GenomeNet

Database: RefSeq
Entry: NC_016476
LinkDB: NC_016476
Original site: NC_016476 
LOCUS       NC_016476            4342007 bp    DNA     linear   CON 28-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 5, complete
            sequence.
ACCESSION   NC_016476
VERSION     NC_016476.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 4342007)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4342007)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4342007)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4342007)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003006.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4342007
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="5"
     gene            complement(<6643..>8397)
                     /locus_tag="MYCTH_103794"
                     /db_xref="GeneID:11511468"
     mRNA            complement(join(<6643..8241,8302..>8397))
                     /locus_tag="MYCTH_103794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664680.1"
                     /db_xref="GeneID:11511468"
     CDS             complement(join(6643..8241,8302..8397))
                     /locus_tag="MYCTH_103794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664728.1"
                     /db_xref="GeneID:11511468"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_103794"
                     /translation="MDPRPSGGWDSESTAGFTTTSSHLVLGREDHTDKAPAERASEPE
                     GWVRGAGFWRCFVGLCFPILLSAFEGSVVSTALPTISRSLGLGPNSSWVATAFLLASI
                     VFQPLFGQLADIWGRRHLMMAAVAIFGAGSAIAGYANSCAVLLCGRIVQGIGSGGIDL
                     FAELILCDIIPLKKRGHYVAIKAAVYALGTTIGPLLGGVFAQTNWRWCFGVNLPVCVL
                     ALVLMWFWLRLSSGNSWKGLSVLQQISQVDYVGILLLTAAVVLILCALSLAGTVYAWS
                     DPTIVAFLAGGVAGIAVFVFWERSRRCTRPIMAPHVFSNRTTIAAMTITAVHGFITYG
                     FQFYLPPFFQAVLRASPSQSGVLILPCSLTIVVLAAVGGPLLARFGKYRLMHLAGFAL
                     MGAGLLPSIPLEESRSVVLWISLSFLVGVGSGIIVSTTLPAVLVELTDKENAAATGSW
                     AFLRGLGSLLGVAVPNAVFNAQFSASLRSIDDAVVRAELSNGQAYEHASGTFIAGLDA
                     TVRQQVLGAFTASFRFVWIIFLAFALVGFVSALLERQVQLRRDLDSEYGLKERVRI"
     gene            <10143..>10514
                     /locus_tag="MYCTH_2045420"
                     /db_xref="GeneID:11506474"
     mRNA            <10143..>10514
                     /locus_tag="MYCTH_2045420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664681.1"
                     /db_xref="GeneID:11506474"
     CDS             <10143..>10514
                     /locus_tag="MYCTH_2045420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664729.1"
                     /db_xref="GeneID:11506474"
                     /db_xref="JGIDB:Spoth2_2045420"
                     /translation="KCGDTICQAGLTCCNPSCGICVKPGMKCTMQACTKSSPAPPVVT
                     PREDDKTTQCGPARCKEGTECCNESCGICVEPGNGCTKQLCLPAGEVCGNKVCAEGLV
                     CCNESCGLCAPPDGGCTMQLCL"
     gene            complement(10659..12006)
                     /locus_tag="MYCTH_2307834"
                     /db_xref="GeneID:11506475"
     mRNA            complement(join(10659..10977,11052..12006))
                     /locus_tag="MYCTH_2307834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664682.1"
                     /db_xref="GeneID:11506475"
     CDS             complement(join(10788..10977,11052..11911))
                     /locus_tag="MYCTH_2307834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664730.1"
                     /db_xref="GeneID:11506475"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="JGIDB:Spoth2_2307834"
                     /translation="MDPPLQRSCLTRHPVAFASCSIGLPRHTLHQKIEAIKEAGFDGI
                     ELSFPDLQAFASRHFGRDIAEDDYRSLCEAGKAVGTMCAGHGLRVLVLQPFSNFEGWP
                     ERSEERREAFARAEAWIDIMAAVGTDMLQVGSSDLPAMSRDPDQIAADLARLADMLAA
                     RGFRLAYENWCWATCAPTWKDVWAIVQKADRPNIGLCLDTFQTAGAEWGDPTTASGRI
                     ETGGVTAEELSQRYAASLAELARTVPADKIYFLQISDAYRLDPPLDPTPSSTSGLRPR
                     GQWSHEHRPLPYDGGYLPIKECVRAVLATGFSGWMTIEVFDGRFEHKYGDDMRRFAKK
                     AKQAYERLLKEARAG"
     gene            complement(13302..15034)
                     /locus_tag="MYCTH_2307835"
                     /db_xref="GeneID:11506476"
     mRNA            complement(join(13302..14300,14371..15034))
                     /locus_tag="MYCTH_2307835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664683.1"
                     /db_xref="GeneID:11506476"
     CDS             complement(join(13617..14300,14371..14667))
                     /locus_tag="MYCTH_2307835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664731.1"
                     /db_xref="GeneID:11506476"
                     /db_xref="JGIDB:Spoth2_2307835"
                     /translation="MAAAVAVPLSTINSELGGVLPPSAVVQHSPRHGRSRAMSMKGKG
                     GRQRGYSVVEDRDVTIAKALMFVVKRAIQKEDVEEGDEGEYLVADPEGWVSVADVLAH
                     SRLSALGATFDDIRRVIANAPKPRFDLRKASNADAEPEEPAAWQVSRITHKETTASPV
                     PVGDKLTADSPDLPEFVIYETSYQRYPLLLALGAITRAPGGSEYRAFVPVTVDEEGNE
                     SRQHAGAGDAAEISIWIHLRTALQAEPSIAWRRSESGAIVTVDDVPKSLWNKAIARRP
                     EIGILFEDGEVRKEVPANLRGKGAKGKTRKGKGALKQEGSGDDSGSASEE"
     gene            16173..17161
                     /locus_tag="MYCTH_2307838"
                     /db_xref="GeneID:11506477"
     mRNA            16173..17161
                     /locus_tag="MYCTH_2307838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664684.1"
                     /db_xref="GeneID:11506477"
     CDS             16309..16899
                     /locus_tag="MYCTH_2307838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664732.1"
                     /db_xref="GeneID:11506477"
                     /db_xref="JGIDB:Spoth2_2307838"
                     /translation="MPDFEKQSYWHERFASERAFEWLTPSSTVMDILTPYLAGLNASI
                     RILHLGSGTSDLHNHLRERGFLNVTNVDYEPLALERGRQLEQDRFGDVQTQYLLADAT
                     RLNLSDKYQLVIDKGTADAIACGEEDALLSMARSVRRFLDESGFWVSLSYSSQRFDEE
                     IQSIFSVEVISKIPTPKHKPTDPDIFHHCYLLRPRG"
     gene            18032..20936
                     /locus_tag="MYCTH_2307840"
                     /db_xref="GeneID:11506478"
     mRNA            join(18032..18893,18978..20936)
                     /locus_tag="MYCTH_2307840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664685.1"
                     /db_xref="GeneID:11506478"
     CDS             join(18493..18893,18978..20658)
                     /locus_tag="MYCTH_2307840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664733.1"
                     /db_xref="GeneID:11506478"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="JGIDB:Spoth2_2307840"
                     /translation="MDGSVSAACSAASEAVARTLLAVNRFVREVRESRSEFDGITTEL
                     HSLDGVLDLLGYDAAFIPPSLAEHTPAVLETCLALLNELEGCISLLNRPDVPRPEKRS
                     RWLASRKHVDTLRWTLSEYKLVLGLAADLVGVTKSRATDAADRGTPDDEQARGGDGAE
                     DNGLAIVTARITEVANELKDDLEQSVAMARLGHYLDMLRAETGVEPRSPVPAQRDDRR
                     PHRTSSMGGPPDSAIDVSYDDVPFRSGKQRRPTQSTSFLADPWEEEEEDGDEFVGELN
                     EMPARVPPVPPRSASRMSCAMPSRPPAQHRPSTADTYCDPRPSPTPSWPSTPRMSTST
                     SSSSDVSYGTSQEPYYTPVTELPERAAPNPRFRPEARTTHSRRGSALGQVLESVWEHP
                     QHDASPTSAPAGVPAGVLAGAGSETPPSGRQSSLFRRRSSKLSTTFRMFGRKRSSSAK
                     GDAATVGDEAAAQVPNAVFGVPLANSIQVAKGVAGTRHGTGGSSSHATRDYPLCVLRC
                     VYHIRDCGLHVPHVFGGLEDQDRLAELKAVFSSPETSYGKELDWSQFTVHEAAALILV
                     FLSELPRPLISESVAKRWVSLSRQAAVGGVRLDQGIDFWEEALLGVQGHARALFKLLL
                     NLWGDLADAAPVNEMTAERLAARVIRPLMHTIPARHHTDFMLGLAFLIRKRSEYNLAA
                     NGVARKSNAAF"
     gene            complement(21499..22397)
                     /locus_tag="MYCTH_2307841"
                     /db_xref="GeneID:11506479"
     mRNA            complement(21499..22397)
                     /locus_tag="MYCTH_2307841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664686.1"
                     /db_xref="GeneID:11506479"
     CDS             complement(21776..22393)
                     /locus_tag="MYCTH_2307841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664734.1"
                     /db_xref="GeneID:11506479"
                     /db_xref="InterPro:IPR009959"
                     /db_xref="JGIDB:Spoth2_2307841"
                     /translation="MARLRVNTLVTEGPCLPSAARKHSEYARHMVAHFADGKISHLYD
                     ISDADEKQNLSQRIVPLPSPRPPPPPPRTSVDLRRFYADYISCINDGRIAEELHRFCS
                     PSGVVWNGTHYTVQQYGEMIQSSREAISGLFFDTHTLVVDGSRQQLAARLEFTGTPVK
                     PLAGGVPNGRPVAFAEHVFYWLEGGKISDVLTIVDWDDYRSQLAR"
     gene            23780..25194
                     /locus_tag="MYCTH_2307842"
                     /db_xref="GeneID:11506480"
     mRNA            23780..25194
                     /locus_tag="MYCTH_2307842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664687.1"
                     /db_xref="GeneID:11506480"
     CDS             24011..25153
                     /locus_tag="MYCTH_2307842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664735.1"
                     /db_xref="GeneID:11506480"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="JGIDB:Spoth2_2307842"
                     /translation="MEEGRLHSLTFRDRLATEYRWTVAPLIVGAPMRVMSGPELAVAV
                     SRAGGLGFIGPGLKPESTAADLETAKGLLLASSSSSSSSSSSPPPLASDSSDSFSYGI
                     PQRDGVLPVGVGFQLWNGDVDVAAAAVARYRPAAAWLFAPRHGQPDVDAWTRRLREAS
                     PETRVWLQVGTLREALDAARSASPPDVLVVQGAEAGGHGRASDGTGFVTLLPEIADAT
                     RDSGIPLIAAGGVADGRGVAAALAVGAAGVAMGTRFLASHEARISKGYQDEVVRAADG
                     GANTVRTHLYNHLRGTFGWPEQFSPRTIINRSWAEHQAGTPFQEIKKRHDEAVSKGDA
                     AWGPDGWTATYAGANIGLIRSVAAAGDIVREVRSEAVRIIQTLSGL"
     gene            complement(25195..26355)
                     /locus_tag="MYCTH_2307844"
                     /db_xref="GeneID:11506481"
     mRNA            complement(join(25195..26256,26319..26355))
                     /locus_tag="MYCTH_2307844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664688.1"
                     /db_xref="GeneID:11506481"
     CDS             complement(25236..26201)
                     /locus_tag="MYCTH_2307844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664736.1"
                     /db_xref="GeneID:11506481"
                     /db_xref="JGIDB:Spoth2_2307844"
                     /translation="MAPRRPQRRAIRTAVDPALPTPDQSTETTPVSSAFPSAYPSEAE
                     NESDAEEGILSAPMTPPATGAVVPQTPPKKRRIPEKPFRFLDLPSELRVEIYALHFEG
                     IDQVVDLDSDNYKRVHKKLAIFRTCRTIYHEASHVFYSTHTFRIFPTQPGRFFKTKKP
                     LLARLNTNQRRSITSLELRLGPGWNRPPRGWVVNAALGLSECVNVRQLTVFVECDPSD
                     SVFKGFRKADGFYETFSRNLLDDVLAEMPFLDRVHFDAWSSVKKTGAMMTGLLEVARA
                     RGRKICWGPERGWSEDEEEDEGGQRDQHEQTMAQLQAAMAFLGTT"
     gene            26995..28973
                     /locus_tag="MYCTH_2307846"
                     /db_xref="GeneID:11506482"
     mRNA            join(26995..28158,28227..28973)
                     /locus_tag="MYCTH_2307846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664689.1"
                     /db_xref="GeneID:11506482"
     CDS             join(27154..28158,28227..28862)
                     /locus_tag="MYCTH_2307846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664737.1"
                     /db_xref="GeneID:11506482"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="JGIDB:Spoth2_2307846"
                     /translation="MLSRAAARSAATLRAVTLAGPSAFRPQSVPATIWSRGMAKNSKP
                     QPPRFASSPNTSAQKPSQPPPSSAASPSASQPVSEPPKEQAAERASEPGTPREPATEE
                     PIPDLSKLPDLTQGIPSTLEYETSGATDKAALAAVEQQEEPPKTGGRGGRGKGELPAS
                     AYVSSTERRRQKMATWAFIFAGVSAVVGVAYLGRDWDEEELAKNPEIPNGWGIGLWWK
                     RAMARMGRTVTYYQEPAFEKLLPDPDPSFARPYTLCISLEDMLVHSEWSREHGWRVAK
                     RPGVDYFLHYLSQYYEIVLFTTVPFATGEPLVRKLDPYRFIMWPLFREATKYQDGEIV
                     KDLSYLNRDLSKVIIIDTDPKHVRAQPENAIILPKWTGDPKDKELVSLVPFLEFIHTM
                     QYNDVRKVIKSFEGHHIPTEFARREALARAEHNKRLQAKSRGGGMSWLSSHLGLKPSN
                     MSLMVAPEGEENPQEAFAKGKMLQDIARERGLRNYLMMEEEIRKNGEKWLKEEQEAME
                     KAQKEAMKSMKSSFFGWFTPAEDKKENTGASAGQTKSN"
     gene            <29860..>30642
                     /locus_tag="MYCTH_2128552"
                     /db_xref="GeneID:11506561"
     mRNA            <29860..>30642
                     /locus_tag="MYCTH_2128552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664690.1"
                     /db_xref="GeneID:11506561"
     CDS             29860..30642
                     /locus_tag="MYCTH_2128552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664738.1"
                     /db_xref="GeneID:11506561"
                     /db_xref="JGIDB:Spoth2_2128552"
                     /translation="MKLTRAMLTAALAAGAASALPRLTSGADYSNAKEPSKESLGVTL
                     AANEKRSQHYSDPRMELGSSDCIQTVPSTRRDYQGAEPGSQNAESPGFGQDFNAMPAD
                     LNTRDDSQMPSSADNEMLSVHQTATEDERHGTADGVSSSRRVNNFAVMARNVFKEAFG
                     LSRDQQRTGAQQDARQSEQAEQAAEKRNDENATARNQEDARRGTRHSNAMPQNSFSLT
                     RSRVGRAGTDITMEDAQRGTEQGEYREEEHSEQQQQQQQQQA"
     gene            complement(31131..33203)
                     /locus_tag="MYCTH_2307847"
                     /db_xref="GeneID:11506562"
     mRNA            complement(31131..33203)
                     /locus_tag="MYCTH_2307847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664691.1"
                     /db_xref="GeneID:11506562"
     CDS             complement(31284..33059)
                     /locus_tag="MYCTH_2307847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664739.1"
                     /db_xref="GeneID:11506562"
                     /db_xref="JGIDB:Spoth2_2307847"
                     /translation="MTRLIPTAILRNVLRYLIPLSIALTLYLYLYPVFNTCAFPLPPD
                     PSSASVSADTGRAAFVETAKVHWHTAAGTADHPTIFIPSRPPAPFRLLALGDPQLEGD
                     TSIPTDYLGVFPHAKSLFRHATFRSRHSSLRQRIRQSFHDLVDIVFEDTFNALESLRK
                     RIDLVGNDLYLAHIYRTVRWWSRPTHVTVLGDLLGSQWINNEEFYRRAGRYWNRVFRG
                     AERVPDDVAAYPAEEYDLAGRLGGGPFNESTAWVRRVINVAGNHDIGYAGDLNDERAE
                     RFERAFGKLNYELRFELPLTNASLAGTNFDADPSSTRLVPELRIIVLNDMNLDTPVIS
                     TKLQDETYAFVNKVISTSAAVEFKGHFTVILTHIPLYKPVGVCVDDPFFDFHQHDGSL
                     REQNQLSVPASKGFLEGILGMSGDVKAAGRGRGRPGIILNGHDHEGCDTWHYINQSVA
                     DPEQRSWEVKRWRQAKTAGIVGRDELPGVREVTVRSMMGGFGGNAGLLSIWFDEASWE
                     WRTEYATCPLGTQHLWWLVHILDLIVLAAILLLAVAAFLSASGLNVDRAVQESAAKLS
                     TPQKKLARPNTPAKRSALAKGGGSG"
     gene            complement(33502..37094)
                     /locus_tag="MYCTH_2307849"
                     /db_xref="GeneID:11506563"
     mRNA            complement(join(33502..34778,34838..35909,35963..36685,
                     36766..37094))
                     /locus_tag="MYCTH_2307849"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664692.1"
                     /db_xref="GeneID:11506563"
     CDS             complement(join(33982..34778,34838..35909,35963..36685,
                     36766..36948))
                     /locus_tag="MYCTH_2307849"
                     /note="Contains conserved domains Zn_clus[pfam00172],
                     Fungal Zn(2)-Cys(6) binuclear cluster domain and
                     Fungal_trans[pfam04082], Fungal specific transcription
                     factor domain."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664740.1"
                     /db_xref="GeneID:11506563"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2307849"
                     /translation="MPQPRPPKRPSDAGDGSADSAAPAPKVKLARLERRPEEFSNVVK
                     SKLQSYTRTGQACDRCKVRKIRCDALPEGCSHCATQNLECYVTDRVTGRTERRGYLQQ
                     LEREKGAMLVHIRELEKLLENHGVEVRPWQWPGYTTTYPPGVSFDHLGNPVQDPSSKE
                     QWQQVGLVWVKNSQKKSQNNSSAQPPWSTLASRPKDSYLGVSSDSAPLSSIKGTTLSI
                     LGTNIDITCFDAPDMDEPAPGTPIGSPLYNKSVMAYLQSALNINPPLTNVELPPKMEA
                     FRYAEWYFLMIHPFLPILHKPSFMQLLTRIYDDPTFKPTVPELVIVHMVLATIYFQYG
                     VRNREEPEKHAQLNDLSNKHYHWSLSKFFDLAISQSVTAVQALAMIASHTRNFPKPEC
                     SLAVSSYAFGRAIEMNLHRAAEIPAGGTTLENEVRKRVWWAIVAILCTLNGRLGRPMP
                     ISVEEFDVEFPIAIDDEFIGEEGILDPSKIGHCSYHAGLMGFKITPLFIEMYSKLYSV
                     RRDPSKYVQVVTQLEEALRNLLDELPDELRVEKCQPGNRVFALYTQAFCLEFTLCLRH
                     PSVCLTDDPKICAENTRICEDAARELLKVVGSLYKLKSLDTTWYQQSVYIAAMFSVLV
                     AHWQRRFETTAVEVAALREDMSLWLGIIREIGRLQGIGDRLAIEISGIIERTISWIEQ
                     DMGRKPGSPAGEASVKKQPDSYPTSAKPKQQVEDPGNPLLPASVGTVGSSEQRSAGTT
                     NGNTYYDGGVAGSTAPYPPLGYGDQANGGAALNNNGNGTVDSADGTQYLYAAASAATA
                     AAGPNHTGAMDQAAAAQNPLVAFASQATQHVAGQTADSWPAQTSLMGHPAAPANPWHD
                     WTNAIQDTQERYSANALLTLNSGRPGDAGTGTGAVVDHVGQGDAMTNAHTGQWPLLLF
                     HDGSGNVSGP"
     gene            37728..38616
                     /locus_tag="MYCTH_2307850"
                     /db_xref="GeneID:11506564"
     mRNA            join(37728..38120,38176..38616)
                     /locus_tag="MYCTH_2307850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664693.1"
                     /db_xref="GeneID:11506564"
     CDS             join(37845..38120,38176..38508)
                     /locus_tag="MYCTH_2307850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664741.1"
                     /db_xref="GeneID:11506564"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="JGIDB:Spoth2_2307850"
                     /translation="MALEKLELEHVPSSCQIYAAFFRDVSNADFLHAQLLSRNSEFKY
                     AFIDASSVISRLHLLSAIYSAVNVLLDGSLRTPNVHSEIVVSFNANNNIADAYRRWGI
                     TPGKTKDLIVVKVVPPSNAQDGDSAPIQTQQAIWDHLSQHVHGKPTPLTDAELAQTTD
                     WPKVRKYYRLNGVPALDRISDEQEKRKQSERLALMGMALRGL"
     gene            complement(38699..40523)
                     /locus_tag="MYCTH_2315754"
                     /db_xref="GeneID:11506565"
     mRNA            complement(join(38699..38986,39052..40523))
                     /locus_tag="MYCTH_2315754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664694.1"
                     /db_xref="GeneID:11506565"
     CDS             complement(39056..40324)
                     /locus_tag="MYCTH_2315754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664742.1"
                     /db_xref="GeneID:11506565"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="JGIDB:Spoth2_2315754"
                     /translation="MGRPAPLAVLPLANVLRSLMTTTVSSSPLLLPPSLAVMSALANT
                     TRPLLNPDRNPILRFFLKKTFYAQFCAGENAAEVRRTIESLKGIGFAGVILGHAREVV
                     LSEAQMKDLMSCSSGAVADECVRNEITPWAKGTMETVMLASPGDFVALKLTGAGRQAL
                     YALSKRLPPSEALSSAIDAICRLAADRGVRLLFDAEQQALQPGIDDWSLEYMRKFNTA
                     DSAVVYGTYQAYLKATPSTLSRHLAAAREGGFALGVKLVRGAYLGSDPRHLIHDTKAD
                     TDMAYDGLAEALLRRRWNDQLRPQSESDEDAAFPNVGVVLATHNRESVLRAQAILSEG
                     SADCVDVAFAQLQGMADEVSCELVTKGAGDKTPRAYKYLVWGSTGECMKYLLRRAHEN
                     RDAVQRTRAGRDAMRAELMRRVKKAFGLST"
     gene            complement(41455..42367)
                     /locus_tag="MYCTH_2307854"
                     /db_xref="GeneID:11506566"
     mRNA            complement(join(41455..41694,41762..42367))
                     /locus_tag="MYCTH_2307854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664695.1"
                     /db_xref="GeneID:11506566"
     CDS             complement(join(41519..41694,41762..42212))
                     /locus_tag="MYCTH_2307854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664743.1"
                     /db_xref="GeneID:11506566"
                     /db_xref="JGIDB:Spoth2_2307854"
                     /translation="MAATDDDEASHARRNQPPPLSRAEVDQLYRNARLSLPAPLRIPM
                     ASVLSFLAGFTLGTANGGKMAGLQFRAEHAHKLPTTTTGWYLYHKSKNYHMAYGGIRE
                     GLRMGLRVSFWTTAMFGIEQMFDSYRGTADMLNTITSCVTVAGGFSLWNRFSLPMTAR
                     TTKAALVAGFVYGGLQDILGIVRGRPIRYVDWVRQRLGYPRREDPKMQ"
     gene            42470..43402
                     /locus_tag="MYCTH_2082040"
                     /db_xref="GeneID:11506567"
     mRNA            join(42470..42569,42654..43402)
                     /locus_tag="MYCTH_2082040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664696.1"
                     /db_xref="GeneID:11506567"
     CDS             join(42567..42569,42654..43076)
                     /locus_tag="MYCTH_2082040"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664744.1"
                     /db_xref="GeneID:11506567"
                     /db_xref="JGIDB:Spoth2_2082040"
                     /translation="MPPNAKTVEDPELTVRLKYGMHTIFLIAMADWSFSRLTAELLSI
                     LRDRYPNGLNTSTNPAESQVTPVPANDSDVKVAYALPKNPNDLNQGWRTIKATETDTI
                     GKKGLTDMCSVAFTFLEPDADEASAQFVVEVPIIEEEEE"
     gene            43598..43684
                     /locus_tag="MYCTH_t131"
                     /db_xref="GeneID:11506568"
     tRNA            43598..43684
                     /locus_tag="MYCTH_t131"
                     /product="tRNA-Gln"
                     /note="Anticodon: TTG"
                     /anticodon=(pos:43631..43633,aa:Gln,seq:ttg)
                     /db_xref="GeneID:11506568"
     gene            complement(<44287..>45614)
                     /locus_tag="MYCTH_2065797"
                     /db_xref="GeneID:11511472"
     mRNA            complement(join(<44287..44798,44873..>45614))
                     /locus_tag="MYCTH_2065797"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664697.1"
                     /db_xref="GeneID:11511472"
     CDS             complement(join(44287..44798,44873..45614))
                     /locus_tag="MYCTH_2065797"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664745.1"
                     /db_xref="GeneID:11511472"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2065797"
                     /translation="MHLTPALVAATCAVEVCAGVLPRSSSTPTTFGSGTLSLKQVRNP
                     NFVRNGPVQLARIYHKYGVPLPHDLREAVARFRAEIRKRSNGSTETNPETNDVEYLTP
                     VSIGTPPQVLNLDFDTGSSDLWVFSSETRSSDVQGQTIYDPNESSTAQKLQGYSWQIS
                     YGDGSSSSGDVYTDAVTVGGLTVPSQAVEVARRVSDEFTSDPNNDGLLGLGFSSINTV
                     QPVPQKTFFDNAKADLDAPIFTADLKASAPGFFNFGYIDHGAYTGEITYMPVDSSDGF
                     WAWTSPGYAVGSGSFKRTTIQGIADTGTSLFLLPSSVVSAYYGQISGAKYDSIQGGYT
                     LPCSGSVPDFAFGIGDSNTTISVPGDYVRYAATDSSGIICFGGIQANTGIGFSIFGDV
                     ALKAAFVVFDGAKQQLGWASKPLPS"
     gene            complement(<47891..>48453)
                     /locus_tag="MYCTH_2111679"
                     /db_xref="GeneID:11506569"
     mRNA            complement(join(<47891..48049,48088..48318,48394..>48453))
                     /locus_tag="MYCTH_2111679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664698.1"
                     /db_xref="GeneID:11506569"
