
                     EAKSAEEKGDAEEAMRVKKLGMVTTSAEFLAFSHGRHACPGRFFVAHELKMILAYLVQ
                     NYEFKPLAERPKSIWIGSSFIPEVQARIEVRRRKRRV"
     gene            <2258282..>2260657
                     /locus_tag="MYCTH_52175"
                     /db_xref="GeneID:11513794"
     mRNA            join(<2258282..2258331,2258555..2258681,2258737..2258842,
                     2258896..2259154,2259211..2259256,2259307..2259674,
                     2259721..2260064,2260119..2260331,2260434..>2260657)
                     /locus_tag="MYCTH_52175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664115.1"
                     /db_xref="GeneID:11513794"
     CDS             join(2258282..2258331,2258555..2258681,2258737..2258842,
                     2258896..2259154,2259211..2259256,2259307..2259674,
                     2259721..2260064,2260119..2260331,2260434..2260657)
                     /locus_tag="MYCTH_52175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664163.1"
                     /db_xref="GeneID:11513794"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="JGIDB:Spoth2_52175"
                     /translation="MSTFNGLVAEFPDIRGNVYCSAATKEMLLRLERYPCRINYARGI
                     LEARVQKYRHLRNLFKPIPLNTPTLLELEPENHLQVTLLDANHCPGAVMFLFEGQGKA
                     VLYTGDVRAEPWFVNAIARSPSLIEYSSGLKTIDTIYLDTSFIDDVEFPTKSEGISEL
                     LRKVSRYPSDTIFHLQAWTYGYEDVWLALSKALGSKVHVDEYKLLMYRSLVATHSDAK
                     FAPSSHLTPEAPALVGFRCGNTQHSGCLTLDETVRIHSCEKGNYCSTVRNHPVVWIRP
                     IITRLPDGQDVLEVGVGGGAQDLEREAELDYLTPGDVKALMEALGDVDCISNDLRERL
                     GQFLLGAIASGRKVPIELKSTAFRDSNETELINGLQGIASKLKMRSERLSTNQYQPLP
                     NIITFPYSRHSSYPELCRFVSKFKPRDVWPCTVDVPRWLREGITVEQLFSPHCSGDEF
                     RHDQAMTERFKKHDLDVPVSLNSQSAASVSNAGLSTQSSASVPDRHREPSTPLEADVD
                     PTSLQDSQDSTLSDFALDTRLQAFRTVLDNAKGRVGGEVRLLSTTDHHSTIEPELGLE
                     VTQTSSSGGPST"
     gene            2260967..2262690
                     /locus_tag="MYCTH_2306666"
                     /db_xref="GeneID:11513795"
     mRNA            join(2260967..2261635,2261698..2261854,2261908..2261939,
                     2261997..2262690)
                     /locus_tag="MYCTH_2306666"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003664116.1"
                     /db_xref="GeneID:11513795"
     CDS             join(2261276..2261635,2261698..2261854,2261908..2261939,
                     2261997..2262512)
                     /locus_tag="MYCTH_2306666"
                     /note="CAZy_ID 268049"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003664164.1"
                     /db_xref="GeneID:11513795"
                     /db_xref="JGIDB:Spoth2_2306666"
                     /translation="MARLRSVTLGAFMTLFSPWACLVFGLAVDVAGHSSQVAARADPN
                     LAGYLGVFFLGADPYVYFYLSNGNNPVSFRALNGGSPIIKPTKGTGGVRDPTIIPGGG
                     SEAGKKWYIIGTDLDIGKTTWDAAQRTGSRGIFVWESTDLINWGNERLVEVEDATAGM
                     VWAPEAIWDPAKGQYLVHWASKFYSTSDPSHTGSPSNIRIRYAYTSDFKTFTSPQTLI
                     DKNPTNIIDLTILPINGTDSNSFLRFMKDETRKTVFVEVSDTGLFGTWTRPGGDSAII
                     QQGVEGPAAYWDNTTPGKAHLLLDFYGQDGYRPFESTNPGSNSGWTGSDRSAFPTNLR
                     HGSVLPVDQAAYETLNARWG"
     gene            complement(2263755..2265497)
                     /locus_tag="MYCTH_2306669"
                     /db_xref="GeneID:11513796"
     mRNA            complement(2263755..2265497)
                     /locus_tag="MYCTH_2306669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664117.1"
                     /db_xref="GeneID:11513796"
     CDS             complement(2263850..2265361)
                     /locus_tag="MYCTH_2306669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664165.1"
                     /db_xref="GeneID:11513796"
                     /db_xref="JGIDB:Spoth2_2306669"
                     /translation="MPASPLVRVKVTLLADASFSIPLTGTPDALTQRAERKPIDPPPI
                     VQLLVNPRKDPARTFLQNPYLILTARLIRKGDEDSQDDQSAPKESDLTGTLVSSLYSL
                     KDTDNSQGGFFVFGDLSVRRVGTYRLAFILYELRLAEKECWLLSRTVSDPFVVYATKT
                     FPGLAESTFLTRSFSDQGVRLRLRKDSRTVSTKKRTISQAEQIRASQGIHGYLPHDAN
                     HDLSPNGHSPHHLRRVDSLHDQAQLDRSRSYYSESPQMRAGEYASSPYGYTPYDDQKP
                     LKRARMDGTPDSPHLSGGSGGGYETDAYHTYTHHHPHPHSGPRTVPDPLGSIYPLTST
                     ITTSSSSSYTTTIPSQPAVLPPVPSPYGSMPRLDTTHLPPHSPAAAGPGSATSTFLHG
                     TAGSGGGTRRSPTIGGGGAAYPYPTHPGHGGQQAMFAAAAAAAVSQGTSLPYHPAVTA
                     HGGEHHVAAAAAAAAAAAAAAANAHHHPHPGAAAGLGIVGVGAGLGGLDLDRP"
     gene            complement(2281255..2283062)
                     /locus_tag="MYCTH_2306673"
                     /db_xref="GeneID:11513797"
     mRNA            complement(2281255..2283062)
                     /locus_tag="MYCTH_2306673"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003664118.1"
                     /db_xref="GeneID:11513797"
     CDS             complement(2281869..2282891)
                     /locus_tag="MYCTH_2306673"
                     /note="CAZy_ID 268050"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003664166.1"
                     /db_xref="GeneID:11513797"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_2306673"
                     /translation="MSSFTSKGLLSALMGAATVAAHGHVTNIVINGVSYQNFDPFTHP
                     YMQNPPTVVGWTASNTDNGFVGPESFSSPDIICHKSATNAGGHAVVAAGDKVFIQWDT
                     WPESHHGPVIDYLADCGDAGCEKVDKTTLKFFKISESGLLDGTNAPGKWASDTLIANN
                     NSWLVQIPPNIAPGNYVLRHEIIALHSAGQQNGAQNYPQCFNLQVTGSGTQKPSGVLG
                     TELYKATDAGILANIYTSPVTYQIPGPAIISGASAVQQTTSAITASASAITGSATAAP
                     TAATTTAAAAATTTTTAGSRCYRHALDRRLSFFRPACSYHRCRYLQPCSPDPLRWSEE
                     APSPRP"
     gene            complement(<2283807..>2284496)
                     /locus_tag="MYCTH_2127975"
                     /db_xref="GeneID:11513798"
     mRNA            complement(join(<2283807..2283919,2284284..2284358,
                     2284466..>2284496))
                     /locus_tag="MYCTH_2127975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664119.1"
                     /db_xref="GeneID:11513798"
     CDS             complement(join(2283807..2283919,2284284..2284358,
                     2284466..2284496))
                     /locus_tag="MYCTH_2127975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664167.1"
                     /db_xref="GeneID:11513798"
                     /db_xref="JGIDB:Spoth2_2127975"
                     /translation="MRRARNEIAVGGLKLAADLATDQHLGALSTEFDGAYPPYLSPSS
                     RTTTNLPAFDPSSNLTMFHALLYQRAAS"
     gene            2285455..2288627
                     /locus_tag="MYCTH_2306674"
                     /db_xref="GeneID:11513799"
     mRNA            join(2285455..2285648,2285710..2287484,2287544..2287605,
                     2287711..2287824,2287930..2288627)
                     /locus_tag="MYCTH_2306674"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664120.1"
                     /db_xref="GeneID:11513799"
     CDS             join(2286869..2287484,2287544..2287605,2287711..2287824,
                     2287930..2288292)
                     /locus_tag="MYCTH_2306674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664168.1"
                     /db_xref="GeneID:11513799"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="JGIDB:Spoth2_2306674"
                     /translation="MTDYYNVEARTRRLARFRRAKALAAEKRRIEEEERKLKEEEELE
                     MELQRSTVARLTSAVPSAFSASDSNTLPTPVTPITKSVNEGEGRDTSRVIPVKRELEP
                     ETSPEARQEKVPRLEAPPSTRSRDLEDRTREDDKRDELYSRRELSPRHQDRHDQSPLP
                     RPHYRDDNNGEDNRRVDRYRGEDSRYRESERRSSYPIHVDLGRKGDTRFFILKSFNEE
                     NVRRCMEDCLWTTQIPNAEVLSKAFAECKNVILFFSVNKSKAFQGYARMMSAPSPDNP
                     RPSFAKGIHWETSDPFRVRWLSKTAVDFWRIGHIKNPYNDYLPVLVGKDGQEIEEECG
                     AALLREMEGYAAAAESSRSYGGGKRPAVESYHLGRRESGGGRFYVDRYRG"
     gene            <2289383..>2290282
                     /locus_tag="MYCTH_2032127"
                     /db_xref="GeneID:11513800"
     mRNA            join(<2289383..2289521,2289618..>2290282)
                     /locus_tag="MYCTH_2032127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664121.1"
                     /db_xref="GeneID:11513800"
     CDS             join(<2289383..2289521,2289618..>2290282)
                     /locus_tag="MYCTH_2032127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664169.1"
                     /db_xref="GeneID:11513800"
                     /db_xref="JGIDB:Spoth2_2032127"
                     /translation="EAARGFSSRVQNPTTKLTGAQLTYLFVMQALPSMLIAGALNFAV
                     AYPMYASPRPPPGPPPAGSVPPFLFRPPVSLVVDAALTTVVQSAITWTCLAVLVNRAL
                     SRGEVAPYAPPPPPAKARWWWWWWLWGEPRNVAARWFLMLDHYNAERGSRLLGACERL
                     CCCCCSSSSSSSSSSSSSGQCARRVGRWVAFGLASLGRAVIVALLGYLAMIGPTIGIC
                     AAVGTRFDGDWVFLGRWDGALFKLVYGGVLGFITSPALALMWMLRAGWIV"
     gene            complement(2290418..2292374)
                     /locus_tag="MYCTH_2306681"
                     /db_xref="GeneID:11513801"
     mRNA            complement(join(2290418..2290894,2290987..2291602,
                     2291754..2292374))
                     /locus_tag="MYCTH_2306681"
                     /product="glycosyltransferase family 76 protein"
                     /transcript_id="XM_003664122.1"
                     /db_xref="GeneID:11513801"
     CDS             complement(join(2290507..2290894,2290987..2291602,
                     2291754..2292126))
                     /locus_tag="MYCTH_2306681"
                     /note="CAZy_ID 267883"
                     /codon_start=1
                     /product="glycosyltransferase family 76 protein"
                     /protein_id="XP_003664170.1"
                     /db_xref="GeneID:11513801"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="JGIDB:Spoth2_2306681"
                     /translation="MMPRRRVGAEDGAVGPHPHPYRTLLASFAAWKLFLLTIALGSIL
                     AGDAYDTSAGLLLLQGDQEEGRSNATAGRPPEEGLGIRLITRLTSWDAVYFVSTAHRG
                     YRFEQEWAFGAGLPFTVRNLLRGLTHIGVLDPSAAGGKPVPEALTGIAIANTAHLLSA
                     LVLYRLGQVVWRDHTLSLVAALVHIISPAGLFLSAPYAESSYALLSFSGFLLFALGCR
                     AEGSPTRRDLYTIAAGALFGLATAFRSNGILNGLPFALEALRHLPALPKRPFDTLRRL
                     LALGVGGVMVAAGSLGPQTAAYLRFCSGPSGALPRPWCHQYLPSIFTFVQQHYWNVGF
                     LCYWTLSNLPLFLLATPMLTILTKSGMDTLRGRSIPAADGSAESARLLSLVQSAAAAE
                     VLLAVLAVTTYHVQIITRISSGYPAWHWWLAGNLVRGEEAGSRIVMFMVLYASIQGAL
                     FASFLPPA"
     gene            2294191..2296508
                     /locus_tag="MYCTH_2306684"
                     /db_xref="GeneID:11513802"
     mRNA            2294191..2296508
                     /locus_tag="MYCTH_2306684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664123.1"
                     /db_xref="GeneID:11513802"
     CDS             2294520..2296391
                     /locus_tag="MYCTH_2306684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664171.1"
                     /db_xref="GeneID:11513802"
                     /db_xref="JGIDB:Spoth2_2306684"
                     /translation="MPAVRFREGQDDLPPTPSTHEDSISESELSDVTFSIDGALSPRS
                     VRSRRPRRASRKGTAYYLGYPAPRIIGKTKVVQKVLLPRLLLQLQQVSQEGRSKPVLE
                     VFPALRITGPVVAPRLTKKFPGIFGVKRHLGCDDIVLLRRDDGDASWDGPDSEAEESM
                     ESRELLAVFSPLKHSNEAELVLNDGSVWMAKPLPNGNFDFVHTDADGKVTTARWARRQ
                     TAGGAVSPTTDSSISSTAPQARYTFSIINPLTRRHPVMATLTPSTLNVFDTYTSVSPS
                     HARQRPVNRPRRSQSVTSPPTSPPTPARVTPYSPSDMSLSGSTSDGENGSAICIPPSP
                     EAEASNRTVHPIDDRTKTLISITALWVCLQSGWPQSHHSAPVSNGETAASSTSLAASS
                     TRPRGRSRRNTWTTRSSSASDTPQSPTADPSLAHGNQPSRETAKEAAFRKRSSMPVPV
                     PTSTHLSGEDIGGVESFTPLLLLPQPPRQQLSPARPPTRRTTVSTALDSRPPHVRSSP
                     KRATSLGAAFMRKRLLASSSSSNSTVDRGEAPEQAGTVSAKPQLLPSLATTQGEGGTI
                     EAETAPQGGEKPLGTGVGVTLDSAACRGSASGSKKSGGGARSKLVRWMYKLRSSSSR"
     gene            2297232..2300371
                     /locus_tag="MYCTH_116384"
                     /db_xref="GeneID:11513803"
     mRNA            join(2297232..2297740,2297849..2298722,2298825..2299194,
                     2299321..2300371)
                     /locus_tag="MYCTH_116384"
                     /product="glycoside hydrolase family 74 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664124.1"
                     /db_xref="GeneID:11513803"
     CDS             join(2297493..2297740,2297849..2298722,2298825..2299194,
                     2299321..2300084)
                     /locus_tag="MYCTH_116384"
                     /note="CAZy_ID 267864"
                     /codon_start=1
                     /product="glycoside hydrolase family 74 protein"
                     /protein_id="XP_003664172.1"
                     /db_xref="GeneID:11513803"
                     /db_xref="InterPro:IPR002860"
                     /db_xref="JGIDB:Spoth2_116384"
                     /translation="MKGTSALQLLLAVAAAVAPAGAATAWKNVNIGGGGGFVPGIIFH
                     PKEKGVAYARTDIGGLYRLNPDDDSWTPLTDNLGTNEKWGRWGIDAVAVDPQDADRVY
                     AAVGMYTNDWDPNPGSIIRSSDRGATWEVTELPFKVGGNMPGRGMGERLAVDPANSDI
                     LFFGARSGNGLWKSADGGVTWARVESFTNVGTYAPDPSDATGLNSDLIGLTFVTFDST
                     SNVVGGATSRIFVGTADNKTASVYVSEDAGATWKPVEGQPGAFFPHKCVLQPEEKALY
                     LSYSNGAGPYDGTLGAVYRYDLAARTWTDITPASGGDLYFGFGGLSVDLRKPGTLMVA
                     TLNSWWPDAQIYRSTDSGATWSKIWEWAAYPDMNWYYGLYTDKAPWINAGFISQDTKR
                     LGWMIEALEIDPHDSDHWLYGTGLTLYGGHDLTKWDTVTRNVTISSLAAGIEEMAVLG
                     LASPPNGSELLAAVGDDCGFTFRESQDLGTSPQTPWMNPIWTSTTDVDYAGNEPDHVV
                     RVGNSQGAPQVAVSEDGGVTWSAHPGADGTTNSGTLAYSADADTIVWSSGSAGVLRSQ
                     NQGAFAAVGSLPSGATVAADRRNNTVFYAASGASFYRSTDTGATFAKVASAFGSKVAA
                     VKAIAAHPVVAGEVWVATDAGLFRSIDYGATFSAASGSITDAIQVSLGKGDGSAWNVY
                     VFGTGPEGTKLYASADEGATWVDIQGEQGFGSLSANRLVGSGNVAGQVYVGTNGRGVF
                     YAKVSLSAAAN"
     gene            complement(2302001..2305834)
                     /locus_tag="MYCTH_2306691"
                     /db_xref="GeneID:11513804"
     mRNA            complement(join(2302001..2302287,2302421..2305201,
                     2305269..2305487,2305558..2305632,2305724..2305834))
                     /locus_tag="MYCTH_2306691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664125.1"
                     /db_xref="GeneID:11513804"
     CDS             complement(join(2302148..2302287,2302421..2305201,
                     2305269..2305487,2305558..2305632,2305724..2305760))
                     /locus_tag="MYCTH_2306691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664173.1"
                     /db_xref="GeneID:11513804"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="JGIDB:Spoth2_2306691"
                     /translation="MYILKPSWLRHSGEQKDFEVYSCHISPDGSRLATAGGDGHVRIW
                     STEAILNADKPDSGRPRQLCHMSHHLGTIHSVRFSPNGRYLASGADDRVICIYQLDSN
                     PPSHAATFGTNEPPPVENWKTHKRLVGHDSDVQDLAWSYDNSILVSVGLDSKVVVWSG
                     HTFEKLKTIAVHQSHVKGITFDPANKFFATAGDDRHIKIFRFTPPPPNATQHDMVNNF
                     VLETTISAPFKSSPLTTYFRRCSWSPDGNHIAAANAVNGPVSSVAIIERTRWDSEINL
                     IGHEAPTEVCMFSPRLFHTQKPGENGSDKGNSSLVTVIASAGQDKTLSIWNTNTSRPV
                     VILQDVASKSISDLAWTPDGQTLFASSLDGTILAVKFETGELGWVATSEENDKALQKY
                     GGSRKGMGTAEDVDGLHLENHSKEGELRGAESRMGALMGDFQTEDDKGRPVSTNGTKS
                     SAKNGETNGAPEQKQKEEGGPKAAPGEESAEKTAERIAELKSRVQVTKDGKKRVAPLL
                     VSSSATGLLSLPQSQLVGAKSTKPAQSDTPQAILDLSKPFHGLPKGGIAALLLGNKRK
                     AVALEGEEEDEPAAKRPSNGPVPVLVDTPEGLEPPPPTTPAQGVVPTPEFLRPAVINP
                     AISVSQVRLAVPKVRSHIVRPLQRGVLQGESTLDEASRVPENVILEARNPVKPREPSH
                     ITASKRGARLWQDFLPRAILLVTGSKHFWAAACEDGSLHTWTPAGRRLLNGIILESQP
                     VILESREHWLLCITSVGLCHVLNMKTMSAPHPPVSLAPILDIAVTSLSPDGATPAPGV
                     TSAHLNSTGAIVVTLSNGDGFYYSSTLYAWQRLSESWWALGSQYWNSNDSSISALSST
                     AVGPVPTTTTTTTTMTTTTTTTTTNSTTGAPSDKGAAADEVNVSAGIIPFLERHTTTE
                     FLLKGRAFTLQRLIKTLLSKDGFEGFESTVSVAHLENRIAGALALGAREEFRLYLFMY
                     AKRIGAEGLRGKVEELLNSLVGGVLQEKGSGGGGGGGEGKGWFSREEKLCGWDRRELL
                     KGVVLILGKFRDLQRLTVQYARILGLTAGWEEEGGEGGEGGENEASERMQVEQ"
     gene            complement(<2306661..>2307242)
                     /locus_tag="MYCTH_102652"
                     /db_xref="GeneID:11513805"
     mRNA            complement(join(<2306661..2306714,2306886..2306987,
                     2307069..>2307242))
                     /locus_tag="MYCTH_102652"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664126.1"
                     /db_xref="GeneID:11513805"
     CDS             complement(join(2306661..2306714,2306886..2306987,
                     2307069..2307242))
                     /locus_tag="MYCTH_102652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664174.1"
                     /db_xref="GeneID:11513805"
                     /db_xref="JGIDB:Spoth2_102652"
                     /translation="MARETRSQTGNSKPRVIPVIDTAPTITRKAAPKKKAKGAKPIGV
                     TKNKAPKKEGFVTKVKSAAKKTEKKAVSVEKETQNSVEKAEKAEKAEKEAKPTTTTKK
                     KEPAATK"
     gene            2309000..2311693
                     /locus_tag="MYCTH_2306697"
                     /db_xref="GeneID:11513884"
     mRNA            join(2309000..2309191,2309252..2310075,2310146..2310409,
                     2310517..2310681,2310742..2310828,2310888..2310994,
                     2311552..2311693)
                     /locus_tag="MYCTH_2306697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664127.1"
                     /db_xref="GeneID:11513884"
     CDS             join(2309149..2309191,2309252..2310075,2310146..2310409,
                     2310517..2310681,2310742..2310828,2310888..2310944)
                     /locus_tag="MYCTH_2306697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664175.1"
                     /db_xref="GeneID:11513884"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="JGIDB:Spoth2_2306697"
                     /translation="MGAKAPEHERSDGHGNPPSLDTSNSICGGEPRGSHQRQDGDGCL
                     GNGGGDNDDDDDDGDDDDDNGSDGDNHRDVDPAAADGRANKKKRRKRSKKKSKKKSKA
                     NAPIEQSWPPRIPLDQLFPAGNFPEGEVQEYQATARTTAAEIRYNNRRKCWEDETFLG
                     NYRKAAEIHRQTRRWVRETAKPGQSLHDIATGIEDSVRALLDNAGLGPGDGLKSGMGF
                     PTGLCLNHQVAHYTPNPGQKPVVLQQQDVLTVDFGVHINGWIVDSAFTMAFDPTYDNL
                     LAAVRDATNTGVKTAGVDVRISDVSAAIQEVIESYEVEIRGKTYRVKPVRNLCAHDIK
                     QYRIHGGKSIPFVKNRDQTKMEEGEVFAIETFGSTGRGYTVDDVGVYGYGLNYNAPLN
                     VPVPLSSAKRLHKTIRENFGTIVFCRRYLERLGVEKYLAGMNCLIQNGIVEEYVPLMD
                     IKGSYSAQFEHTFLLRETHKEVFSRGDDY"
     gene            <2313252..>2315135
                     /locus_tag="MYCTH_94999"
                     /db_xref="GeneID:11513885"
     mRNA            join(<2313252..2313495,2313558..2313601,2313681..2313809,
                     2313927..2314343,2314454..2314638,2314745..>2315135)
                     /locus_tag="MYCTH_94999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664128.1"
                     /db_xref="GeneID:11513885"
     CDS             join(2313252..2313495,2313558..2313601,2313681..2313809,
                     2313927..2314343,2314454..2314638,2314745..2315135)
                     /locus_tag="MYCTH_94999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664176.1"
                     /db_xref="GeneID:11513885"
                     /db_xref="JGIDB:Spoth2_94999"
                     /translation="MKSSLAHLIPAASLGHAISISLPPLIPSIPGVTEPLNDLAPPLP
                     ILQVPTPPLDSPPFEASDIKPKKIGYFWTGAGDKKHKECAPPDFLATYSLDDDTFGTL
                     LWVTDVPTSGNDPHHLGPSLDGKTLIGGGLLSLLKTQDTAFYFDTSNPYRPKFLKSNR
                     ALLSSITDEIRAKPDGGFFITYMGSAVGTSPGRLVETDAEFNVIHEWPEDVEGTLNIL
                     GQQFNPHGLSIDWERGNILTSDFVEPISILKPSLGIKKANTLRLWDLKTKKILNTITI
                     PNGGGIQDVKHIPGNPEGAAIATAVQTGQVWIIYPQRKDANGKPGVAELLYDLGPKAR
                     DTTAIYSDLTQDGRFLYLTLTTANHIAALDISDLGNVKRLDDPDEDQPTIGPHYVKVT
                     PDQKHLLVTDYFVQTGSIGLINTPADFKALYIDILDDGSLAFNRSIDFSRDFANRGGG
                     KPHSSVVFDLTDPEHPLYY"
     gene            2315904..2316968
                     /locus_tag="MYCTH_2306702"
                     /db_xref="GeneID:11513886"
     mRNA            join(2315904..2316248,2316490..2316968)
                     /locus_tag="MYCTH_2306702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664129.1"
                     /db_xref="GeneID:11513886"
     CDS             join(2315996..2316248,2316490..2316902)
                     /locus_tag="MYCTH_2306702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664177.1"
                     /db_xref="GeneID:11513886"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Spoth2_2306702"
                     /translation="MPPPTEEIRNWTRRLPDNSSYTISTDPSLIQLDAINAAFDTDMV
                     YWAKPLPLPALKRCVEQSLCFGLYFHEEQEEEEEEANRSAKDAAAAPAPAPPKKKKMV
                     GLARVVTDYVTFAYLTDVYVLPAHQGRGLGRWLMACLDEVLASWPALRRCMLLTRDEA
                     AVRMYGATIGARVLRGRAANDDVGGEPDGKGKGSPKEKGLFILERKGPGIGFTVGEGG
                     GGR"
     gene            complement(2316969..2318379)
                     /locus_tag="MYCTH_2306706"
                     /db_xref="GeneID:11513887"
     mRNA            complement(join(2316969..2318140,2318232..2318379))
                     /locus_tag="MYCTH_2306706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664130.1"
                     /db_xref="GeneID:11513887"
     CDS             complement(join(2317035..2318140,2318232..2318334))
                     /locus_tag="MYCTH_2306706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664178.1"
                     /db_xref="GeneID:11513887"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="JGIDB:Spoth2_2306706"
                     /translation="MGKSSKDKRDAYYRLAKEQGWRARSAFKLLQLDEEFNLFENVTR
                     VVDLCAAPGSWSQVLSRVLIKGEKFGRSAWQDREAKLRQHMLNIVPSDEAPGQEKKPG
                     SGDDASPKEQPQPRQDVKIVSIDLQPISPLPGIITLRADITHPATVPLLLKALDPDYD
                     PNSMDPQASQPVDLVISDGAPDVTGLHDLDIYVQSQLLFAALNLALCVLKPGGKFVAK
                     IFRGRNVDLLYAQLKIFFEKVYVAKPRSSRASSVEAFIVCINFRPPKGFKASLAEPLG
                     VGSRLPEMLAARNASAPTTAPVLMQNHDTGAWDTRPVRTTRTTDEDGICEVEVDDLCP
                     EPRDKDTRWIAPFVACGDLSAFDSDASYKLPDDHVSLDPVQPPTAPPYKRAIELRRAN
                     GGAYGKPPGK"
     gene            2318700..2321430
                     /locus_tag="MYCTH_2306707"
                     /db_xref="GeneID:11513888"
     mRNA            join(2318700..2319127,2319181..2321430)
                     /locus_tag="MYCTH_2306707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664131.1"
                     /db_xref="GeneID:11513888"
     CDS             join(2318894..2319127,2319181..2321304)
                     /locus_tag="MYCTH_2306707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664179.1"
                     /db_xref="GeneID:11513888"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2306707"
                     /translation="MAIDKKRKRNEGHGKRSKAPPASSKRQKSNSGKRVVNVDALPWK
                     SVDVPEMFDDAEGFYGLEEVEGVEVVREGGTVKFVTAADAESEEDSEEFEGFDDPPED
                     AQVSPEGTEVKGSASEEPAAPEASAKEPKAAKKATGADGKDAPKRDAETQKKDKKRGK
                     KEKQSSKVESANGDPELEANVFAQAASLAEAPAEDNDLDMSEWVPLGLSPQVLSAIAR
                     LKFAKPTAIQAKAIPHIMNGHDLIGKAATGSGKTLAFGIPIVESWLARRAEAQTTDKK
                     QPIALILSPTRELAHQIRDHLKELCAGLTTGPYVCSVTGGLAVQKQQRQFEKADILVG
                     TPGRMWELASSSNSVLGALRGISFLVVDEADRLLKDGHFKEAEEIMNALDRKAPGEEV
                     VEDEGDSDDETPRHNRQTLVFSATFNKNLQQKLAGKARYNLMGDAESLEYLLKKLNFR
                     EPRPKFVDTNPVSQMAENLREGLIQCGDLEKDLFLYAVLLLQPTRRALVFTNSINTVR
                     RLTPFLQALNLPAFALHSDMEQKARLRSIERFRAGANAANNKKNNPAPSSSPPASSIL
                     VATDVAARGLDIPEIDLVIHYHVPRTADDYVHRSGRTARANHSGISILLCGPKEAVPT
                     RRLIAKVHAAAAAHMPRAKLASSAGVGVQTVDIDRRLVAHLRPRVTLAKKITETTIAK
                     ERGAKEEDWLRKAADELGVEYDPDELEAAGSWKGRGSGRKMREKEAAAVSKAEVKQWR
                     WELKELLSKRVNTGVSERYLNGVDVDALLRGARGEFLGQVEGLGL"
     gene            complement(2321430..2322960)
                     /locus_tag="MYCTH_2306708"
                     /db_xref="GeneID:11513889"
     mRNA            complement(2321430..2322960)
                     /locus_tag="MYCTH_2306708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664132.1"
                     /db_xref="GeneID:11513889"
     CDS             complement(2321556..2322668)
                     /locus_tag="MYCTH_2306708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664180.1"
                     /db_xref="GeneID:11513889"
                     /db_xref="JGIDB:Spoth2_2306708"
                     /translation="MHMASSSAPRPTTARILSKAESATGLMKTSNFPSTTTLDSGSGT
                     SSTVSTPVAPPRESYPGLLPTWEAEQAIREFIDRHWSHRADYIKVDCWLTLPELRALG
                     RLSREEGWLACRRLVRVPAIHEEVALSLWEHLAEEEEKEEEKEAEEEEEAGDAGPTAV
                     VTVPSFSQMPLADPSAAGDARVVPGNNSSHEAAEARTRRRWPRPRQRRLRLRLRLKSL
                     VTSLLLFPEARPPPPPPKPHTTPALNRKAAGNPHPCPFCSGDCTTSLAAAARQQQQQA
                     HKPAFWRRENYASASPPPCPPPSPRLSGDTLTASRTGESAGRAEASASEKGDARSKPP
                     RPVGPVFFLQPAPGLRLSLWKGQQRVGRERQRRASG"
     gene            2325005..2327052
                     /locus_tag="MYCTH_2306709"
                     /db_xref="GeneID:11513890"
     mRNA            2325005..2327052
                     /locus_tag="MYCTH_2306709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664133.1"
                     /db_xref="GeneID:11513890"
     CDS             2325134..2326933
                     /locus_tag="MYCTH_2306709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664181.1"
                     /db_xref="GeneID:11513890"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="JGIDB:Spoth2_2306709"