     CDS             complement(join(47891..48049,48088..48318,48394..48453))
                     /locus_tag="MYCTH_2111679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664746.1"
                     /db_xref="GeneID:11506569"
                     /db_xref="JGIDB:Spoth2_2111679"
                     /translation="MADRSSKPHWPNFAPVAHYYSRRPDMRIAAWIGRRFNFWKRNPL
                     DTRRQRGGVQHALQQLSLEDLRSLDIVSGPSRNNHKKCGGCLPDFLGLQTDFADQFER
                     YRPSNRASRLTSSTTTNTCPLAEPLPQDPSAGNSPLKSFLQPASDHG"
     gene            49989..52697
                     /locus_tag="MYCTH_2307857"
                     /db_xref="GeneID:11506445"
     mRNA            join(49989..50377,50497..52365,52440..52697)
                     /locus_tag="MYCTH_2307857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664699.1"
                     /db_xref="GeneID:11506445"
     CDS             join(50098..50377,50497..52365,52440..52552)
                     /locus_tag="MYCTH_2307857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664747.1"
                     /db_xref="GeneID:11506445"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Spoth2_2307857"
                     /translation="MTEKKSFEATAATGAVRPFAESQPPVEDATELKTHDVSVEKAPT
                     EVEEVDEEDLYRPLAMDPSIPHEENPLTFRAVFTGCVLGLLVCASNLYLGLKTGFTFS
                     ANMFGAIFGYGVLKLLEKTGGKLPIIGGMFGPQENSIVQAAATGAGGTGGIFVAAIPA
                     MYQLGVMDPGHSPKDDIGIIFTITLVTSFIGLFYVTPLRRFFIIQVARELKLMFPTAT
                     AVALTIRSMHAGAAGSIDALKKLKCLAVCFFGALIHRVCSYYAVGILYDWHVFTWIHI
                     WSGYKSWAMNIESWGWYMEWTPAFIGSGILIGLNPAISMFIGSLTAWAIIGPALVHYG
                     ECIGIDLSDGDPKWNGYYTFASLSNLGKQTPSPRYWLLWPGVMVMVCCSMAELLVQYK
                     AIWAGAKSIWNQTCAGINSTLVARGKSSAFFEKHGSVQAKNEDIVEDPFPPKEQVKTW
                     MWALGLLVALVIGMIIFHFQWDTHPGLTILAIVLAFLFSFLAIQIGAVTDNTPLTAAS
                     KASQLIFGGATSNSGYTIQHAQKINLVAGALASGGADMATSLVSDFRTGFLIGTSPIK
                     QWIAQAIGAFCSVWLGPGLFVLFTSAYPCIWSPNQEDRAKCPFLVPSVSAWAAVAQAV
                     TDPNVAIPLKSGIFAIVMGVVSIIQVVIRHFYLVGDRAKYRAWLPNWGAIALSWVVPA
                     PVFANAALLGAIIAALWRKYSMRTWDIYGYAVAAGFIAGEGLGGVVGAILTLANVDGS
                     VKGTNVACPMNSC"
     gene            complement(52880..55235)
                     /locus_tag="MYCTH_108890"
                     /db_xref="GeneID:11506446"
     mRNA            complement(join(52880..53227,53323..53496,53693..54807,
                     54936..55235))
                     /locus_tag="MYCTH_108890"
                     /product="MFS sugar transporter-like protein"
                     /transcript_id="XM_003664700.1"
                     /db_xref="GeneID:11506446"
     CDS             complement(join(53020..53227,53323..53496,53693..54807,
                     54936..55040))
                     /locus_tag="MYCTH_108890"
                     /codon_start=1
                     /product="MFS sugar transporter-like protein"
                     /protein_id="XP_003664748.1"
                     /db_xref="GeneID:11506446"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_108890"
                     /translation="MGLSTKILQKIVRNEAMASDPPEIYGWRVYLLACSACFGAMSFG
                     WDSSVIGGVIVLPPFIRDFNLGDPKSQASANLSANIVSTLQAGCFLGALVASPMTDRF
                     GRKWCLIGVSLIIIIGIIMQAAASGNLGPMYAGRFIAGAGVGAASTINPIYVSENAPR
                     AIRGLLTGLYQLFIVTGGMIAFWINYSVSIHFPETKIMYVFPLAIQALPAALLCLCML
                     LCQESPRWLARRDRWEDTKRVLSRIRNLPPDHPYIQDEFQEIVAQLEHERRLIGDASF
                     WNLQREMWTIAGNRRRVLISIILMICQQMTGTNAINTYAPTIFKNLGLTGTSTSLFST
                     GVYGIVKVTSCIIFLLFMADSLGRRRSLLWTSIAQGLAMFYIGLYVRIAPPKEGESVP
                     PAGYFALVCIFLFAAFFQFGWGPACWIYASEIPAARLRSLNVAYAAATQWLFNFVVAR
                     TVPVMIVTMGEGGYGTYLLFGSFCFSMFVFVWFFVPETKGVSLEAMDKLFGVTDESSK
                     SLTVDEDAKEKEKDGPHARQTEVVA"
     gene            56714..58520
                     /locus_tag="MYCTH_2307864"
                     /db_xref="GeneID:11506447"
     mRNA            join(56714..57150,57234..57940,58048..58520)
                     /locus_tag="MYCTH_2307864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664701.1"
                     /db_xref="GeneID:11506447"
     CDS             join(56813..57150,57234..57940,58048..58358)
                     /locus_tag="MYCTH_2307864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664749.1"
                     /db_xref="GeneID:11506447"
                     /db_xref="JGIDB:Spoth2_2307864"
                     /translation="MLSQPTVTVLGRDPARRRQFNINCYAFQQDAIVTFNGWQYSCFY
                     SFRQSDSSDAAGEPLYVHVARRQLPGGDWEVLVLDDYAQTTDDGHNTVQMGISPVDGV
                     IHLSFDHHCDVLKYRSSAPEVATRPGDFEWRASLFTPTLHALPGLPTSHPPFRDVTYP
                     RFFGTLGGHLFCSFRDGKAGLGNDHLYLYEPAEKRFAYVGRHLTGIQSNPYVHGMDWR
                     DGRLHVTWVYRGFVYYDGWDDPLDSKHKQQAGPNGAENNHDMCYAYSDDMGYTWRNGA
                     GAVIARLREGETITNDAEGIVAFEIPKHSGLTNQEAQTVDQDGGVHVLNRDTLDGVEE
                     EDRAVWRHYYRSPEGTWSRRPIRPVTGSARGRLAISRTGDLYILLPNFAASELQILRA
                     SRAGGYATYEEVWKGGKLTGEPLVDATRLEHDNVLSVLVLAEEEDPARGRNVAVLDFQ
                     L"
     gene            59901..61986
                     /locus_tag="MYCTH_2307871"
                     /db_xref="GeneID:11506448"
     mRNA            join(59901..59979,60038..61986)
                     /locus_tag="MYCTH_2307871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664702.1"
                     /db_xref="GeneID:11506448"
     CDS             60191..61405
                     /locus_tag="MYCTH_2307871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664750.1"
                     /db_xref="GeneID:11506448"
                     /db_xref="JGIDB:Spoth2_2307871"
                     /translation="MQTETLMRMLGDLLARIATPAEFTLADDPAAFNKAMLSWLTDPD
                     FRLPNGSVVGLCCSSLLSLQFREDADASTDDLMLDFRRFLLATSLAHAGWRDGSLKAI
                     RADDLRAAGHISGARLFRRLGRVLTPQFLSRCGRDQCQVLFLLVLGAVLGVGYYSSSR
                     LEDDRSPDFFPPAVGGMLSPELRRSPTLWLAMKEQLCQMLAHHLIFLGSMLEIKLEAA
                     VEQRIIETAVARWNKAEDFVWADMSSSGFGVGEDRKEEGKEEEEEEEEERPPSTRTCK
                     SPEVVRSEDVDQDSVLVQPSSSRVPSSHCAPASSSSSAPPPPPPAAARLPPLVTISLS
                     ELKQFHPESVDAWFENPQSYLSMFDDELGSTGERAASSASGAAPELTARQEGESRERF
                     LVPKVGVCRPES"
     gene            <62090..>62892
                     /locus_tag="MYCTH_2128565"
                     /db_xref="GeneID:11506449"
     mRNA            join(<62090..62152,62217..62373,62476..62604,
                     62717..>62892)
                     /locus_tag="MYCTH_2128565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664703.1"
                     /db_xref="GeneID:11506449"
     CDS             join(62090..62152,62217..62373,62476..62604,62717..62892)
                     /locus_tag="MYCTH_2128565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664751.1"
                     /db_xref="GeneID:11506449"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="JGIDB:Spoth2_2128565"
                     /translation="MTSYGALKEQDEVWERTFEAHDGDSKWNDPIIKYVPELAAAADK
                     AKEDPVANVAWDEVTIGTLAGQLSGAIRDYGLMSEVTQEFNQSQAVELGFPPLQDSNP
                     MLPKCGEWPQCNRTEFFNGPLEAYPSFAPFATPPYTNMGYQILTYALKAIKGKSFQTM
                     MGESVLRPLGLNHT"
     gene            63102..63733
                     /locus_tag="MYCTH_2307872"
                     /db_xref="GeneID:11506450"
     mRNA            63102..63733
                     /locus_tag="MYCTH_2307872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664704.1"
                     /db_xref="GeneID:11506450"
     CDS             63498..63671
                     /locus_tag="MYCTH_2307872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664752.1"
                     /db_xref="GeneID:11506450"
                     /db_xref="JGIDB:Spoth2_2307872"
                     /translation="MFSTDCGTWVSFTGVVYSTQPLDQFVLEVDAAGGGGERRESGAE
                     GVNEEIKGSYIKQ"
     gene            complement(63734..66240)
                     /locus_tag="MYCTH_2307873"
                     /db_xref="GeneID:11506451"
     mRNA            complement(63734..66240)
                     /locus_tag="MYCTH_2307873"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003664705.1"
                     /db_xref="GeneID:11506451"
     CDS             complement(63793..65562)
                     /locus_tag="MYCTH_2307873"
                     /note="CAZy_ID 268062"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003664753.1"
                     /db_xref="GeneID:11506451"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="JGIDB:Spoth2_2307873"
                     /translation="MVCRALANVAMMLATVAALHCLITWLAAGDSHLYWFFALFVWRY
                     LRFLVNLAAFWLYTPAPRPVKPTYTPPDVTVILPTIDPQGEKFLETVKSCADNGPAKI
                     IVVTAGDELFSKASALVGTFTSAYPDVKFVVDRTQVVSKRAQVALAVSLVETDITVLL
                     DDHVFWGPRYLESLLCAFEDRAVGLVGTNKRVRRHRDLGLWGRVWNMLGATYLCRHNF
                     EIRATNTVDGGVFVVSGRTCSIRTEILRHPDFLPGYTNERFFFGLFGPLNADDDNYVT
                     RFVVRHGWKIKIQYTEEAVMHTSVGVDKPVATKFLGQCRRWVRTTWRSNLCSLLTDRS
                     VWALQPYCVYAVYLTSLTNFAALTDGLLVYLLARSSAYSVGTLAGLVSWILLTKTVKV
                     FDYFRRHPRDVVLFPAYLAFAYFHGLIKFWALLTFWDCTWSGRRLDRIGVDGHNKTAR
                     GGGRDDDDDDTRQTPDPPHLDTLRSIRDRIAGLHEQHVRHIAEYQRPLLAELQHLRES
                     FRDLQGDHDAIVENQDAIWPELHKIETQTKDLAAGHISISTTVAESDILKAITGVKDA
                     VAGVEGRWKDWASELAKTASASP"
     gene            complement(67187..68643)
                     /locus_tag="MYCTH_2307876"
                     /db_xref="GeneID:11506452"
     mRNA            complement(join(67187..68349,68409..68643))
                     /locus_tag="MYCTH_2307876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664706.1"
                     /db_xref="GeneID:11506452"
     CDS             complement(67429..68109)
                     /locus_tag="MYCTH_2307876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664754.1"
                     /db_xref="GeneID:11506452"
                     /db_xref="JGIDB:Spoth2_2307876"
                     /translation="MPCDSYTVTQIQRFLWPRPMALGFWAFGKEAVKQAAHDVARYFG
                     FGSEDSDGTQARPNPTAPPPLPPSPSPEIQRALQRLRQGTTRRPEQVDDPGSISSSQR
                     AQSSAPAPTSDKSIGLPEKPTLDQSNRGPSKQKGFTEELIESFSSSEPWKRLKETYQR
                     ERRPIRPDPPRGSILVTGIIELQTQRAVMFLDVASWYNPKTKSYALETMTVSVRRIRP
                     KYAVAPLR"
     gene            69307..70933
                     /locus_tag="MYCTH_2307878"
                     /db_xref="GeneID:11506453"
     mRNA            join(69307..69594,69654..70040,70108..70933)
                     /locus_tag="MYCTH_2307878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664707.1"
                     /db_xref="GeneID:11506453"
     CDS             join(69433..69594,69654..70040,70108..70764)
                     /locus_tag="MYCTH_2307878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664755.1"
                     /db_xref="GeneID:11506453"
                     /db_xref="JGIDB:Spoth2_2307878"
                     /translation="MRFSAGLTAAALSGLAAAASQQSADVYMFPSSSRASAETPSIPK
                     EVARHIMLQRTSRQRYGSDLRDIPSSIDIETAVEHLTTFGKSPLPLFTHADKADASQL
                     VIILEGAAADQSSRLREKLGHNVAFTISDPPSATANNQLMAHFQNMGVASPEQCELPL
                     VINPFETDCWTGPSSVVKYDLRTSPKTYDSLLENLSRLEKFVADGDLEVLLVLLPESS
                     RSSKLSQWGGAAVAGTGASLQRRRGTEMVLTDHDIQKSTPAANGMPTAGSSSSSSAAR
                     RPGAIPKCFSTLEGCIKDTNSCSGHGECVNKYGTANGTDESHSCFVCACKATVVKAPD
                     GRESSGRKTVRWGGDMCQKEDISVQFWLIAGFTITIVGAVTFAIGLLFNVGEEKLPGV
                     IGAGVSRSK"
     gene            complement(70934..72860)
                     /locus_tag="MYCTH_2307880"
                     /db_xref="GeneID:11506454"
     mRNA            complement(70934..72860)
                     /locus_tag="MYCTH_2307880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664708.1"
                     /db_xref="GeneID:11506454"
     CDS             complement(71102..72751)
                     /locus_tag="MYCTH_2307880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664756.1"
                     /db_xref="GeneID:11506454"
                     /db_xref="JGIDB:Spoth2_2307880"
                     /translation="MSSFGAKKKARIIHTFDDDGDDLSSSAPNTSDETQSDRKLSTVT
                     APASLNSPPLLMMIGPTKSEQADALPAEPAPLGRIKFGRNKPAKSSALRKSININDDE
                     SQEGPASEPATIARGDDGDDDDGSGGPVVIRPTASRSGSAKFKKRPAASRSSFRPGEG
                     TADEDDDNTEVGGAVTKPAPKKPLGRRLLENNALRKSASLPSLSGDRNLPIRFGGQEE
                     APKYSKEYLEELQSATPVAPQNLAELHLHDDGDEMSLDPSELEGALVVPATEVAAPST
                     GSGSTPRILTEAEIRERKERRARLAREAEFISLDDGSEDERAAQSSRVTVNFGKKKSE
                     SRLIAEDEDLGEGYDEFVSDGRLALGKKAEREAARRHRKEIAELIQAAEDGSEAESDD
                     SEAERRAAYEAAQRRAGLDGLHRPDEDHDMGGVVGPDAVPRMKPLPKLNEVLQRMRDI
                     VQELENEVARKRTRIGDLKREKEEILAREKEVQEILNQAGAKYQAAVANAGGNVGDVA
                     KMVIQSPLRPLPPGISGELPVERGLESFGATPIRRDDTEMA"
     gene            <73005..>73412
                     /locus_tag="MYCTH_2119714"
                     /db_xref="GeneID:11506455"
     mRNA            join(<73005..73034,73141..73212,73263..>73412)
                     /locus_tag="MYCTH_2119714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664709.1"
                     /db_xref="GeneID:11506455"
     CDS             join(73005..73034,73141..73212,73263..73412)
                     /locus_tag="MYCTH_2119714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664757.1"
                     /db_xref="GeneID:11506455"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Spoth2_2119714"
                     /translation="MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDDA
                     VEEKDNGEKVKLGMVVIRGNSVVMLEALERIGDDARGGR"
     gene            complement(73496..74379)
                     /locus_tag="MYCTH_2307881"
                     /db_xref="GeneID:11506456"
     mRNA            complement(join(73496..73807,73879..74379))
                     /locus_tag="MYCTH_2307881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664710.1"
                     /db_xref="GeneID:11506456"
     CDS             complement(join(73629..73807,73879..74164))
                     /locus_tag="MYCTH_2307881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664758.1"
                     /db_xref="GeneID:11506456"
                     /db_xref="JGIDB:Spoth2_2307881"
                     /translation="MALREDGTPWWTDFPEPASTAAQVTPGEVFDLLQAQETAENEQR
                     RFLLVDTRRTDCKGGTVRGAINLPAHSFYPTRKTLYGLCKQAGIKTVIFYCGSSLGRG
                     PRCAAWFQDYVNQVGGVLESKVMTGGIRGWMKAYGGRMMDGYDDKAWEAEER"
     gene            complement(74860..76311)
                     /locus_tag="MYCTH_2144570"
                     /db_xref="GeneID:11506457"
     mRNA            complement(join(74860..75364,75427..75750,75816..76311))
                     /locus_tag="MYCTH_2144570"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664711.1"
                     /db_xref="GeneID:11506457"
     CDS             complement(join(74979..75364,75427..75750,75816..76257))
                     /locus_tag="MYCTH_2144570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664759.1"
                     /db_xref="GeneID:11506457"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="JGIDB:Spoth2_2144570"
                     /translation="MSFLKKLTDGIAEDLGRLGLGSEKKESRDEHRYSNRDGVGHYPP
                     QQYPPQGYGGYHSPQPYGGHYQSPPPPPPPPEGSYYPPQGHQPYSPPPPQPNYSSPPP
                     QGETPYAYPPEPGPRPPPPYNPPADKPPIPSGWKPCWDDHYQRWFYVEEHSGRSQWEA
                     PGYEQSYHPPQEGDNRGHDTPGAYHDGYGAPPAGYDSHHTSYGQSPYGGEHVSPQPEY
                     DDRGSHKEKKSHSGMLLGAAGGLAVGAVAGAVIAHELTENSSDDGSNSGGGAYAAAPA
                     AAAAAPAAAPATVVYETNNYYYNEPPPPPPPSDYPPSDYPPGVLPTTNAYGEEIDSSD
                     RESLREARDNYEEALEEAASSSASSSEREELEEAREEYQEEYEEAYYDD"
     gene            77030..78868
                     /locus_tag="MYCTH_112363"
                     /db_xref="GeneID:11506458"
     mRNA            join(77030..78225,78338..78507,78575..78868)
                     /locus_tag="MYCTH_112363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664712.1"
                     /db_xref="GeneID:11506458"
     CDS             join(77162..78225,78338..78507,78575..78600)
                     /locus_tag="MYCTH_112363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664760.1"
                     /db_xref="GeneID:11506458"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="JGIDB:Spoth2_112363"
                     /translation="MSYYPGQGYGPGSGSGSGSGYHQGYGSGGYGQQYPPSQGYGQYP
                     PPQQQQNYYPPQQQQQQRQYQRPPGPPPQGYDAYGYPINHGPGYGGSGPRETAPPPPS
                     GMQEFGHGAPQGYTFQYSNCTGRRKALLIGINYFGQEGELRGCINDVKNVSAFLTEKY
                     GYRPEDMVKLTDDQSDPVLQPTKANIIRAMQWLVDGAQPNDALFLHYSGHGGQTEDLD
                     GDEEDGYDEVIYPVDYKTAGHLVDDQIHDLVVKPLRPGVRLTAIFDSCHSGSAMDLPY
                     LYSTKGVLKEPNLAKEAGQGLLEAVGAYARGDMGGVASSFMGFAKTALKGNDAYERTK
                     RTKTSPADVVMWSGSKDDQTSADATIASQATGAMSWAFITALRQNPKQSYVQLLNSIR
                     DVLETKYTQKPQLSCSHPLDTDLLFVM"
     gene            complement(78988..82131)
                     /locus_tag="MYCTH_112362"
                     /db_xref="GeneID:11506459"
     mRNA            complement(join(78988..79186,79328..80638,80702..80785,
                     80859..80984,81097..81224,81411..82131))
                     /locus_tag="MYCTH_112362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664713.1"
                     /db_xref="GeneID:11506459"
     CDS             complement(join(79444..80638,80702..80785,80859..80984,
                     81097..81224,81411..81950))
                     /locus_tag="MYCTH_112362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664761.1"
                     /db_xref="GeneID:11506459"
                     /db_xref="JGIDB:Spoth2_112362"
                     /translation="MILPRASETPAPAAVGSEFGTTPDTKPEPRLDGVGIWWITFGAV
                     WTALLVCGMTFLYKKRNTPTLRLRSLSLTFSGIILLHLYWISVQIAYSVGPLAPEVAE
                     YWIMGVWYPFGIALFHAGNSQFLHVAKAQSRFARPPSQMKTRYDEKRLVRRPNLFQAI
                     MQMDYSKRMFMFVTMGMTVQLLVVVIIYLISRKFHSDFGIPGTEVTGSSPAEIAMKQG
                     RGWEWWPSIVWQFVWAWIIAPIILWRSRGIHDTHGWQRQTIACCIAGLPAAPMWLIAL
                     YVPGMAPVNKYFVPPQWIALTIMVMEIWTVFVPCWEIHKHQTLRQETLESIANWESKK
                     RLGTKSETSSDRSGGPPLSPTSTKVGDSGGFDSWKKLSNLESNSSQSNLGPDESVLTM
                     AALEHVLEKNPEPLRQFSARKDFSGENIAFLTAVSEWKNGLPADFVRGRFDASPDAVR
                     DQFTRALRIYTEFISPREAEFPINIAWADLRKLQGVFERAARSLAAANPSSPVNHADA
                     ATPFADDNFVSTPAAAAAAGAAAMKTPADTAAPNKAPPSRDSQVHILDPPGPEPEAES
                     EPARRTPPTSSRGNNHIPLTVKIVTPPPTATPPPPPPYPVYEGDIPEAFDATVFDAAQ
                     ASIKYLVLTNTWPKYVRERRGSESGSSSGAPSERGGGSAPSTLGGGSVRSKISLKSAL
                     GFLKGVIH"
     gene            85092..85195
                     /locus_tag="MYCTH_t132"
                     /db_xref="GeneID:11506460"
     tRNA            85092..85195
                     /locus_tag="MYCTH_t132"
                     /product="tRNA-Leu"
                     /note="Anticodon: AAG"
                     /anticodon=(pos:85126..85128,aa:Leu,seq:aag)
                     /db_xref="GeneID:11506460"
     gene            <87107..>88569
                     /locus_tag="MYCTH_96309"
                     /db_xref="GeneID:11511473"
     mRNA            join(<87107..87713,87820..88333,88437..>88569)
                     /locus_tag="MYCTH_96309"
                     /product="4-O-methyl-glucuronoyl methylesterase"
                     /transcript_id="XM_003665662.1"
                     /db_xref="GeneID:11511473"
     CDS             join(87107..87713,87820..88333,88437..88569)
                     /locus_tag="MYCTH_96309"
                     /codon_start=1
                     /product="4-O-methyl-glucuronoyl methylesterase"
                     /protein_id="XP_003665710.1"
                     /db_xref="GeneID:11511473"
                     /db_xref="JGIDB:Spoth2_96309"
                     /translation="MKLVSAYTLIGAAIGSASRVPRIPRQGGGNTMIECAPIPSPFPT
                     WQELPLQSSMPDPFLPLAYTTPDNAADVVAGRGKGRVQTPEEWYRCRQPEIIQLLQEY
                     QYGYYPDPSEEKVEATRSGNTLNIVVTAGGKQGSFRATISLPSGASASNPAPVVINIG
                     GMQNQPYLSAGIAVAQFDYTTVSPDSNAKTGAFWSIYNGRDIGVLTAWAWGFHRTLDA
                     INLTVPEIDAARVGVTGCSRLGKAALAAGLFDKRITLTMPMSSGVQGAGPYRYYDMSG
                     QGENLENSKQGAGWWTNSKLGTFVNHAQNLPYDAHTIVAAIAPRAVIIDQGTGDPFVN
                     SKGTAVVVYPAAKVVYDWLGAGENIGISVRGGGHCDLSGYTAILPYVQKIFFGTPTDK
                     DYNNLGSYGSPVSSAFPWATAVPGA"
     gene            complement(123208..123989)
                     /locus_tag="MYCTH_2307892"
                     /db_xref="GeneID:11511471"
     mRNA            complement(join(123208..123616,123744..123989))
                     /locus_tag="MYCTH_2307892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664714.1"
                     /db_xref="GeneID:11511471"
     CDS             complement(123318..123506)
                     /locus_tag="MYCTH_2307892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664762.1"
                     /db_xref="GeneID:11511471"
                     /db_xref="JGIDB:Spoth2_2307892"
                     /translation="MVARGLSTLDELEEVKRQETPTMPSSQINDAIDTIDWGAVFGSV
                     PGFPLVDPDSAGRTVLVS"
     gene            <132565..>134175
                     /locus_tag="MYCTH_54374"
                     /db_xref="GeneID:11506461"
     mRNA            join(<132565..132592,132685..132846,132924..133706,
                     133817..>134175)
                     /locus_tag="MYCTH_54374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664715.1"
                     /db_xref="GeneID:11506461"
     CDS             join(132565..132592,132685..132846,132924..133706,
                     133817..134175)
                     /locus_tag="MYCTH_54374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664763.1"
                     /db_xref="GeneID:11506461"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_54374"
                     /translation="MERFGLRADDLQWSSIPTELLLAELSRRSDADERPACGSGKKGY
                     YDTGIHVFALFLILTLSTLSCGFPLFSQRLTKGSKRQRNIIFLCQHFGTGVLMATAFV
                     HLLPTAFTSLTDPCLPHIFSEGYRPLAGLIAMVSAFVVVALESYLTTRGAGHSHSHHA
                     WEEEEDSDDGDTAGNEHGHAGESASRHPRRDLPANIALDDLEATEGLVAGASPLPGST
                     PTMAPRRDNPLKSQRDSTQGNDRESLDLDLGFEELRQSPEPSQQRKSDPRLPPLQRVP
                     NPDEQKRMMLQCALLEAGILFHSVFIGMALSVATGPTFAVFLIAISFHQCFEGLALGT
                     RIAALHFPRSSPRPWLMVLAFGATTPVGQAIGLFVHSFYDPMSQTGLLMVGFMNAISS
                     GLLLFAGLVQLLAEDFLSEKSYKVLKGRRRVNAFLAVVSGAGLMAVVGAFA"
     gene            complement(<134502..>135295)
                     /locus_tag="MYCTH_2119721"
                     /db_xref="GeneID:11506462"