                     /translation="MSEAYPSPQLTGVGRPPRSGRISSSPSLHETQRPRSLHLLVAAN
                     GSRDVAFAEAITVRLSKEPQISTRAIVDDMTHRLAQEIIVLQNQSLRRGSPDGPSPRD
                     IESCQQSASELVEWADLLVLAPVDADTLAKMMCGISDTLLLEVLRSWDASKRIIMVPG
                     MSTQMWENPVTKRQMSKLHRKWGWIRVMPPILWHYDKSPHPKRIVEWDGFNELLGIIK
                     NQADFLKLGHDMEISAQPGTPPAMRAKARSTLPPEIWSMILEFTNDWELATCLGVYTN
                     LEMPTSQGWRREPKDPNDPLQVFMHSLEWTLLTADTKAVCDKLAHAPPTFHDLSALAV
                     HLIFKFSLTGVLTYIEANLPHIFKCFDGKTIPTKASAYYGRTEILDWWARSPSFLEKQ
                     YDVEALNHASGHGFVHILDWWRRSGLPLKYDEQAFEAASAKGHVHVLEWWREAGRQDP
                     SIVIKPGRSLLAAAQWGQVAVIRWWEESGIPVGHQDAVCKMASRWGQVKVLDLWRQLR
                     GDDKFQFDNQILIEATLHAHIPVLEWWRQYAHGELPGMGGRKGNRVEYKTMDVEEALE
                     DSLGDQTKVRRWWAENGLNLGLGTSEWMKIRYL"
     gene            complement(2327053..2328090)
                     /locus_tag="MYCTH_2306711"
                     /db_xref="GeneID:11513891"
     mRNA            complement(join(2327053..2327360,2327466..2328090))
                     /locus_tag="MYCTH_2306711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664134.1"
                     /db_xref="GeneID:11513891"
     CDS             complement(join(2327172..2327360,2327466..2327855))
                     /locus_tag="MYCTH_2306711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664182.1"
                     /db_xref="GeneID:11513891"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="JGIDB:Spoth2_2306711"
                     /translation="MSSKRHSMLPPVSSGPKPPVQFSSSIVIADSAVLTGTHPITIHS
                     ESVVHPRARLDSLAGRVTIGRRCVVHERATVGAVGASGRVTEAAVTLADYVTVEVGAA
                     VEAGDTFIGEGTVVGVGAKVGAGAVIGKHCTLTPHTEIAAGEVVPDFTVVYSNGMRRT
                     DKRGVAELKNKGLARQIDVLRRIIPSNPAKFA"
     gene            2328211..2330727
                     /locus_tag="MYCTH_2306712"
                     /db_xref="GeneID:11513892"
     mRNA            join(2328211..2328734,2328885..2329872,2330011..2330727)
                     /locus_tag="MYCTH_2306712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664135.1"
                     /db_xref="GeneID:11513892"
     CDS             join(2328387..2328734,2328885..2329872,2330011..2330180)
                     /locus_tag="MYCTH_2306712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664183.1"
                     /db_xref="GeneID:11513892"
                     /db_xref="InterPro:IPR011538"
                     /db_xref="JGIDB:Spoth2_2306712"
                     /translation="MLSRTAAPTKASTRTISSAVSAISTTTPSQCRSFATVQDANAAA
                     TVRTYGGLRDQDRIFQNLYGRFPPDLKHAKKMGDWHKTKEILLKGHDWIINEIKTSGL
                     RGRGGAGFPSGLKWSFMNFKDWDKDNKPRYLVVNADEGEPGTCKDREIMRKDPHKLVE
                     GCLVAGRAMNASAAYIYIRGEFVQEAAILQNAINEAYAEGLIGKNACGSGYDFDVYIH
                     RGAGAYVCGEETSLIESLEGKPGKPRLKPPFPAAVGLFGCPSTVANVETVAVAPTICR
                     RGGSWFASFGRERNQGTKLFCISGHVNNPCTVEEEMSIPMRELIEKHCGGVRGGWDNL
                     QAVIPGGSSTPILPKHVCDDQLMDFDALKDSQSGLGTAAVIVMDKSADVVRAISRLSH
                     FYRHESCGQCTPCREGSKWTEQIMKRFEKGMGREREIDMLQELTKQVEGHTICALGEA
                     FAWPIQGLIRHFRPELEARMQKFAKETGGEALAGGWTHNAREQGKLVSPGM"
     gene            2331604..2333025
                     /locus_tag="MYCTH_2306713"
                     /db_xref="GeneID:11513893"
     mRNA            join(2331604..2331794,2331913..2333025)
                     /locus_tag="MYCTH_2306713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664136.1"
                     /db_xref="GeneID:11513893"
     CDS             join(2331740..2331794,2331913..2332853)
                     /locus_tag="MYCTH_2306713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664184.1"
                     /db_xref="GeneID:11513893"
                     /db_xref="JGIDB:Spoth2_2306713"
                     /translation="MTSGITVFEQFVRFGTDAYGIERLLRLLQALTTILLHFPTLSYW
                     FLVFLAPFSSLPATLKTSPTTISPTTLTLLRKRLASLRQAVRLFRFLDSFAAAWSVLS
                     SLQEQPPPQAQSQPQARHDEKEGRQGGPTKRTPATPGPAAGVVVAVVVEKWLDFGSKS
                     FTGMYLLLESAVFVEAVLDVPGLRVWDSPEAVVRLVLDGQRFWFAGLVCGILAAAVRL
                     ARSGGGARGGTGQVGGGKDGDSKDGGEENDDEEEEEEEEVREERKAARRKVVRRLAAD
                     IMDLAVPGSVVGWVPLAPGYVAVLMFGSTILTGMEVWERCGRELAAQRAATMARP"
     gene            2333444..2335397
                     /locus_tag="MYCTH_2306714"
                     /db_xref="GeneID:11513894"
     mRNA            2333444..2335397
                     /locus_tag="MYCTH_2306714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664137.1"
                     /db_xref="GeneID:11513894"
     CDS             2333629..2335083
                     /locus_tag="MYCTH_2306714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664185.1"
                     /db_xref="GeneID:11513894"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="JGIDB:Spoth2_2306714"
                     /translation="MPGNKKPKASGSQKKGPAAAEKSGSTAEPPAQLLDMVESFLSEH
                     DFSDAHRAFTKQRAKKGWKSEKSDVAGKDSLVSVFNAWKTSSQKATTATAARASSDES
                     SSSGESSSSESESSDSDTDSDSDDNTDVEMKDVAEEESSSADSSSSSSSDSESEDKKE
                     TAKPAANPLKRKAASESSDSSDSDSDSSSDEEAPAPKKQKIAAAPAASESSDSSSDSS
                     SDSSSDSDSSSDSSSDSDSDSSSESEAESKPATKKAAAKKETSKKKKTESSSESSSSS
                     SSESSSSESSSSESESDSSSSDSDDESEDEAEEAAKVPLPESGSDSDSSSDSSSSDSS
                     SDSESDSEKTETKTKTKSAKSTSPAGGGSDSSATLDRTSPKVYPVDKFAPLPPDPATV
                     KTNNRGKGGNNNNNNNNGKVNQPFSRVNRNIQVDPRFASNAFTGHEWGRKAHEDLSVT
                     RGKGFTKEKNKKKKGSYRGGRIDTNAKGGIKFDD"
     gene            2336523..2339592
                     /locus_tag="MYCTH_2306716"
                     /db_xref="GeneID:11513895"
     mRNA            join(2336523..2337939,2337998..2338377,2338446..2338836,
                     2338933..2339592)
                     /locus_tag="MYCTH_2306716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664138.1"
                     /db_xref="GeneID:11513895"
     CDS             join(2336918..2337939,2337998..2338377,2338446..2338836,
                     2338933..2339206)
                     /locus_tag="MYCTH_2306716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664186.1"
                     /db_xref="GeneID:11513895"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="JGIDB:Spoth2_2306716"
                     /translation="MGISSSQSSPGSDRNGEKAAGQGKLLALSDIVKTTRRRRLAGLV
                     ANPFRSSPSETAAAKGSTVTGRGSVAAKRPSQREVAHPPDIDRIREIPGQFLRELRGS
                     SEKGRPGEESTSFWISKELEEKLASYSEKKAQEYSDLRQKGTEYERSLGFDSACTKTA
                     KPIEVKANAVFQHLKKNDIARFYETAPKKRGYRGQEHPRFYGDHFLSNADLIEQTQLF
                     ALCRAMPKGAHLHIHFNSNLPPSVLLGIAKDMKRMFIWSNIPLDRPEAYDLCRIQFSI
                     MNEKAVEERGAGNLFHKDYGGGTVMQFQEFREAYPGGPEAADAWLQSKLVFQEEEAHN
                     LLQTAEGAWEKFNARTQMMKGLFNYKTAYRRYTRQCLDEFVADNIQYAEIRPNFMSSN
                     QVWEDDGSSRIDNVGIMNLIIDEYEAFQKDHQRRILKGLKIIYCTPRSFGEEQVGEAL
                     MQCFQFKTDKKFSTYIAGFDLVGEESKGKPLKAFTRQFLQFQALCKAADIEIPLLLHC
                     GETLDIGTDTDGNLLDALLLGAKRIGHGFALPRHPYVMGEMKQRGVCVEVCPISNEIL
                     GLTPRISGHSVYNLLANNVPCTISADNGTLFRSRLSHDFYQIIAGKPDMTLHGLRQVV
                     EWSIEHSCMEPELRSEVRGSWEKMWDEFCQRIVDGEFTLKDGAGEMAAEGDVAADKPV
                     GGLPPV"
     gene            2341419..2343377
                     /locus_tag="MYCTH_2315566"
                     /db_xref="GeneID:11513896"
     mRNA            join(2341419..2342190,2342257..2343377)
                     /locus_tag="MYCTH_2315566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664139.1"
                     /db_xref="GeneID:11513896"
     CDS             join(2342178..2342190,2342257..2342954)
                     /locus_tag="MYCTH_2315566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664187.1"
                     /db_xref="GeneID:11513896"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Spoth2_2315566"
                     /translation="MNIQDLDLDEFTAFEGGASTTAYSSPALASVFDLSASASSSTTT
                     VGTVSPQDLLIQEPFMSAPNSTALTALTSPSLYGESPEFGDAYDVSPTFGSGDFDTGS
                     TDAWYPLFPQANPRPEAAPKPASAEQSPASKSDDSGVASAPGHRRKSSGTSPPSSRPS
                     SIAGVGSRRRDKPLPPIIVDDPTDVVAMKRARNTLAARKSRERKAQRLEELEQRIVQL
                     TAERDHWKNIALAHGAKE"
     gene            complement(2344824..2348939)
                     /locus_tag="MYCTH_2306719"
                     /db_xref="GeneID:11513897"
     mRNA            complement(join(2344824..2345098,2345219..2348581,
                     2348788..2348939))
                     /locus_tag="MYCTH_2306719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664140.1"
                     /db_xref="GeneID:11513897"
     CDS             complement(join(2345018..2345098,2345219..2348581,
                     2348788..2348805))
                     /locus_tag="MYCTH_2306719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664188.1"
                     /db_xref="GeneID:11513897"
                     /db_xref="JGIDB:Spoth2_2306719"
                     /translation="MQAVPSLAGTGTATAAAAVGLVFGQPPEPEVPWSSPVQHRFPAD
                     YDGFRAQAVPPRPSTSAVPNYHPCSSPTEEFPYSSFHQLADEYPSPLASNPTSPLSPV
                     SPTSAPRPMTGNSAMLPRSSSRRHSFIRPGDLASQPISENKRDSVSSRDFWIRRLSLR
                     PLSQHGSRRSSVGPDSSSMAFSHGSGVPILGQPPTSRASPNKLVKRTTTSGQNGAGGD
                     ARRRGSISQVLTLRRPATSHQRSATMQEFQHQGALAEPLSRGMKVPLDGYNPSPTSMT
                     FAPTRDNAGQSGRWTSFFHARRSSVSGGDISGLPPGSSPLHNLFPRRRLSLARSHDFR
                     AYLTKPSHLAEVSVSTDEVEVPPDQLTSGNKQDNKQDTSLPAADLATAADSMADRPPR
                     RSFSMHFSSASNWIARTGNPRRPRRSTIDAKSGAGSDVPDPGAVPHGQAQTPVQLRLG
                     GSHAPPKTEENPHHKPEPELGSSHPVRTRKRNSSSPLPPLNHLPNLSIDVTRGPTKAL
                     QSPINYPHTPSVTTHSRGPSGERSVTLAGSDVSARDGTFRDDEDTDFKSDDMYDSFRT
                     GASSNRMRSVETPAESVFDESPPSTANNGRTKRLSIQEMLGRSWDGETKITEEDEGVD
                     VPTRPGHQAGSSEFDSQGTKNGFGFEFSGTHGSSLADPSLERLSFDDDDDDDWAQDDE
                     NTLSNHLSPPSSTNSRRVSPTMREALRNISGNGSLDCQRDSMSDRPRSNIFDWSEPSV
                     HDKLDSGMPRPKTAHGKQEPDLRGGRTISRKPPGAAHIRSQSVPVVVPDLSDGSKQLP
                     KFGTWGLGTKTASEDWDDDFEFDGDESAICSPGGKDSAMSFSVVVPASIQATQPSVRA
                     HSGQIRELSLLVNDLKRLCRHGKDLDILQGPLASKWADAESIIALASPDEEDEDLDST
                     KPSMDFDRSKIDEQFLEDGFDGSFLDHIDKSFGFSESEMSKTAVIRERHSPKRRSVFS
                     PEDDIFGNWPLNERSATPSRCSSPSRNSAVVSTVIEAIKKRQQKNDRVKGPGHNTPDT
                     KLFFDTNSLQELVKRAGQLRDTLSDAVRKAELLTQSPAGTPRRERHSRHQNPDGSPAF
                     TRVFVEPGSSPPRRLPNSRSNPSILSRASIDSPRMQMMTASLMADVQCLKYSNRDCIC
                     RTTSLLV"
     gene            2354281..2357024
                     /locus_tag="MYCTH_2306722"
                     /db_xref="GeneID:11513898"
     mRNA            join(2354281..2355336,2355416..2355496,2355563..2357024)
                     /locus_tag="MYCTH_2306722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664141.1"
                     /db_xref="GeneID:11513898"
     CDS             join(2354554..2355336,2355416..2355496,2355563..2356948)
                     /locus_tag="MYCTH_2306722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664189.1"
                     /db_xref="GeneID:11513898"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2306722"
                     /translation="MEAEIRAVLPNIDPVISEYSAGYLTHASTAWAGDEDASGRSPLD
                     EAAATITELLLSASGNAGAATHDKIRSLVEKWVDKYAAASNSEERRGPAVRRLDQTIQ
                     VSAQRNISSTLAVATGSVDLESANTRKVESKVDKRKLEKAERKIAAKQKKKTFKTVEY
                     EASRLLNQPDPTQSYEEFYMAVNPLQMGSQGGKSKDIKIDNFDVSIGGNRILTDTSLT
                     LSHGHRYGLVGHNGVGKSTLLRALSRREVPIPTHISILHVEQEITGDDTPALQAVLDA
                     DVWRKVLLKEQAEITQKLADIEAQRASMADTSTDALRLDKEREAQDQRLGDIQAKLAE
                     MESDKAESRAASILAGLGFSPERQQYATKTFSGGWRMRLALARALFCEPDLLLLDEPS
                     NMLDVPSITFLSNYLQSYPSTVLVVSHDRAFLNEVATDIIHQHSQRLDYYRGANFDSF
                     YATREERKKTAKREYENQMAQRAHLQAFIDKFRYNAAKSSEAQSRIKKLERMPVLEPP
                     ETEYSVRFKFPEVEKLSPPIVQMSGVTFGYTRDKILLRNVDLDVQLDSRIGIVGPNGA
                     GKTTVLKLLIGKLQPTSGTISQHPRLRIGYFAQHHVDALDLNASAVSFMAKNYPGKTD
                     EEYRRQLGAFGITGTTGLQKMALLSGGQKSRVAFACLALTNPHILVMDEPSNHLDIEA
                     MDALADALKEFQGGVLIVSHDVTLLQTVCTSLWVCENGTVEKFPGDVQAYKKRISAQA
                     DAAGVVKAH"
     gene            2357797..2360240
                     /locus_tag="MYCTH_2306723"
                     /db_xref="GeneID:11513899"
     mRNA            join(2357797..2358002,2358199..2358222,2358295..2358320,
                     2358393..2358434,2358491..2358545,2358612..2359402,
                     2359480..2360240)
                     /locus_tag="MYCTH_2306723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664142.1"
                     /db_xref="GeneID:11513899"
     CDS             join(2357991..2358002,2358199..2358222,2358295..2358320,
                     2358393..2358434,2358491..2358545,2358612..2359402,
                     2359480..2359873)
                     /locus_tag="MYCTH_2306723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664190.1"
                     /db_xref="GeneID:11513899"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="JGIDB:Spoth2_2306723"
                     /translation="MREIVHLQTGQCGNQIGAAFWQTISGEHGLDSNGVYNGTSELQL
                     ERMNVYFNEASGNKYVPRAVLVDLEPGTMDAVRAGPFGQLFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDQVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFP
                     DRMMATFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICMRTLKLS
                     NPSYGDLNYLVSAVMSGVTVSLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSR
                     GAHSFRAVSVPELTQQMFDPKNMMAASDFRNGRYLTCSAIFRGKVSMKEVEDQMRNVQ
                     NKNSSYFVEWIPNNVQTALCSIPPRGLKMSSTFVGNSTAIQELFKRIGEQFTAMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAGVDDEEGEYEEEAPLEQEE"
     gene            <2369210..>2370481
                     /locus_tag="MYCTH_2111197"
                     /db_xref="GeneID:11513900"
     mRNA            join(<2369210..2369308,2369421..2369458,2369573..2369594,
                     2369786..2369800,2369868..2369940,2370153..>2370481)
                     /locus_tag="MYCTH_2111197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664143.1"
                     /db_xref="GeneID:11513900"
     CDS             join(2369210..2369308,2369421..2369458,2369573..2369594,
                     2369786..2369800,2369868..2369940,2370153..2370481)
                     /locus_tag="MYCTH_2111197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664191.1"
                     /db_xref="GeneID:11513900"
                     /db_xref="JGIDB:Spoth2_2111197"
                     /translation="MTLRWGGKELVGGRKRKLGEILPVRLQLIVWYDLNRRVLGLGST
                     LMMTRGVAQCPISVLCKDKAVPSLWKQLAPPAKWHANTADHRGIALFTDGGGLGLGGK
                     PHLPVPSSDPSSDLNHVDDAAPLRFSKAPSQPEWLELGPPFGSSTLHVVMTTGSVLAE
                     AVLEASQRLKKGWAKALTSSAHTSPCCDLVA"
     gene            2373098..2374465
                     /locus_tag="MYCTH_2306730"
                     /db_xref="GeneID:11513901"
     mRNA            join(2373098..2373468,2373557..2374158,2374246..2374465)
                     /locus_tag="MYCTH_2306730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664144.1"
                     /db_xref="GeneID:11513901"
     CDS             join(2373279..2373468,2373557..2374158,2374246..2374371)
                     /locus_tag="MYCTH_2306730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664192.1"
                     /db_xref="GeneID:11513901"
                     /db_xref="JGIDB:Spoth2_2306730"
                     /translation="MFAMSQHTYAYPVQSAPAPARQYSNHSTSSAFSSSANPDEDWTK
                     ISDLAERRRIQNRIAQRNYRKKLKKRLEELERRAGSSDDTSSSGNEKQSAPAKAKRTQ
                     TTKAQRQQQAPPPPPPPPQPQPAQAKPTVQGQYTPPMHHDDEYLFPPSYDGRERSHTP
                     PMFVYSTYPAPPEEMMMAQYGGMQGYRPMTTEAYTEYLSPPQPVPVTLPSMTHFNDAI
                     KREPGYPSALPAEDGLSYMNYNGYPSVVPGMDMNAGHPSPYDQMPHTPPSLSHSYDHS
                     AACSDSGSYDAYPTTPLSMPGSPGLVQQG"
     gene            2379225..2380120
                     /locus_tag="MYCTH_2306732"
                     /db_xref="GeneID:11513902"
     mRNA            2379225..2380120
                     /locus_tag="MYCTH_2306732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664145.1"
                     /db_xref="GeneID:11513902"
     CDS             2379651..2379923
                     /locus_tag="MYCTH_2306732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664193.1"
                     /db_xref="GeneID:11513902"
                     /db_xref="JGIDB:Spoth2_2306732"
                     /translation="MGHVRATTLRFGVRRAHTPRVRARVCACVFVTVVLPLTRMKGEL
                     PVRFSHSHYAPSARHRRELSWEKRPRGEGQKCGMFMLAAELKPSSS"
     gene            complement(2380121..2386841)
                     /locus_tag="MYCTH_2306733"
                     /db_xref="GeneID:11513903"
     mRNA            complement(join(2380121..2380938,2380999..2386296,
                     2386362..2386841))
                     /locus_tag="MYCTH_2306733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664146.1"
                     /db_xref="GeneID:11513903"
     CDS             complement(join(2380319..2380938,2380999..2386296,
                     2386362..2386644))
                     /locus_tag="MYCTH_2306733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664194.1"
                     /db_xref="GeneID:11513903"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="JGIDB:Spoth2_2306733"
                     /translation="MAAADVDLAYLSTQGGVPESDLNTIVTAPTADLVAKVLGAIVIK
                     LRDLEQEKFQLSVELEAAYRGAESRCEQFKATTDKALKEVEEVRQKLQSEESARRSLE
                     NELEALRSSGTTSLSEIETLRARIASLETSNRETLAIVDSKTTANAGLAEELQKQHQK
                     ILKLNQEITALNQSVQTAQTAANSAKYREESLKQELELAKKNNDWFDNELKTKTAECL
                     KIRKEKGARIAELQRQNEEALSNIESLTRTEQQLRKRLEEAQAKAEEALTKVQQLQES
                     AARAEESFRQELESSRRLVELKDQQSQTHRNRLKEVELRLEQVKDDCAEEIRRVRREL
                     EKEREDHAQTEQQLQEIQSEADRLRAIADSNSGVPGSAPQTPRANGSLQGRPSSPFGT
                     PASIRGKASYRATETLEELLRVKAQLAGEQRRSQKLQEELDDAVSLWEAKMPEYQEMV
                     AENERLRLESAHMSELAEQSYEQRDAAVKAARKAEGAAAAAQAEVKILQAQLRDLSTQ
                     IHVLIFNIHAREKGMDQLTEEEVAQFERLQRGEVAENALDDMSDTHRFITERFTVFKD
                     IYELQQKNEELLKLTRELATKMENEEALAAKQQAAQDHEEVQELRSTVSALQDEVQSI
                     TVRMKSYMTERDMFRRMLQQKATASEIQQALGLPREGGQREVLASIEQPSQAEEANLA
                     VALRELQAHFDSYRNDQAADRNAMKDQIEKLSVEKSALQSEVSRLSSQLTLSTERYNM
                     LESNFKALQNEKQELQKRNQSLSEAAAKQDIRTQQVAEDLVEARGLVESLRSETANLR
                     AEKTLWKTIQERLSQDNESLAQEKARLNTLLANQQSILNERELSESETRRRLQAQVDS
                     LTSELGTTKRKLSEEVEESKKIQLRKEFDAQQFQKRIDELTAMIGQIKEENVQIKTTR
                     DHLQARVGELEIELRNAQERAERLRPLPTPRPGAINERSTADSESQARIEELENEVQE
                     LKNSLDLLNVQLDNAKQQAEQFKQLSKDMEEELTSLNETHEQYRAEMDAALEAKANAA
                     NELQQRIEALTIGLSNSNNELNRLRDSQGDIARKYEEKERMLNSEIARLKDEEERYKE
                     AARFHQQDLRAQAEIATKAQQEYEQELVKHAEAAQLLQQIRAEHNELKTKAAAWRAEA
                     ESARLSLSQSEQSWEERRLQLEQEISELKTRREDVAAQNKLLHQQLDSVTAQITALQQ
                     NRVRAEGEAPPPSVADTATEGLRELNNYLRREKEILEVQYDIKVQEAKRLQQQLEYSQ
                     SQLDEARLKLDQERRAHSNSSKTSLTYKELMDKLNELNLIRESNVTLRNENHRAQAQL
                     EKKNEQIAELEAKIQPLEARISELELDKGFKEQEIRQLQEAREGLQKRIESILSKYGQ
                     ADPQEAEQLKETITSLEAERDALQQKVKDAEEALETKTNEWKTTKERLAEDFKTRFRN
                     MKAQRDEANTEKNTLQSSLDAANQRLADVERELEAAKQELRGLTEKNKALEQQAQQAE
                     QAAPAAAPAVEQPTAAPADSAEVAELTKELDSLRQQLEAVTSQKAAAEAQVEQLKTEL
                     ATAISERDNALEQALAAKSGDAVMADAAPAPTQPATGLSAEERKALEERIAVAEAKAA
                     EFERKAKELEEQSDAILKQRSDKMKNALNKKLTESKEAMEKQAQEDRKKMQEEFELRL
                     QQELAIIKAEQQTAAPRNGVPSTPAKPSSEAQPPQTPVADLNSMNDAQIRDLVATNPT
                     VSSIVKANVKRMVAAEVKKAKEEAEAALKAEYDQKIANARELAEKKSSLRINMLDKQN
                     KTAQAKLSVVETAAKDTPQRPVIEVWNIAKEAKPPVPPPAPASTQLSAASAAAHPAAA
                     SPPPAAAGQPSQPSQAASATAVKDESKPAGSGTAPPSAIPQPAKPASGIPPPVVNNPF
                     GAPATAPSSSLPQPAATQQQQKQQQQQQQGQQQPPQQQQPQQQQQQPQPQSQPQQQEQ
                     QQQQQQAQPQQQQQPRGIPVPSGRGGAAGRGARGGLYQAGPGRGGQGQRGRGGFGRGG
                     GNAGLNPNAGEFNPAGGGGAGAGNKRPRDGADGGGPGEGGRGGKRARGGG"
     gene            complement(<2387481..>2389317)
                     /locus_tag="MYCTH_94982"
                     /db_xref="GeneID:11513904"
     mRNA            complement(join(<2387481..2387804,2387926..2388081,
                     2388330..2388601,2388813..2388870,2388933..2389115,
                     2389204..>2389317))
                     /locus_tag="MYCTH_94982"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664147.1"
                     /db_xref="GeneID:11513904"
     CDS             complement(join(2387481..2387804,2387926..2388081,
                     2388330..2388601,2388813..2388870,2388933..2389115,
                     2389204..2389317))
                     /locus_tag="MYCTH_94982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664195.1"
                     /db_xref="GeneID:11513904"
                     /db_xref="JGIDB:Spoth2_94982"
                     /translation="MARPRLSAATMLALAIVRTTAASIEYAYVTDMPAFSAPEAVGYN
                     IQSLTYDACPEAVSTLQSCVCTKSNNFANLVRDLGVSVSYECGSTASEGQASAQSVLN
                     AYCNPSKDTLILNSDCKYATYNSTNHEVPRSWARCPTEAPALASCACKKNQNSFVVSQ
                     LINPAKSWCAGHMADVSSAQAMFAAYCAMNDATTKVSGAVHRPPPRRATQPYDLCPGG
                     PQALASCVCLKEGMTGDVLKLVTSSVEWHCSLTATEDISSAVAVTPPTRTGRSWLAST
                     TSHRSNRLHMQQQQQQQHRYLLHQVPSPAQSPHPQRMQPGYQSYNAGTPLPGLYGQQQ
                     QQQQPRPEASWRAGPVPDLHEMDAGHRAGGMEQR"
     gene            complement(<2390384..>2391301)
                     /locus_tag="MYCTH_2031920"
                     /db_xref="GeneID:11513905"
     mRNA            complement(join(<2390384..2390766,2390949..2390986,
                     2391123..>2391301))
                     /locus_tag="MYCTH_2031920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664148.1"
                     /db_xref="GeneID:11513905"
     CDS             complement(join(<2390384..2390766,2390949..2390986,
                     2391123..2391301))
                     /locus_tag="MYCTH_2031920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664196.1"
                     /db_xref="GeneID:11513905"
                     /db_xref="InterPro:IPR014980"
                     /db_xref="JGIDB:Spoth2_2031920"
                     /translation="MADIFNYTYPSPLAGYEDAPPLPEERAEDGKSYRNPQTGVLSSA
                     YERFPDPLDNGRRGGFDVHVYYFQNNPEQTQYARQLWERIRREFPELRIYTFWDRPIG
                     PHPVAMFEVNLLSPAQFGAFIPWLAIWRGPLSVLVHPNTTEADGGAELPLAERELRNH
                     TQRAIWMGERLPLDVARFRNLGKPGPAAGAGVTEAAGSAA"
     gene            complement(<2391970..>2393408)
                     /locus_tag="MYCTH_2111202"
                     /db_xref="GeneID:11513906"
     mRNA            complement(join(<2391970..2392275,2392367..2392376,
                     2392473..2392562,2392618..2393055,2393188..>2393408))
                     /locus_tag="MYCTH_2111202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664149.1"
                     /db_xref="GeneID:11513906"
     CDS             complement(join(2391970..2392275,2392367..2392376,
                     2392473..2392562,2392618..2393055,2393188..2393408))
                     /locus_tag="MYCTH_2111202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664197.1"
                     /db_xref="GeneID:11513906"
                     /db_xref="JGIDB:Spoth2_2111202"
                     /translation="MTEHEGAAISAETLSGQVLHIPDLRPAFASWKQGVNPNHEWVKT
                     AVEERLEDLIENKEVLAKVKATDITLFASGLFPTASAEDLKTAALYYVWLFLWDDVID
                     GAEADGAGDALAAEAYCRRSVAFVRRALGVDGAETAPCPEEGAPTRICESFGDVGRRI
                     VERGCRAEQRRGLFEQLREYMEGCVTEYKWRLSGRVPSVEQFYSWRLKTSSVDAMLEL
                     CRIINNIDLPNDILGSEEHAAMGRSVNKLLIIKELKDGSFGNLVPVTMRALNLDLEGA
                     TQALIQDIHGSIKDFNDNASAIRSRIVPEQGVGVAEQLRRLTESYQAIATTVLNFSIQ
                     SPRYGLSKYRQEDGSYAVPL"
     gene            complement(2394368..2395851)
                     /locus_tag="MYCTH_2306743"
                     /db_xref="GeneID:11513907"
     mRNA            complement(join(2394368..2395569,2395640..2395851))
                     /locus_tag="MYCTH_2306743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664150.1"
                     /db_xref="GeneID:11513907"
     CDS             complement(join(2394511..2395569,2395640..2395759))
                     /locus_tag="MYCTH_2306743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664198.1"
                     /db_xref="GeneID:11513907"
                     /db_xref="JGIDB:Spoth2_2306743"
                     /translation="MADSMCGPSNGAKNLLAHIDRDRTHHQDRLVTAPHAGAGNAFRS
                     QTPFANGAESAFGGFQQGGAPLDAAFGPGLDINNVVDARAHGHPVPGVPSTIGHMGPG
                     APAARLASPATGGASHQEWVNQFSSMQIGGGAAGPSTAMPSQMRPTAMGALNPAMNVQ
                     QPAFGMPLYAGVPPPPPVFGFQNPAMNPVAQHQQQQQQQPQATVSQDSALDVEAFNRA
                     FGEYDDANFETELADWTEKQKIANNEFTEAQDKWMAEHGPRAEPTTEVKPPSADEMEV
                     IDANLEKLAQEQDKRRSDDELARAAVDIVNSVADNTSEKFKNSRFFELMRRIGNREVV
                     VEGDSFVNAVTGETVNTSHDDDDDDDGGGANGHHESGKGSDSATPQKTDGAAAQGQAA
                     "
     gene            2396292..2398075
                     /locus_tag="MYCTH_2306744"
                     /db_xref="GeneID:11513908"
     mRNA            join(2396292..2396504,2396600..2396647,2396765..2396880,
                     2397090..2398075)
                     /locus_tag="MYCTH_2306744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664151.1"