     mRNA            complement(join(<134502..134805,134922..>135295))
                     /locus_tag="MYCTH_2119721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664716.1"
                     /db_xref="GeneID:11506462"
     CDS             complement(join(134502..134805,134922..135295))
                     /locus_tag="MYCTH_2119721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664764.1"
                     /db_xref="GeneID:11506462"
                     /db_xref="JGIDB:Spoth2_2119721"
                     /translation="MRTAIANVFSFCLVLLLGSLRGGHAFATAPAPALDKRQSTSRYC
                     SPSTQICYLEYSWGPTIPVFRIAVPDSASTNTDFQTLLQIVAPASLGWAGFSWGGGMT
                     LNPLTVAWPNGSGGATVSSRWATGRSLPTVYSSATYRIISAETNSTHWTVETVCSGCS
                     RWNGSALSTTAVNTFAWAVSKSPVSQPADSSSSFQIHDNIGTFAASLNDAKVPKATFD
                     QYVQGAQ"
     gene            complement(137485..138852)
                     /locus_tag="MYCTH_2307894"
                     /db_xref="GeneID:11506463"
     mRNA            complement(join(137485..137536,137649..138135,
                     138199..138852))
                     /locus_tag="MYCTH_2307894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664717.1"
                     /db_xref="GeneID:11506463"
     CDS             complement(join(137757..138135,138199..138545))
                     /locus_tag="MYCTH_2307894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664765.1"
                     /db_xref="GeneID:11506463"
                     /db_xref="JGIDB:Spoth2_2307894"
                     /translation="MDVPNVVDPTLTEAAAADNTSDLDRPIRVLVQTQTHLVSGDRST
                     EFGERYDAMVNLICQHVWQREYDKFRERDWSYHCHFALDNVECWFLVDHHGPDPSPPP
                     DPPIIWYRWTGKEFVMMRDPLPGRVRRELRHYPFQRVAYHLLIQEYPKRRTPRRYKSR
                     AEEIRVKRKMLHNTLLSNLGLTEELLRFVQDCPDAAEWVKARVPPETWARLEDPSEIV
                     LPLEPKEGHTWTGSSDRVGRPES"
     gene            138910..140546
                     /locus_tag="MYCTH_2307897"
                     /db_xref="GeneID:11506464"
     mRNA            join(138910..139377,139461..139729,139788..140546)
                     /locus_tag="MYCTH_2307897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664718.1"
                     /db_xref="GeneID:11506464"
     CDS             join(139076..139377,139461..139729,139788..140356)
                     /locus_tag="MYCTH_2307897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664766.1"
                     /db_xref="GeneID:11506464"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2307897"
                     /translation="MASSRLALALRHSLLWPRTVALQSVRRPAYLISPFWNHLPGLSL
                     LQFWQYRTQHTIGSSRTRRSEPFLVDSAIRGDSGRIYKVEEILSVRRKPLLCVYRASS
                     EGKQFILKDMIKGEFDYQLSLQTPLAPCPNIRVLVDTIRDDEMFVYDFLPGDLLHLSQ
                     QALSTQTRRHILKSALLGLAELHDRGIIHTDIKPNNILLDYDTSGPDIRITQVRISDL
                     EDSVLLGPGKSIKGCLCGNELWRSPESWARAKQNTPSDIYSFAIMAIYVMSNEIVFRV
                     SDEELKSDMAWWHILRRHISYFADESGFQGLLGHIGEDNPFFERLIALTGDFNAEKPR
                     QPFALWHYVEPDFRDLVGKMANLDPNRRITAREALEHPWFKKAVL"
     gene            143553..144771
                     /locus_tag="MYCTH_2307898"
                     /db_xref="GeneID:11506465"
     mRNA            143553..144771
                     /locus_tag="MYCTH_2307898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664719.1"
                     /db_xref="GeneID:11506465"
     CDS             143775..144683
                     /locus_tag="MYCTH_2307898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664767.1"
                     /db_xref="GeneID:11506465"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Spoth2_2307898"
                     /translation="MAPFLRMPFRSLSADNLISRGAAGHVFHISPNIVLKCPTKFDNG
                     LPEQIKEMEESSKKIEAEKAVYRILMEHPHPNIVQCILCVPEGIFLRRMESTLQERLS
                     QSRKATIPARTQERWVLQLTSAVAWLERLGLVHGDLRPANILLDANDNIQLSDFDATV
                     KPGAELIVASEPFCKMDENFETPPAGPVSEQFSLASCIYTIRFGHWPWHELDPRARGE
                     KLRRNKFPSVSADIVFGDVTTRCWHGEYTSIASVQQDVLSRLGRSIAKDEALMQVAIE
                     EIATQYPLLRAECERFVATQARERSS"
     gene            <146895..>147530
                     /locus_tag="MYCTH_16152"
                     /db_xref="GeneID:11506466"
     mRNA            <146895..>147530
                     /locus_tag="MYCTH_16152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664720.2"
                     /db_xref="GeneID:11506466"
     CDS             <146895..147530
                     /locus_tag="MYCTH_16152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664768.1"
                     /db_xref="GeneID:11506466"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Spoth2_16152"
                     /translation="TLKRCAKCSVTPYCSRDCQKADWKAHKKVCGKGGGNTASGSSSN
                     ASNIPRADTLLSPPKSLDQHIAKPFTRLDNGTWLHDRPEKDVYRLLIDAYRLRVEDNY
                     KLEGENVDLYAGEPSGLNGLKRFIRLAGSRPGLLPPWWNAEKQRKCEAFGMDSSNFQD
                     LRCAVEKSDIIDHYGDPRFPMQLRMFAEAVYGRGPGGQSGAPMRKMMAAME"
     gene            complement(148189..>150054)
                     /locus_tag="MYCTH_2094697"
                     /db_xref="GeneID:11506467"
     mRNA            complement(join(148189..149382,149493..>150054))
                     /locus_tag="MYCTH_2094697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664721.1"
                     /db_xref="GeneID:11506467"
     CDS             complement(join(148373..149382,149493..150054))
                     /locus_tag="MYCTH_2094697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664769.1"
                     /db_xref="GeneID:11506467"
                     /db_xref="JGIDB:Spoth2_2094697"
                     /translation="MASKKAKPAPTDDELGELFEGIGDDTAIKKTTKAKSASSSSRPK
                     ADAAADQDILAELENQLGEKPPERPHTPRVREVAKRTSTNTPPPASEAARKSAESAAS
                     HRTQPTSGAAGSEQQHETEKKEAPARQAQASSGGGGSSSWWGGLLSTASAAMKQAEAA
                     VKEIQQNEEAKKWADQVRGNVGALRGLGDELRHRALPTFTNILHTLAPPISSHERLVI
                     HITHDLVGYPSLDPLIYGVFNRVMAQVEGGDLMVIQRGQESTIRDKSASGGGGGGGFF
                     GAAQQSSAGWRDGPWWRQTDVTRDLGVVQGLVEGTKLCRANAEGYAADYFAAHGGIEQ
                     ARQRAAEPVSESNPVRSSDIFLSVQAVGVRPDKALFAGSTAVEKDKEASVVAEEDEDA
                     DGEVCFAVFILDPVHEIQYATVSQRVPARWIRWLDAPATPATPASGDDEFQAEFGLVP
                     EEIREIVESGAVDPREWVAEWVEEALALSVGVVAQKYVARRMGVGEGGIGKGKKKVES
                     VIEAGGNEVARAGLI"
     gene            150767..155579
                     /locus_tag="MYCTH_2307901"
                     /db_xref="GeneID:11506468"
     mRNA            join(150767..154702,154773..155579)
                     /locus_tag="MYCTH_2307901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664722.1"
                     /db_xref="GeneID:11506468"
     CDS             join(150847..154702,154773..155104)
                     /locus_tag="MYCTH_2307901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664770.1"
                     /db_xref="GeneID:11506468"
                     /db_xref="JGIDB:Spoth2_2307901"
                     /translation="MHQPPEEGRANGTGEQIELQPGSMGRGRGGIPRGRGAKKRTSLP
                     SHSYSNYSAEAHPFSDSAKPSTPEPSSLPPPQRMAYTAPQRGGKARQVGNMTTPHRAS
                     SPAADQALRIAAAKSERPPRSSTFHSFSFSGESPSTAGSIMAAGDPPRKRSRTFEASY
                     DGGADDEGHSKGGHSLRKRARIDYTQEMVDDDLGLPAGARTEPAVKPASTPGARGSRK
                     RKGGQDESDEESEDFSSNPKRHRADKSPAPARLSSSRRRNPSKKLSADLTPFVDQASD
                     NEVQDTILVSVPDTGPDAPSEEDSERSVQDAESRPASSDGSEPGRTEVPSPTPQVQQH
                     PSSVHHDAAPRAVDGEPIREEKNPEQPHDEPHKAPVLTSATIGSAEAEQPMEEEGPVN
                     ENQPSGVSVPEVAQDVSAQTVEVGPGQQSLEQPNGGDDEPSHQGPAATEPTTGFTKPT
                     PTPAPEPQLAVDSTAQRVPQGDGHTESRTSSFEGSKPAGPTRLKALEHIYKIETPFAI
                     HLKLTPYEDEDTPLPGPYTEWVYPAKTGKAESSPAPAAVATLSTAKKKTVDVEWDPSR
                     PLKASEFFALYRKESKRRQEKGEPTISMVEFNNECVRRYKAANAQRSPSDTPPSTTES
                     TASPTVVIERSTAADGDETPSDSQPDGSRLPTAAPSPAPAEDATALGDAPEDDQDVEE
                     SIDDPAKPDSPEEPIEVTRIPPKQYLFPKIRDPNEFVEAFEGWQDMPTERLYETVAAA
                     VEALHVYQQEYNELKKILDDEENAKRRQANDKTIVNWENRQRADEPLPPRRHFDDPVK
                     GPPAFEVRGMRASKPYIDDMVLEHQKEEDRIMANAYGFKLNTHPTQVGRQNPEEQRWD
                     MLENRLRKRTEKGAELAEENVVEGKRIRKPRHVSDQSKDVSRSGTPTGTGMLGPGRRQ
                     RRKPATAANGEDAEDAEQNQASNNFSESPRKGRAARSRPAMRADDQDQIPTAAEADGN
                     RTEDEDAEAEDRTKVSRRRGRAAAAPLPEPPTSVPAGVGGELGKPKRVRGGKGSQANH
                     QTKGEIASSSFYSNASTQPESRPSTASSESSSQTAETMESTYSLRDKRRRNFALENDP
                     ELESRPQRRARGTAAPKQDAAPEPIKKRGPKKKEPAAQAPPPPPVSGPSSTPRPSSPP
                     ALQPPVATKFYHNFVAGPMMVDVGNGTQQHVPAQVGPYLHTFNAAPAFLPGAHPQAPP
                     PPAVKKPITKIKLTNNNGTSSSAPSRASTPANGTSTNTKPKRARGKKGKAGADTPATN
                     GDGELDKPYAEMTKSEKMSWSMRRRWASGEMQGAVEKRRTTLAIKKAEKAASNLNHDT
                     SDANATNQTTDSGSAGPSNPATPASMHGQPGSGLLALPQGPPMMLPHPPPPQGFLHQP
                     SYPYSMPPPSGPPRPMP"
     gene            156447..156978
                     /locus_tag="MYCTH_2307902"
                     /db_xref="GeneID:11506469"
     mRNA            join(156447..156721,156776..156978)
                     /locus_tag="MYCTH_2307902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664723.1"
                     /db_xref="GeneID:11506469"
     CDS             join(156688..156721,156776..156951)
                     /locus_tag="MYCTH_2307902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664771.1"
                     /db_xref="GeneID:11506469"
                     /db_xref="JGIDB:Spoth2_2307902"
                     /translation="MSWFTSRLVYRELPDQEPDAMAILADYTLVLPKNTGVQAAVDRT
                     KSAKVQMYGLEAITEGDYFFDASFP"
     gene            <157445..159745
                     /locus_tag="MYCTH_71373"
                     /db_xref="GeneID:11506470"
     mRNA            join(<157445..157612,157823..159745)
                     /locus_tag="MYCTH_71373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664724.1"
                     /db_xref="GeneID:11506470"
     CDS             join(157445..157612,157823..159640)
                     /locus_tag="MYCTH_71373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664772.1"
                     /db_xref="GeneID:11506470"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Spoth2_71373"
                     /translation="MRLLNATTFEVEELYGSEIPQYAILSHTWGAEEVTLQEVEAFAR
                     YRRSRREHARHMQKAGFSKIDYACRQAIKDGYRYVWVDTCCIDKRSSAEVSEAVNSMF
                     DWYQRAAVCYAYLEDVHFDDYTEGYRTWKDHFHRSRWFTRGWTLQELLAPKKVVFYAR
                     GWRLLGTKSSLVKHVVKATGIDEVTLIDPKLIHNASVAQRMSWAANRTTTRIEDQAYS
                     LLGIFGVNMPIIYGEGTKAFLRLQEEIIKRSDDHSIFAWGTLGHPSSHPHHPHHLADP
                     SDDDLDYAAMTGTTGVLATSPRDFAGMERVITTAPPPNRDTSDYAMTNKGLRITLDMT
                     RQRGDAEDNTTTTTTTTTTTHLAILNCRPDDDPSVRLALLLTETATPNVLLRTRTRTA
                     TLVSAADASAAGPRSVYILNAPAQVPHSAAKLAEEVVLVRTPDLIAPGYDVLDVRGCG
                     AQWNREFRSIRLVGVDYTARRARRGGGGGGGVLFQLAVVTFWNKHLKCGFLARILVEG
                     ASKAAFVDLVQGLRSDGGGGDGKGLVEEAKRIWEQPGTVQVSVPGRGGDSPGRRIQVE
                     VVNPVAAPEAAGNEEETADERSGMMMPGGGWTFRPGHELQVSGSVTFTEKWEKDYRRT
                     VNAKAGRTKKGAIELTMTSMLWLAVPVAKGEELDQPS"
     gene            complement(160563..161708)
                     /locus_tag="MYCTH_71369"
                     /db_xref="GeneID:11506471"
     mRNA            complement(join(160563..160896,161013..161259,
                     161370..161417,161632..161708))
                     /locus_tag="MYCTH_71369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664725.1"
                     /db_xref="GeneID:11506471"
     CDS             complement(join(160786..160896,161013..161259,
                     161370..161417,161632..161645))
                     /locus_tag="MYCTH_71369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664773.1"
                     /db_xref="GeneID:11506471"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="JGIDB:Spoth2_71369"
                     /translation="MAKISRGAPGGKLKMTLGLPVGAIMNCADNSGARNLYIISVKGV
                     GARLNRLPAGGVGDMVMATVKKGKPELRKKVHPAVIVRQAKPWKRFDGVFLYFEDNAG
                     VIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM"
     gene            complement(161922..164256)
                     /locus_tag="MYCTH_2307908"
                     /db_xref="GeneID:11506472"
     mRNA            complement(join(161922..162821,162887..163130,
                     163184..163480,163533..163725,163788..164256))
                     /locus_tag="MYCTH_2307908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664726.1"
                     /db_xref="GeneID:11506472"
     CDS             complement(join(162047..162821,162887..163130,
                     163184..163480,163533..163725,163788..164105))
                     /locus_tag="MYCTH_2307908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664774.1"
                     /db_xref="GeneID:11506472"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="JGIDB:Spoth2_2307908"
                     /translation="MDSQHDNNSGSSRSRFGHLPLSTSGPLECALRGTVLLNHPYFNK
                     GSAFTVEERRDFQLTGLLPQGVQTLEQQVQRAYEQYSARPDDLAKNTFLTSMKEQNEV
                     LYFRLLLDHLEEMFSVVYTPTEGDAIQNYSRLFRRPQGLFLNIHDVGRVRHDLSLWGT
                     ADDIDYIVVTDGEEILGIGDQGCGGILISIAKLVLMTLCAGIHPNRVLPVVLDCGTDN
                     EALLNDPLYLGLREKRVRGGKYDEFVATFVRSARELYPKAYIHFEDFGFQNARRLLER
                     WRPEIPCFNDDVQGTGCVTLAAIMAAMHVSRQKLGDVRMVVFGGGTAGVGIADQVRDA
                     IAAGSGISKEEAAKQIWLIDKPGLLTTRVEGLSDAQKPYARTEDWSGKRTDLLGVVKE
                     VKPNVLIGTSTVPRAFTEEIVREMASHVDRPIIFPLSNPTKLHEAVPADLLSWTTGKA
                     LVATGSPFKPVKGPWGPDGNEVEIEVAECNNSVVFPGIGLGGVLCRARLVTDKMLIAA
                     VQGVSELSPALKDDTAPLLPGVEVVREVSVRVARKVIQAAMEEGLATQEGIPTDENEL
                     DEWIREQMWYPVYRPLKYVEAHSASRQAKGELRVVGSLPGRG"
     gene            complement(<183138..>187478)
                     /locus_tag="MYCTH_2119730"
                     /db_xref="GeneID:11506473"
     mRNA            complement(join(<183138..183150,183207..183948,
                     184034..184153,186769..186996,187033..187386,
                     187442..>187478))
                     /locus_tag="MYCTH_2119730"
                     /product="glycoside hydrolase family 75 protein"
                     /transcript_id="XM_003664727.1"
                     /db_xref="GeneID:11506473"
     CDS             complement(join(183138..183150,183207..183948,
                     184034..184153,186769..186996,187033..187386,
                     187442..187478))
                     /locus_tag="MYCTH_2119730"
                     /note="CAZy_ID 268063"
                     /codon_start=1
                     /product="glycoside hydrolase family 75 protein"
                     /protein_id="XP_003664775.1"
                     /db_xref="GeneID:11506473"
                     /db_xref="InterPro:IPR009939"
                     /db_xref="JGIDB:Spoth2_2119730"
                     /translation="MVQFYTVVGALALTFSAVQAAPNLSARQNIPDPAGEKNVGNGRG
                     LQFIGGQCLGAADCASGCCAILPKGGQTIGVCSGVGAQNQAGKQGCGFESGVGAGNQT
                     QGGSQGGNQNNTGGNQRNGGNNQCNNQGDNQNNGQTGATIRPSTLKPDPAGAANVGNG
                     QGQQFIGGECTSDADCASACCALVNTGEERFGICSGPAANTQNGKQVTTARDAPKNLL
                     EFYDVIRAKGHCRHELASGFYSRDNGPNNFAYCGDYLDSAGVIYIQGRSGALANLDVD
                     CDGSSGGPSDDGRCRRELSPDLQNATSFRDVLASYGRAGVAELNPYVHPYVVFGNAPA
                     TKTTTASTGRGAKSGAWRAFDPSEYGMRPLGVMAVVCPTSRKLVYGVWGDMNGDDGAR
                     PMVGEASLALVTACGGKGVSGADGIDEDAALFLGFTGDEAVPGRDGADWAAKDFDTFE
                     RSIERLGNRLVERVRAADEDASCSVRPSWARVAAVAAAVVGSTWSLL"
     gene            complement(<189675..>190557)
                     /locus_tag="MYCTH_2128593"
                     /db_xref="GeneID:11506570"
     mRNA            complement(join(<189675..189762,189843..190276,
                     190342..>190557))
                     /locus_tag="MYCTH_2128593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664728.1"
                     /db_xref="GeneID:11506570"
     CDS             complement(join(189675..189762,189843..190276,
                     190342..190557))
                     /locus_tag="MYCTH_2128593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664776.1"
                     /db_xref="GeneID:11506570"
                     /db_xref="JGIDB:Spoth2_2128593"
                     /translation="MAPSVTLREDAAAVEKDPSRKAEYQKGEVFGKFRTDASMEYIFF
                     DHQWWRRAWTAQEIVLAKRALLVSGRYQHPIFGNYFDPPTTPFWEVQAIRKQANAVAN
                     PNPADELLSYLLRTRHRHATDPRDKLYSALGFADGRLKALEVVPDDRLPHRDVYRDVT
                     RRLIEVSGNLDVLGLCFPFKKPSTSGLPSWVPDWGPAERIAQPLMSDAHGNPRKTHAL
                     ASVQHHYDDVKWDDDFNFDDWDGDPWY"
     gene            <190613..>191167
                     /locus_tag="MYCTH_2128594"
                     /db_xref="GeneID:11506571"
     mRNA            join(<190613..190716,190817..190839,190887..>191167)
                     /locus_tag="MYCTH_2128594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664729.1"
                     /db_xref="GeneID:11506571"
     CDS             join(190613..190716,190817..190839,190887..191167)
                     /locus_tag="MYCTH_2128594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664777.1"
                     /db_xref="GeneID:11506571"
                     /db_xref="JGIDB:Spoth2_2128594"
                     /translation="MAVEFARASLRANHDGASSLVRLQLNNLGVMLASSQLPDVFLYV
                     IDLLPAVSTKLLDRSDQQFVMSTFAGVAFDVCAIPLAYNGPADALEYLEKGRRVIIGQ
                     LVDARSDISSLEQQHPDIARRYMQLRDDVKSKF"
     gene            193621..195732
                     /locus_tag="MYCTH_2307916"
                     /db_xref="GeneID:11506572"
     mRNA            193621..195732
                     /locus_tag="MYCTH_2307916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664730.1"
                     /db_xref="GeneID:11506572"
     CDS             193810..195645
                     /locus_tag="MYCTH_2307916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664778.1"
                     /db_xref="GeneID:11506572"
                     /db_xref="JGIDB:Spoth2_2307916"
                     /translation="METAVAVENLSPLAVARRPMGAVFTTGPFKPISQGFSLFFEALL
                     SAVALGNADTLETLAHLDVSTVSSISENEDDKGVPAFSKPSTSHQTPVPEISACPAVE
                     TPGPVDSAIIKEDNEAAATITLRNEDSQGMNAESPTVTAVTQDVIASQQAETALACTE
                     DSTAPVDASLPDITRDAEPVIDEAEGSTSIAVACATEEQHDASEVDLIVSEGEAVAAA
                     ECTLDAEVQVTDNVSDETQHTESPKEDSVCVVSEGVTDTVTSAVDTLDNSLNSSIEAA
                     KVSDVTSAAAGLDNIEDTSAAEVSVKLDIESNPADKPEAVATQDITSAPENISHQDFI
                     EDSESVAKDVIEDIVVSSNENLDTNADVAVEATDEELTQISDVESMETISDEGDEEPM
                     PLPVFPLILEDDFDAPVSSTFQAGLELLMEIDTTWCVPQIVEKGKSERERVRERLANR
                     STAQFNLQNLRLEKAALALTINGGPVHAQPSRKVAALPTRVPPAKRDIAVPETKDGFA
                     QTEVADAPARNHSRSTSASSSASKISADAVFDSAPCPGTPVTEYTGTPTKEVQSHAAA
                     SSDGKVVPQQVSRDDKINNTIGIAKETESLHTPATVSRDVDETRN"
     gene            complement(<198486..>198949)
                     /locus_tag="MYCTH_2034916"
                     /db_xref="GeneID:11506573"
     mRNA            complement(join(<198486..198689,198764..>198949))
                     /locus_tag="MYCTH_2034916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664731.1"
                     /db_xref="GeneID:11506573"
     CDS             complement(join(<198486..198689,198764..198949))
                     /locus_tag="MYCTH_2034916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664779.1"
                     /db_xref="GeneID:11506573"
                     /db_xref="JGIDB:Spoth2_2034916"
                     /translation="MAAFDPIEFFGIGHSRDNSIASHARSPSQSTISLSSVGFPSHQA
                     LHTRQVEQHTSYTDILPNPRSPGHAFTSITPEDSLDGAAIALDNDSPPASPDVSTNSS
                     WASNTDRPFAVGRYVHSHERHEALLLAI"
     gene            complement(200179..203649)
                     /locus_tag="MYCTH_2307917"
                     /db_xref="GeneID:11506574"
     mRNA            complement(join(200179..200519,200650..201075,
                     201227..201265,201339..201401,201480..202646,
                     202715..203649))
                     /locus_tag="MYCTH_2307917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664732.1"
                     /db_xref="GeneID:11506574"
     CDS             complement(join(200416..200519,200650..201075,
                     201227..201265,201339..201401,201480..202646,
                     202715..203423))
                     /locus_tag="MYCTH_2307917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664780.1"
                     /db_xref="GeneID:11506574"
                     /db_xref="JGIDB:Spoth2_2307917"
                     /translation="MSPANRLFIFRKVASRHGDDETSNTTPAPDADNSVVDREPPPAY
                     EPGTSSSASSNAPNVPNVPNAPGGEAASPIAALDRLASSNLPLDSVDMCLAHLKLLFA
                     FQWMKEDVGFTDGLWGLWDSHAGTLDPARMGRQNPGNMRRRAAGADGKSEVPIEIRMG
                     DKDLAILSKIREKRWALFVARAVDRYRTWWKTVMRWQQSAPLTEDDMRVAGSPRYSEF
                     PSNPDDILPWREDMLPPLDVLLVWHTHMLNPRAFLEDCMLAGLRRFWVTGMPWHLINK
                     VIDGEFNYTVSAEYVQRWTRETGLAWENAQDPMAKTIRCPRCNTSIDITWTTCEFPEQ
                     AQFRSGDDSYDPGNGYGDANLQFPCPSCNMIVCKELLATAQFVQDHRALLSPIGRPMP
                     GTLLDPITGTPSRPSSPWVPPAHEFPNRLLKSGCGFIRSNIATLMVSGTPNPSMKDVR
                     AMIDNVMKDKNNIREIEQVPPSEWFRLPAKSRMAVRKMMSRYWENFGPFALELGAAVM
                     RQGIFVEKMCQLDWLHSPTARDTMARLIVKYQRFMQIMARNPGKIAVPTLDVDLAWHT
                     HQLSPGRYYQYTVNLAGRFIDHDDKIDSTTLGEQFEWTSKMYQELYGEVYSECTCWYC
                     ESVRSSHISSVGRVLGLSRQEKIAESFHASGAASLHPPSSSAHISAHPAVLSKPDPTI
                     LSAQPWSSIAFIGKIREENYRLRLDTALAKARARARKKGREPPRREDVYYDHWGYPYA
                     YAAPYVYPLWWTPGLYYGWYPGYLALCGAGAHAACVAGTCGGGVAAGACGVPQGGGCG
                     GYSGAGCSGGGGCGAGCGGGGGGGSGGGGGCGGGGGC"
     gene            complement(207023..209026)
                     /locus_tag="MYCTH_2307921"
                     /db_xref="GeneID:11506575"
     mRNA            complement(join(207023..208109,208235..209026))
                     /locus_tag="MYCTH_2307921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664733.1"
                     /db_xref="GeneID:11506575"
     CDS             complement(join(207451..208109,208235..208904))
                     /locus_tag="MYCTH_2307921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664781.1"
                     /db_xref="GeneID:11506575"
                     /db_xref="JGIDB:Spoth2_2307921"
                     /translation="MDSVEIVVVASPFANLAPLYEADSDADALLIVPPSNNTIALRSE
                     LPSHPNGIDSEQNGRGAATGVLQTGLRIKASSKHLALASRVFRNKLQFGNARAARQSD
                     GRIHLRLAEGFHPTAVSIVINAIHGRGSKVPRNVDLEMLAHIALFVDRFQLLDAVEVY