                     /db_xref="GeneID:11513908"
     CDS             join(2396502..2396504,2396600..2396647,2396765..2396880,
                     2397090..2397837)
                     /locus_tag="MYCTH_2306744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664199.1"
                     /db_xref="GeneID:11513908"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2306744"
                     /translation="MAAGTQVIANSGHDDMIHDAVLDYYGRRLATCSSDRTIKIFEIE
                     GETQRLTETLKGHDGAVWCVSWAHPKYGNILASAGYDGKVLIWRELNGAWQRIFDFAL
                     HKASVNVVSWSPHEAGCLLACASSDGNVSVLEFRDNSWEHSIFHAHGLGVNSVSWAPA
                     TSPGSIVSSKPGPKSTGNRRFVTGGSDNALKIWAYDPATNTYKLEREPLTGHTDWVRD
                     VAWSPTVLQKSYIASASEDRTVRIWTSDPANPLQWNCKVLNFDAAVWRVSWSLSGNVL
                     AASGGDNKVTLWKENLKGEWECVKTIEE"
     gene            complement(2398161..2400059)
                     /locus_tag="MYCTH_2306748"
                     /db_xref="GeneID:11513909"
     mRNA            complement(join(2398161..2399504,2399588..2400059))
                     /locus_tag="MYCTH_2306748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664152.1"
                     /db_xref="GeneID:11513909"
     CDS             complement(join(2398314..2399504,2399588..2399935))
                     /locus_tag="MYCTH_2306748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664200.1"
                     /db_xref="GeneID:11513909"
                     /db_xref="JGIDB:Spoth2_2306748"
                     /translation="MIPLTKRAAAAALLLSGVTAQDTTTIATAIGSVPSACATLTPAY
                     SPPVVAKGWKAQLIATGLTRPRGIKSDSNGGLLVVEQGVGLTHLTLNDKGGTCVSVAK
                     NVSVIEDSKVGNIQLNHGLELSEDGRTLYVSSSEYVDRYHYDPDTAVVGERTRLVANM
                     TNPGGGHSTRTLLLSKSQPDLLLVSRGSATNIDPLAADQSTGVSSIRAFNISDAATGE
                     NPYDYPSDGLLVGWGLRNSVGVAEHPVTGTIWSVENSADNVARLGQDIHEDNPGEELN
                     YHGLLNDTSSPLLGANYGYPSCFALWNTTDFPSQGDLVVGSQFSLDNDATINDTYCAE
                     STIPPRLTFEAHTAPLDIEFLPGNGSRAFISFHGSWNRDRPAGYKLAYVPFTSAGEPA
                     DESDSRGAARNILTPPDVTQCSRRGACFRPVGLAFDAAAQRLFVSSDATGEIWVVLRD
                     GEEEEEIEGRRTATDTSAQPGSTSSGAAMPGAALRGVGPEGWVVVVAVTAWMMVVGGL
                     GFIV"
     gene            complement(2402209..2404863)
                     /locus_tag="MYCTH_2306750"
                     /db_xref="GeneID:11513910"
     mRNA            complement(join(2402209..2402718,2402888..2403231,
                     2403343..2403481,2403574..2403610,2403686..2404416,
                     2404542..2404863))
                     /locus_tag="MYCTH_2306750"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664153.1"
                     /db_xref="GeneID:11513910"
     CDS             complement(join(2402427..2402718,2402888..2403231,
                     2403343..2403481,2403574..2403610,2403686..2403761))
                     /locus_tag="MYCTH_2306750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664201.1"
                     /db_xref="GeneID:11513910"
                     /db_xref="JGIDB:Spoth2_2306750"
                     /translation="MAAAGGAASIITQVQQGGPPLNPLGDVPGDETIVMDLRGTRFKL
                     SRDELLTLPEFVLLSLFPNGLFPEGHMGGGFSEGDAVQVDYDPASLQYMLDFFRNVAQ
                     SIPTEPSNGQEGADGLVSFDPSARDESSRRAGIIVLREDLDFYAIPPKQDIEQPEMIE
                     VKRAAARALLKQDGIFSGLKKSDEPGTTEAHLIEMLTAGGFNHDDRWGHRAPEPNKAV
                     ICSLALARLRSDIRGNEMGSGAVGMAQKLLLFWRKPARRCWWEGVELENVEGLPAGTK
                     LKVWIRRVWTLEMSVIGLR"
     gene            complement(<2405323..>2407551)
                     /locus_tag="MYCTH_2128009"
                     /db_xref="GeneID:11513911"
     mRNA            complement(join(<2405323..2406733,2406832..2407290,
                     2407370..>2407551))
                     /locus_tag="MYCTH_2128009"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664154.1"
                     /db_xref="GeneID:11513911"
     CDS             complement(join(2405323..2406733,2406832..2407290,
                     2407370..2407551))
                     /locus_tag="MYCTH_2128009"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664202.1"
                     /db_xref="GeneID:11513911"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR011666"
                     /db_xref="JGIDB:Spoth2_2128009"
                     /translation="MSYKRSRATYEADLTAQRSPYVAFGTPLPPLDSEARDDGSYVPL
                     WKQEVRDERGRKRLHGAYFNTVGSKEGWTPSTFVSSRTNRRKDDPNAAQRRPEDYMDE
                     EDLADAEEARKIQTQAAFSGLGSTADDATRRNGLMDLFRAEGDTMGTRLLKKMGWKEG
                     QGIGPKVRRTARLELRSDTGDPGETYLFAPEDVPMISFARKTDHRGLGYEGETSRKKE
                     REKSRGGIGVGILNDTGSDDEDPYEIGPRISYNRVIGGDKKKKKAITAINPALKAKPA
                     FIPSKKSGLGKIALGVRKCHDGRLPLDGFVFGREPDALTSEINSEGKYPPPKIPDGWV
                     SAKQSKSQAGATGYVSTAEAAMASTLDPKARAAILGEKPLPGKSVFDFMSAEAREHLA
                     AVTGKKDLPPARGEVPAEYALSEEDRLQELLSRVPQLGKETAVAAISRGASGNAPYRD
                     DEAKRARYIAFLEYQAGFKPTPGTKPPKMNNEEWLREMHEFYNCARIFRPMTGFMASR
                     FTTSTNQSSPGSGGEAEERDLLSKPPAKPQDPSEEAAKLGMFGPMTRSVTEFYPARLL
                     CKRFNVKPPEHVQANDPGAASAASGKAKYDTATQFSATQAYGSSGQEPMALEFGSVHS
                     SSAGTTRDAGSNLEDEAAGRQPSGPGKAVIDTSRNEALEGERAGEDVFRAIFGDSDDE
                     D"
     gene            2409720..2412776
                     /locus_tag="MYCTH_2306759"
                     /db_xref="GeneID:11513912"
     mRNA            join(2409720..2410207,2410283..2410919,2410989..2412776)
                     /locus_tag="MYCTH_2306759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664155.1"
                     /db_xref="GeneID:11513912"
     CDS             join(2409830..2410207,2410283..2410919,2410989..2412427)
                     /locus_tag="MYCTH_2306759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664203.1"
                     /db_xref="GeneID:11513912"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2306759"
                     /translation="MPMRSQSVRTRRPPTASRPEPLPRSESSTRAEASRPHRRSSQRS
                     TTGAAQSPRHPPSDVPAPAAEEPHDRAAANAAAADHYAQRPSKHRYRTVIPAPSGNYA
                     FIKTIGQGSMGKVKLARKEGTNELVACKIIDRVSPDDGRLSREERERADAAREDRNAR
                     EAAIVSLLNHQYICGLRDNLRTRWHWYMLFEYVNGGQMLDYIISHGKLKEKQARKFAR
                     QIASAVDYCHRNSIVHRDLKIENILISKTGDIKIIDFGLSNLFSPDEDRKLKTYCGSL
                     YFAAPELLQARPYTGPEVDVWSFGVVLFVLVCGKVPFDDQYMPALHQKIKKGEVDYPN
                     WLSSECKHLISRMLVTDPKQRATMHEVMNHPWMLKGYNGPPENFLPHREPLKLPLDEE
                     VIAHMTGFKFGPPEYIREELTKKITSPKYQAAVRRLEKEREQPQPNPQGTEKRRGFGF
                     DFYKRRNSITSKETLTNGSSDGLPIGDDPLNAFDPMISVYYLVREKFERERQEAQAAQ
                     PAVPPKVQQVPPSSPQQAQAPPPVPPSPIARHKEKHSLAEIVPPQPAHTENSRTRHRA
                     RSHSEDQVREPVQNGLLSPDMVPTKKGGNGPVSLLRRLSTRDRRKEPSDGKTISLQKS
                     VSKRAKSLGHARRESIQARRARREAEARDQPQTPHTPHQEPPLREETDAELGLEGEGE
                     GGETSGGSNERLEPEDPDLAKPVYLKGIFSVSTTSTKPLSEIRADIKRVLKMLGVDYT
                     EIKGGFSCTHAPSIAEEERYHSPSRGEERVADGEIRFEVLIVKVPIVSLHGVQFKRLG
                     GDTWQYKATAEQIVRKLRL"
     gene            complement(2413021..2413986)
                     /locus_tag="MYCTH_2306762"
                     /db_xref="GeneID:11513913"
     mRNA            complement(2413021..2413986)
                     /locus_tag="MYCTH_2306762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664156.1"
                     /db_xref="GeneID:11513913"
     CDS             complement(2413268..2413687)
                     /locus_tag="MYCTH_2306762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664204.1"
                     /db_xref="GeneID:11513913"
                     /db_xref="JGIDB:Spoth2_2306762"
                     /translation="MASSFRMPAPRLLLTARSATLSSATASRLRHAQGWTKPLPPTSV
                     SPLSSSTTSSFSTCHAMRSSGAHSGGATPSPSPSYLALSLRRIVPNPRTRAALAVGVV
                     LLAAVDTYAYVTYWPKIAGKGRGGGVPEVGGEGDSRE"
     gene            2417857..2419248
                     /locus_tag="MYCTH_2306764"
                     /db_xref="GeneID:11513914"
     mRNA            2417857..2419248
                     /locus_tag="MYCTH_2306764"
                     /product="glycoside hydrolase family 33 protein"
                     /transcript_id="XM_003664157.1"
                     /db_xref="GeneID:11513914"
     CDS             2417972..2419201
                     /locus_tag="MYCTH_2306764"
                     /note="CAZy_ID 268051"
                     /codon_start=1
                     /product="glycoside hydrolase family 33 protein"
                     /protein_id="XP_003664205.1"
                     /db_xref="GeneID:11513914"
                     /db_xref="JGIDB:Spoth2_2306764"
                     /translation="MRWLQGIALWAALAPLSHANVPDPAKDATPYHEEFVLFRSANMA
                     SPDKLSSGVGFHSFRIPAVVRTNTGRILAFAEGRRHNNRDYGDINLVYKRTKTTTSHG
                     ASFSDWEPLKEVVGAGAGTWGNPTPVVDGDTIYLFMSWNGAQYSQNGGDTLPDGSKTK
                     KIDSTWEGRRHLYLSKSTDDGATWSEPEDLTETLTPAGRAWDAVGPGIGIRLTTGELV
                     VPAQQRNIIGRGPPGNRTWSVQSLPGAGSEGTIAQTPDGQLYRNDRPGSNSDYRRVAR
                     GNLTSFGAFADDTGLPDPGCEGSVLLYNLADDKGPARVVFMNSASKDSRRAMRVRISY
                     DSDAAKFNFGRELGDAPVSGAGYEGGYSSMTKTADYKIGALVESDFYNDKGGEKSYRA
                     IIWRRFNLSWILNGPRN"
     gene            complement(<2419364..>2421739)
                     /locus_tag="MYCTH_116363"
                     /db_xref="GeneID:11513915"
     mRNA            complement(join(<2419364..2419578,2419738..2420372,
                     2420453..2420594,2420654..2420723,2420788..2420954,
                     2421008..2421167,2421257..>2421739))
                     /locus_tag="MYCTH_116363"
                     /product="alkaline phosphatase-like protein"
                     /transcript_id="XM_003664158.1"
                     /db_xref="GeneID:11513915"
     CDS             complement(join(2419364..2419578,2419738..2420372,
                     2420453..2420594,2420654..2420723,2420788..2420954,
                     2421008..2421167,2421257..2421739))
                     /locus_tag="MYCTH_116363"
                     /note="Alkaline phosphatase-like protein"
                     /codon_start=1
                     /product="alkaline phosphatase-like protein"
                     /protein_id="XP_003664206.1"
                     /db_xref="GeneID:11513915"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="JGIDB:Spoth2_116363"
                     /translation="MHILSTLSLAALSAPLASASFDGNINYLSPSRRHVNLGIDVPAV
                     ARRSMKRGAVPYKPSELNFTHGIASGDPYPDSVILWTRVAPSLASDNSNVTVEGTVDL
                     YNHETEKYVKADPNPICVEWKVWEAQEKGSKRPGHGGSGKHIVSQGTAYTTSDIDYTV
                     KVEAKGLKPFTTYNYQFNVCKSDNASPVGRTKTAPRENAKLDEINLAVFSCSNFPNGY
                     FNAYGNAARKDKHDYVVHLGDYIYEGAQGGERAHNPPRIIFSLWDYRTRHGQYRTDPD
                     LQLLSQNYAWMPTWDDHEIANNGYRDGFSALNNTEDSFRKDGPSISVDQRKMNAVRAY
                     FEWMPIRQVDLDDNLRIWRSFKLGRLLDLIILDTRNYDRSITSLGWNDHYIDLIRDDA
                     SRSLMGSRQEHWFYNQLAESSRRGAAWRVVGSQVIFSDINNSGDTWSGYTANRNRTLK
                     HLYDNKIGNNVFLAGDSHQNWVSDLAWLGEKPYDSQTGEGAVGVEFAGTAVSSSGQSG
                     PILAAREKARQQVEANELMQWQEGYYRGYFILRIREEAVTAQYFGSPSVATPNAWDLP
                     LANFTIASGKNHLTRPVAGGNVEAGFVRGGTTTGTNLTLNTETGKWDVVGFEKMYIK"
     gene            2424721..2426942
                     /locus_tag="MYCTH_2306767"
                     /db_xref="GeneID:11513916"
     mRNA            2424721..2426942
                     /locus_tag="MYCTH_2306767"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664159.1"
                     /db_xref="GeneID:11513916"
     CDS             2424813..2426741
                     /locus_tag="MYCTH_2306767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664207.1"
                     /db_xref="GeneID:11513916"
                     /db_xref="JGIDB:Spoth2_2306767"
                     /translation="MLPGVTAYNSALVLLCATLSRIPSCVAAPWTEFLSRRFDLILDY
                     SPAPPPEDGPPASAGALRDPAFLPAQIGGIVGAYALSLVLVALLLLALSKRRREHLRN
                     RDLAPEEGGVFFSGFNPFPEPFLLQSEEEYKRQLEAFQQLTELEQQQQFHLYQAQPEQ
                     PFQQLSLEIPTSPIRNFSLPSTSPLSPTRTGPLSPTKSQRSLFTSPSPTSTIRAPGLE
                     LVVDQTVLHRDRTMAQQQLEEMYKYVMEHEQAKAEGREYEGPPIASPSSGASPTKGPK
                     KERNKPSNLNLSRDDKAQSRGSSFLSFLKSPRKSKMNANVTISSPILTPMSGTFPRHD
                     DQEMNAMAPRHYAPAAPPPVPSSSDLSFRRATASTAGGSHHLPTPDISPVSSQSIDSR
                     IDAAIGKPPSRAAWRERHEREGRSSNRLPSHSHNDSSATSTAGDHEPVSASSERSTTR
                     LVGLPASPRPNATRFPSDLSLPASPRPHQQSFQQQQQQQQQSGPNNNSNSNDSNDSSN
                     NNNKNNASSSTSSFPRPSAVREGGTLPLRTYEQQQQQQQQGSSVTSPTAASFATTTRQ
                     TVFTRAEGPLSPGTALPTGMRTPWTGAPVPYSPYQPFSPVVPITPSVVTRADRKRMKK
                     LEPRTPTVEMVRSDEELW"
     gene            2429016..2432568
                     /locus_tag="MYCTH_2306768"
                     /db_xref="GeneID:11513917"
     mRNA            join(2429016..2430178,2430322..2432568)
                     /locus_tag="MYCTH_2306768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664160.1"
                     /db_xref="GeneID:11513917"
     CDS             join(2429144..2430178,2430322..2432475)
                     /locus_tag="MYCTH_2306768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664208.1"
                     /db_xref="GeneID:11513917"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Spoth2_2306768"
                     /translation="MASLDGNAPELFANMDGGLDVFDLGDAALGDSGLAGDFGDGALG
                     SSEPISTAPTSVTTTTAAETVSPISIAGGTLSDASPDVAGPSHQQQQQQQQQQQQQRQ
                     QQQHPGFFESATTPQWEFQNTPPYDSPINPFGTAPQPTWELPLNLSKPPQPQQQTSSY
                     PQTSTAATNDPNPAPSTSAGNVPLAPAFAPSLQPAQPEHIRNIQDTLTPAQRERLKSI
                     AMPPHLQYHSPQSNAGSPDSASSGQDKAALSSPDPAAPAKPTSRKRKSSASADDDDDE
                     DEVEQPVKKTAHNMIEKRYRTNLNDKIAALRDSVPSLRIMSKSARGEDTTEDREELHG
                     LTPAHKLNKATVLSKATEYIRHLEKRNNRLLEENSNMQARIAAFEKLFMAGAMSGQLP
                     NPLQQQPAPMQYPQDTSSYLNTPMATPRGPDPPGMIPIPDDMKRILAAQQMNAGRPYP
                     VPAQQFGQNPTFMRQQQIQQQQQQSQAQSGRWNPYLGKLMVGSLAGLMLVEALVESEP
                     SGDSTDSRGLGLVPSVNYITSFVRSSHVSVGGYYVSAIHLLAKLRLLSLLGFVFWLAC
                     SSFVDTSAFKPSNKTENTAAVVKAVPSLASPIHVRRQAWLTAIQTVWVPRHNIFLEAA
                     ALLLKTWKYTLRNLVGSHSYLSLAGLSEEQEAARIKAWSIALDAQLAGGDVEINKSRL
                     TLTLIASGTLPDTPLRLMLKALHIRVLLWQLNGARWAANVIAAKLARDRWNEARQLNR
                     ILNSLPEGDASADDALPEYLATLIEQDCDEVLTDAIIQRVHNLAWNRHTTHNVVGKID
                     GMDTVVEDAAVRSPMDAVAAWYSCLILHRVLLASLRQPRDDLAAAHRPEDAIALAAKI
                     APIGSNAQVRALVARAVFAEGARGSHIVAALQALGPSVNPDKHQDYRRGVPPLIDSPM
                     TSIMPDPDAQMALRCAMGIAQLQKFENPPTAAYPIISSVLPAGTDIEKVSLLGYAAAF
                     RLMETLNRHAVARETSARSLERLAGSLRIWMGCERAAGEKLGVDAAMRSAMIKRCLAV
                     TKSVVGMEAEADPGYWSMDDCAGADGEGEDGC"
     gene            complement(2433661..2435651)
                     /locus_tag="MYCTH_2306772"
                     /db_xref="GeneID:11513918"
     mRNA            complement(join(2433661..2434376,2434449..2434994,
                     2435053..2435085,2435166..2435651))
                     /locus_tag="MYCTH_2306772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664161.1"
                     /db_xref="GeneID:11513918"
     CDS             complement(join(2433906..2434376,2434449..2434994,
                     2435053..2435085,2435166..2435345))
                     /locus_tag="MYCTH_2306772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664209.1"
                     /db_xref="GeneID:11513918"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="JGIDB:Spoth2_2306772"
                     /translation="MRFIIRDNAEAASAYVANYIVDRINHFAPTPAHPFVLGLPTGST
                     PLGVYKRLVEKYKAGEVSFENVVTFNMDEYIGIPRDHPESYHSFMWKHFFSHVNIHPS
                     NVHILDGNAPNLEAECVEYEAKIQAAGGIDLFLAGMGEDGHLAFNEPGSSLASRTRVK
                     TLAYGTILANSRFFGDDLEKVPKMALTVGVQTVLEAREIVVLALGARKAIALQRCVEQ
                     GVNHMWTLSAVQLHPHSMIVCDEDATLELQVKTVKYFKDIEQVAQAQGFEQILPSKVR
                     TGPATVPTTIVTDEFPASTIHSPQPTTSRLLRATPATEYPVRSRSPSPDLSAPRRHLR
                     PVSPPAGNESAEFTEGTEYTTVLSRSPTPDFVPDRMASRIGDPSLLRRSTPNPERQRP
                     RSPGLPNSAPLMNGIKA"
     gene            complement(2436615..>2436882)
                     /locus_tag="MYCTH_2306775"
                     /db_xref="GeneID:11513919"
     mRNA            complement(2436615..>2436882)
                     /locus_tag="MYCTH_2306775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664162.1"
                     /db_xref="GeneID:11513919"
     CDS             complement(2436721..2436882)
                     /locus_tag="MYCTH_2306775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664210.1"
                     /db_xref="GeneID:11513919"
                     /db_xref="JGIDB:Spoth2_2306775"
                     /translation="MFERATGGRGLFVKIVQYPGVASVANGSSIAGVEWRKTVATLER
                     DREVGTLAW"
     gene            2437343..2439638
                     /locus_tag="MYCTH_2306777"
                     /db_xref="GeneID:11513920"
     mRNA            join(2437343..2438169,2438232..2438804,2438901..2439638)
                     /locus_tag="MYCTH_2306777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664163.1"
                     /db_xref="GeneID:11513920"
     CDS             join(2437565..2438169,2438232..2438804,2438901..2439363)
                     /locus_tag="MYCTH_2306777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664211.1"
                     /db_xref="GeneID:11513920"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="JGIDB:Spoth2_2306777"
                     /translation="MPLVSAMMSLREALLAAVRSLLRGKSFLKALLAFWTASPVTPIN
                     SQDAGAKVNADPAADFLAEAEHLLLGFIEAGGLKRFSRKLKRQFKERLWSNTECMLPS
                     YNSQLPTGRESGQYLALDVGGSTLRVALVELGGKGAEGAEGSIIRMDTFKIDSHVRNL
                     RGARFFDWMAERIQQTVAKDSTRGHVPDVPLLMGLAWSFPIEQTSSKGGKLSVMGKGF
                     LAHEGLVGQDLGDIIKSACQKQGLHVELSAIVNDSSAALLSEAYVTPSTRFSLVLGTG
                     VNIAVHLPVNTIDQPKFGDRPSSWHEKASHVIVNTELGMFGHDILPLTKWDKLLKADH
                     PRPDFQPLEQLVSGYYLGEICRLALLDAIASTGIFGGNVPPSLRTPYSLDTETLSLIE
                     ADTSPSLSDALQAFAARHPIPSYRPTTADMSFLRTLASHVTRRSASVVAASLHALWEL
                     KAEAERAMLASLPDPSGAFALETEAEIALASSKTTVAFNGSVIEQYPGYRARLQAFVD
                     GLLAEDDGDGDLKKGSIALVEARESSLRGAAVALACLS"
     gene            complement(2439652..2442168)
                     /locus_tag="MYCTH_108157"
                     /db_xref="GeneID:11513921"
     mRNA            complement(join(2439652..2440128,2440243..2440718,
                     2440803..2442168))
                     /locus_tag="MYCTH_108157"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664164.1"
                     /db_xref="GeneID:11513921"
     CDS             complement(join(2440011..2440128,2440243..2440718,
                     2440803..2442047))
                     /locus_tag="MYCTH_108157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664212.1"
                     /db_xref="GeneID:11513921"
                     /db_xref="InterPro:IPR007888"
                     /db_xref="JGIDB:Spoth2_108157"
                     /translation="MAGFSSMPALSSGAAPGPDSMSISASEMEAFDASMAFDDSMLSV
                     HPPYLFDNDGHANHTSPASDPVNVPQIPFTPTAYDFENFSTTFEDPFSYPARPFDGTG
                     RSHSRGPHDAAAAPTDSHRSHHDLYGHMGIGGASPQDDDDEGPDNKLLSFGPPIPGKA
                     TLLTDTGQFVEPAMTGELYGMFFVAEDVFGADSNATGRPLELTCYRRNLWQISGQITL
                     PRHVAQYVDDQGRRGPVVELAASITAVESIEGRAAEMITIPWRGSNAPLGAEESKAVS
                     APPVVPLDFSGSGQEVDGGSRVSVPVAWKRLQFKHATANNGRRKGLQQHYVVQINLLV
                     KSKAGEYIKVAEIQSGPVIVRGRSPRNFDSRKEVPLGDKRPLERRNTEGSGSAAAKQE
                     KQERQDDGTPVKTQRYNPTTGVQQSPSDRATPYGMNTPNPQHPNKKLAVTSPNVNRPP
                     VPSWGSLEPPSSANAKQNNAGNANPNAAAVRQRSNSTTGPQPLPLSLSLSEDERSPPN
                     RSSSNDSSQSPRLTTKASTRSSTGGGAGLASAGQAGSSSGAHDHLGGSLDSDDMLYEY
                     FPLSLDDWMPPVDAIYRPHVVHHTIVPPEVKAQQVRSKAKRYFAAE"
     gene            complement(2442384..2446584)
                     /locus_tag="MYCTH_2306784"
                     /db_xref="GeneID:11513922"
     mRNA            complement(join(2442384..2443056,2443125..2444452,
                     2444510..2445778,2445851..2445969,2446262..2446584))
                     /locus_tag="MYCTH_2306784"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003664165.1"
                     /db_xref="GeneID:11513922"
     CDS             complement(join(2443039..2443056,2443125..2444452,
                     2444510..2445778,2445851..2445969,2446262..2446311))
                     /locus_tag="MYCTH_2306784"
                     /note="CAZy_ID 267876"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003664213.1"
                     /db_xref="GeneID:11513922"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="JGIDB:Spoth2_2306784"
                     /translation="MSTLDGDLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRTLIEQHH
                     LGSVLLTAKNLKSAEQTARLVQELQTIARQAGHPYPLLIALDQENGGVNSLFDEDYIC
                     QFPSSMGQAAASSADLAYKIAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRATG
                     DDPQEVSQYGIAAMNGYKDAGVATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSA
                     LVPFRNAIATGKLDAMFVGGCGIANPSMNVNHACLSEQVVDDLLRNELGFQGVAISEC
                     LEMEGLRNEIGVKTGTVMAVEAGCDLVMLCRAYDVQLEAISGLKLGVENELITKERIY
                     TSLRRIVRMKKSCTSWQKALNPPGISLLSKIHPGHLALSLKAYDDSIAVIRDNEKLLP
                     LTSSMHQEEELLLLTPLVRPLPASSMTKALLEKKQIDPVTLHDKWVHRDRGAIMSGEG
                     VFRELGRSLARARHGKLLHTSYTANGVRPVHENLINRASCIIIVTADANRNLYQAGFT
                     KHVSMMCSLLRANGQKKSLIVVAVSSPYDFAMDKSVGTYICTFDFTETAMAALVRVLC
                     GKIKPRGTLPGTLRKSRKVLKSRQHWLVEPYDRDRDAKGLQDLLQSLARASAPAHQFL
                     QTTSAHSFELFSPNIEEAHFVVRNSSTQALYGFCATYFVQGTGIIGALFVDPAKRNVS
                     IGRSLQRRALRGLTQKRGIKKVQLGMSFPGVFLGIPADDSAGLKQWFTNGGWDLQFPR
                     RLVNMAVSSLNSWIAPEGLLQSIQRAGITFDLIHGLDNADNVLAHVSAHASPEVLELY
                     RFALQETKSCGVVRAKGHAEALLGTVIVCKPGSTLASFIPPLQPSPARPDEPVGGIVS
                     PIVAPSSAQATLVLQGLALMGLRQNKTHKSLKSVLSWVQDDAHEPLLAMGFEVVQVFE
                     EFTNSPDNWQDFS"
     gene            2447422..2449809
                     /locus_tag="MYCTH_2306786"
                     /db_xref="GeneID:11513923"
     mRNA            join(2447422..2448107,2448191..2449083,2449289..2449809)
                     /locus_tag="MYCTH_2306786"
                     /product="carbohydrate esterase family 9 protein"
                     /transcript_id="XM_003664166.1"
                     /db_xref="GeneID:11513923"
     CDS             join(2447724..2448107,2448191..2449083,2449289..2449547)
                     /locus_tag="MYCTH_2306786"
                     /note="CAZy_ID 268052"
                     /codon_start=1
                     /product="carbohydrate esterase family 9 protein"
                     /protein_id="XP_003664214.1"
                     /db_xref="GeneID:11513923"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="JGIDB:Spoth2_2306786"
                     /translation="MPSAIRSGSPRHTGITKLTNCRLVRGDELVWDDIWVSSATGKII
                     RSQSAFYDELIMPDEVVDLGGRIVSPGFIECQLNGAYGFNFSTMTDDMSQYGKQLRDL
                     NKKLARTGVTSYVPTVTSQTSELYKKVLPYLGPSGSSRRAHDGAESLGAHVEGPFLNP
                     TKNGVHNTSVLRVANSLSDLEDMYGAANITPSASSSSSSASSQDSDSSSTSGPEEEGK
                     VEEKKHGREGTIPIKMITAAPELGAMTSLIPALASRGIVVSIGHSEATYEQASAAVAA
                     GATMITHLFNAMRPLHHRNPGIFGVLGAPEPQRQQQEQQKQPTTPPPSPQWQQQQQQQ
                     QEQEQEQQKKQQQPPKRPYFGLIADGIHLHPATVKIAWHAHPAGLVLVTDAMHMVGLP
                     DGRYPWTNGEGEHFIVKKGSVLELEGTGGVIAGSSITLVECVSNFLNYTGATVPEALR
                     AVTATPAAMLGLEVVKGCLEAGADADLVVLSENNDEGGRRELVVDEVWKFGVRIFERG
                     RDC"
     gene            complement(<2449873..>2452269)
                     /locus_tag="MYCTH_2119272"
                     /db_xref="GeneID:11513924"
     mRNA            complement(join(<2449873..2450988,2451043..2451573,
                     2451631..2452146,2452201..>2452269))
                     /locus_tag="MYCTH_2119272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664167.1"
                     /db_xref="GeneID:11513924"
     CDS             complement(join(2449873..2450988,2451043..2451573,
                     2451631..2452146,2452201..2452269))
                     /locus_tag="MYCTH_2119272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664215.1"
                     /db_xref="GeneID:11513924"
                     /db_xref="InterPro:IPR006823"
                     /db_xref="JGIDB:Spoth2_2119272"
                     /translation="MPFQHHRRGAPAPNRALAATISTGEEKLASRFQHHDDADNPFLS
                     HPRAARAGDKYLIGVGKADITGPVVEINFAGYANMEQVGTGLRQRIYARSFIIGEVGT
                     NNRFVYVVLDTQSGDTAVRNGVLEGLAALGPEYSVYGQSNVAITGTHSHSGPGGWFNY
                     LLPQVTSLGFDRQGYQAIVDGTVLSIKRAHESLQEGYLDFGTTTISDANINRSLYAYL
                     ANPESERAQYTDDVDKTLTLLRFRRASDGKSIGVLTWFAVHGTSMLGNNTHVSGDNKG
                     LAAYLFEQSVKGTDQATDGFVAGFSQANVGDTSPNVLGAWCDDGSGSMCDFKTSTCAD
                     GKSQSCHGRGPLFQKLDLGVSSCYEISRRQFSGAKALYDSFDSKSTPVVGSTVRSFHY
                     FQDMQYYTFPLDNGTVVQTCPAALGYSFAAGTSDWPGAFDFTQGDSGSPNNPLWQVVS
                     GLLRAPSAKQKECQGPKAVLLDVGEMDTPYAWSPNIVDVQTLRVGQFIIIVSPSEATT
                     MAGRRWRNAVKEAASEYSITGDSEPFVVLGGPANSYSHYVTTPEEYAVQRYEGASTLF
                     GQWELPAYINLTLRALPYLAPTAKDSPPPGPTPPDNREKSLSFITGVVQDGTPPGKSF
                     GAVIKQPPSSSARGAVISATFQGANPRNNLRLEGTFAAVEKLGDDGKTWTQVLSDYDW
                     RLVYTWKRTNFMLGYSEVTIDWETDEQDAPGTYRIKYYGDSKPLIGSINAFTGTSNSF
                     TLT"
     gene            complement(2455686..2457207)
                     /locus_tag="MYCTH_2306791"