                     ADRWISNLEHSDPDTFSRDPIPWIYISHVFRQGDIFKEATKLAAAQSSGPISTLGLPI
                     KEKIIHHIDAQRQALLGRALAPLHQAVDTLVSGAAACSSHHCDSLLLGELIKSLQGGD
                     HERGREHETTTTTTTTTATAGLIWPRPARPFPGLGFASVVGRVDRGLAAYRRAVEARE
                     EAERQRRQSVEVEPWYMKKGGGPGPGPSTPGRPGWGVVSDRLPVTPAASPEPVYANPR
                     QEPGSDGGERHHHDHWCGTAGIVAALGELRRLGDEVEGLVLEGRLGYLQY"
     gene            211062..212874
                     /locus_tag="MYCTH_2307922"
                     /db_xref="GeneID:11506576"
     mRNA            join(211062..211600,211768..212475,212567..212874)
                     /locus_tag="MYCTH_2307922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664734.1"
                     /db_xref="GeneID:11506576"
     CDS             join(211245..211600,211768..212475,212567..212684)
                     /locus_tag="MYCTH_2307922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664782.1"
                     /db_xref="GeneID:11506576"
                     /db_xref="JGIDB:Spoth2_2307922"
                     /translation="MDQDDAARPSPTSSTGSSIDGPTILVCEAETIPGSRIINEGTAD
                     IRARIRAVYDSGAPIFTKDAMRRAAQSFDRILQGSDETVPVTGLDGVTIEFKFPHRVE
                     DLLPGEANDESNFEYTMREPCLLYRTVHQLIGTAGYEDWQVNIVSAYLPFSIGYETTK
                     RDKHTKDAIFPWPAVSQDQVEARLAAQRRKWQDSETCARLGALFAGRAAVPLPEAVVI
                     NKVVAFACSSMAWDLENGEGSVRSAAQHALVLGVAELLAQRRQRQQQQAGSVDDGRLK
                     EEVVCYAQDPVYHPADKAVLSAAGVVVLDDPRAFLEVDETSVVVSPYPDIPVREVVAD
                     IARPAVMIWNRVTDELTTSPMTDPVSPRVTDMISQDYLQLECPLDDEPFRDMAVYVRK
                     T"
     gene            <213580..>214550
                     /locus_tag="MYCTH_96290"
                     /db_xref="GeneID:11506577"
     mRNA            join(<213580..213606,213650..213724,213781..213802,
                     213934..>214550)
                     /locus_tag="MYCTH_96290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664735.1"
                     /db_xref="GeneID:11506577"
     CDS             join(213580..213606,213650..213724,213781..213802,
                     213934..214550)
                     /locus_tag="MYCTH_96290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664783.1"
                     /db_xref="GeneID:11506577"
                     /db_xref="JGIDB:Spoth2_96290"
                     /translation="MAEVPAFTQETSALRRIDLGDVPGYIPRELDNAKILTAAVLRGS
                     QIRVSSRNIVEEQTSLSSHAPGHPVGDLHGYLSCPLPPIIPHHRDQHWRRSRPNRTVQ
                     AVTAVQEVQGVAAHSRTQAPLIRPLTACRRRGARRYWPRSLAFSLDCSPGHPSDNVTM
                     YDTLVVWSIRKFFPCSTPLGQGAKVALFRGSERNKRCPEVVMHPKRPLRRSGAGGLDW
                     VKSGSSVTPRDIPQSYSLLDTGISEPAI"
     gene            <215065..>215872
                     /locus_tag="MYCTH_56237"
                     /db_xref="GeneID:11506578"
     mRNA            join(<215065..215312,215449..>215872)
                     /locus_tag="MYCTH_56237"
                     /product="glycoside hydrolase family 11 protein"
                     /transcript_id="XM_003664736.1"
                     /db_xref="GeneID:11506578"
     CDS             join(215065..215312,215449..215872)
                     /locus_tag="MYCTH_56237"
                     /note="CAZy_ID 267878"
                     /codon_start=1
                     /product="glycoside hydrolase family 11 protein"
                     /protein_id="XP_003664784.1"
                     /db_xref="GeneID:11506578"
                     /db_xref="InterPro:IPR001137"
                     /db_xref="JGIDB:Spoth2_56237"
                     /translation="MVSVKAVLLLGAAGTTLAFPFNATQFSELVARAGTPSGTGTHDG
                     FYYSFWTDGGGNVNYENGPGGSYTVQWQNCGNFVGGKGWNPGQARTITYSGTVDFQGG
                     NGYLAIYGWTQNPLIEYYIVESFGSYDPSSQAQTFGTVEVDGGTYTLAKTTRVNQPSI
                     EGTSTFDQFWSVRQQHRTSGSVDVGAHFDAWAKAGLQLGTHNYQIVATEGYQSSGSSS
                     ITVQA"
     gene            complement(216839..216910)
                     /locus_tag="MYCTH_t164"
                     /db_xref="GeneID:11506579"
     tRNA            complement(216839..216910)
                     /locus_tag="MYCTH_t164"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:complement(216876..216878),aa:Thr,seq:agt)
                     /db_xref="GeneID:11506579"
     gene            complement(217328..218362)
                     /locus_tag="MYCTH_2307924"
                     /db_xref="GeneID:11511505"
     mRNA            complement(217328..218362)
                     /locus_tag="MYCTH_2307924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664737.1"
                     /db_xref="GeneID:11511505"
     CDS             complement(217519..218205)
                     /locus_tag="MYCTH_2307924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664785.1"
                     /db_xref="GeneID:11511505"
                     /db_xref="JGIDB:Spoth2_2307924"
                     /translation="MRGLQRTTGALPRATPGLLRTCATRHSRTINTLQARQKTSGDQQ
                     RANAPATSATTPLDLSRNQGVYGANWSSHFTASSESHSLLQQADDPARALYTTQIYHG
                     QARPPSRRGIHHHSAPAASSSQADGSSSSSSSSISRPAAGAGTGTGVSASAQKFGSAV
                     KGNPTESEADVAADRAEDDPLPPELHHTIQLGAGGAAPRRTESEEDVVADRGAVGEDP
                     LARVKKDQRR"
     gene            219388..221004
                     /locus_tag="MYCTH_2307925"
                     /db_xref="GeneID:11506580"
     mRNA            join(219388..220013,220081..221004)
                     /locus_tag="MYCTH_2307925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664738.1"
                     /db_xref="GeneID:11506580"
     CDS             join(219622..220013,220081..220855)
                     /locus_tag="MYCTH_2307925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664786.1"
                     /db_xref="GeneID:11506580"
                     /db_xref="JGIDB:Spoth2_2307925"
                     /translation="MSVIIGQAPINLGPLTTTFTPPAACTVAVGERRNALADFFGIGG
                     DKDVAFLGQGCSGGKPYDATSCWPATSKGVEEKEAPLSGWGFYSPGLHCPVGYATACS
                     ATGGSGGGSGWPVQFKLRDGETAVGCCPSGYGCANINGQTCTMIATSTAVPIVTCKGS
                     TTGDVETQTVPDDKASITAFSLLAPMIQINWQSSDRPASTTSTSARPSRTEATRTSTS
                     SRDKTDSTETTRTSATSSTETLILDDSPQTTGTVTGTEAKGVDEPTGTPTLQDADDSS
                     SDSGSLSSGMKVAIGVAGSVAVLLMLVCALFYCWRRRKNLREEQELDRLYGMKHTMND
                     GGDFTHNNDIPGWYRGQRLATPAKDPFGGYPANSGLGTEMERPAAPYYRAYRPA"
     gene            221550..224036
                     /locus_tag="MYCTH_2307926"
                     /db_xref="GeneID:11506581"
     mRNA            join(221550..222054,222110..224036)
                     /locus_tag="MYCTH_2307926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664739.1"
                     /db_xref="GeneID:11506581"
     CDS             join(221674..222054,222110..223657)
                     /locus_tag="MYCTH_2307926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664787.1"
                     /db_xref="GeneID:11506581"
                     /db_xref="JGIDB:Spoth2_2307926"
                     /translation="MSTEATRPLLLPQNRKLRHLRGIALRNLSFSRPRGHSIDDAILN
                     IKSPAKVEALRDTPRLHHALSSDDLQPPTARRRSTNLASVSPATRQKKFEDAFDSRLA
                     DAFFSLHIQGVEEPIYISEVGERATNFNFRPFELCELDSTITQSPKVTVKVWARRNDA
                     WSLLREDEVDLRSLNWLGTLHNVHFPPNSLVFYLVDGIYSLELAGKPTPPKHTASAPT
                     SSYNALMRLATLDNSIQDALATRELLTQQINDLLSRERKNEVPEAEDSLALAKKYLTQ
                     QRRAVAHAKKRNDDLRASLAARKEAIAQGRAAQERAAKDVENATEKLAQSQALLAKTK
                     SDIHGQRRRICEDLSRIYNIIPVPLGPPLSFQICGLPLPNTTSADETLAGASKSSSSS
                     SAFFSSSGGGGGPPPITEDALSAALGHVAHLADALQYYLAVPLPYPIRPFGSRSSIRD
                     DISQLPDPQREFPLYVPRGGSSAQFRFDYAWFLLNKDIEALCSSQGLRVVDIRHTLPN
                     LKYLLYVCSAGTDEVPERKKGGVRGLWAGRLKGLGVNVGVAGADDASSLGGAGSSRRG
                     SDASEMVSRQREELRKAAVCGGGSGGSGGGDGGKERERERDESREHGIDGGKGLPFAE
                     EGMKLSLRTKGLRENAAP"
     gene            <225475..>226377
                     /locus_tag="MYCTH_2128605"
                     /db_xref="GeneID:11506582"
     mRNA            join(<225475..225611,225794..225872,225973..226123,
                     226193..>226377)
                     /locus_tag="MYCTH_2128605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664740.1"
                     /db_xref="GeneID:11506582"
     CDS             join(225475..225611,225794..225872,225973..226123,
                     226193..226377)
                     /locus_tag="MYCTH_2128605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664788.1"
                     /db_xref="GeneID:11506582"
                     /db_xref="JGIDB:Spoth2_2128605"
                     /translation="MVLTSDYQPIAAASQSPRVFPSSGFQIIDPSDKVEGQKLPFYER
                     DEDGKYWTLKGHVNTMKYNQEHVVYRHLVFVITPLGMSLRTLQEMQSKRVFQKLLVTS
                     SLDQVLVGLDCLHGAKVVHTDLHSDNLLVAITDDSILIKVEEGEILEPAARKQDDDRF
                     IYVPRYMLGGTGALIVCGLPRND"
     gene            235912..237445
                     /locus_tag="MYCTH_2307928"
                     /db_xref="GeneID:11506583"
     mRNA            235912..237445
                     /locus_tag="MYCTH_2307928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664741.1"
                     /db_xref="GeneID:11506583"
     CDS             236051..237121
                     /locus_tag="MYCTH_2307928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664789.1"
                     /db_xref="GeneID:11506583"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2307928"
                     /translation="MDDIPVSDYEIQSLRDAKGILSQREIDLILELSVAGQVANLDVM
                     LGDIASQHGTTMGVLLIHARDAENRNAVHHAAMGQSIKSLNYLLDSRLFPQQPALRLA
                     LLHTRTRTGENAAIYAIRQRCSVAFLDRIIAAGTPCILDTLTADGLGPVHCAAMEDAR
                     EMIIHLVKKHCLDPNQPFTPPANRLLNSDDDDDDDDGNSKNSNGEQHHTATGAGAGQL
                     VEGDTPLHLAARRDSAAAFEALHSALGCNIWTARNAAGQSAIDVACSALASGVLAYLG
                     RKRGVSDVNRGDKKRKRQNKQQQQQQQQQQQQQEEEEEEEEEQMEGIELDEVDDEADF
                     FLESLDVFGQKHPANGCGLRGW"
     gene            237941..240041
                     /locus_tag="MYCTH_2307929"
                     /db_xref="GeneID:11506584"
     mRNA            join(237941..238049,238126..239863,239932..240041)
                     /locus_tag="MYCTH_2307929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664742.1"
                     /db_xref="GeneID:11506584"
     CDS             238199..239794
                     /locus_tag="MYCTH_2307929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664790.1"
                     /db_xref="GeneID:11506584"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="JGIDB:Spoth2_2307929"
                     /translation="MSGHPSWRLLPASAPGIPTLLVSTDFKADSYSIHLSDLANVWAE
                     SLDRRPIIKRGMMEDTSIDPSDGPDQIRKMLELLRAAFDSGDSEHANTSLTLSRDDDE
                     DSLVIHVTCVLPKPLKPFKWPMHLKKCPQSTLTSELVLPMIQAQEARTREIDQLVSLL
                     REKDAVITRLVDKLEATGTGLEYVFHSLSGKRRVTRAVAEEKVKGLAAFSESEFRSKA
                     AEVRPITQASDVSALLGSVFGPPGLQYKSDLEIQASAGLEDWWKKLMKGSKVILSPEL
                     PEKRRPQNEVTSPGPEASKEEDDFQVQATPPGVRPTRQRGSPAPAVDDDETSGGEDTA
                     EPAPPPLSPAKTKETASKLGTIGRNRKPTSSPPRPPSPPPPATSHKSTKTQIAASDTQ
                     SETASEPDDVDAVSSPPPSPPKALPRRGGLGRIGGKTNPVTQPPQPTRSPPPREPVED
                     SSNQPSRRHKLGVIGKKPTHPEPPATGGEDEARGRSETPASEPNKKQRETSQERADRK
                     RAELQKEMERRAAAGPAKKKRKF"
     gene            complement(249362..251753)
                     /locus_tag="MYCTH_2307931"
                     /db_xref="GeneID:11506585"
     mRNA            complement(join(249362..250692,250758..251753))
                     /locus_tag="MYCTH_2307931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664743.1"
                     /db_xref="GeneID:11506585"
     CDS             complement(join(249400..250692,250758..251639))
                     /locus_tag="MYCTH_2307931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664791.1"
                     /db_xref="GeneID:11506585"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="JGIDB:Spoth2_2307931"
                     /translation="MAVISTMRTLCASPAQQVTGTSVSPDQSQVDQELVVGMSALQTH
                     DRDNHQTYVPSHWSGSLGSQTSSSDDLENYALHSSPAVSSLQQPSSTQTSPRSWDSPE
                     QLGPTPWEAATEHFHNRYSGLDPHLSGSGVHNGDDSTSFPGDSAPFIPIQGLDGLHNE
                     CQQVPRQTDPCPAGPYHTAPEEAYPSTPESSQPVSPETAAGPMAVDMPAEDATCPPNN
                     DAYGQAKKSPSPVQVRKEGEKEEPYAQLIHRAFLSTPRRAMTLQEIYQWFRENTDKGK
                     SDNKGWQNSIRHNLSMNMAFTKRERKSSVAKAGDGGSGSATASTQIETKKSTEWYLEP
                     WAIGGVQSTTRYRKGNQSRRSATNPGMLSSRVYRGYPAHHHASLSRKGGRVLRGARPG
                     VRGSTGSIPSVAATHPQLRRYQFSPPHTATGSPFINHTLTNGAAASSGSSTYSGSTSH
                     QPFFHPQVPPQSQTLDGTSSNMGLDYDYPDPQQLFPTTTTTTTTTTSPSSSSSGTAPL
                     VSMGRASSEPGYAGPVDESVAQGPLHHHPHLLHQSPYGSVGSEQAGGPMALADLRAVS
                     TTGGSTAAGATAAPYHRHTGSDNSSFAAAVAAFSAATYPTPMSGIVSVVTPGVYEDGM
                     DRYHHHHHHHHHHPHHHQQQQQQQQQQQQQHQQQQQQHHQQQQLQQQAHSIPRWDAGG
                     ASDACLTGMDGMNAMAGGQCGGEEAGQGGLPAGYGFGQAQGY"
     gene            complement(252886..253959)
                     /locus_tag="MYCTH_2307932"
                     /db_xref="GeneID:11506586"
     mRNA            complement(join(252886..253793,253849..253959))
                     /locus_tag="MYCTH_2307932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664744.1"
                     /db_xref="GeneID:11506586"
     CDS             complement(253466..253645)
                     /locus_tag="MYCTH_2307932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664792.1"
                     /db_xref="GeneID:11506586"
                     /db_xref="JGIDB:Spoth2_2307932"
                     /translation="MNAPSNSSPEKYHPEPLRLATGSAAWYFGLFLCLDLKTLAKCKR
                     QHGPVGDIDDGHLSG"
     gene            complement(253961..255939)
                     /locus_tag="MYCTH_2307934"
                     /db_xref="GeneID:11506587"
     mRNA            complement(join(253961..254030,254095..254127,
                     254380..255939))
                     /locus_tag="MYCTH_2307934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664745.1"
                     /db_xref="GeneID:11506587"
     CDS             complement(join(254013..254030,254095..254127,
                     254380..255801))
                     /locus_tag="MYCTH_2307934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664793.1"
                     /db_xref="GeneID:11506587"
                     /db_xref="JGIDB:Spoth2_2307934"
                     /translation="MDPGRQAMINGLKSPRKDRERNIMAPRYDPSNRIAKPSRQPPAK
                     SSKAGAADRYLTQDQQAEQFIADEDKFVLKQAKKKADIRVRERRAKPIDYLAFGLRFI
                     DSDRDAFDNDDDDVEIAIPAPEAVLQNLNEAQLKELEEDIRSYHTLEHNPRNKEYWTA
                     LLTLCADRRQKLKPQGPEGRAVTSVASDVDRILSPKTLEQLEALEKQIKAKLQSNEPI
                     DTDYWEELLKSLLIYKAKASLKKVCAEIKEARVEILKARDPDRAAALAASDGFADTVP
                     ALKPASRKALARPSPATTQASSSAPPPGTARFAPSGNEDFSQATKALYDREVARGINE
                     GEEIFTAEEAVPGIQRPLWADKYRPRKPRYFNRVLMGYEWNKYNQTHYDHDNPPPKVV
                     QGYRFNIFYPDLIDKTKAPTYKIIREHGRRKGESVAPAGKEDTCLIRFIAGPPYEDIA
                     FRIVDREWDYSAKKERGFKSSFDKGILQLHFQFKKIYYRK"
     gene            256154..260578
                     /locus_tag="MYCTH_2307935"
                     /db_xref="GeneID:11506588"
     mRNA            256154..260578
                     /locus_tag="MYCTH_2307935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664746.1"
                     /db_xref="GeneID:11506588"
     CDS             256278..260450
                     /locus_tag="MYCTH_2307935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664794.1"
                     /db_xref="GeneID:11506588"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2307935"
                     /translation="MYYSIGNQGKIMRKLLGKTTPDSAHDTAAPPAAITSAPIAPHYR
                     PSSSQDVVYNAGVPIAALDRSPDGRSAVLAGRHVLKTVTFDGLAVKEGIDLRALITAQ
                     PSQRNNMSTSVADQLSIKAVKWGEPQGKQAIFTAGTSGKIFQYDLVRAGTTAPGSPVD
                     CIQIREDSRQINSLDINPHRNSWLLSGSQDGIVRCFDIRQPTQTRTGATFRSIQAFKC
                     NADGVHHVQWNPRDGFLFACATEQGSLLKWDMRKPSAPILRIKVHEKSCTSMAWHPDG
                     IHIASGGVDSKCRIWDMSKQDKRQKPKWTISTPAPPGTLAWRPGQWSATAQGKRASQL
                     AISYDETSQKRYGINVIHLWDLARPTMPYKEIQRFDTSPSAMLWHDQYLLWTAGQDGI
                     FSQCDISFAPKVIDRQAVSTMAFSPRGDVLMLLDERPPPQRPRPHVVHHEAVAVPSYS
                     SSPTTPKFGVSRSDSEDDAIGSFIGPKRRGSRRRRPSTRSTATLSTTPPAGPGMEEVM
                     SLEQTIKATGPYKPQQSMAVGHVPAATNVDVYRYLTVNYLEALHRDLPYSAGAGLLPD
                     RVATILEHYAKAAASVRQFRLAQTWRILAYAVEMLLHKRAQYHLDRRMDRHHYSARRK
                     SEAKAEARAKAKAKAMAEVFNAPMPTIVDGEETPRKVFSFASLDKTLHPRSLLSEELE
                     STSNVPTPVARPVTDGPEAPREGEFQRRRELMPIVEPESFTLPPAAHPASLVTRKRLD
                     SVPLSIASHDSGATHASTEGYDFYDTEAILSKAVDIPTPGPKPTQTTDSREGGSPSTA
                     RKLLLRQDSEDSYVHLLSISAESKRAKNPTASIEGSATEQAARAAILAELRRESREGS
                     EPRARGGDLQKSPERNPIAPFRTMLGRTETDMTGFTDEHHAITQTTTDSFESRFPSQT
                     DADFVATSPLVEGPAPDFPAVPEDDQSPFIVETDYLCWPDDQPYPYPANPLSGPSTVS
                     FNNPLQPYSLISRALAFEAKSSALNASAIILLLKPLLPDGVLDNFQVAAILRQHHARL
                     MSMELFTEAALLRKLCIKGWPGGVLHSWGDNYPAIFTPAQQGVQAGFVCSACHRPRDV
                     DRSAGSVDSVWRCDRCRAAMAGCAVCGGRDSVVPARALPLPSSTYPVTWSGSSALPGD
                     EDEAENGDREGRVVVVDDDDDHHHHPALLATWWYCPGCGHGGHSSCLQSWHAALEPGG
                     HPALEDAPQTAEPSEGCCPLDGCGHRCLPTRRGLDSVVTRSEDVSRVVREATRAVAKA
                     TVAAAAAAAAEAASQRGAGAAAEASQVATQFADEQQQHAELGGGGGGGFGGGYGGKPP
                     PLPVRSDGNDIPQSRAVETARETLGGSGGFGSGMRASGTGILSSSPGRSGIGAERERR
                     KSVKFVATDERR"
     gene            complement(260803..262062)
                     /locus_tag="MYCTH_2307937"
                     /db_xref="GeneID:11506589"
     mRNA            complement(join(260803..261475,261587..261671,
                     261753..262062))
                     /locus_tag="MYCTH_2307937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664747.1"
                     /db_xref="GeneID:11506589"
     CDS             complement(join(261174..261475,261587..261671,
                     261753..261956))
                     /locus_tag="MYCTH_2307937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664795.1"
                     /db_xref="GeneID:11506589"
                     /db_xref="JGIDB:Spoth2_2307937"
                     /translation="MTETSKDYPLVGQPSDELDRRWSNLMQYFYAQVPASYMKKLGRE
                     KTGIRLKNGNYLANYAWVHQLHCIKRLHQAHFPERYFPNMTDYEKELQTEHSLHCLQM
                     LVEAIMCKADETPLTMIWFDNSILPGGNRTIAHECVNWDRLIEGMEKVKVDPFEPGLL
                     VHPKFGPVLPDGRDTVLDNRIGYIFNPVPLDRDQYP"
     gene            263252..263552
                     /locus_tag="MYCTH_2307942"
                     /db_xref="GeneID:11506590"
     mRNA            263252..263552
                     /locus_tag="MYCTH_2307942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664748.1"
                     /db_xref="GeneID:11506590"
     CDS             263289..263489
                     /locus_tag="MYCTH_2307942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664796.1"
                     /db_xref="GeneID:11506590"
                     /db_xref="JGIDB:Spoth2_2307942"
                     /translation="MGHASAKKGELQKDADAIWLWKKSELTKDADEIWLWKRGELKAK
                     LQKDADAIWLWKKEEAKQDADA"
     gene            complement(263553..266463)
                     /locus_tag="MYCTH_2307943"
                     /db_xref="GeneID:11506591"
     mRNA            complement(join(263553..265603,265763..266463))
                     /locus_tag="MYCTH_2307943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664749.1"
                     /db_xref="GeneID:11506591"
     CDS             complement(join(263663..265603,265763..266278))
                     /locus_tag="MYCTH_2307943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664797.1"
                     /db_xref="GeneID:11506591"
                     /db_xref="JGIDB:Spoth2_2307943"
                     /translation="MDPETFAPGNPPGPNETTSQPAGGQLIIPSQYDAVSEQTSAGLV
                     NQLLVRPHLLDVAVAVRRFSSPSIQSGQQRLTENMEAARTAYAKAVVAIQKSVKDMDA
                     VTILTRTSEHDVAQTAIELFNSPSGEDNKGRVSQFIDILHHYSGVFDVLSQAGDFAYL
                     AVVWGGIKMLLLMAKNKKELLTRVTDMLVEIGLSLSRIEVYAKLFPTARMVELVSMIY
                     AAVAEFLEDVILHFARKSALRLRVLLSAFVRPFDEKFGRAVDRIRRLETCIEKDALLL
                     HALRTTSMAQHHLGAYLQRAHLTTALDAHAQPHPLEEPAPSSSSSSSSVPAPAPPVPA
                     LLEEVKRALFRGLRDQATYHESLAATYRVTASAWEEWFAVEQRHLPSSSSTSSTTTTT
                     TTTGGAARLSQGLCDAPDHQHALQWLAQQRRLTPELPSCYLVWAPGMTAQAAVASLVL
                     QVLLQRPGAVVELGLDRPGVFDRARDSIAALWGLFTYLMRAMGGGLVYMSIGSAGEEE
                     FAIVDRFVRTVRAWDGPPIWVTIIHPHNGGFVGIDRATDLDGLYDVHPSLTTTDALHH
                     VLMLELDIHHVSDTIQTVLWEAAWRETRYASVGISFSRVVAVMEDLARELATRKTDVD
                     NDGGGGADPVLTDAAREQWMEGVRRWLSHPGASNCTRELVQRHLDVVPLAFPDDVRAE
                     VGRHLKRLVLRIDDDESKTKSFASRSMTEAQRHRVWDHMRAAIVPGSEAMFCAHIRDL
                     MSEALQVFAEMPCHTPKQATYVVARLLNGRFGADGVWKSTMPTDAQLMVHGIKEAVKT
                     GFARTIEALSEPEGAHEVAG"
     gene            complement(<267511..269204)
                     /locus_tag="MYCTH_117073"
                     /db_xref="GeneID:11506592"
     mRNA            complement(<267511..269204)
                     /locus_tag="MYCTH_117073"
                     /product="Acyl CoA acyltransferase-like protein"
                     /transcript_id="XM_003664750.1"
                     /db_xref="GeneID:11506592"
     CDS             complement(267566..268795)
                     /locus_tag="MYCTH_117073"
                     /codon_start=1
                     /product="Acyl CoA acyltransferase-like protein"
                     /protein_id="XP_003664798.1"
                     /db_xref="GeneID:11506592"
                     /db_xref="JGIDB:Spoth2_117073"
                     /translation="MSTPTPPKPEGEAPLTPADVVFAEATPHQRVLSWQLNGASWASP
                     MTIEQYVGRETALSQTALSANGGTRYYVLHPEGDPDTIVSACEVTAKRALVADDAGTG
                     GAGPREVRAYSVASVFTNPRFRERGMASHMLRRVQEVVDGDGDGDDGGYKAEFGALYS
                     DIGRVYYTRLGWKDFRSPQVLLGLGTPPADAAAGSAAAVPEGVSLLTADEVAPLCERD
                     VAAFRERFERLARSGSGGGGGGNNNNGKKQTHIAFLPTPEQMAWHFTRDKYVCQKLLG
                     REVVHRGARTEDEGGGSGSGWICWDHDLREKKLKVLRIATREQDRPEARRGAVRKLLL
                     AALAEAKGWGLPRVLVWSPGAEVAGAATDIWRELGPEVSVTFEEREDGSIPSLRWKCG
                     KGPEEIVWESNEYYAWC"
     gene            complement(270065..271634)
                     /locus_tag="MYCTH_2307949"
                     /db_xref="GeneID:11506593"
     mRNA            complement(join(270065..270665,270750..271115,
                     271204..271634))
                     /locus_tag="MYCTH_2307949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664751.1"