                     /db_xref="GeneID:11513925"
     mRNA            complement(join(2455686..2456010,2456071..2456446,
                     2456534..2456689,2456764..2457207))
                     /locus_tag="MYCTH_2306791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664168.1"
                     /db_xref="GeneID:11513925"
     CDS             complement(join(2455830..2456010,2456071..2456446,
                     2456534..2456689,2456764..2457121))
                     /locus_tag="MYCTH_2306791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664216.1"
                     /db_xref="GeneID:11513925"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="JGIDB:Spoth2_2306791"
                     /translation="MMPNPHVYGHHQYPQAAETAWMHQQTSHQHHTQAAAAAASVAQQ
                     QHYNRIASAHNAAGVLTQAHAADNTLESTVSEDNRRTLQYIADLLNENTREGALLELS
                     KKREQVPELALILWHSFGVMTSLLHEIISVYNLLSPSQLTAAASNRVCNALALLQCVA
                     SHNETRTLFLTAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKNDSSEVINFLL
                     TTEIIPLCLRIMETGSELSKTVAIFIVQKILLDDNGLNYICATYERFYAVGTVLSNMV
                     AQLVEQQTARLLKHVVRCFLRLSDNARAREALRQCLPQPLRDQTFSAVLRDDAATKRC
                     LAQLLINLSDNTMEPTVGQLGL"
     gene            2463430..2466658
                     /locus_tag="MYCTH_2306795"
                     /db_xref="GeneID:11513926"
     mRNA            join(2463430..2463503,2463563..2463664,2463724..2463809,
                     2463877..2464393,2464460..2464797,2464847..2466658)
                     /locus_tag="MYCTH_2306795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664169.1"
                     /db_xref="GeneID:11513926"
     CDS             join(2463640..2463664,2463724..2463809,2463877..2464393,
                     2464460..2464797,2464847..2466415)
                     /locus_tag="MYCTH_2306795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664217.1"
                     /db_xref="GeneID:11513926"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="JGIDB:Spoth2_2306795"
                     /translation="MRIPGFKAAIFPEESLPVFNNVANLGLLVFLFLVALEVDIRLFT
                     HNWKAALSVGLAGMVLPFGLGFAIAYGIFHQFQPGNTEHPVGFGTFGLFVGTALAITA
                     FPVLCRILSELNLLRCDVGVTVLAAGIGNDVTGWILLALCVALVNNSNGLAALWALLC
                     CIGWTLVLVFLVRPPFMWVLRRTGSLQNGPTQGMVALTMLMILVSAWFTGIIGVHPIF
                     GAFLIGLICPHDGGFAIKLTEKIEDLISVLFLPLYFALSGLNTNLGLLNDGITWAYVV
                     GITVCAFVGKIAGGTLAARANKLLWRESLTIGCLMSCKGLVELIVLNIGLQAGILSET
                     TFTMFVVMALVTTVATTPLTKALYPPWYQKKVDKWRRGEIDWDGNPISSSDSDQHHEK
                     PVESQIRRLMVHLRLDSLPSLFTFIALLSPESVSTPVPAQSDEKESGSQSEVVRVKKK
                     PLEVHGLRVVELSNRTSSVMHLTEGEDFYSLQDPVVNAFLAFSQLHDVAVSGRVAVVP
                     TDAYAETLMHRASEVSSDFALIPWGEYGSVSDDMSLPVSMSGSERFRPNANLEFISQT
                     LQQAAHTCNAGIFIDNGFGGITKSVDRPGLSRSKSALSIRSFRTELAALPVANKSHHI
                     FLPFFGGPDDRVAIRIVLQLALNKHVTASIVRVNWPTSAPAETSTASAAATTTTTHPP
                     NAQSALAHQEQLDAAFFSTMRDSLPADLAPRVVFSELDISPSTAVPTALTEILLLAQR
                     TVGQTPKNAGDVVVLGRRISRFGDAVPGSADVQGTGGSAAGGSGAVGGGGPAGAGAGA
                     GGGDGGGSTDLRRTVGAVAEKLVTTGVKASILVVQAGGRGLDAVYA"
     gene            complement(2466658..2470852)
                     /locus_tag="MYCTH_2306799"
                     /db_xref="GeneID:11513927"
     mRNA            complement(join(2466658..2467990,2468110..2470157,
                     2470230..2470380,2470445..2470852))
                     /locus_tag="MYCTH_2306799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664170.1"
                     /db_xref="GeneID:11513927"
     CDS             complement(join(2466901..2467990,2468110..2470157,
                     2470230..2470380,2470445..2470509))
                     /locus_tag="MYCTH_2306799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664218.1"
                     /db_xref="GeneID:11513927"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR007419"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2306799"
                     /translation="MAVGTRKRVVVVGLGMVGISFIEKLLKLDARTREYDITVIGEEK
                     HVAYNRVGLTTFFEHRKVENLYLSPLEWYESIQDGALSYHLNTKVTKIDPSRKSVTCA
                     DGREVDYDILVLATGSDAILPRAVPNYDATGVFVYRTVDDLEKLIAFSAHQNGTVGAV
                     VGGGLLGLEAAKALTDLQCYSKVKVIERGKWLLTRQLDSVGGAMVADQVRALGVDVLL
                     DKSVAGIEVDEQHRVTGVKLADGESFACSTICFAIGVRPRDELAREAGLKCADRGGII
                     VDSSLRTSDPDIYAIGECANWEGQVFGLIGPGVEMADVLSFNLTQAKLHQPRLYKQPD
                     LSTKLKLLGVEVASFGDYFADVDGPKLLPPKARRALAAKSATNGANGANGTNGAHSTH
                     GVNGTKPDTSSSPVKALTYRDPFQNVYKKYIFTADGKYLLGGMMIGDTRDYVKLVPMV
                     KNQKELEIPPAELIIGAKKEGDDGDDLDDDTQICSCHNVTKGDIVKVTKDGTCKSIGD
                     IKACTKAGTGCGGCLPLVTSIFNKTMKDMGNEVKNNLCPHFNYSRADLYNIIMVKRLK
                     TIQEVMREAGTDPNSLGCEVCKPCLGSIFASLWNKHVMGKPHHGLQDTNDQFLANIQR
                     NGTYSVVPRMAGGEITPDKLMAIAQVAKEYNLYTKITGGQRIDMFGAKKQDLLDIWKK
                     LVAAGMESGHAYAKALRTVKSCVGTTWCRYGVGDSVGMAVRLEERYKSIRAPHKIKGG
                     VSGCVRECAEAQGKDFGLIATEKGFNVFVGGNGGAKPRHAELLAKDVPPTEVIPILDR
                     YLMFYIRTADRLQRTASWLESLPGGINYLRDVVLNDSLGINASLEAQMQELVDSYFDE
                     WAEAVNSPAIAAKFRQFVNTDETVDNMELETDRHQTRPVMWTKEQATDDFASLRHRWS
                     QTTWQPVLEAAYFRGADDLPNGISATIKRGDTQLAVWRFKGRYYATQQMCPHKRAFIL
                     SDSLLGEDPAGGGDAASEGEGRQRPDPYISCPHHKKNFSLGSGACKNDSALSIATFDA
                     EERDDGMVYLKLPPVQELDAALGTKKWRVKKGEAGPGQFAEVDKRIGFVGQRAKKPGV
                     KTMVNGELGMRKGLELMTAGGGCGGAPDW"
     gene            complement(2472422..2480183)
                     /locus_tag="MYCTH_2306800"
                     /db_xref="GeneID:11513928"
     mRNA            complement(join(2472422..2479029,2479085..2479172,
                     2479233..2479809,2479892..2480183))
                     /locus_tag="MYCTH_2306800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664171.1"
                     /db_xref="GeneID:11513928"
     CDS             complement(join(2472590..2479029,2479085..2479172,
                     2479233..2479809,2479892..2479938))
                     /locus_tag="MYCTH_2306800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664219.1"
                     /db_xref="GeneID:11513928"
                     /db_xref="JGIDB:Spoth2_2306800"
                     /translation="MAVEGATQALIAAFFFGIVLNAASAALVLFVKGYGLSAVFRDSQ
                     RLVLVLFLLSAALWAQTDFITILLDITASNVPCQVGIIFATVFDQLARFSVEQFLLWA
                     LNLDNGAKLSLMQLIPQVLVLARFLAGAVFIGFIRPQTDDFCVATTSALPVGILVTAL
                     DGAIISLLIIRAYSAGGAAKDDQYGKGVTADRARALMAVLLGLVFWTGTSVPMLLGLA
                     TLALATRTALPAGGLLIVIIFVAGGADTLLASRKASSHPPEAPSPRRINISRDVSTSD
                     TDYPPTRFEDLKEAALRSSRTFVNPREAPKVKDETGIMFATEAERIRAMPKTGLVDFG
                     KGKIAISHPILLQNGDQNPATRIALMGLEEAAAAEKERRARALQDESARVGVRAAARS
                     NGMAPEEALKRGISLKRKEVASASIRETLFPGTLPPGEGGAVARTTSAQPSPGGEETR
                     RRSPRPSLQEESAHARPAFPAKAEEALETNPQSRLSRPLTSQQPLLRPNIRPSRTLPP
                     SPPTPPPEPTKTPLQRRPTIGLPSNPRAQGVKVAEEPGSQHRTILFLNNIQYNDPSTV
                     EAIIKTAGNPSSKPSFPAAKPPSPQSVVNRPRPIPRKPADSPAEFSPAFGHRRTRSSG
                     SLMGRKSRLASSPGSPTALPPLPPLPVRSATVASRPHPNNTKSMTVEEKVTLFFPNPP
                     SATASKRRSSVPEVPRVPAFYLGTGTSPTKQQHGQRASNQTTKTSTGSESVSDVEEIQ
                     RRSGKTLLKNAGEAGSAWLRAFGGNDGANSSDESQPKQADGKRGSSPVLPPPAQPRVS
                     AWTETTYDNSDDEGTNWSSINTPEVAIGVPVVRRIGLPASIRMPKRQDTRESQLSHAT
                     DSRSRETLPIMLNASSAQQADAQGSPASEAEAPVATPQLPTWHHRVGDQCPTFSVRKT
                     ETKARKMPPPAPLPLHTISTRKIIAIHQAEPSPLESPAEAIRQIRAQLRKLDDLPQTT
                     PESASRRMELLKDLEREMGQQAEHWEEIKHDMGRDSMSTMQSLSPTVRDSRHTSVASA
                     LDVARASAQRSTDLEHWASQEAQMQRDNNLEALKIPEASVRDSPSPKLSKWQKRLTEA
                     QMDYMDAKLLTASNAAFTQLSKAQLASPTPPDSDDSELPPLPILDEGIPAQQPAEEPT
                     KHVSLWKPAPKVAAAPTGLLWTAPSRPAPEPEAPLPGLSLRPAQRKELPPLQIESRQL
                     WRKPYDTANRTTSGLWRPLWASAAPPAEPLARVSSKSGSASRKPPRPVTQRPPRRNKR
                     VTLLPDILESPEPLPDKRGTLGIFQFPWGEKSDTASIQPRQSMYMAMPGTMTSGGPSG
                     AMAGRTGQWAPTDYSSSFFDEYDNDDDRDVVDMDSYEEDSDDEFDDSTLWEIASLLRT
                     DSVPSRDSLFPPSFEPVVDSDPDELSSDEEEESIFIGLDASLEVLSEQQRDSATLESS
                     TLLVLKDALESKTPPRPAVSVGLPALPKASLDSREVPVTSDSTPTPELSTMARHTTEV
                     QEIKTANEQCSTGLWIPPSPASSPPARDGLFVLGRNPSDYRSTSEEPAALVIRRAPRP
                     VDQRPLERLASTKLWAAEDAVNKRERNWILGEQPMLKARKAWRPHFTREDWQAALREA
                     IQASRPVTRKPRRIAATKAEWEAALQEAVFLSTTRLPFDSSTRHPVFAAASLTARTEL
                     FHPAATGYTYDIAAVHPVFFGSLAITCPQEAVHPAMSAHAEKILLLQQCSETHQSSGS
                     QGYSASHGQTETEEDIRSSDQHQHLQEEKDEGVNEVQTSSYAPSPIPTALESASSYEH
                     DMIQARTEALEQERLFVERAVHKEYRRRTSMAPPAAIVEQQPSMTAEGLAGVEMVQEL
                     QRRLSLRIRQSLVFVHPAPVPVSEEPKETPTAESKEVRAVSPGLREPVRDRQGEQLLL
                     WKPRVPAAMGLSTGLWSANSEHNQPVTAPSVEEDAYAASQRAQRRRTLQKKQRTQEVL
                     AQMPLVDFTGMGLWVSWTQALTTRTMDWLHSACVSGPNGAASTSAQKLWTTPARSVAS
                     SAPNGLWTAPRTTDRPSPGLFLSEDVSAAPQWTIRYHRRRQETSAYVDEVQHGAELWS
                     QKSSSVVSRGLRTKHDWLHSTCVPKATVPEARREKERLWTAPLRSHVTASQTGLWETS
                     TAGGRSPVSSLPEDNNTLACSHGAWSGSPRRQLDMSTQPIEIDLGAAELWTRKNSPAS
                     LGSMDRRDWLHTACLSVSVSASASAPAAPAPASTPSPAPTSGYPSKQLLWTRPSSSSS
                     STTTRSGLSTGLWTAPTTTSARPSVSSSSAAAAMVVDEEDGVAAAARARRRKAMQELQ
                     ELQEMQEVLARIAAVERGVDPSVHFPGMKMWTAPRAAVAADAAAAADEVGSGKAGGRD
                     WLHSLCVRPTEGGRVEVFG"
     gene            <2482298..>2482603
                     /locus_tag="MYCTH_2128027"
                     /db_xref="GeneID:11513929"
     mRNA            join(<2482298..2482364,2482425..>2482603)
                     /locus_tag="MYCTH_2128027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664172.1"
                     /db_xref="GeneID:11513929"
     CDS             join(2482298..2482364,2482425..2482603)
                     /locus_tag="MYCTH_2128027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664220.1"
                     /db_xref="GeneID:11513929"
                     /db_xref="JGIDB:Spoth2_2128027"
                     /translation="MPLRELQYPTEPYSKVNRHKERADYSLETIHQIVNSCPILHVSF
                     QTPDSPFPAVLPMIGKMGSFSRPSADLGEVLDLYLHG"
     gene            2482763..2483455
                     /locus_tag="MYCTH_2306802"
                     /db_xref="GeneID:11513930"
     mRNA            2482763..2483455
                     /locus_tag="MYCTH_2306802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664173.1"
                     /db_xref="GeneID:11513930"
     CDS             2482783..2483382
                     /locus_tag="MYCTH_2306802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664221.1"
                     /db_xref="GeneID:11513930"
                     /db_xref="JGIDB:Spoth2_2306802"
                     /translation="MKTARSAASTETETETGTKMEGGGGGGGGGLPVTVAASHLDGLV
                     LALTPNSHSYNYRSAVLFGHAVPVTDPAEKLYAMELVTDGVVPGRWARTRVPPNAAEM
                     QSTGLLRVRVAAGSAKIRSGGPSDERGDLADEALLDRVWTGVVPVYTVMGEPVPGGYN
                     RVTEVPRYLEEWRVEANKEAEEFAKEAVKKEAAAEKAKE"
     gene            complement(2483457..2485962)
                     /locus_tag="MYCTH_2306804"
                     /db_xref="GeneID:11513931"
     mRNA            complement(join(2483457..2484175,2484287..2484593,
                     2484656..2485962))
                     /locus_tag="MYCTH_2306804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664174.1"
                     /db_xref="GeneID:11513931"
     CDS             complement(join(2483762..2484175,2484287..2484593,
                     2484656..2485752))
                     /locus_tag="MYCTH_2306804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664222.1"
                     /db_xref="GeneID:11513931"
                     /db_xref="JGIDB:Spoth2_2306804"
                     /translation="MAPKKASSSSKKSTTKVPANDSSPTISTATSTSTKESFEADLRA
                     LAAKARNETFANRARAQARIYLWSATLLTLLALSSVVSQLALSPVYGSIPSARWHAKL
                     LMAACFVGWSSNLFLDRTLPFRPEHLLPVIALWTPAVHFFLGSVSSSLTAAWGPLVTE
                     ALTLFPLVGLSAACVATSLDGADLSALPGWLADAAPGLGSYAFFRAAEKVLGGLVQRF
                     VGRSLLTTRTGLEVVLGALYALVAPSKLLLLALPAVLHTALFNTHVPTSTALARLNSG
                     LAETGYVVLDRAESITGYVSVIDSPKEGYRLLRCDHSLLGGEWVKLIGQGRLKGNQVA
                     EPVYSVFAMLEAVRLVKTPEPIVDSEAKALVIGLGVGTTPAALVAHGIDTTVVELDPV
                     VHKFASQYFHLPSNHTAVIEDAVTYTSRQAADEAAPRYDYIIHDVFTGGAEPIALFTY
                     EFLQDLHSLLKPNGVIAINYAGDFALPPPRIVVNTIRSIFPACRIFREHPRDEELFAK
                     SGGDFTNMVIFCTKQAGGKLAFRLPGARDLLNSPSREASLLPRHEVKDADFLAGEAQA
                     GGILRRNETDRLEKWHEVSAAGHWAVMRTVLPDAVWEAW"
     gene            2486293..2487574
                     /locus_tag="MYCTH_2094032"