                     /db_xref="GeneID:11506593"
     CDS             complement(join(270329..270665,270750..271115,
                     271204..271310))
                     /locus_tag="MYCTH_2307949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664799.1"
                     /db_xref="GeneID:11506593"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2307949"
                     /translation="MEPSSESTKLEGEGQAYEYLAAGKLKGCKALITGGDSGIGRSVA
                     VLFAREGADISIVYLPEEQPDAEDTKKLVEKEGHECLLIPGDLMDYNKCKEAVQKHVD
                     AFGIIHVLVNNASKQVMCEDFAEIDLNKVESTFRSNILQIFAMTKYALPHMKKGASII
                     NTTSTVAFRGTAAMVDYAATKGAIVSFTRSLSKNLMPKGIRVNAVAPGPVHTPLQPAS
                     RPAEQMEGFGGKSGIGRIGQPSEIAPSFVFLASKDSELYYGQVLHAYPLGD"
     gene            272306..273369
                     /locus_tag="MYCTH_2307954"
                     /db_xref="GeneID:11506594"
     mRNA            join(272306..272739,272798..273000,273077..273369)
                     /locus_tag="MYCTH_2307954"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664752.1"
                     /db_xref="GeneID:11506594"
     CDS             join(272637..272739,272798..273000,273077..273238)
                     /locus_tag="MYCTH_2307954"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664800.1"
                     /db_xref="GeneID:11506594"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Spoth2_2307954"
                     /translation="MATQKPVVRVGVAAIIQDVQGRLVLGIRKGSHGEGQWQLPGGHL
                     EMGESYFACAEREALEETGLVVKADKFGAVTSDIFGPEKHYITLFVSCRMVKEGQEPR
                     VLEPEKCECWEWKSWADVRALIASEDGRTKVFLPIVNLLEDHPDIEALTEASH"
     gene            274120..277663
                     /locus_tag="MYCTH_2307957"
                     /db_xref="GeneID:11506595"
     mRNA            join(274120..274609,274658..275179,275237..275599,
                     275648..277663)
                     /locus_tag="MYCTH_2307957"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664753.1"
                     /db_xref="GeneID:11506595"
     CDS             join(274388..274609,274658..275179,275237..275599,
                     275648..277468)
                     /locus_tag="MYCTH_2307957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664801.1"
                     /db_xref="GeneID:11506595"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2307957"
                     /translation="MTGEANASARPSAADDSPRQTETASTTSTHDSYDPQQIIAMARH
                     PPPGASVYSPTAVPSAALNPRSCVTCRRRKVRCDKHMPCSNCRRAQIPCIFPAPGRAP
                     RRPRPKDPNAPAKQPSSERELELMKRLRKLEGIVEELSGQIEIESARHPYSATSSPEA
                     GTAYSKDEQAIGGRFGRLVTATSSSNHASSGVASAKLPPRQDSGAISESDSLGKGSPD
                     VHKQFGRLVLNEKGVTRYVSSSLWSSITDELDELRKASQDLSDDESAVSEDHASPESA
                     DHDKGFMDHHSFIFGYRSADVDLKSLHPLPSQIPFIWQVYQENVDPILKVVHVPTMSK
                     VIKEFRQNLDSLSPSMEALMFSIYYATISSLEEEDVKLNFGTERSVLIQKYRFAVEQA
                     LAKAEFLTKPDFAVVQALMLFLVLVRRHDDTRFAWTLTSLLIRLSQALGLHRDGSHFP
                     NLTPFQIEMRRRLFWAVCVLDLRSAEDQGTDLSILSDTFDTQLPLNINDADISPESTQ
                     LPEPREGTTDMTFSLIRYEICSLSRRLHTVSSDMAPACRGDAKKSLAEREALLNEVAN
                     KVQKKLLKGGSNTMFWVASNVTRIVLAKMTLVIYQPLLFPGSGDESLSEDVRTRLLNA
                     ALDVFEYSHILNTDPRCKQWRWLFQTWMHWNALAYSLIEVSHRPWGPKAERLWAALNL
                     NFRSPNPAELEKLASHHAVWMPLRKLYLKVKKHRELEIARLQADPQAAQELAIKDEPG
                     TPPSTFGAIPGSVKGAMALDRWRKLVNLPPPPPEQSQSHQEPTPGPPARCQTAPQGTM
                     GAHAADTAGYAKPEVMEYLDGAMADPAFIPIDFAPLWNTAQPDEVVRAAFNTPYQPCN
                     FTQNSGSLGFNTNTPMPDLQQIGRTPTSMSLPAHLSQPQQQQTSQGMVHTPLNNEDTL
                     PPWLWPTTGSPDILNLPNTENDDVDMNMDDGFDWQTWQENLGRYEVEANGGRTGNTWV
                     PGL"
     gene            complement(<278318..>281308)
                     /locus_tag="MYCTH_2139914"
                     /db_xref="GeneID:11506596"
     mRNA            complement(join(<278318..278659,278759..>281308))
                     /locus_tag="MYCTH_2139914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664754.1"
                     /db_xref="GeneID:11506596"
     CDS             complement(join(278318..278659,278759..281308))
                     /locus_tag="MYCTH_2139914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664802.1"
                     /db_xref="GeneID:11506596"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2139914"
                     /translation="MRRARSSPTASPYRALAHHQAQYGSSQGQQARDSVSSVLRSFDV
                     ETNPARPMRPSPLTASTIPDMPLDLVDRIRSFPLFMSAPDDFLAAIGAHLRPQTHNAH
                     DHILTEGDDAKAMYWLVRGVVAVTSRDGEAVYAELKPGAFFGEIGVLMDMPRTATIIA
                     RTKCLLVVLKKEDLRAELPKFPEMEQAIRQEAQERLAILKKKRQEGGKDAKLPETSAA
                     GVAREAVPGEVSMGDSGIIREGAVVNNKKRKSPSPGVVEDPTISGSALGSAYVNVRKT
                     LKELPLFATLPADILHFLGLNAQPRTYPPFTDIVRQGTPGNDIYFIVRGEAEVIQDPA
                     SPTLRRTSKATYSRPRLKQGQYFGEVASLGLSQWRTATVRAVSDVECLMIPGDVLDEL
                     WRRCPPEVKCQVEETARQRFHPEDVEMEDAETKERPTREEKAGPAVTFDLPSKPVSPP
                     NEEEDTRRPSDPDPFLSVDMENFRNRRRNSLAPPTPQTDCSVIVGGIKVPPVAPAPPL
                     LSPISLDDSPFPKRARTLPIGTKAKEKATFPDSVWIGVFEHLDLLEMLRLRAVCRKWR
                     QMLTTSPELCTRVDLGRINRKVTDWSVANILAPFIGTRAVEMDISNCFHITDEGFQAL
                     WKACGKNVKVWRMRSVWDVSASQILEMSECAKDLEEIDWSNCRKVGDNLLARVVGWVV
                     PNPAPARESNKNVVIAPSNAKPRRGQRNPQPGPPSQPSAPAPGTVVGCPRLRRLNLSY
                     CKYVTDRSMAHLAAHASSRLQSLSLTRCTSVTDAGFQAWAPHRFTQLTHLCLADCTYL
                     SDHSIVALVGAAKGLTHLDLSFCCALSDTATEVVALGLPMLRELRMAFCGSANVLEGC
                     SRLEWFDVSQCKNLGGWLAGGGVERWGFDERFVGQPGHGSVVPGSVRVKGGGPPGGVG
                     GETRRTMTDAKPLGPGPILRPVIPPKGAPPSRSRKPVRFVVEKGPGELR"
     gene            284129..286725
                     /locus_tag="MYCTH_84198"
                     /db_xref="GeneID:11506597"
     mRNA            join(284129..284794,284893..286077,286226..286725)
                     /locus_tag="MYCTH_84198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664755.1"
                     /db_xref="GeneID:11506597"
     CDS             join(284256..284794,284893..285379)
                     /locus_tag="MYCTH_84198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664803.1"
                     /db_xref="GeneID:11506597"
                     /db_xref="JGIDB:Spoth2_84198"
                     /translation="MFTITVRAGPGRLAAKAPQLARAFHSTPKNSFFTPRTASLAFRA
                     NTKSPSKILARLQGASRGYQTHYEAYVDPATRRKELFRKLMIGGAIFGGTLVTVNVMF
                     NRETREDGGMPPFERSYLNRTFMHTGLGVGIIGLSAYQMVQSGFVYRLMVTNPWVVGI
                     GGLALSIGSMMATRAIDPDNYIPKYACWTAFNATQAALIAPLMTIAPPALLARAGLYT
                     LAMMGSISFVGATAKQDKYLYIGGPLLAGAAIVAVSGFAPLVLPATAVRTLAFTENLW
                     LYGGLAVFGGFTLYDVQKVLYHARAAQRGIIKEDPINESISLELDFLNIFVRMVQILM
                     MQNNRRK"
     gene            complement(287399..290374)
                     /locus_tag="MYCTH_2307966"
                     /db_xref="GeneID:11506598"
     mRNA            complement(join(287399..288523,288658..288931,
                     289056..289284,289350..289457,289519..289623,
                     289704..289844,289909..289998,290067..290374))
                     /locus_tag="MYCTH_2307966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664756.1"
                     /db_xref="GeneID:11506598"
     CDS             complement(join(287814..288523,288658..288931,
                     289056..289284,289350..289457,289519..289623,
                     289704..289844,289909..289998,290067..290266))
                     /locus_tag="MYCTH_2307966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664804.1"
                     /db_xref="GeneID:11506598"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="JGIDB:Spoth2_2307966"
                     /translation="MARISSTLRASVLYGLLAVASAEAALSPTPKPRPLRLRSPQADH
                     SESESDPATITAVSECHLHGTVQYCQAGTTEFRISGTATASSYTDCHNHGAETFCMAP
                     TGEVQIFAAEAAQTTTPTPTRADSTSSSITAVSDCHAHGSTLFCMAGTAEYEVHTTVT
                     ATQDIPPAYTGCHSHGTETFCIGPDGEEVELHPAGEEEEEDGSGGQNCHFHAGVEHCV
                     GSSGEEEEHSCERVDRDYNIRLRVGLLFVMLVTSSIGVFGPILVASYVSPSHPVFTVL
                     RQFGTGVIISTAFVHLYTHATLMFENECLGELTYESTASAILMAGLFLSFLVEYSGNR
                     LIQWRESKAKAKEGSIESGADADAAPAAARTDMVNIVVLEAGVIFHSLLIGLTLVVAG
                     DSFFLTLFAVIVFHQMFEGLALGTRIAALGRPCPTSAPETPGHGQAFPNGHNHAHGHE
                     HYHAQDDQTVDDHPAEPADPKAAAATQPSATSKEQEPASGAPSVSNDPAAASGQKLRG
                     GGSSSTITSVPLSKKLLLAVAFALVTPVGMAIGIGVLRQFNGNDPSTVVAIGTLDALS
                     AGILIWVGVVEMWAHDWMLGGEMTRAGPARTALGLVALVVGMALMSLLGKWA"
     gene            291533..292640
                     /locus_tag="MYCTH_2307967"
                     /db_xref="GeneID:11506599"
     mRNA            join(291533..291830,291960..292640)
                     /locus_tag="MYCTH_2307967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664757.1"
                     /db_xref="GeneID:11506599"
     CDS             join(291709..291830,291960..292395)
                     /locus_tag="MYCTH_2307967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664805.1"
                     /db_xref="GeneID:11506599"
                     /db_xref="JGIDB:Spoth2_2307967"
                     /translation="MKAIAYAAVLLGLVSTALGQSQTLAPSPTESYGCEPHGDHWHCE
                     GPRTAQSLATTTTGAALTTSTAAHDHDEDDDHDHDHDHDDDHDGSTDATGTGSLKPSP
                     TESYGCVAHGDHWHCEGPITASSAGTASTLATTTITSSSTPAASSIGTTDAAAASSTS
                     TAGAPRLELAGLGFAGLAAAAALAF"
     gene            complement(<299485..>309607)
                     /locus_tag="MYCTH_2128625"
                     /db_xref="GeneID:11506600"
     mRNA            complement(join(<299485..299631,309596..>309607))
                     /locus_tag="MYCTH_2128625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664758.1"
                     /db_xref="GeneID:11506600"
     CDS             complement(join(299485..299631,309596..309607))
                     /locus_tag="MYCTH_2128625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664806.1"
                     /db_xref="GeneID:11506600"
                     /db_xref="JGIDB:Spoth2_2128625"
                     /translation="MFGNRDITIAAFTPIVVAVQMVGLACCDREYSDALDILSRDSSL
                     SDQMEVWF"
     gene            complement(<400727..>401873)
                     /locus_tag="MYCTH_2067496"
                     /db_xref="GeneID:11506601"
     mRNA            complement(join(<400727..401424,401513..>401873))
                     /locus_tag="MYCTH_2067496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664759.1"
                     /db_xref="GeneID:11506601"
     CDS             complement(join(400727..401424,401513..>401873))
                     /locus_tag="MYCTH_2067496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664807.1"
                     /db_xref="GeneID:11506601"
                     /db_xref="JGIDB:Spoth2_2067496"
                     /translation="SIILLSPTNQVLLLHRVQTSTSFASAHVFPGGNVSSFHDGPLPP
                     LDDPAIHEDGPAYRLAAIRETFEESGILLAKKQGRGRDQCLLHLPAHVLEEGRKQIHG
                     NTVRFTEWLASQGGEPDVENLVPFTRWITPPGPPKRFTTQMYLYMLPLDLPPPPPSSG
                     AGGETTATSHDLLLRQHRPALIPTPTHDGGVEHTAAAFDDAGAWLARARAGDIILFPP
                     QSYLLHLVSQFCSPGSNDNNQNDYGAQRAALLAFLRRTPTSAVADRAGTRMIPWSEKA
                     ISPAVLFVRRRDGRAVLGLDKPGPELRGSRRGGDWERVVLVDFRKEGPRNVEVRDREE
                     VLKEEREEGDADGEVAKL"
     gene            complement(402418..405794)
                     /locus_tag="MYCTH_2307970"
                     /db_xref="GeneID:11506602"
     mRNA            complement(402418..405794)
                     /locus_tag="MYCTH_2307970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664760.1"
                     /db_xref="GeneID:11506602"
     CDS             complement(402689..405565)
                     /locus_tag="MYCTH_2307970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664808.1"
                     /db_xref="GeneID:11506602"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_2307970"
                     /translation="MAHEDSVVIISSSPDFPSICDLLPKATKKPPLRSGSNAALTPYD
                     APVTFTSAASQLKSSHASQSERTSPRKTQVVSGVTVTKSHARNPPTERPPEPNAQGTN
                     LESKEANEKLNETGIVTKGRRSARPGSREVAAEPRTIVSVDEVHPQPGGGLSPVQGSA
                     EAENTLPKSRVRTTVKERRPKKRTETVSRHFAPQGSAPKPLPELIADPIEDESVMLEP
                     AMRRKRDWTPPRESVRSYCSADSSTTKEPQSSQDNIFETLQETYGFVADPATHVKVTL
                     PLPDTEVLGKRKIIEMASIGNKQKSPDASPTKPKAPKKRPRTITDLATAAYRPSEKQS
                     VPSAETRTGSLFTYLESPKEQATIAPKDASAKPKASRGTKAKAGKRKEQPPKPILLSP
                     TSAMRQVANQDFVFGTASQLATEDDPVLLRALHEAMQVSNQADSGSDLSPSPKPVNSK
                     LAGRKRPGAGLWAAGARYDDGDLGVDVLDLTRSSPLLLDKSAPEDLYANHEPALSVLS
                     HKKAGMEVELPDDSFALSSSPPVGRHNSSPPSASRNIRQAVVQRDQGSSSLNNHPQIT
                     PEESDLGPPPSNQEQYDELLLSQSNSSRQEEPVRPPAPNYEMYSDARLAKEVASYGFK
                     AVKKRTAMIAILKQCWESQNKTTFGSRATFAAMSTSSTNGSGSSPKPRDRAGRSTTGP
                     RSGLEGPAPSTRRGKKSVTAGAAAETEAPQPMKRPRGRPRKSSTASSVSNTTEARAFS
                     PANSGRDIPASVRDTESEGARVEKRAQGQTGIDNGAISSNQAPGVRTATSPKNARCSP
                     KRNNPAPSTPGGKSSSKQVLEIPDSDSDDPFGSTPGSSPERWADAFSPPPAMDLSVTE
                     DTETSLIASPTSHQVSLFRYITKAIVNAPRATNPEEPSWYEKMLMYDPIILEDLTAWL
                     NSGQLDKVGYDGEVSPGDVKKWCESKSVCCLWRVNLRGQERKRF"
     gene            405984..406966
                     /locus_tag="MYCTH_2315781"
                     /db_xref="GeneID:11506603"
     mRNA            join(405984..406112,406186..406450,406509..406966)
                     /locus_tag="MYCTH_2315781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664761.1"
                     /db_xref="GeneID:11506603"
     CDS             join(406081..406112,406186..406417)
                     /locus_tag="MYCTH_2315781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664809.1"
                     /db_xref="GeneID:11506603"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="JGIDB:Spoth2_2315781"
                     /translation="MENDRGEIVDLYVPRKCSATGRIIRAKDHGSCQITVAKVDENGR
                     AIQGENIIYALSGFVRAMGESDDSLNRLAQRDGLLKNVWSAQR"
     gene            407745..407832
                     /locus_tag="MYCTH_t133"
                     /db_xref="GeneID:11506604"
     tRNA            407745..407832
                     /locus_tag="MYCTH_t133"
                     /product="tRNA-Arg"
                     /note="Anticodon: TCT"
                     /anticodon=(pos:407778..407780,aa:Arg,seq:tct)
                     /db_xref="GeneID:11506604"
     gene            <410519..>411276
                     /locus_tag="MYCTH_2025813"
                     /db_xref="GeneID:11511474"
     mRNA            join(<410519..410733,410988..>411276)
                     /locus_tag="MYCTH_2025813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664762.1"
                     /db_xref="GeneID:11511474"
     CDS             join(410519..410733,410988..>411276)
                     /locus_tag="MYCTH_2025813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664810.1"
                     /db_xref="GeneID:11511474"
                     /db_xref="JGIDB:Spoth2_2025813"
                     /translation="MPNLVAIDVSVTDNRIRLVFSDRAVAAAYAAYLRAQDLRPPQYQ
                     TIPGYQRSPQLHTTTKEVSLSLPAFITWFITCRLPDDEDAVTFTFMPEHARYATRWAE
                     TMLLFEPVRPDHEEDEDEDDYYDDAKGNDRDYQYGAPARQRSPKQLHVRRLWNRAYLL
                     KRLEELRR"
     gene            <413057..>414496
                     /locus_tag="MYCTH_2128634"
                     /db_xref="GeneID:11506605"
     mRNA            <413057..>414496
                     /locus_tag="MYCTH_2128634"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664763.1"
                     /db_xref="GeneID:11506605"
     CDS             413057..414496
                     /locus_tag="MYCTH_2128634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664811.1"
                     /db_xref="GeneID:11506605"
                     /db_xref="JGIDB:Spoth2_2128634"
                     /translation="MRPEYLPPLIIPKRRTRTPILVATCPRRQEQEKQQQQQQQDEEE
                     KEQEQQPGQRPLPIFRPSYRTPPATLPATAFPNPPPERKPDDIDDIEAFSFYNPCLLP
                     PSPVAPPFETRSYTDPSHGIPPLEPAPAPPLPDYSPQRWRQRQRQRQEGDPLPPRPRP
                     GSAQPGLRRSTQPLNRDYRRRGGNRAAASVPPPPFRPPRTPPPARPDPELPPSPFSIQ
                     RSPSRLYARPPLRRGGPRPGAGPGTGPAAQQQQQQQQQQKHQISLPRWDTCGPPGFDA
                     SRPPSPVVAAHRRPAKPPVEWDAKSMSSSVYSMYTDDVVQSPYYSHSHNNNDDDDNDN
                     NLYDDDDDDDDGSSTPGSWGRRDGGAYVNVTPCLAVRPPGQEGRRGGGGGGEGGYKEK
                     EEAALRDLWGVIDELLGPDRRLGDYDAMSITSSMNGEMAAAAAASAAGYHSRPSAPRA
                     SHSNRESRQSGVSGEGAWWRAVRQGLLLS"
     gene            complement(414668..416072)
                     /locus_tag="MYCTH_2307978"
                     /db_xref="GeneID:11506606"
     mRNA            complement(join(414668..415407,415519..415556,
                     415642..415688,415838..416072))
                     /locus_tag="MYCTH_2307978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664764.1"
                     /db_xref="GeneID:11506606"
     CDS             complement(join(414840..415407,415519..415556,
                     415642..415688,415838..415913))
                     /locus_tag="MYCTH_2307978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664812.1"
                     /db_xref="GeneID:11506606"
                     /db_xref="JGIDB:Spoth2_2307978"
                     /translation="MSEQYVLFDLPSRDPCRCWSLNPWKTRMLLNFKGVDYRTEWVEY
                     PDIKPTLEPHVPPHPQKPQYTIPTVRFPDGRYVMESFAIAREIEAAHPTPSARLDAPV
                     VAELMAAVPRLLHKLRAVLLPGVPRLILNERSKPYWHETRSAWVGKPLDEWEREVVAA
                     GEPDWDGAEPVLREVTALLKKEAGGPFFLGNEASYADFIWGGFLIFFDRLGVSEELLA
                     RTGDADAHRALLKGLEPWTERSDR"
     gene            418725..>420012
                     /locus_tag="MYCTH_117063"
                     /db_xref="GeneID:11506607"
     mRNA            join(418725..419898,419972..>420012)
                     /locus_tag="MYCTH_117063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664765.1"
                     /db_xref="GeneID:11506607"
     CDS             join(418785..419898,419972..420012)
                     /locus_tag="MYCTH_117063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664813.1"
                     /db_xref="GeneID:11506607"
                     /db_xref="InterPro:IPR003421"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="JGIDB:Spoth2_117063"
                     /translation="MLVQQQQQQHTASIVGAGPAGFALAAGLQSQGTSVLVYSHPTHV
                     RHANQVRRNGLLRASGLMEGSTRVRVTTDMAEAVAFSRIMFLTVPSTGQETVLEELRK
                     FSLRQHAIVAVPGNLFSLIAADLHAGCILETNLSPYSCRMEGDGELRVLGKKELVFIA
                     ALQPAEGEEEEDDVVVVRRALCGEVARILSPTRLKWCSSVVEVSLANVNGVFHPLMML
                     MNAGRIESTGGDFMLYADGLTPSVANAMAAVDRVRIQIGEALGLRLDGAVAVSNECYG
                     QGFSNFVDLGRHSPPHNRLRAPPTLENRNLTEDVPDLLVSWCSLAEKLGIDASPIRAV
                     ITLAQMATGVDYLATGRNLRRLGLEHATRAELIARFGGCDSSADRQKRAV"
     gene            complement(420640..421869)
                     /locus_tag="MYCTH_2307981"
                     /db_xref="GeneID:11506608"
     mRNA            complement(420640..421869)
                     /locus_tag="MYCTH_2307981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664766.1"
                     /db_xref="GeneID:11506608"
     CDS             complement(420816..421619)
                     /locus_tag="MYCTH_2307981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664814.1"
                     /db_xref="GeneID:11506608"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2307981"
                     /translation="MGDTRELAVGYVRANETQFKAGLFLLDRLQLRPGMRVLDVGCGP
                     GNLTAHIASLVGSEGSVVGVDPSPERIGLARELAGKLAAEGKKENLTFYEGVAEDLSR
                     FPDASFDAVFVNSTLHWVQDQPRALREFARVLRPGGRVGISGGSGDFETAQERIKAAV
                     LSREPYRAYPEPAPPRFLGRAELSRLLDEAGFSGARDMVVNRIVKKAESADAMIDWLD
                     TSSSGKTYGGIPPELRPAAREEMKVEWNKLLTDDGIHMDMELLVTVAVR"
     gene            complement(<422450..>422968)
                     /locus_tag="MYCTH_2128639"
                     /db_xref="GeneID:11506609"
     mRNA            complement(join(<422450..422552,422599..422777,
                     422963..>422968))
                     /locus_tag="MYCTH_2128639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664767.1"
                     /db_xref="GeneID:11506609"
     CDS             complement(join(422450..422552,422599..422777,
                     422963..422968))
                     /locus_tag="MYCTH_2128639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664815.1"
                     /db_xref="GeneID:11506609"
                     /db_xref="JGIDB:Spoth2_2128639"
                     /translation="MTETIVDAAVEAGVRFFVPSQFGLADTHPLLQRYFPIFVGLWRD
                     WGVRGGFILDLDRKRARLIGKAVVGVLEGKAGEGKTEVRIKDVDRPHPLGS"
     gene            complement(<432625..>432945)
                     /locus_tag="MYCTH_2128640"
                     /db_xref="GeneID:11506610"
     mRNA            complement(join(<432625..432840,432895..>432945))
                     /locus_tag="MYCTH_2128640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664768.1"
                     /db_xref="GeneID:11506610"
     CDS             complement(join(432625..432840,432895..432945))
                     /locus_tag="MYCTH_2128640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664816.1"
                     /db_xref="GeneID:11506610"
                     /db_xref="JGIDB:Spoth2_2128640"
                     /translation="MVQNGGDFDLDIDMATNELDQRDKAAQARIKELENREKYSQKLV
                     NEAYTKIEALEGAKAKRIKIELPSKYGGTKEDLAGFLTNLRSYF"
     gene            complement(454417..456265)
                     /locus_tag="MYCTH_2307982"
                     /db_xref="GeneID:11506611"
     mRNA            complement(join(454417..455514,455645..456265))
                     /locus_tag="MYCTH_2307982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664769.1"
                     /db_xref="GeneID:11506611"
     CDS             complement(join(454633..455514,455645..455821))
                     /locus_tag="MYCTH_2307982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664817.1"
                     /db_xref="GeneID:11506611"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_2307982"
                     /translation="MSDPIVPTAYDPKGMKFRYLGNTGLQVSLFSLGGWLTLGGTVKG
                     SNVKEILKTAWDHGIQTFDTAEGYANGGSEVEIGKALQELGWPRDEYVLTTKIFFGTG
                     RKEPNTRGLSRKHIIEGLKASLKRLQTPYVDVVFAHRPDPATPMLEIVQAFTLAINLN
                     LAYYWGTSEWSAAQITEAIQLADKHNLIAPVVEQPQYNAFHRERFEVEYAPLFRQHGY
                     GTTIWSPLASGLLTGKYNDGIPEDSRFATNKDFFANTVKELQSEQGQAKIEKVRKLTK