                     /db_xref="GeneID:11513932"
     mRNA            join(2486293..2486408,2486492..2486531,2486590..2486606,
                     2486667..2487574)
                     /locus_tag="MYCTH_2094032"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664175.1"
                     /db_xref="GeneID:11513932"
     CDS             join(2486342..2486408,2486492..2486531,2486590..2486606,
                     2486667..2487193)
                     /locus_tag="MYCTH_2094032"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664223.1"
                     /db_xref="GeneID:11513932"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="JGIDB:Spoth2_2094032"
                     /translation="MSLPASLSELLEFVDFNQRSFYVSAASIAFNPTFWNIVARREYR
                     TRFLTRAFGGNSQRACYALAITIFSLGLLRDFLYERALRDQPSHPALEGPLAQYAAYA
                     LLGVGNLFVISSTWRLGITGTFLGDYFGILMDDIVTGFPFNITNAPMYYGSTMSFLGS
                     AILYGKPAGILLTLHVLIVYLVAIQFENPFTASIYAKRDKERAKADGKPYESKKEL"
     gene            2491172..2494871
                     /locus_tag="MYCTH_2306810"
                     /db_xref="GeneID:11513933"
     mRNA            join(2491172..2491578,2491640..2492913,2492977..2493215,
                     2493292..2494447,2494547..2494871)
                     /locus_tag="MYCTH_2306810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664176.1"
                     /db_xref="GeneID:11513933"
     CDS             join(2491301..2491578,2491640..2492913,2492977..2493215,
                     2493292..2494447,2494547..2494848)
                     /locus_tag="MYCTH_2306810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664224.1"
                     /db_xref="GeneID:11513933"
                     /db_xref="InterPro:IPR003100"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="InterPro:IPR014811"
                     /db_xref="JGIDB:Spoth2_2306810"
                     /translation="MSDSRGRGYGGGRGGGRGGRGGQAGEGFRGGGGRGGYPGGGRGG
                     GDGYRGGRGGGGGEFRGGRGGRGDFRGGRGGGGRGGRGGYGGSGPDVFLGAGPSIPAP
                     DAAVTELEDRWIEKHGIQSRTTGASELESKMADLSLGTISMPKRPGFGTGGNPVVLWA
                     NYFNVNLKLGAVYRYDLRVISKKLTKEQDDALSKQQESASKKAKGKPKQASGQQPNAP
                     KDAREAKGKKLSEVIKLALDRLPGEPAIATEYKQQLVTTEKLQVPPDGLMQVELAEPG
                     RNPETWYVRFDGPSSINIAGLMDYVRSLEDKNDGVFPKFPEEIDALGIVLGHTARANL
                     NTAAIGSSRFFAIDQARKDQASMPPDSRIEILRGYVQSVRPATGRLLLNTNVTHAVFR
                     KAVKLDELFQKCGLANLHLPQQRPNHALRTLDGLNKFLAKSRIECKVPGERPGEFFKI
                     QRGMAGLATTKDGKDEDQKPEFTESGFRFGTPATVRFYLRKPKDLGAKPPPGLSFDTM
                     VLVSDYYKARYGIRADPGLPLINVGTAGKPIYILAEFCTLLPGQPLKARLSPQEQDAM
                     IRFACRPPPENALSVTTSARELLALDNNMLLDKFGITVDKHLITVKGRELPPPAVGYL
                     RGNSIERVTPENGGWLMKGVKVCKSGRRIANWAFLVIGKARPPIDFGTIKSAVGGFAR
                     FLNNNMGIDMNMQPVPANGYQTAGTSEEDLRNAFRTISKQKPQPEFILVLLPDKDATT
                     YNIVKKLGDVEYGITTVCVRQEMLTKEQGQMGYFANVGLKVNLKFGGINHRVRDETGL
                     VDKTMFVGYDVTHPTNLPGGAGDNAPSLVGLVASVDNSLAQWPAVTWENKSRVEQVGG
                     KTDEGQFIAHFKDRLRLWQKHNSNRLPENIVIFRDGVSEGQFSMVLEKELPNIRQACQ
                     ETYPARPNAQPRLSLIVSVKRHQTRFYPTDRNHIHPRSKSPKEGTVVDRGVTNVRYWD
                     FFLQAHASLQGTARPAHYTVLLDEIFRHKFGPNAADALETLTHNMCYAYGRATKAVSI
                     CPPAYYADLVAARARIHKSELFENVQSLASSEQSSVSRRKVHDRLKDTMYYI"
     gene            2495360..2496460
                     /locus_tag="MYCTH_2315578"
                     /db_xref="GeneID:11513934"
     mRNA            join(2495360..2495889,2496054..2496460)
                     /locus_tag="MYCTH_2315578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664177.1"
                     /db_xref="GeneID:11513934"
     CDS             join(2495585..2495889,2496054..2496132)
                     /locus_tag="MYCTH_2315578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664225.1"
                     /db_xref="GeneID:11513934"
                     /db_xref="JGIDB:Spoth2_2315578"
                     /translation="MSALRPSARLAARIAAASPSSAAGTTTTTTTAVAPARLRHFSTT
                     PRRAGGGGMQYDPPSGWLWGVRPGEKYQNEGWEGPFIYGFWGSLIVFAIAYAWKPDTS
                     IQTWALEEARRRLEAEGILEDPEKK"
     gene            complement(2496455..2498231)
                     /locus_tag="MYCTH_2306813"
                     /db_xref="GeneID:11513935"
     mRNA            complement(join(2496455..2497701,2497817..2498231))
                     /locus_tag="MYCTH_2306813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664178.1"
                     /db_xref="GeneID:11513935"
     CDS             complement(join(2496692..2497701,2497817..2498048))
                     /locus_tag="MYCTH_2306813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664226.1"
                     /db_xref="GeneID:11513935"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="JGIDB:Spoth2_2306813"
                     /translation="MMRRLIPRCAPRATVFLTPRRSPLGLLQAARQYSASPAAAPQTK
                     LQDIDPAQLVLNTTPNPKPLKKPEDLVFGRNFTDHMLTIEWDQATGWQRPHITPYQNL
                     SLDPASCVFHYAFECFEGLKAYKDKEGRVRLFRPDKNMERFNKSAARIALPTFDSAAL
                     IDLIARFAKLESRFIPEERGYSLYLRPTMIGTQKTLGVGPPGSALLFVIASPVGPYYP
                     TGFKAVSLEATDYAVRAWPGGVGDKKLGANYAPCIVPQREAMSRGFQQNLWLFGEDEY
                     VTEVGTMNFFAAVRNKQTGRKELLTAPLDGTILEGVTRDSVLSLARERLAPEGWDIIE
                     RKFTMRELDEAAAEGRLIEAFGAGTAAIVSPVRAISWRGKLVNCGLKDHEESGEIATK
                     MKNWIEARQYGDDAHEWSYVC"
     gene            <2499241..2502548
                     /locus_tag="MYCTH_116348"
                     /db_xref="GeneID:11513936"
     mRNA            join(<2499241..2499840,2499924..2500761,2500849..2502548)
                     /locus_tag="MYCTH_116348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664179.1"
                     /db_xref="GeneID:11513936"
     CDS             join(2499241..2499840,2499924..2500761,2500849..2502485)
                     /locus_tag="MYCTH_116348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664227.1"
                     /db_xref="GeneID:11513936"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_116348"
                     /translation="MFANALKSISSTNISSNYAISPNLTSTAGPWKIYPAKNKKTGKE
                     CSVFVFDKKSLDVHRSGMNRAEVAEFKKAVEAVVERLKKEASAIAKLRHPGILEVVEP
                     VEETRGGGLQFVAEAVTASLSGLLQEKDDQERRGAGARASRYVTEDADGNRRRREIEI
                     DELEIQKGLLQVSKALEFLHENAGIVHGNLTPDAILINAKSDWKLSGLAFCGPVDNST
                     SHSSIQPINLRELLRHTPTLPRTVQLNLDYTSPDFVMDNNLTAPADMFSLGLLIISLY
                     NSPHKSPLSCNGSLSAYQRLFQSSQTTPSSSNNFLSSRPLPKELTNHVLPRLITRRPA
                     QRMTASEFQQSEFFNNILVSTIRFLDTFPAKTPNEKSQFLRGLIKVLPSFPKSVMEKK
                     LLPALLDELKDKELVSLILHNVFKIIELLPSGRRAFNDRVRPRLKEIFVTNTKQTQEK
                     DPVRDAGLMVVIEQLAIIGENCGGKEFKDDILPIIFSALESSTPSLVDAALRSLPSVL
                     PQLDFSTIKNELFPVIATIFSRTNSLAIKVRGLQAFVTLCGGSNDPDGDDGLDGLGPQ
                     KKKATSSTALDKFTMQEKIVPLIKAIKTKEPAVMMAALKVLQVVGRVADADFVALDIL
                     PVLWSMSLGPLLDLKQFQAFMELIKSLSSRVEEEQTRKLQELAGGNANGSALKDDFMS
                     FGPVAGSSFDGNGPTEADFESLVKGGTGGVSANPLDSGWESMGSSAAVTSPTGSSRKS
                     TPTVAFSWSTPPATSPGASADKLGAGKAQQAGFRSVTPDLSSFQPMAPMTTQFSQPLQ
                     PTPKTSTLSPASPTPQTTSINWGAATSTTTAASSSSNTNTNSLWSSPPATQQQQQQQQ
                     PPTSAFASLSLGQQQQQQQQNQNRASSFSLPPPPSAGNSGATSSLSSFSLAPPPGASK
                     PAFSGLGGINSLNSLNSLGSLSATANKTASSGSSMGSGMGMGMGMGTMNAALQATTTG
                     NSTSMNSMMGMGMGMSGLAQQQQQQQQSQWQGQGQGQGQSQKTGLDKYESLL"
     gene            complement(<2503800..>2505406)
                     /locus_tag="MYCTH_10995"
                     /db_xref="GeneID:11513937"
     mRNA            complement(join(<2503800..2505052,2505142..>2505406))
                     /locus_tag="MYCTH_10995"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664180.1"
                     /db_xref="GeneID:11513937"
     CDS             complement(join(<2503800..2505052,2505142..>2505406))
                     /locus_tag="MYCTH_10995"
                     /note="Contains conserved domain SIR2-fam[cd01407], SIR2
                     family of proteins includes silent information regulator
                     2, PRK14138[PRK14138], NAD-dependent deacetylase and
                     DUF592[pfam04574]."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664228.1"
                     /db_xref="GeneID:11513937"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="JGIDB:Spoth2_10995"
                     /translation="SSKNNSSGNGATTTRKPSTRVKNVVDYDEKRAFVELGSEEVDGE
                     QNDVSNPGLNELEERVNDLSESWETESLFQDALEDLAEDRFFTDDPEACTPDEATKFR
                     QLLRSVGPAIFCERTIGSGLITAKKLLTAFGIRPPAFLEGADDEAYYSLLSLALSREL
                     SKRAKLPKYNTIDDAVELLKNSNNIIVLTGAGISTSLGIPDFRSKGTGLYSKLEHLGL
                     NDPQEVFDIAVFRQDPTIFYSVARDILPSHDRFSPTHAFIALLQEKGKLLTNYSQNID
                     NLEAKAGIRPDKLVQCHGSFATASCVKCGHKVPGESLFPEIKAGEIPRCRKCAQGNRT
                     TTNSSGGSRKRKVQRDGTDKKPRRRPGDYDSNSDSEFDSSMTTPTNWTWCGVMKPDIT
                     FFGEPLPDEFSRRLTEHDRDLVDLVIVIGTSLKVAPVSEVVPFLPPHIPQIYISRTPV
                     SHVNFDIDLLGDCDVVVAELCRRAGWELKHEMIPEGQVVETKLAEGWSSRHIFTQV"
     gene            complement(2507687..2512611)
                     /locus_tag="MYCTH_2306817"
                     /db_xref="GeneID:11513938"
     mRNA            complement(join(2507687..2508722,2508814..2512134,
                     2512267..2512611))
                     /locus_tag="MYCTH_2306817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664181.1"
                     /db_xref="GeneID:11513938"
     CDS             complement(join(2507813..2508722,2508814..2512134,
                     2512267..2512325))
                     /locus_tag="MYCTH_2306817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664229.1"
                     /db_xref="GeneID:11513938"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2306817"
                     /translation="MASSGQDTKDESAPSRRTRAPTINIDTTAVSPSPAALETDAEAG
                     TQAASTPTAAHSSPTDPSSSSHKRSLSQTRPEVQAAKASDARDSRPTSPHNVLSPFSF
                     RGPGPNQGFLAVPNAQRSRQNSLNSTDDARSVASSQDVTVIGGGSSTGEKSTSPFGDR
                     SDNYQIMNDKDALKPDQGKEADFVVEDNPFAFSPGMLGKMFDPKSLSAFYKLGGLAGI
                     ETGLRTNRTTGLSADETALTGTVSFEEATSRPPEKALTEAVSPPSPDHHRKPDPNEPF
                     SSRKRVFRDNRLPVKKGKNLFQLMWITYNDKVLILLSIAAVVSLAIGLYQTFGQEHKA
                     DDPAVEWIEGLAIIVAIFIVVMVGSLNDYQKERQFARLNKKKQDRLVKAVRSGKTVEI
                     SVFDILAGDVLLLEPGDMVPVDGILIEGFDVKCDESQATGESDIIRKRPADEVYAAIE
                     NNENLKRMDPFIQSGSRVMQGAGKFMVTSTGIHSSYGKTMMSLNEDPEVTPLQSKLNV
                     IAEYIAKLGGAVALLLFLVLFIIFCVRLTRQYASMTPAEKGQQFIEIFIVVVTIVVVA
                     IPEGLPLAVTLALAFATTRMLKDNNLVRHLKACEVMGNATTICSDKTGTLTQNKMQVV
                     AGTIGTTHRFGATTAPGEPVSPEKEVGIRELVSTLSPEVKDLVLKSIALNSTAFEGEA
                     DGERTFIGSKTETALLILAREHLAMGPVSEERANAKTLHLIPFDSGRKCMGVVVQLEN
                     GKARLYVKGASEIMLEKCAQILRDPSSGLASTTLTEDNREMIKKLIEMYARNSLRTIG
                     IIYRDFDRWPPRQTRRLGAEKDEIVFEDICRNMTFIGMVGIKDPLRPGVREAVRDCQK
                     AGVVVRMVTGDNRMTAEAIAADCGILQPNSVVLEGPEFRNMSKAQQDEIIPRLHVLAR
                     SSPEDKRILVKRLKDKGETVAVTGDGTNDAPALKMADIGFSMGIAGTEVAKEASAIIL
                     MDDNFNSIVKALKWGRAVNDAVKRFLQFQLTVNVTAVVLTFVSAVQSDDQVSVLTAVQ
                     LLWVNLIMDTLAALALATDPPSDSVLNRKPERKGASIISITMWKMILGQAVWQLLITF
                     LIYFGGVSILPGPDDMTEGQIHTLVFNTFVWMQIFNQWNNRRLDNEFNIFEGMNKNPY
                     FIGISAIMCGGQVLIVMVGGTAFRIEHQTAVMWGIAIVLGVLSIPVGVIIRLIPDDLI
                     EKLIPSSWKRRGDSKVPPVTVSDDDERFSAYPEPLAEVREELAWLKRVKGGRLNNLKF
                     AMQHPRETFMPWRSPVPSREHSRSNSIHRLPQTPTRADSFSSVAAPTPDSRRRSRSMR
                     SRSNSALGAPTVMAGIVAGSIAAGWSPIDRRGEPDFGQFPRPSLSVQESTNESQPAAS
                     RSVLGDVVLSDEPQEIGEGPSEKPAAAAGSGHVPILSVPKPRSPATPKPAE"
     gene            complement(2517371..2520869)
                     /locus_tag="MYCTH_2306820"
                     /db_xref="GeneID:11513939"
     mRNA            complement(join(2517371..2519136,2519409..2519474,
                     2519546..2520869))
                     /locus_tag="MYCTH_2306820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664182.1"
                     /db_xref="GeneID:11513939"
     CDS             complement(join(2517507..2519136,2519409..2519474,
                     2519546..2520630))
                     /locus_tag="MYCTH_2306820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664230.1"
                     /db_xref="GeneID:11513939"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="JGIDB:Spoth2_2306820"
                     /translation="MHILVVNDDGPPSPHSSPYVHSLVRELQAHGHTVSVCLPHTQRS
                     WIGKAHIIGQTVKPLYYRPPPPSAPAAGLMHEDDEEGESATITTTTTTTTNNNTNNTN
                     NTNNTPEQKQGQQGKLQQPPRHGTTHARPSTRPGTEEWILVDGTPASCVQIGLYHFFR
                     DRGPVDLVVSGPNYGRNTTAVFALSSGTLGGALEA