                     IAERLGASVTHLAIAWAAKNPNVSTVILGATKVEQVKDNLKALDLIDKLTPEILDEIE
                     GVLQNKPKPVNTFGRDRN"
     gene            457457..458071
                     /locus_tag="MYCTH_2307984"
                     /db_xref="GeneID:11506612"
     mRNA            457457..458071
                     /locus_tag="MYCTH_2307984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664770.1"
                     /db_xref="GeneID:11506612"
     CDS             457566..458024
                     /locus_tag="MYCTH_2307984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664818.1"
                     /db_xref="GeneID:11506612"
                     /db_xref="JGIDB:Spoth2_2307984"
                     /translation="MLEVVCREPIVRDAFPNVWKGLVWLQSTQASRYRRLDVRKSGQN
                     RSREGRPGNLIKAERADSPRLHEASTLVQDIVLDVSSHRHWPGDHEAQMVRPSGPRMY
                     HNKRGLPGLLPSHCGAGRVGIASPNIDGISKPTVTSKIKETPRRKRTLPS"
     gene            complement(458072..459660)
                     /locus_tag="MYCTH_2307985"
                     /db_xref="GeneID:11506613"
     mRNA            complement(458072..459660)
                     /locus_tag="MYCTH_2307985"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664771.1"
                     /db_xref="GeneID:11506613"
     CDS             complement(458120..459301)
                     /locus_tag="MYCTH_2307985"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664819.1"
                     /db_xref="GeneID:11506613"
                     /db_xref="JGIDB:Spoth2_2307985"
                     /translation="MDDPGDHCWTWPFWKFGLKKDDLFGTLHDRYNTFASPILDPEAF
                     HHDVYEISQQANSTDEFHRLLNARKEQRLRELNETLESAAFEIIANPSLIGTEQWQHA
                     VQLFRTKSLDSLVRYYASYLPSDHPWYKSADSSSQSEAGSSVGSLTDSHGSSEDEEIP
                     FMDEPLEYPSYPKQLLPPSPRSMTMCSDSSVASPIDEAHDEFDFERSAPARALSFSES
                     EPDCCSVPGTDRCCNRDRESDCQPSSGTVPTIATRGVDSGVDAKPKPESTRGEATLPG
                     ATLDVTDSETPTPRPETHTASFFCDTKPSPSQQRRHRSLSPSRPHPLSPRELDEVLTA
                     HRDPRNRQRSRLSRKERECSPAAQRRRRGSPMDSVTRIQKPLADSGHCRFRGRKLAES
                     S"
     gene            461303..463217
                     /locus_tag="MYCTH_2307987"
                     /db_xref="GeneID:11506614"
     mRNA            461303..463217
                     /locus_tag="MYCTH_2307987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664772.1"
                     /db_xref="GeneID:11506614"
     CDS             461353..463134
                     /locus_tag="MYCTH_2307987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664820.1"
                     /db_xref="GeneID:11506614"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2307987"
                     /translation="MGDIRESSGLSEDRTEPFSQTEIQARLQRSRMEQLDAINSAVPL
                     DKLVVPLDDDIRILMRPLARDRTVRENRNVVPLSLPAETEEDETTQQVLAVRQTDRDV
                     NFTVSIPDYRNPDRRLACILFYDPSSDNQILVNRSNVPFTLSRISQEPEETRGVRYEV
                     NPEFEKSLSPGTWRITMDGTDLLDFRLLERRPVRLRAVSTASCDSSSSGSGSGSDVVN
                     SSGKRSFVPGEDDPASPEKKRRPTNGAGDKKEDSVIMFVPAGAKGKELVGATGHPLLD
                     MQSNETIEVSRGAGLVGYTLTKKDPIASTSLSSVFTAEYSGAPGRYVVAKVLKTTLPA
                     NANANEGALAKTVIRQAQTWLRELENQEKVKHKNIVQIYGGDARFLSLYMEPVEGRDL
                     SARGVWRTQGTDLFAGDRSDALRILKDTSSGLHYLHSLRLEHNDIKPGNILYSRERGA
                     VVCDMGLSSEKGASTGGGTPWYVPPEYIGLRQRGPPSDVWALGVVMLYVMRKISWPDI
                     RGDRRHPRHLYWTIAHVHEKRPNLQVTAVSQMRRWLSEVNAVRSSLDLNDKLERLVHG
                     MLAPNPRERLTMKEIVNQLFVDQGPDR"
     gene            complement(463218..464307)
                     /locus_tag="MYCTH_2307988"
                     /db_xref="GeneID:11506615"
     mRNA            complement(463218..464307)
                     /locus_tag="MYCTH_2307988"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664773.1"
                     /db_xref="GeneID:11506615"
     CDS             complement(463301..464059)
                     /locus_tag="MYCTH_2307988"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664821.1"
                     /db_xref="GeneID:11506615"
                     /db_xref="JGIDB:Spoth2_2307988"
                     /translation="MTIQTFLTLAIAGLAHAHFGIEYPPMRGDTLSSHANETWSQWTN
                     PCKPAFDISTCFHPRRLVRRPGSKYANKVKQTGAGVPSNLTGRPITPWPLTGGSLKLD
                     LHHPWTYIFVNLGLGSDVSNFNYTLTRPFWNETGNGTLCVPRLELPADLPVRDGSPAS
                     LQVVTVGEDGNALYNCADIVFREDAKVLSGDECRNSEGVTVAPVVVEADDDAAGNNTT
                     AGDKGSAGSAMGVNTAALSSVVGLAMVFVAGLSM"
     gene            465737..467478
                     /locus_tag="MYCTH_2307990"
                     /db_xref="GeneID:11506616"
     mRNA            465737..467478
                     /locus_tag="MYCTH_2307990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664774.1"
                     /db_xref="GeneID:11506616"
     CDS             466163..466969
                     /locus_tag="MYCTH_2307990"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664822.1"
                     /db_xref="GeneID:11506616"
                     /db_xref="JGIDB:Spoth2_2307990"
                     /translation="MAPLFSWRQAIVAALFVTGQAAPLLQARQHVRKSDQTQTVDSAA
                     LQTLLQGLVAGIGAGAGAPPAVTVPDIKSTQGVLAPPVLPSRGHDNDGTSGISKRADT
                     AESGESKLPEGLLEKINKDGITVKGVVDGTVNFVKPLITSQQSTDGTNDDNVDLADIV
                     GLLTGNENSAEKVENGFEGRESSLDELFGEKEGDNESGNDEEGNDEIGNDEIGNDEEG
                     DDEIGMSSSSKSKVKRKVVARAEEEEDPTLMEVLLKLLGVPNSEEESGAN"
     gene            complement(<467705..>468371)
                     /locus_tag="MYCTH_96254"
                     /db_xref="GeneID:11506617"
     mRNA            complement(join(<467705..468003,468089..>468371))
                     /locus_tag="MYCTH_96254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664775.1"
                     /db_xref="GeneID:11506617"
     CDS             complement(join(467705..468003,468089..468371))
                     /locus_tag="MYCTH_96254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664823.1"
                     /db_xref="GeneID:11506617"
                     /db_xref="InterPro:IPR007612"
                     /db_xref="JGIDB:Spoth2_96254"
                     /translation="MASYQSQAASTTITNRQLVLQVEEMLNNFTIKDTATNKTFMRSK
                     AKKLSMRGRMKVYDGNNNLLFDIIQKPFRMRPTFSIRGQDKGEIMRVKFGAMSISRTA
                     HAKFTTAEGQPVKLTMKSSLVGGMSAEIVQEPSKRPVAHIKRKMIGSGKTLLRTALGQ
                     DTYHVTVQPGVDAALIVAMCICWDTKKEQQQRR"
     gene            <469974..>471800
                     /locus_tag="MYCTH_55581"
                     /db_xref="GeneID:11506618"
     mRNA            <469974..>471800
                     /locus_tag="MYCTH_55581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664776.1"
                     /db_xref="GeneID:11506618"
     CDS             469974..471800
                     /locus_tag="MYCTH_55581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664824.1"
                     /db_xref="GeneID:11506618"
                     /db_xref="InterPro:IPR012878"
                     /db_xref="JGIDB:Spoth2_55581"
                     /translation="MGQSSWPQPFDMSAVSLIDSRWTDNQNRTVTYLKWVDVDRLLYN
                     FRANHGLSTQGARQNGGWDAPDFPFRTHVQGHFLTAWSHCYASLRDDACRDRATYFVA
                     ELAKCQANNDAVGFGAGYLSGFPESEFDALEARTLSNGNVPYYAIHKTMAGLLDVWRH
                     VGDTTARDVLLALAGWVDSRTGRLSYEQMQAVLGTEFGGMNDVLTELSLQTGDPRWLE
                     VAQRFDHAAVFDPLASRQDRLDGLHANTQVPKWIGAVLEYKATGTARYRDIAANAWNF
                     TVGAHSYAIGGNSQAEHFHEPDAIAKYLLEDTAEACNTYNMLRLTRELWMLDPASTAY
                     FDFYERALLNHLLGQQNPADPHGHVTYFTPLNPGGRRGVGPAWGGGTWSTDYDSFWCC
                     QGTALETNTKLMDSIYWHDDDDDADDDGAANLWVNLFTPSVLRWTERGVTLTQETAFP
                     AGSDTITLTVGGEPTGGWDMHVRIPSWTTSGAEVLVNGEKAGVAAAVPGTYVSIRGRD
                     WKAGDVVTVRLPMTLRTVAANDNPGVAALAYGPVVLSGDYGSASLASLPTLDLDSVRR
                     AKGNGLVFTATADGQSVTLGPFYDAHDSNYNVYWVTKGRLPE"
     gene            <472133..>473748
                     /locus_tag="MYCTH_2139925"
                     /db_xref="GeneID:11506619"
     mRNA            join(<472133..472140,472988..473274,473342..>473748)
                     /locus_tag="MYCTH_2139925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664777.1"
                     /db_xref="GeneID:11506619"
     CDS             join(472133..472140,472988..473274,473342..473748)
                     /locus_tag="MYCTH_2139925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664825.1"
                     /db_xref="GeneID:11506619"
                     /db_xref="JGIDB:Spoth2_2139925"
                     /translation="MAAPANAAVRETRRQSTPLELERMDVSKALIAAEHSRRQFILNF
                     AASRNTQLLIPGKKSDAVKVAEEWVAAWLSQNGYQAVKNDFFRYTVDARLWATHVGDD
                     IDFPFAFMRGRFETSVSDSSEADDKRPDSKTSLVAKEIEIGEGDINSTPPAQPTTPAG
                     LRSPRKQQSAPSTPLARRQRSTTYPKPHEISLRDRSMSLTGFDAMKSPKAGQDKVPFL
                     TRLGRSWSRRLPSAS"
     gene            475372..476608
                     /locus_tag="MYCTH_88807"
                     /db_xref="GeneID:11506620"
     mRNA            475372..476608
                     /locus_tag="MYCTH_88807"
                     /product="NADP-dependent dehydrogenase-like protein"
                     /transcript_id="XM_003664778.1"
                     /db_xref="GeneID:11506620"
     CDS             475484..476227
                     /locus_tag="MYCTH_88807"
                     /codon_start=1
                     /product="NADP-dependent dehydrogenase-like protein"
                     /protein_id="XP_003664826.1"
                     /db_xref="GeneID:11506620"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_88807"
                     /translation="MPVYVITGTRAGIGLEHVRQLSQAASNTVFALVRSAAGDLATLK
                     SIQQTAAAKVHILECDVSSESSIAALPDRIREASGDANIKINTLINNAAVLHAREQTA
                     LTLTPAALNDHMRSNLLGPALVLQALLPLLAPGARVANISSGAGSLTLLATGRITPEI
                     TPYSLSKAALNMLTVHQQAQLRARSGGGGSGIVVVAVDPGHVKTEMGGPNAVVEVEDS
                     ARAVLKLVEGLTERDGGKFWLYNGEELPW"
     gene            complement(<477265..479304)
                     /locus_tag="MYCTH_84164"
                     /db_xref="GeneID:11506621"
     mRNA            complement(join(<477265..477383,477490..478575,
                     478701..478910,479014..479304))
                     /locus_tag="MYCTH_84164"
                     /product="sugar transporter-like protein"
                     /transcript_id="XM_003664779.1"
                     /db_xref="GeneID:11506621"
     CDS             complement(join(477265..477383,477490..478575,
                     478701..478910,479014..479239))
                     /locus_tag="MYCTH_84164"
                     /note="Sugar transporter-like protein"
                     /codon_start=1
                     /product="sugar transporter-like protein"
                     /protein_id="XP_003664827.1"
                     /db_xref="GeneID:11506621"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_84164"
                     /translation="MPKARSRVPVKVNVGTSADPIVTRLVQEDKIPWYKKPNLRRMYI
                     FLFLCCMGVEMTSGFDSQLINTLQYAETFHKYLGNGRKDEDGNYAIEPGLLGFVNSCY
                     QLGSIFAVPIAPWFAQRFGRRWSIMLGSLIMVGGAIIQGFAQHVAMYIIARMILGMGI
                     LFCIISGAALIGELGHPKERAVLTSLFNSSYFIGQILASAITIGTTEMKTNWAWRLPS
                     LLQICPSLLQIVTVFFLPESPRFLISKDRDDDAKEVLIKYHAEGDASSLLVQAEIVQI
                     RETIRTEMEVSNQSWMELVSTYGMRRRLVITLFIGLFTQLSGNTLLSYYSGKLFEMMG
                     YTEASVKTRINVANACWSLLNATTIAFLVPYFKRRHMFMTSALSMCAVFIAITVSLER
                     TQAAQDAGFKNTAAGISGLFWYFAFAPCYNMGNNALTYTYLVELWPYSHRSRGIGVQQ
                     IFGKLGGFFSTNVNSIALDAIRWKYMAIYCGWIFFEFLIVFFLYPETSGRTLEELAFL
                     FEDASLNEKAAAAVEKQIHYGDEKVVHEEGQPAAKSVV"
     gene            <479414..>479713
                     /locus_tag="MYCTH_2128653"
                     /db_xref="GeneID:11506622"
     mRNA            <479414..>479713
                     /locus_tag="MYCTH_2128653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664780.1"
                     /db_xref="GeneID:11506622"
     CDS             479414..479713
                     /locus_tag="MYCTH_2128653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664828.1"
                     /db_xref="GeneID:11506622"
                     /db_xref="JGIDB:Spoth2_2128653"
                     /translation="MNTLGYATILPSRSSKQHTLDLTSQTPELQPASVPDVPSSPASA
                     PQLQGSPSSMCARPCLGAGDLPVGRWLGCNPRSPVAQPWFVPYRGEPVAHSVHYA"
     gene            484404..485713
                     /locus_tag="MYCTH_2307998"
                     /db_xref="GeneID:11506623"
     mRNA            484404..485713
                     /locus_tag="MYCTH_2307998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664781.1"
                     /db_xref="GeneID:11506623"
     CDS             484434..485552
                     /locus_tag="MYCTH_2307998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664829.1"
                     /db_xref="GeneID:11506623"
                     /db_xref="JGIDB:Spoth2_2307998"
                     /translation="MPYTPSGGIGTNGSDPIYKVASDFDYQSLALALYHEWIELDLFH
                     WGLATFSDEEFEAYGITGEDRHLLQHMADQEIGHASVVANMLGPSAPKQCTYNYPVSN
                     VREYIDFNQKLTRWAEAGVYGFLPHLNSGPAANMLLQSITVEARQQLIFRQFGGQFPM
                     PEWHTPGIPQSWAWTLLAPYISSCPHNQTRLVWQNFPALHILNQPNPARIDGSAVWGE
                     TTGGYANTLSTEGIPEDELCVNATDDELSDCPAAISQNRSIPLSYPGREVFLRWDAPG
                     QLVGPNNSYVTTTSAAEPRFAAWLSQLNVTYTPLLGVSLEHRTAYTIQPNVSTWKNDP
                     AVNGTMFLALTDVDLYVTPYNVSMINPHVAALAVYQAG"
     gene            complement(<486089..>486391)
                     /locus_tag="MYCTH_2040301"
                     /db_xref="GeneID:11506624"
     mRNA            complement(join(<486089..486154,486242..>486391))
                     /locus_tag="MYCTH_2040301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664782.1"
                     /db_xref="GeneID:11506624"
     CDS             complement(join(<486089..486154,486242..>486391))
                     /locus_tag="MYCTH_2040301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664830.1"
                     /db_xref="GeneID:11506624"
                     /db_xref="JGIDB:Spoth2_2040301"
                     /translation="QESQECTRELIRTDDCAAVINPTACYNQFRWTSRTLSCIDGVDD
                     AERKRRACLCCSCVGDVMCNWVRQNRFC"
     gene            <487242..>488568
                     /locus_tag="MYCTH_2128656"
                     /db_xref="GeneID:11506625"
     mRNA            join(<487242..487397,487512..487703,487811..488441,
                     488531..>488568)
                     /locus_tag="MYCTH_2128656"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664783.1"
                     /db_xref="GeneID:11506625"
     CDS             join(487242..487397,487512..487703,487811..488441,
                     488531..488568)
                     /locus_tag="MYCTH_2128656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664831.1"
                     /db_xref="GeneID:11506625"
                     /db_xref="JGIDB:Spoth2_2128656"
                     /translation="MKWNVLTAAAGLVAPSHALLRFGCSQLTVQRLDPLVTPGENPSP
                     HLHQIIGGNSFNVSMPYPEHDLPTRSTCTSCQFTEDFSNYWTAVLFFRARNGTFKRVP
                     QLAQAGMEGTNGGMVVYYMSDALFDTAQRSSVTAFKPGFRMLIGDATFNTREQAREFR
                     QITYTCMENQASRQPESVGFPRTPCKLGIMANHRFPTCWDGVNLDSPNHRDHVAYPES
                     GTFESGGPCPASHPVRIPQILLETVWDTSGFNREEDWPEDGSQPFVWSTGDSTGYSSH
                     ADYVFGWEGDSLQRAMDAHAYVVAPMLKTQTIADQNKCTVRDMVGEDIDSWLPELPGG
                     NQIY"
     gene            490122..490862
                     /locus_tag="MYCTH_2308000"
                     /db_xref="GeneID:11506626"
     mRNA            join(490122..490428,490538..490862)
                     /locus_tag="MYCTH_2308000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664784.1"
                     /db_xref="GeneID:11506626"
     CDS             join(490234..490428,490538..490681)
                     /locus_tag="MYCTH_2308000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664832.1"
                     /db_xref="GeneID:11506626"
                     /db_xref="JGIDB:Spoth2_2308000"
                     /translation="MFRPQLDDKQREWLRAIVWNFGSAAEVPRGSRIDHGLGGILVLE
                     DVEGRRRKGTMFFSGMCNTRWWIDPETGIGAIMLVNVIPYGDSAALALFNELERAVYG
                     NLVPAWKASK"
     gene            complement(<490967..>492399)
                     /locus_tag="MYCTH_2128658"
                     /db_xref="GeneID:11506627"
     mRNA            complement(join(<490967..491954,492092..>492399))
                     /locus_tag="MYCTH_2128658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664785.1"
                     /db_xref="GeneID:11506627"
     CDS             complement(join(490967..491954,492092..492399))
                     /locus_tag="MYCTH_2128658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664833.1"
                     /db_xref="GeneID:11506627"
                     /db_xref="JGIDB:Spoth2_2128658"
                     /translation="MAPNNRSPGLPAIPDMVQGETEHLIPELEEALSSTGETIVTFED
                     DECRPARSHSTSTQNSRQPRRTVLPSRFPSTSSSTSPAFYAALPVSPRHYDVTCQVQP
                     LQLPSSKKKVYESWTITYHHPAPRPPVRVRVLGLTLFRLSGRPSEGSPGEGEGGSVLS
                     VVPNTHFSQDELAGTVAMHEASVAAHVARRNKGNKGQGRRWWWRPKTTANTLCKPRLV
                     GSGSGSGAASRGRGGCWYVNDQEAQDGGDGNGTGTGTGTGTAKTGIAIGIGTGSWDAA
                     VYAADLEKRIRRLDWKVQDEIYELLSDRVQSSSNAFRRRDWRVVVLTEVPGGELTDQP
                     TGFRAFGEREKGGRRRRWGRRESRGSTCRTPPPPPPHDMPVTEYRLILRGTETKANDQ
                     GWGYYNRYSRPWRDADEKELGHRRRWSTMTGKNEKYVDF"
     gene            complement(493262..494785)
                     /locus_tag="MYCTH_2308003"
                     /db_xref="GeneID:11506628"
     mRNA            complement(493262..494785)
                     /locus_tag="MYCTH_2308003"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664786.1"
                     /db_xref="GeneID:11506628"
     CDS             complement(493553..494473)
                     /locus_tag="MYCTH_2308003"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664834.1"
                     /db_xref="GeneID:11506628"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2308003"
                     /translation="MTVQKILIVGATGQQGGAALKALLELPDSASRFHVLALSRDVES
                     ERAKRLMSAHNGAVSLVEGDVANPKAIFASQPAGSIDSIFIVTTLGGKISEEQQAIPL
                     IDEAVAHGVKHIVFTSVDRGGDAKSWDNPTKVKHFLAKHKVEIYLRDKAAKEGGNKFT
                     WTILRPVAFMDNLNPGFLCSLFTSMWDTALSPDTKLQLVSTRDIGVFAAKALSNPSRW
                     AGKAVSLAGDELTLAEAREVFQKVVGKPLPQTWSLLGRGVLWGMKEMGDMFAFFEKEG
                     YGADIEALKKEAPVQNLESWLRNDSKWLKQ"
     gene            495322..496374
                     /locus_tag="MYCTH_2308004"
                     /db_xref="GeneID:11506629"
     mRNA            495322..496374
                     /locus_tag="MYCTH_2308004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664787.1"
                     /db_xref="GeneID:11506629"
     CDS             495490..496143
                     /locus_tag="MYCTH_2308004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664835.1"
                     /db_xref="GeneID:11506629"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Spoth2_2308004"
                     /translation="MNRLFGTNAPKAPKPTLNSAISNLDSRISSIDVKLAAINAELQG
                     YQAKLSNMRDGPGKTALKQKALKILQRRKQYEAQRDQLQSQVWNMEQAQTMQDNLKNT
                     MVTIDALKSTNKALKKEYGKVDIDKIERLQDEMADLLDVGNEIQESLARSYDIPEDVD
                     EAELDAELEALGQEVELEREMAGPGTEGALPSFMQDEVPEFIDEPPAQAGKVSEAAG"
     gene            complement(496375..500161)
                     /locus_tag="MYCTH_2308005"
                     /db_xref="GeneID:11506630"
     mRNA            complement(join(496375..499569,499636..500161))
                     /locus_tag="MYCTH_2308005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664788.1"
                     /db_xref="GeneID:11506630"
     CDS             complement(join(496607..499569,499636..499828))
                     /locus_tag="MYCTH_2308005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664836.1"
                     /db_xref="GeneID:11506630"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2308005"
                     /translation="MAGFNPQPDEGYSEDPLTALSSAPPLSLKSREDAVSALGSARSR
                     DDFPLWLVEHISNLSLARKTELAMALLNDLPTSVISQIVENLHPRLYIDFVQYLPPEV
                     CLKILEYLDPVSLINVARCCRAWYVLALDRKLWEQLYFLEGWKANPEEIAKAEREMNG
                     PFSSTHGVLRRMQSEEDAHAHKKRAISLSPPLGGQTDTVMADAETNAHHQEATETGPT
                     ETSIFGGPRRPVLKTGISQLMGDLEMSSAVSRSNSKGKSADKGKGKAPSSAWPEAPHG
                     SIRNSFLQTVMEPPRLAKSTLWTWDGPSGRYKINWKYLYTMRRRLESNWERGRFLNFQ
                     FPHPAHPEEGHGECVYSLQFNSRYLVSGSRDRTIKIWDMKTRRCLRTLAKHRGSVLCL
                     QFDSDPEEDLIVSGSSDSDVIIWRFSTGEALQTLNHAHRESVLNVKFDKRILVTCSKD
                     KTIKIFNRKPLRHGDLGYREVDPVPTNVKNYGYSIPMTPDDFPVIPAWTMIGCLEGHS
                     AAVNAVQIRDREVVSASGDRHIKVWDWPTQVCNRTIVGHNKGIACVQYDGRRIVSGSS
                     DNEVKVFDRQTGLEVANLRAHSSLVRTVQAGFGDLPHSVEDDLAEAKKVDQEYFRALE
                     LGLLKDRDRPRPGRRSGNAGSRRPEDICAYGAKLPPGGGGGKYGRIVSGSYDASIIIW
                     RRDKEGVWKDQHHFKQETAAMAALQQDRQEAPTPLHPSVQGLASREALRAMRAASSGV
                     STGTFDGTGTSMPAPSTGSRLQTASAPPGGLTGPTLPPISALTTELNQADGSVAAFQQ
                     LRQVIDSAVEGGQQALAQAIAAHPAILTCRAYVETAIDRQQNPVVRSQLRQTYATALM
                     RDQFEQARQRREALRSQEATGSTATAAGQVAAEGVAAAQSGARLTPAQLAAAAAHQAH
                     AHVPHGAPMHQVPSPVPVVAPAAGAVASSLGSFGGSAAGGSTAAPGLGAAPAAPPPVG
                     PQLPVQAQAQQQHHHHPHIAHAPSPFEVHDPANPARVFKLQYDARRIICCSQRSVIVG
                     WDFCNGDSELEEASRFFGPVD"
     gene            501957..506801
                     /locus_tag="MYCTH_2144606"
                     /db_xref="GeneID:11506631"
     mRNA            join(501957..503137,503204..503746,503798..504040,
                     504103..504289,504341..506801)
                     /locus_tag="MYCTH_2144606"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664789.1"
                     /db_xref="GeneID:11506631"
     CDS             join(502541..503137,503204..503746,503798..504040,
                     504103..504289,504341..505863)
                     /locus_tag="MYCTH_2144606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664837.1"
                     /db_xref="GeneID:11506631"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="JGIDB:Spoth2_2144606"
                     /translation="MTHASLLRMNTGPAATMDAIDRSNTMGVPSAPRTSQLSGSATFP
                     TTNSSSSVNSASTAPTPPSNGQVVATSNIINQKADASRSLYQICLSLKQRLAKVPGFE
                     PYMEQLEQMAADPDEGGPVESLWKLLRTGYPLLAIYNCLQPETPLQVQEGPEVSQAKR
                     SKIAILRFVEACKSKLMLPTSEVFIITDLAGNDTTGFVKVTSVINHVLDLAEQRGLLL
                     QIQPYPEDDTIESGSQMSYRDYIVRELVDTERKYVQDLENLHDLKKTLEQNGIITGDI
                     VHDIFLNINAILDCQRKFLIRVETTNSMPPSRQEWGSPFVAYEETFTTCYQPFIANQR
                     KAGQVASQVFDKIQAADHPVACDFNTLDGFLLKPMQRLVKYPLLLKDLLKKSEDEATK
                     ADLTAGIEAAERVLQKANEAVNRDLLNEAVKDLVNRVEDWKKHRVDQFGELLLHGVYT
                     VVTGKGDQEKDYEIYLFQCILLCCKEVVPGKTKDKKDKTRSTGPKVRNKNAKLQLKGR
                     IFMTNVTEVVAMSKTGSYTVQIWWKGDPGVENFTIKFQNEDTMRKWAAGLDKQRKENA
                     PQHRPNTDAATQFTYLDIVGSMENPYAQEAQEDDDDEPDGNSTALATTPQQNTLAAMP
                     GTIQRNTSSTSLRQRSMTGDSTHSIPASSRVPPPRFPMALPPTPLSVQTQGAGQGSPL
                     PKAGESYFSPLVESPASSRASTTSGVFANSGYPFPKTTTPQPWNSEDRYTAPAMPRAP
                     SRDGSSPANGFGAANGRNPRGPSMPVMPRDNTAQSSQGPARVRSHSTPDINGQASRNA
                     QAIPNVPSIPAHLHQNHPPYQTHARHDSNIPRSNTGSPANELPLRTNTNSPGTQRGRP
                     YGGTMAQFPTQPVYPRQGTPGSATNLPPPGPPPPGVPPLAPVDPSRSITQGLGTAPLT
                     SSQGAIPPTPDIAMPNQLKVKVHYSSKPNTYVTLVAQYNITYQSLVDRIDVKLARLTN
                     SSIARGDLKLRYQDEDGDFVTIESDEDIQIAISEWRESQSNMPGGLGEIELFCVGDLN
                     "
     gene            complement(506844..507606)
                     /locus_tag="MYCTH_2082154"
                     /db_xref="GeneID:11506632"
     mRNA            complement(join(506844..507393,507480..507606))
                     /locus_tag="MYCTH_2082154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664790.1"
                     /db_xref="GeneID:11506632"
     CDS             complement(join(507224..507393,507480..507588))
                     /locus_tag="MYCTH_2082154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664838.1"
                     /db_xref="GeneID:11506632"
                     /db_xref="JGIDB:Spoth2_2082154"
                     /translation="MTNKNPIRLPPLRVLRVRHPNRPESNPCLTVMSSVLACWASAGH
                     TGRGCTTVEQALRACMDAPPPPKKSSNTINYHLARFSKRLIAQGKKKK"
     gene            507893..512609
                     /locus_tag="MYCTH_2308011"
                     /db_xref="GeneID:11506633"
     mRNA            join(507893..508138,508206..508513,508571..512609)
                     /locus_tag="MYCTH_2308011"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664791.1"
                     /db_xref="GeneID:11506633"
     CDS             join(508080..508138,508206..508513,508571..512178)
                     /locus_tag="MYCTH_2308011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664839.1"
                     /db_xref="GeneID:11506633"
                     /db_xref="JGIDB:Spoth2_2308011"
                     /translation="MTESNSGVQATPAADMLSQDNPITAECFLPPRFSCPRAWQRVAV
                     APVPGMRRQSRIWKRVGGLTVGTGQSPYIRAMAELERQGMGPRKRARHAHHLQAWGDA
                     KWDPRAEERPDGHQDIVEAQGMVSDAAHKPTTTTNNTKTKPATYPEESLKWVPRKRHN
                     SRWPLAPKSEAGSPTTHLQHSTESERLVSTEPVEATAKVDEEQMSKRSTRRLSRRISL
                     FPGDESPRRLSTIALSPAGSSAPAASPVKRSSVALSPTKVADSPLRSFRVNATPTKVV
                     LESPKVSPPEKSPAKLQAPLTPDTRPSSPPASPPASPAPLMFDQPVPDAQAEPQHEVR
                     RRLSLQSARRSERGSNGALRLLALKRGTDNLNRRHSLTTIPAIAVGDGVRGESKSRRK
                     TMDVFSSGLEATGGNAEDARTTGATPDHHRAEDVVEIDMKTRLDIFGQPPVTAAANPP
                     LLSSDGQSPLTSGELGVAEKVEVEAEAEQATPCCQAATTSMAAETNEVPALTRETSPR
                     LAESASVEGGSESDAVRLPDANELPCAAHEVSSDEGSPAPDDDLQEATQNLAVETNPH
                     ACVEMEHLSEQEMIEAQFTNGGSPVANVEQSESTTNADSSASSPASPRLRSDTPNLGA
                     KATDAVQDEQPVVAASVTESHVCSGNVVSAANGTAVGTELPQHSTENTATDDLDENAR
                     ATDDQAANPPKDCGVNPCPTGIANIQLPESSSGTDRSTPPSPGTPCSTPTARSTEPME
                     GVSNPQNQGDGLSPSGESSGFTPINKRRVPPPSDLPTGLRDDEEPAADHESDELDADE
                     VVEEDVPQEEGDEDIVAMDEDMTVEAPKPECDTLQLHARQDDSETEMLRNFVTRVAAG
                     KSAKAAAAAAALAKKIARRSSSLGSISSSTGSPVGRAGLETPGSRQPLGVRSPNSASP
                     AKKRKADAFEDDLAKEDSSAEPCAEPTDGPRLKKRRKYPESILKTAPEPAAPSSEANS
                     APPSNITTSLLSPKSGPRRSTRARSTRVALKPSAPSANSIAFSMIPVRLPGMGAMDEP
                     AMASDAHLSAARQRSEEKDLAAVTRANTRKNKGGAVPPPVVLAKQAEDPAGWRMRELK
                     GVWEAKERRKGAALSEKGPEAEEEGGGKGKKGKKVKEVRWAEELVRYQPYEEGGGMFS
                     GMARALLADVMADDGVDEIAEAEPPALAEPAVEKTARVAARKAGSGRKSSTTGEAAPA
                     PPAAPASTRRTRSSKLPPPTPVKKLRGAGKPAAEKSPPAEKTEPAEKPAATPSLRTRA
                     RSLPKRAAAPAPATAPATVDPSPATASSSTRTGMATRRTRVTKLGMSGNGTPAPKRRG
                     KAAA"
     gene            513153..513236
                     /locus_tag="MYCTH_t134"
                     /db_xref="GeneID:11506634"
     tRNA            513153..513236
                     /locus_tag="MYCTH_t134"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:513186..513188,aa:Lys,seq:ctt)
                     /db_xref="GeneID:11506634"
     gene            complement(513531..515716)
                     /locus_tag="MYCTH_2308014"
                     /db_xref="GeneID:11511475"
     mRNA            complement(513531..515716)
                     /locus_tag="MYCTH_2308014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664792.1"
                     /db_xref="GeneID:11511475"
     CDS             complement(513801..515474)
                     /locus_tag="MYCTH_2308014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664840.1"
                     /db_xref="GeneID:11511475"
                     /db_xref="JGIDB:Spoth2_2308014"
                     /translation="MKANTTRRPRLLLFAGLSCLLLGNAATAQSTCYNTRGEEDPNLQ
                     PCSAPGADADAGEATWCCARGDTCLSNGLCLSPGSSNLMTQQGCTDKNWGGSCKKYCP
                     ASDGKLFSPPSDFERAGAHSHQTNAFLPPPDQKLTEIPLVPCPASFNSDTNDVKFCCG
                     PDPSSCCEESASWISLPAGTIVPSQANDDSTSSSSSSSSSSSSDSDNVRYSLRIGLGI
                     GLGIGVPILLVLLAVAYLLAQPLHSRSGGRHGSGRRKGGGGRGGDWDGDDVDDGTNTE
                     KTSDTYHTYPPRSYFARTAGGVGGGGGGSGGGTRTHTTRPRRKSFGNHTHVRGGFASS
                     SSSSSPAADDEANHHGGRDDQHTHPAIALWSPHLHHHHHHHHGTGGIQSARSVATALA
                     QWARSPFGFGGLEPPLPGPENPREMDGSGSGSGSGRSARAHGGSGGGSGSGSGMGETT
                     PSRLGAAELPSPDLCRLEEGGGGGGGGGEVGGHGPGPAASSPSSSSPSAPGGGGGGGI
                     SSGGGGASGQAAWHAGRRVHVAAEEVELPTPDTPVRPDQDVEKGLGGKK"
     gene            complement(<516948..>517490)
                     /locus_tag="MYCTH_2067166"
                     /db_xref="GeneID:11506635"
     mRNA            complement(<516948..>517490)
                     /locus_tag="MYCTH_2067166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664793.1"
                     /db_xref="GeneID:11506635"
     CDS             complement(516948..517490)
                     /locus_tag="MYCTH_2067166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664841.1"
                     /db_xref="GeneID:11506635"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="JGIDB:Spoth2_2067166"
                     /translation="MAAQPDFLWIKNDMSPDGRVFRVSRQAAQHSTILRALIEDFEGI
                     DLWKKEQCIPIKIHVSDQCLSDVLQWAENTKTAPEKGENADNNKQVELAAEDMHFFRE
                     AITTSEKLYELLMLTDYLGIVPLYNMACQVVVNMIMGKSAEQIRRMLGISKDFTPEQE
                     EAIRAETAWAYDEEQPPLDR"
     gene            complement(<518434..>519132)
                     /locus_tag="MYCTH_53945"
                     /db_xref="GeneID:11506636"
     mRNA            complement(<518434..>519132)
                     /locus_tag="MYCTH_53945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664794.1"
                     /db_xref="GeneID:11506636"
     CDS             complement(518434..>519132)
                     /locus_tag="MYCTH_53945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664842.1"
                     /db_xref="GeneID:11506636"
                     /db_xref="JGIDB:Spoth2_53945"
                     /translation="QVIVAQLTLFFFHAEDLLGHKPDVLRRLQLNVATGQPCGDPVLD
                     WYARELTPRLWSVFDPLVANMIVVACYDFINGIGIEQLTECASVHPQAPNFPDWLRFK
                     TGLSPMYSLLALARASDLKLPTGGLANYVQVIADVITFTNIVNDVISFYKELLAGEKA
                     NYVQMRAQKDKVDVLAALRTLADEGIRIRDRVLATLADEPEYLANFDAYAKGITHFHT
                     SSPRYRLCELFGKP"
     gene            521010..522579
                     /locus_tag="MYCTH_2308015"
                     /db_xref="GeneID:11506637"
     mRNA            join(521010..521583,521666..522579)
                     /locus_tag="MYCTH_2308015"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664795.1"
                     /db_xref="GeneID:11506637"
     CDS             join(521088..521583,521666..522240)
                     /locus_tag="MYCTH_2308015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664843.1"
                     /db_xref="GeneID:11506637"
                     /db_xref="InterPro:IPR004119"
                     /db_xref="JGIDB:Spoth2_2308015"
                     /translation="MSGSDSEQLPALPSDLTSEWLGSKLGHKIKRAENTRTIWGTASK
                     LFFAITYEDASTDERPTHICVKGVFDPRMMQAQPWTVSLAQREADFYSKLAPNIKNMI
                     FPKAWWSGTSDKQGIAIMNDLTKEGCSFPAEVASYPAEQVMNGVEQLAGLHAQYWGQS
                     QEDHPWIWNNYDPAMKFMCASWDEVVRTPGRPQLPEYLMDGKRCNEALDRYYAERNPR
                     FRTLLHGDTHIGNVYFTADGRIGFLDWSAFHFGSCFHDVVYHMTAMLSVEDRRAHEME
                     ILDHYLETLHRLGGPKFDRHNDPEVMIEYRRSFMTNVIWLICPDGLQSKERVAVLCER
                     TVAAYDDHKVIDCILGQPKPHA"
     gene            523574..525346
                     /locus_tag="MYCTH_2308016"
                     /db_xref="GeneID:11506638"
     mRNA            join(523574..523894,523978..524536,524610..525346)
                     /locus_tag="MYCTH_2308016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664796.1"
                     /db_xref="GeneID:11506638"
     CDS             join(523712..523894,523978..524536,524610..525055)
                     /locus_tag="MYCTH_2308016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664844.1"
                     /db_xref="GeneID:11506638"
                     /db_xref="JGIDB:Spoth2_2308016"
                     /translation="MAKDLTTTTFEPIQPEGLALSMLVTTVVFTILSSIMVCLRFYVR
                     ITLRSFSVEDWLMLAGWIVNLGHNAAVIVLSFCGIGSHDDVITVGMMYKMGLWTIIWQ
                     FLYVLDGALIKSSIIWTLLRLAKGLNKTYTYILWALFALGWVVWQISWPVAIFQCKPV
                     AAAWGEPGDCTSGQRVILNVSYFVSAANIFTDVSTSLVPIFLLRHTRMPTKLKLLTMG
                     VLSLGIFASVATVIRIAYTWAYTATVDKYYTIAKIVMLTVLECDLGIIAGSMPMIRRL
                     FRALATSHGSNEVTPGHSGDVNLVTIGGTGGRARRTTRIKLANTANDTIIGEHQDKES
                     NDDSDSTRRIIQVTREVKQDTSVSHRGGPDNQFQVAVSGSGGPGQNFHLPISTRNTGP
                     SYE"
     gene            <599057..>599260
                     /locus_tag="MYCTH_2026083"
                     /db_xref="GeneID:11506717"
     mRNA            <599057..>599260
                     /locus_tag="MYCTH_2026083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664797.1"
                     /db_xref="GeneID:11506717"
     CDS             <599057..>599260
                     /locus_tag="MYCTH_2026083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664845.1"
                     /db_xref="GeneID:11506717"
                     /db_xref="JGIDB:Spoth2_2026083"
                     /translation="DHKIKLKERVRLKFFKIYYTSQIQNEELKQYLEENLRRGYIRLL
                     ISLAGYLILFMPKKDGKLQLYIDY"
     gene            complement(<685550..>687811)
                     /locus_tag="MYCTH_96234"
                     /db_xref="GeneID:11506718"
     mRNA            complement(join(<685550..686788,687629..>687811))
                     /locus_tag="MYCTH_96234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664798.1"
                     /db_xref="GeneID:11506718"
     CDS             complement(join(685550..686788,687629..687811))
                     /locus_tag="MYCTH_96234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664846.1"
                     /db_xref="GeneID:11506718"
                     /db_xref="JGIDB:Spoth2_96234"
                     /translation="MVQNGGDFDLDIDMATNVTAEQLLAQLGQLQQRIQELDQRDKAA
                     QARIKELENREKYSQKLEIAAIDETTKNVTEVAATSYEDKDSDTDSLGHDGNGEDEQA
                     PYSELVTVDPETGLAEWDMAGEYAPPISILPILRQWGFTVTQRRDGSWTTDTQGIERP
                     GPNALFLQERIEWYRNEVFRLNTELRERDGRLTRLAQQSDEMKDEMRELRRIVETIKG
                     EQPVTYDGPDSYAEYFDDQQLSHDVRNPEYQFMRANRGKDERTWESYWKKHSYLSIGV
                     PTAHVQWEGFGKEFQYLPGDATRLHPRHEAHAQVPWFQCVAHECRYHFRDKFENNHWP
                     TRQENRDGGLCPVEWVYDAGNRAAELLWKIEARDLESITIVPRRAWPRHCGTGRDTWD
                     SCWSNDCLYHADEKKLRIRELQMKLWHARRKAERTQWWEAASTQWLTEMSTIDEAAIS
                     RTTEEVSTDLGNGSGPFEGPGNH"
     gene            700951..702131
                     /locus_tag="MYCTH_84133"
                     /db_xref="GeneID:11506719"
     mRNA            join(700951..701603,701723..702131)
                     /locus_tag="MYCTH_84133"
                     /product="carbohydrate esterase family 16 protein"
                     /transcript_id="XM_003664799.1"
                     /db_xref="GeneID:11506719"
     CDS             join(701027..701603,701723..702054)
                     /locus_tag="MYCTH_84133"
                     /note="CAZy_ID 267909"
                     /codon_start=1
                     /product="carbohydrate esterase family 16 protein"
                     /protein_id="XP_003664847.1"
                     /db_xref="GeneID:11506719"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Spoth2_84133"
                     /translation="MGRFLTTTALALLATGGAATARPIRACDVSTKYLITFGDSYSQT
                     GFDVTGTKPSASNPLGNPPLPGWTASGGLNWVGFLVSEFNTSTTLSYNFAYGGATTNA
                     TIVPPYQPTVLSFIDQVAQFSGSIARKPDYAPWNADNALFGVWIGVNDVGNVWWDPNY
                     DSLLEQIMESYFGQLQILYDAGARNFVLLSVPPIQRTPAVLLNNSPENQKAEALAVDK
                     YNEALAANLEAFTDKNGGITAKIVDTGVPFNTALDNPTDYGAPDATCYNSDGKSCLWF
                     NDYHPGIEINRLVAQAVADAWKGSFF"
     gene            complement(<705341..>706030)
                     /locus_tag="MYCTH_2128682"
                     /db_xref="GeneID:11506720"
     mRNA            complement(<705341..>706030)
                     /locus_tag="MYCTH_2128682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664800.1"
                     /db_xref="GeneID:11506720"
     CDS             complement(705341..706030)
                     /locus_tag="MYCTH_2128682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664848.1"
                     /db_xref="GeneID:11506720"
                     /db_xref="JGIDB:Spoth2_2128682"
                     /translation="MNLIALLLTLLLFLLPVAISLPATTTTDTDHPLRQPAPHQNKRM
                     RGMAAPPMMMPGASRPGPRMMVKRDDGDGRGGKDGKDGYDRDGKDRDGKDRDGKDRDG
                     KDRDGKDRDGKDRDGKDRDGHDRDGKDRDGHDRDGHDRDGHGRDGHGRDGHGGGHGGG
                     GHGGGHGGGHGGGHGGGGGGHGGGGGGHGGGGGGHGGGHGGGGGGHGGGHGGGGGGGH
                     GGGGGGHGGRA"
     gene            complement(708317..710965)
                     /locus_tag="MYCTH_2308030"
                     /db_xref="GeneID:11506721"
     mRNA            complement(708317..710965)
                     /locus_tag="MYCTH_2308030"
                     /product="glycoside hydrolase family 94 protein"
                     /transcript_id="XM_003664801.1"
                     /db_xref="GeneID:11506721"
     CDS             complement(708399..710774)
                     /locus_tag="MYCTH_2308030"
                     /note="CAZy_ID 268064"
                     /codon_start=1
                     /product="glycoside hydrolase family 94 protein"
                     /protein_id="XP_003664849.1"
                     /db_xref="GeneID:11506721"
                     /db_xref="InterPro:IPR010383"
                     /db_xref="JGIDB:Spoth2_2308030"
                     /translation="MRKEGSLLYPSNNGARYELTSPTAMPKAGGFLWNQKMMIQITCR
                     GYATAQFMQPEPAKYAYAPNIEAKTFMQPEPNYYAHHPGRFVYIKDLETGQLFSAPYE
                     PVRATADRFVFSVGKTDVAWVVEHMGIRVEMVMGLPTHDVAELWTIKVTNISGRSRRI
                     SVTPYFPIGYMSWMNQFAEWSEDLVGVVASCITPYQKAADYFKNKYLKDKTYFLCETP
                     PDSWDANQQAFEGEGGLHNPSALQEPKLTCRDARYETPTAAVQYRIELNAGEESEYRF
                     LFGPAYDEAEIRTMRSRYLSKEAFLRTADEYAAYMERGRGCLRIETPDKELDNFVNNW
                     LPRQVYYHGDVNRLTTDPQTRNYLQDNMGMNYIRPEVSRRALITALSQQEASGAMPDG
                     ILLAEGAELKYINQIPHTDHCVWLPLTLEVYLSETGDYGLLKERIRTENGDNFTVFER
                     LCRAMDFLLKLRDERGLSYIAQGDWCDPMNMVGYRGKGVSGWLTIATAFALKLWAGVC
                     EHEGATELAERFRAGADECNAAANKYLWDGDWFARGITDDNVVFGIKKDLEGRIWLNP
                     QSFAILSGAASREQVSRMLPEIDAQLDTPYGVVMFAPPFTKMREDIGRVTQKAVGSAE
                     NGAVYNHASVFYVHSLYRLGGQQDRAYKHLRQLIPGPSEADYRQRGQLPIFLPNYYRG
                     GWHQFPRTAGRSSQLFNTGTSSWAYRCVIEGLCGLRGEADGLVVRPQLPSGWDAIKVT
                     REFRGATFRLDVRRADVQDVVVSVGGKTLPQPKITEFKAGETYQVSVLVPQ"
     gene            complement(<718386..>718592)
                     /locus_tag="MYCTH_2067066"
                     /db_xref="GeneID:11506722"
     mRNA            complement(<718386..>718592)
                     /locus_tag="MYCTH_2067066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664802.1"
                     /db_xref="GeneID:11506722"
     CDS             complement(718386..>718592)
                     /locus_tag="MYCTH_2067066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664850.1"
                     /db_xref="GeneID:11506722"
                     /db_xref="JGIDB:Spoth2_2067066"
                     /translation="YSFYYYTFINDIVIFLDIAEDYIRYLKTIFNLFRKKNIAISPTK
                     LYIGYLNVELLGFRVDSLSLINTD"
     gene            734333..736406
                     /locus_tag="MYCTH_2308031"
                     /db_xref="GeneID:11506723"
     mRNA            join(734333..734807,734865..735131,735210..736406)
                     /locus_tag="MYCTH_2308031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664803.1"
                     /db_xref="GeneID:11506723"
     CDS             join(734548..734807,734865..735131,735210..736371)
                     /locus_tag="MYCTH_2308031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664851.1"
                     /db_xref="GeneID:11506723"
                     /db_xref="InterPro:IPR000848"
                     /db_xref="JGIDB:Spoth2_2308031"
                     /translation="MRGVPHEDAQRIIAIERTCSALSFLGCVFVLVTFALSDAFRQRA
                     INRMVFYATFGNMLTNVATLMTTTYTHKPDSFGCQLQGFLIQVFMQSDAYWALAMAIN
                     VYLTFYHKYDARMLRRMEIAYLACCYGIPFIPGFTFIFVSNKRRGRPYGDAILWCWLK
                     PEWEVYRIATFYGPIWAAIIATMTIYIRAGREIYHNRRKMMNFSSTGNGTVGTGEHFS
                     PAIEFSSAFNFKTTEVTQTTEIVKPPAAVVKTGAAISNTAPSYSVTVSTDIQAANRLN
                     MRASLEEDPGNGDPSTLTHSRGSSSSSSSSSTTTTNHHRAPSATNGSGRPDNGAWRAP
                     VLSTATQPSPLTPTVTSTVTTSRHTRVTAAPGRAHHHHHHHHESASSHSATWSYTKCA
                     ILFFSVLLITWIPSSGNRVYSLVHRDDVSRPLFYASAFVLPLQGFWNAIIYVVTSWAA
                     CKSLARSCLAGARGVRDWVLGEGVSRTRSRRMRSGRRVSAVKIVHRSERGGGGAAGAG
                     AGAGAGGGGRGSAVGIWLGNINSRNERERERESERSTSMEDLTGQRRAMAVSAV"
     gene            737047..747547
                     /locus_tag="MYCTH_2308034"
                     /db_xref="GeneID:11506724"
     mRNA            join(737047..737615,737688..745706,745795..747547)
                     /locus_tag="MYCTH_2308034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664804.1"
                     /db_xref="GeneID:11506724"
     CDS             join(737315..737615,737688..745706,745795..747317)
                     /locus_tag="MYCTH_2308034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664852.1"
                     /db_xref="GeneID:11506724"
                     /db_xref="JGIDB:Spoth2_2308034"
                     /translation="MRASSSDFASTTAFEYAINHVFLPPRTPQKDDTNIIEEHGLIES
                     LLVSTNELSRICQRSESHQLRPITRMLKRLLSVEPGMDSDTKRKTMKEVISELQDGEY
                     AVFHIRAQNAGLLLTGRRNDILVEAFELLAPNKDVMTCRGRLIREFPDCAASVNRAVM
                     FDGDFLDDFVDLLRQLELQASPLAHQKTRKSGRNFDEERDTDSPFLVTDMVMGTLAGL
                     GRSAEPQRIVKRSREQVNWDSALLAFHRSPTWLLLRVATRLVLDRNAARDRHESLYKT
                     LITFHHGLLLRQATQHELGSDLRFTMAAKLCRRLAKLDPRHNVPWVQELSEIIAENTG
                     ALQHRWEEAQTGCNAGNFSPASLEQLCFEADTNLQLQTSLGPHLSWIQTRSLDDQSAA
                     GPGDNTWFSIFPASKLPSFQELAEEEEKYSLLELESWIESNLSSWVTECLCDFHRTSN
                     SSSSLSRTKVGVKLRKLNSLIIKYYTKGKEAYKGNPEALSLMHLNLMSLWVATDKIAG
                     AAAPLLLEFDPGFPPDLLQPLLLPTRLEMARLHEIETYLSRRRKEARNGYPQVFAHFG
                     TPKSFAVRYFDSSAEQKELLSHIQAESERAAAGRQQEYRDMRRTWEALNTELGSSSHQ
                     KVWNSKRKSEICKSTCKACRLGSRIKGLRINLFEWPLPSGDVNLAKAIVFEISVPEVV
                     AIWRDVTTKLLCEVFRTGGTLGTVGKLWSASEHLGLARFVTATSRVQVASTVKPVKAS
                     HYHAKHISGITDPEDVVVRPSWRHYDYYEPTSRIHHSEMFKNLSLPTQCSFAEHQRGR
                     LLGSWTRSTGHTSNEVIAAQSQCPSDMSLDEFRAFGHLRSGHHLQWANVLCQLRVPSL
                     NWNHESTYWLVLQACLEAGPPDHSDCLRREAHADLGNGVFVRCMTDALDTALDRYREN
                     WQNNVAVSLLACLGTRVLSLTSENYKDADDEEDKEDDKEDSKGKKETESNIGNKEHKE
                     PSPPSLIDPLLAFLSRVREATICWARQLLERRASCTLEDEQKSLDKRILMAALTCMST
                     FDIETNLLRVILQSTNFLSIFVEATILAHDYTPPTESVSDPILLMLLHRWRRTMHRSR
                     EIIMTEVVTNTNIGFHRAIHRFWADYPPSTRQWSTLPGKQSHILRTVMGTGTGNDKAI
                     DITFNSLDGRLLVAGYPLSRLPREYTSTPAYKELFGSQVLEVMPSTRQGMFFSMCRQQ
                     HGWVVHLTMVRSDLVIQAVQTEGILSSIKPGAGPRVCEFIPFERLKGDVPASFVRNYS
                     HWLDLATGVIEFRPRDQPWESSEDNWTLTRDGSSNILSRGGCAVLDPHSPTAEALFAR
                     LKPIETREHLDMIFHPDDHVLVVDLPRFSISFSLAEGGAVIKSKHYSGMCIDDDQNIG
                     TFFGLENKLVLRQEENDSEHCAPRRIVLVPRGSPTSEIVSNHVSVRVNVPGGLRVKHD
                     AFRIDTTLGRIASSTSLASKLYLCYLHALTSHCLPDPLTGRTGTEEALRILRSASVRS
                     FERLDLESYHLLCDIARISPRRLFYPEHLTVMERITWSGKLPVLSQNDAFWTQVEDIL
                     SHARNCALLHPQDEEGSDSFKIESVEGSRPLLLDRAKIRNATFHVSEFGAEMHTTTFD
                     SRYAGRHLKRGSEVYSRVKMVSRRLLSGRQELLDPLPSTLREDLLKVIGPQFPGHPEV
                     DLRFKLDYLQPASESLSKLWCGLHRRLTEEPNKYRIAFFLSALIYAEESDWVVVHALM
                     ALAIAPSRFQVLATPPREQSFDLGYDLSTVRHRVDQIIRNSLYDFGLCPETHLARLNF
                     ESDEQVEKRRYCIWKENSDKMARSFKTELELQWYRGWTVTTPTGNMYSSYLDVDTIMS
                     KVSDVLDLARRTSLFEQYLFDLEWELRDMRVSPGQETDQNDFASDDSAVIIPSLEPQQ
                     AGRSAYVSSDMLFSRSAPSTSRPRLVDFTYLCGHAVHAAGDRGPLAGLFERLSRIAGD
                     RPYQTDYLMELESGSISTARPTLQLKQCVDDLRSIFEVHLCECKQTVEEIRGAIEETL
                     SPRSIVDATLRTASLYPRISPIFLLRRLTRDFWADLSEGWRECLANYALSLSYLQRAQ
                     RLVNASSDPSKRTELLREIQSTGTHESDDGDTLLFPENLLLELEQGILIRPVQQSVAA
                     KMRDPPGGRNSVMQLNMGEGKSSVIVPLVAASLADGERLVRVVVAKPQSKQMQHSMIG
                     ALGGLINRRVFYLPFSRALQIQSDGLEVIRGMLETCRKEGGVLLVQPEHLLSFKLMGL
                     ESIYARPGSIGQEILQTYREFEAVSRDIVDESDENFSVKFELIYTMGAQQPIDMSPER
                     WTMIQELMDIVLDVSRELTSGPGRIRGLLLEEHDNNTAGSRFPTIRVLEDSAGKVLVE
                     TIAERICRIGLKGFPIHHQTKRMRQAVLEYVLQPNLTPEQIAAVEDAESGLFSEPSSR
                     NALLLLRGLLASNVILFALGQKRFRVNYGLAPDRRPATMLALPYRAKDSPAPRSEFSH
                     PDVVIVLTCLSYYYQGLSSKQLRSCLEILSKSDQAEQEYSRWAAKSPDLPSSLGHFSG
                     VNLQDGTLYKESVFPALRYTKPAIDFFLSTVVFPREMREFPFKLSASGWDLGKTKRDP
                     LTGFSGTTDSKYVLPLSVTALDLEEQRHTNSAVLACLLRDENTVLELGGDEADVSALT
                     VDVLLDAVTTSRQPMRVILDVGAQIIELSNLEVAQRWLELVPEQDADAVIFFNDHDEL
                     SVLTRDGSVDLFITSPFATQTDRCLVFLDQAHTRGTDLRLPDSYRAAVTLGPNLTKDM
                     LVQACMRMRKLGAGQSVTFCVSPEMQKRVRGLAHLEDSLPLTVTDVLVCAIAETWDDA
                     SRSLPLWATQGLRHQHQELVWERAEDTGELSMNDVVDYMEDEAQSLGERYRPISHGSG
                     TNSQGLTSKLIEASKLEARRDQVSQIRAKCLSFGLANLDAMGSLQEEQERELAPEVER
                     ERQVEGPPPRSPAAHALHPDVKLFATSGILIANSPAFRPAFHTLASTSAAKHFPVERF
                     PSDLLATADFARTVQAGEDASSFDAYQRPVQWLLTTNPTNKQALKASRRQKKTKAAST
                     PRYGMHMVLVSSWEANVLKKVLEAEAAAAAAAAIAGGTGTPAGAPPVLLRAYLPRTSL
                     SFESLEDLTAYTVPAHAATATATTTTTPPQPPKELITQLNLFAGQLYLRTYDDYVRLC
                     RYLGLSYRENEGETDIAADGFVGRGGGGGGDDGKEGGEYEACAFEQSPVGFLGVLFRR
                     IRRDCLDIEKTHMGRVLSGEILTGKDFGEGGSDVRLNRHIKSEPDV"
     gene            complement(748098..749056)
                     /locus_tag="MYCTH_2308036"
                     /db_xref="GeneID:11506725"
     mRNA            complement(748098..749056)
                     /locus_tag="MYCTH_2308036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664805.1"
                     /db_xref="GeneID:11506725"
     CDS             complement(748175..748921)
                     /locus_tag="MYCTH_2308036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664853.1"
                     /db_xref="GeneID:11506725"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2308036"
                     /translation="MAIMAVTLNYGVGFLGFPGGTEVAAAGVTNLGLKDQRQALRWIQ
                     ENIAAFGGDLDKVTVWGQSAGANSIAYQLLAYGAKTDEKLFRGAIMSSGSIGIGNAVH
                     PDREDAVQGYRAVLNATNCLDAEDALGCLRAVPLDEVFEAGEATGTHPTWWPTVDGDF
                     IPQPPSLQLEAGEFLVTCPSSQGPTTTKLKRFVLADIDPHPDAVPGAAGIRESCCGPP
                     LLWPLSSFIATMLSPRLHRLLPVLLGRHPA"
     gene            750765..752327
                     /locus_tag="MYCTH_112329"
                     /db_xref="GeneID:11506726"
     mRNA            join(750765..751412,751488..751554,751635..752327)
                     /locus_tag="MYCTH_112329"
                     /product="C-5 sterol desaturase-like protein"
                     /transcript_id="XM_003664806.1"
                     /db_xref="GeneID:11506726"
     CDS             join(750839..751412,751488..751554,751635..751995)
                     /locus_tag="MYCTH_112329"
                     /note="orthologue of Aspergillus fumigatus Erg3C"
                     /codon_start=1
                     /product="C-5 sterol desaturase-like protein"
                     /protein_id="XP_003664854.1"
                     /db_xref="GeneID:11506726"
                     /db_xref="InterPro:IPR006088"
                     /db_xref="JGIDB:Spoth2_112329"
                     /translation="MDAALEFLDPLVFDQMYAYLVPARTSSVNNGSAHGALDYSGFAS
                     GLSDASASHGSAWARDNIVRQCISILIITQIGATALYWIFSALSYYLVFDRRLEYHPR
                     FLKNQIRQEIISSMSAVPFINILTLPWFLGEVRGYSLLYDKVSDYGWSWMFISTVLFM
                     IWNDFTIYWIHRLEHHPRVYKYIHKPHHKWIIPTPWAALAFHPLDGYVQSLPYHVFVF
                     ICPVQKYLYMVLFGLVQIWTILIHDGDMISGHWLEKYINSPAHHTLHHMYFTVNYGQY
                     FTWADSYFNSHRPPQPELDPLHEALRVMREKGLVDEKGEPIPKNGKGAKGAKGAKDE"
     gene            <753434..>755043
                     /locus_tag="MYCTH_103702"
                     /db_xref="GeneID:11506727"
     mRNA            join(<753434..753532,753662..753761,753836..754162,
                     754329..754845,754950..>755043)
                     /locus_tag="MYCTH_103702"
                     /product="aldose epimerase-like protein"
                     /transcript_id="XM_003664807.1"
                     /db_xref="GeneID:11506727"
     CDS             join(753434..753532,753662..753761,753836..754162,
                     754329..754845,754950..755043)
                     /locus_tag="MYCTH_103702"
                     /note="Aldose epimerase-like protein"
                     /codon_start=1
                     /product="aldose epimerase-like protein"
                     /protein_id="XP_003664855.1"
                     /db_xref="GeneID:11506727"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Spoth2_103702"
                     /translation="MAAEASVIGRERHVPPPGEDGRYTISAEGIKAQFIPYGATLTNL
                     FVKDKNGEDIDVVLGYDDVNYYPEDPGHPVYNAIPGRYANRIGNGKYTLDGKTYFTEK
                     NDGNNTLHSGTNNWSYRVWDVTDLKEDSITFSILDKANSSQGFPGDVKASVTYSVKGS
                     TWNIKMKAEALNHKTPLLLTQHTYFNLDAYHNPDTAKIWDHGLYLPYSKRYLEGDQGA
                     LPTGKILTAEPGSINDFASSADLTVGHARDQPGFEGNCGADGACEGYNGYFLIEDKPS
                     ADAVVLRLSSAFSGVTADLRTDQPGVVLYSCNWMDGSADLKSTQGIKGVNEKVIRSSC
                     IAIEAQDYPDGINHPEWGRTEAQIWGPGETYTWESSWTFGLLEA"
     gene            complement(757093..759384)
                     /locus_tag="MYCTH_2308049"
                     /db_xref="GeneID:11506728"
     mRNA            complement(join(757093..758039,758104..758704,
                     758768..759384))
                     /locus_tag="MYCTH_2308049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664808.1"
                     /db_xref="GeneID:11506728"
     CDS             complement(join(757133..758039,758104..758704,
                     758768..759065))
                     /locus_tag="MYCTH_2308049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664856.1"
                     /db_xref="GeneID:11506728"
                     /db_xref="JGIDB:Spoth2_2308049"
                     /translation="MKALGLAGARTRRLFTRQTLFIALAICIIWALGVQFGGNVSERW
                     AELGNQTPDFKEQPKRMPTHNVLPPLAERVACYGPRGRLLGESPDDDLQTSEINGPYP
                     TPWTGNYEETGLDLTVMNVDRRYGPYGYGEEREDYNRSRVDWNQVDWGQLQNDCFERN
                     RHRFPASATRFDDTRVTPPRFALRHVAKVPEVRHWHEFQPTRRTAVVVRAWRGFEYLP
                     EDMYYLRSLVAETALKTGGEYQVILLVDMKDYEGYENDIFASEEAYKKGMEDAGVPPE
                     FQSITLLWTNRLLDSWYPRVEEHLTIWQVFQPMQLLALHYPEFDHFWQVELDMRFMGD
                     AGKFLDSLSAAARREPRKQSLERSSFLHMIAETGDYGEFFRVVNESNKGGSHAWGPMR
                     VREILPIGPEPPVADPRDDNFEWGVGEDADALLTAFCQNANTPNTWIFRDWIYGLRTG
                     VRTPRFYCPPAIQRGSRALLLAIHQAQLDLGIRIPSEATLPSFALWHGLKLSFPQHPV
                     FHRDNDDVENRRGWWRGGPLASSTGLGPDNNDHPRGFGLSFWWESNWAKHVFNEWYGR
                     KLSDKEPRPWIIKEWDGKLWLPNMILHPVKHIKKK"
     gene            <771988..>772140
                     /locus_tag="MYCTH_2031317"
                     /db_xref="GeneID:11506729"
     mRNA            <771988..>772140
                     /locus_tag="MYCTH_2031317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664809.1"
                     /db_xref="GeneID:11506729"
     CDS             <771988..>772140
                     /locus_tag="MYCTH_2031317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664857.1"
                     /db_xref="GeneID:11506729"
                     /db_xref="JGIDB:Spoth2_2031317"
                     /translation="IELEVTLLDKLYNFTDLFNKEKASRLPLYRGIANHYIKLKEGLD
                     RKIPELV"
     gene            complement(<785848..>787044)
                     /locus_tag="MYCTH_2119779"
                     /db_xref="GeneID:11506730"
     mRNA            complement(join(<785848..786774,786847..>787044))
                     /locus_tag="MYCTH_2119779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664810.1"
                     /db_xref="GeneID:11506730"
     CDS             complement(join(785848..786774,786847..787044))
                     /locus_tag="MYCTH_2119779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664858.1"
                     /db_xref="GeneID:11506730"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="JGIDB:Spoth2_2119779"
                     /translation="MSTVAAERSDSSAVPAPAPVFDAGRQQKADQILRDAVKATTPRH
                     DWTREEISAIFYQPLMKLVYHAATVHRRFHDPAEVQLCTLMNIKTGGCTEDCSYCAQS
                     TRYQKGTGVEAKRVETVEAVLEAARIAKENGSTRFCMGAAWRDMRGRKNSLRKIKEMV
                     SGVRAMGMEVCVTLGMIDGEQARELKAAGLTAYNHNVDTSREFYPSIISTRTYDERLK
                     TLAHVRDAGINVCSGGILGLGETSEDRIGLLHTVATLPSHPESFPVNALVPIKGTPLG
                     DRKPIEFTSMLRTIAAARIIMPATIIRIAAGRKTMAEEQQALCFMAGANAVFTGEKML
                     TTECNGWDEDAAMFGRWGLEPMKSFQKSAAAPHGVEDVEE"
     gene            complement(787466..788615)
                     /locus_tag="MYCTH_2308054"
                     /db_xref="GeneID:11506731"
     mRNA            complement(join(787466..788321,788388..788615))
                     /locus_tag="MYCTH_2308054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664811.1"
                     /db_xref="GeneID:11506731"
     CDS             complement(join(787779..788321,788388..788429))
                     /locus_tag="MYCTH_2308054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664859.1"
                     /db_xref="GeneID:11506731"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="JGIDB:Spoth2_2308054"
                     /translation="MSYYDIDSILTDAEKIPCTFQLDIPDLGYLDNTPTQPLKAGTKV
                     NLPLWLAEMLAIANTGDVEGKSFVTFDLPPALGNDVIQALKADPRAVPLRDQSAHFYG
                     LATHMMELSEERELATTLRKTFVTRASEIALHARKVGGIGHKGKADEGSNLGVGGAGE
                     EFLRGLDEWERKLFRKAHDGAKAGKEWMESVKKH"
     gene            788674..790092
                     /locus_tag="MYCTH_2308056"
                     /db_xref="GeneID:11506732"
     mRNA            join(788674..789026,789127..789392,789463..790092)
                     /locus_tag="MYCTH_2308056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664812.1"
                     /db_xref="GeneID:11506732"
     CDS             join(788894..789026,789127..789392,789463..789765)
                     /locus_tag="MYCTH_2308056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664860.1"
                     /db_xref="GeneID:11506732"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="JGIDB:Spoth2_2308056"
                     /translation="MSSTLLRTVPVLRGALRASAAPKMAGAMASTSFVRGKATLPDLP
                     YDYSALEPYISGKIMELHHSKHHQTYVNGLNSALEAIAEAESKGDFSKAATVAPLLNF
                     HGGGHLNHSLFWENLAPASREGGGEPDGALKKAIDSDFGSFDNFRKQMNTALAGIQGS
                     GWAWLVKDKTAGTLGIVTRANQDPVSGPYVPLLGIDAWEHAYYLQYENRKAEYFEAIW
                     NVLNWKTAAQRFEKT"
     gene            791408..795833
                     /locus_tag="MYCTH_2308065"
                     /db_xref="GeneID:11506733"
     mRNA            join(791408..791742,792256..793100,793275..793660,
                     793723..794003,794059..794261,794453..794796,
                     794862..795833)
                     /locus_tag="MYCTH_2308065"
                     /product="glycosyltransferase family 4 protein"
                     /transcript_id="XM_003664813.1"
                     /db_xref="GeneID:11506733"
     CDS             join(792993..793100,793275..793660,793723..794003,
                     794059..794261,794453..794796,794862..795645)
                     /locus_tag="MYCTH_2308065"
                     /note="CAZy_ID 268065"
                     /codon_start=1
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="XP_003664861.1"
                     /db_xref="GeneID:11506733"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="JGIDB:Spoth2_2308065"
                     /translation="MAFEKARKFSTGTSVHRKRQMSTLVEQQGQFGPSLTTLYLGISA
                     VFADDHTAVVALAIHDTVYLVDFSVKHIILDDAMKMGADLIADYVISEVEKYEHENFS
                     KFVGAGLPTTLKYMSPTLCSRLWLELDIVPIVLRPDDEHKEKSFWDVKRVDEQADSMA
                     RKCIMNFGPSLVPLLQVGWRGVVQTDAGFRAHLTTVQNHKDTCGHATWETMLTFAKKL
                     RGNKTKIAFFSATPQGGGVALMRHALVRFARLMGVDLTWYVPKPRPGVFRITKNIHNI
                     LQGVSHPDQRISAEEKQAVTDWIAENAGRYWFSEGGPLCSPADGGADVVIIDDPQMPG
                     LIPLIKKVTPDRPVLYRSHIQIRSDLVAKPGTPQADIWDFLWSNIQGCDMFISHPIPQ
                     FVPHTVPREKVVYLPATTDWLDGLNKPLSSWASGYYGHIYNIACHSQRMTELNYPARK
                     YIIQIARFDPSKGIPTVIDSYAEFRRRLEKAGITDVPQLVVCGNGSVDDPDASIIYDQ
                     TMSQLETYYPDLLSDVSVMRLEPNDQLINTLLANAHVVLQLSTREGFEVKVSEALHAG
                     RPVIVTNTGGIPLQVKDKVNGFLVAPGDWKAVATHLVELFTDDELWKKMSHAARTGVS
                     DEVGTVGNALSWFYLASKWSEVGVEKHGKGGLMGNERWVNDMAREEAGFPYAEGENRL
                     PRHFTQTKDVPVHPKPEGA"
     gene            complement(796487..798043)
                     /locus_tag="MYCTH_2308073"
                     /db_xref="GeneID:11506734"
     mRNA            complement(join(796487..797742,797807..798043))
                     /locus_tag="MYCTH_2308073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664814.1"
                     /db_xref="GeneID:11506734"
     CDS             complement(join(796842..797742,797807..797934))
                     /locus_tag="MYCTH_2308073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664862.1"
                     /db_xref="GeneID:11506734"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="JGIDB:Spoth2_2308073"
                     /translation="MTLPEKNAPSEAPSTTAQPRHEEYQYLDLVREILDQGELRRDRT
                     GTGTYSIFAPRPLKFSLNRSGVPILPLLTTKRVFTKAIIAELLWFISGDTSSQTLSSQ
                     GVKIWDGNGSREFLDSLGLTDREVGDLGPVYGFQWRHFGAQYVDAKTDYTGQGVDQLA
                     RIVHTLRTNPFDRRLVLSAWNPADMPRMVLPPCHMFAQFYVSYPRGTRSRNGEDEKKQ
                     GGRGADEPVKGHLHCQLYQRSCDMGLGVPFNIASYALLTHMLAHVCDLVPGSLTHVMG
                     DAHVYLNHVDALRTQLEREPRDFPELEIVNDRLDENGERSIDGWRPEDFVIKGYNPHK
                     TIPMEMSV"
     gene            800107..802031
                     /locus_tag="MYCTH_112322"
                     /db_xref="GeneID:11506735"
     mRNA            800107..802031
                     /locus_tag="MYCTH_112322"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_003664815.1"
                     /db_xref="GeneID:11506735"
     CDS             800477..801742
                     /locus_tag="MYCTH_112322"
                     /note="Oxidoreductase-like protein"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_003664863.1"
                     /db_xref="GeneID:11506735"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Spoth2_112322"
                     /translation="MAALTENQIAIVKSTVPVLKEHGATITTVFYKNMLGENPELNSI
                     FNISSQATGRQQRALAGAVLGYATYIDDLPKLKDAVERIAHKHVSLQVTPEQYDIVGK
                     YLIQAIGQVLGDAATPEIVDAWIAAYGALAKVFINREGEMYKANEAHGWVGWRKFRIA
                     RKVAESNVITSFYLTPVDGRVPLPKYLPGQYVSLKVPVPQLGEGRHQCRQYSLSEGPS
                     PAGEYYRISVKREDGTPETNVPGLISNLLHAKYAVGDEVELSHPQGEFYVDPSDASKE
                     GVPAVLISAGVGATPVKAMLDSLTAPGAVRRPVSWIQSARSSAALPFGESVRQICREH
                     DNVTANVFLRNLSPDDAVGVHYEFGDMRLDLAKLDRESHLFVNDPRAEYSVCGPEPFM
                     LDVRSALVSLGVDRSRIFLELFGTGGVSD"
     gene            <803346..>811222
                     /locus_tag="MYCTH_55132"
                     /db_xref="GeneID:11506736"
     mRNA            join(<803346..803501,803576..808888,809354..809712,
                     809803..810688,810749..>811222)
                     /locus_tag="MYCTH_55132"
                     /product="polyketide synthase"
                     /transcript_id="XM_003664816.1"
                     /db_xref="GeneID:11506736"
     CDS             join(803346..803501,803576..808888,809354..809712,
                     809803..810688,810749..811222)
                     /locus_tag="MYCTH_55132"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003664864.1"
                     /db_xref="GeneID:11506736"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_55132"
                     /translation="MAYKTPISEPIAIVGAACRFAGGATTPSRLWQLLEKPMDLSQEI
                     PASRFNVKAFYHPDGEYHGTTNSPKAYFIDQDHRVFDAAFFNISPKEAEAIDPQQRML
                     LEVVYEALESAGYSLHQYTGEKVAVFAGLMTGDFDSLSQRDELDTSQYYATGNARSIL
                     SNRISYFFNFAGPSMTIDTACSSSLVALHQAILSLRSGECKMACVAGANLILTPENFI
                     AESNLHMLSPTGHCRMWDAAADGYARGEGVAAMFIKPLSQALADGDHIVAIIRETGVN
                     SDGRSRGITMPNWEAQSRLIQDTYRRTGLDPEAPEDRCQYFEAHGTGTIVGDPNEARA
                     IEDAFFGQHKSSASDVKLLVGSVKTVIGHTEGAAGLAGLLKVVESMHHGTVPPNLHLD
                     KLNPDVEPYYSHLFVPTSAVAWPDVPVGQPRRGSVNSFGFGGTNAHAIVEQYVPAVHD
                     PIALSYRPGLKTPTPSDRLRGAEHGQVCLPLLLSAPSQKSLVAVAKAYRDHLIQGPAH
                     SIQELAWHTYARQTAFPFRLAVSGLSLSGLVNKLDTLIAESKDYPNADTLGTRARLRD
                     EQPKILGVFTGQGAQWATMSRGLFLSSKVYADTIRSLDAILRTCPEPPSWTLENEIMA
                     DAPFSRISEASISQPLCTAVQLALTELLRSLGITFHTVLGHSSGEIAAAYAAGRISLG
                     DAMLIAYYRGLGVDMARGADNARGGMVAVGLSRTEAEELCARPEYLDRLWVAASNAPA
                     STTLSGDVDAVGQVREELTKQGKFARVLFVDTAYHSPRMEGPSAKYVEALKGCGITPL
                     AGNNTIWVSSMLGQGQPSRAELAANYWKENMVRPVLFYEAVAAALDTHGPFDCAIEVG
                     PHPALKSPVMQTVKTVMTVEKASSIIPYSSLLHRKLDDREAFADFLGWMWTHFGSSSP
                     QIRQFVSGSLQPELVNSRVVNTPSYPWNHSQKFYRESRISRQYHFKVDRPHELLGVRT
                     RDDNKHQLRWRNILSYHKLPWAKHHSFQGQALLPASAYLVMTLDAARIALAGRQASVV
                     ELRNLEFHSGIILEPDTFGVEILFNLSIEREFPNAIDASFTLTSVIAGGSSDMKKNFS
                     GSLTIALGNPSSDALPARPASRAETLHANPDAFYDMMASTGLVYSSAFRGLQTLERRY
                     NFASGTLKKYHDEDTTSLSISPATLDSCLQTAFVTVSSPGDNAIWGAFLPLEIGCVRF
                     SLATCTIQDRDRDRLVVDAYLTNATPATEQTAASYTADIEIFNPKGDMEIQIQGLTVG
                     CVGLTSAEDDYELYLTTRFDTDPDYEIVSSGPIDQAATNPNLVKSCERVAALYSSQTP
                     TLHHRSLGLWLGQTKTPRPPKPWGAETEETLDSFIRTSPYFVTLDFIRELGKNLPDVL
                     VGMLPAIMEEAHQLVAFQQHVSRVVTQISHKYPRMSVLGLLDTDMGLTEHVLTGLNDS
                     FTSYRLGLEPERNLDARIPLNDPIRRKILVKGIDLNATEPEENSRYDLVLLTSSIIDP
                     QKTASTLRLVGRMMRPGAFLMLVNVSRSPLKDRIRRYAGISTGSDVLPSPPDWPDLLD
                     SCGFGYSMKNGNQYYPPGFSLIIRHSDSTEKISLLNPFANLGHSLLSDRLLVVGGKKK
                     STALISSSICSALAPRCGGLDQAETLEWVDVEYAASFSAVIILSDVDEPILATMTNKR
                     MEALRALFKPQMTVLWVTHNARFLNPDHAASFGFTRTLAAEVPGLILQMLDLTTADTA
                     TASVAITETFARLVKHSLAHRPSGSGPLWINEPEIHLEDGHRLVPRVVPWKEGNNRVN
                     AFRRVVKKTVNTLEKTVRIVESAPSGEHSTYYHIEAEQLGAWVLDMSTGSSQLSHLLM
                     QTMPRNCRYTACKALLGTNRLTSDEKDAYSAKFWDKAVALSLAKAESRETAPAPALTT
                     ISDLLRAEEPSPPFCLVDWKSDRLASQTVKPLAGTGLLSPTKTRNPPKTQPNWQTETM
                     AKGINVRFETLDVTSLEQVLELKAKLSETLPPVGGVVNGAMVLEDGVFSQMSLDTFHR
                     VMKPKTIGSRNLDQAFSAADMDFFIMTSSFAAIGGHAGQSNYAAANMYMNGLAASRRR
                     RGLPGSVLNIGVIYGLGFLHREKGCLYQGLEREGYPPISERDIHHMFVEAIVAGKPTG
                     PGRQRAEEEVYDITTGLRRFPASSPTLHWHHDPRFGHLNTRRDDHDDDDDVFSGAPRT
                     VANASTAAGASAAWAAGSHHKNDEGSLRQRLDAATTHDELVDVLEPAFADEAPGSGSV
                     TAEHSIVDLGVDSLAALSMRAWAWKALGQDVAAMKLLSGATVAELCREIAGGILEGRK
                     AARERSEQIGEADDGAAAAAAAAAAVEENGSEVVVATPGSLTTITTASFVSGSVRETT
                     ESTAVSVSSNTEENSQVEGRCGRRCCGEVIY"
     gene            <812984..>815014
                     /locus_tag="MYCTH_108836"
                     /db_xref="GeneID:11506737"
     mRNA            join(<812984..813677,813783..>815014)
                     /locus_tag="MYCTH_108836"
                     /product="oxidoreductase-like protein"
                     /transcript_id="XM_003664817.1"
                     /db_xref="GeneID:11506737"
     CDS             join(812984..813677,813783..815014)
                     /locus_tag="MYCTH_108836"
                     /codon_start=1
                     /product="oxidoreductase-like protein"
                     /protein_id="XP_003664865.1"
                     /db_xref="GeneID:11506737"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_108836"
                     /translation="MTIPPSERVVPGSVNLAPAPWPASATTPAVSVDAPRVAADLVAA
                     LNTALAGGNYAAAADLFLPDPGPANGDGASPSSFWRDHLVLSWRLRTLKGRDKIREFL
                     EAQLGGPGGGKVVRFQVDSSSEFRRPQTAEFRPLGGVTGVQFFVRVEREDGVAGRVGR
                     GVVRMVEAEPGVWKVWTLFTTLEEVKGSEERKGERRERGVQHGAIGGRRNWAERRRAE
                     SEFVGTEPVVLIIGAGQGGLTAAARLKMLGIPALIIDKNSAVGDNWRKRYHQLVLHDP
                     VWYDHMPYVPFPDFWPIFTPKDKLADWFEAYVKALELNVWTESEMVSSSWNDAKQLWA
                     VQIKRARASGQEIRTFHPKHIIIATGHSGRPHMPSIPGMESFKGDLLCHSGSFPGAKE
                     GRKGKKAVVVGACNSSMDICQDYVEKGYDVTMVQRSSTYVISSETALKVTLAVLYEEN
                     GPPVEDSDIAVWGWPSEVLKSLQVDLAAISVARDREMLDGLDKAGFKIDMGPSGGGLF
                     IKYLQRGGGYYIDVGGAKLIIDGKIKVKHGQEISQVLPTGLKFEDGSEVQADEIVFAT
                     GYDNMRTTAKEILGDELPDQVGDVWGWDQEGEMRTIWTHSGHPGLWFHGGNLAFCRYY
                     SRLVALQILARLKGFET"
     gene            <815453..>816709
                     /locus_tag="MYCTH_2067358"
                     /db_xref="GeneID:11506738"
     mRNA            <815453..>816709
                     /locus_tag="MYCTH_2067358"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003664818.1"
                     /db_xref="GeneID:11506738"
     CDS             815453..816709
                     /locus_tag="MYCTH_2067358"
                     /note="CAZy_ID 267984"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003664866.1"
                     /db_xref="GeneID:11506738"
                     /db_xref="JGIDB:Spoth2_2067358"
                     /translation="MVHVGLILALVASLPRTVAEGPRQQLQASLNRTHPELPRLMLYH
                     QTTHDATGRPISLLPLVTKQHIGLTHLIVGAFHVHANGTIHLNDHPPWHPRYSTLWAE
                     TRILQSPSTAGGRSGGVKVLGMVGGAAAGTFAADTLDGDGAAAAAFEASYALLHEAVR
                     AHTLDGVDLDVEEPMTLRGAARLVRRLRADFGPRFVISFAPVATALLGTGAGAGAGTG
                     TGTGRRGRGRGRGGAGNLSGFDYRALERAVGREIAFYNAQFYNGFGGMADTRLFDAIV
                     GEGWEPDRIVIGQLTSPENGGGFVGHERFARTIERLRRRHGEIGGVAGWEYFNAVPGG
                     SSRPWEWAESMTRILRPPGTEPVLRITREMAESLSRAWMVSAAEGGGGGAGGGAGGIS
                     SASGLGTAEKRVGLAPNVDYMAMVNA"
     gene            817122..818194
                     /locus_tag="MYCTH_2308076"
                     /db_xref="GeneID:11506739"
     mRNA            join(817122..817570,817628..818194)
                     /locus_tag="MYCTH_2308076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664819.1"
                     /db_xref="GeneID:11506739"
     CDS             join(817206..817570,817628..817823)
                     /locus_tag="MYCTH_2308076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664867.1"
                     /db_xref="GeneID:11506739"
                     /db_xref="JGIDB:Spoth2_2308076"
                     /translation="MGRPSGVVGRTQLKQDDLMRIQTLSRDARMGPSEIRRVTGYSIH
                     QIKYALKKKTPTVGKRSGRPRKGEVAPRKKKAAEAGAAGDGTAAGDGQIEQLGPPVNQ
                     DESAEAGEGSGELSVELNNQAPGQVGPQELGRLDDGQQHVPDQTHQQQQYQQLQQAQQ
                     SQQLQQQEQQQRQPDQYGQAFQPPQP"
     gene            818661..820615
                     /locus_tag="MYCTH_2308077"
                     /db_xref="GeneID:11506740"
     mRNA            818661..820615
                     /locus_tag="MYCTH_2308077"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664820.1"
                     /db_xref="GeneID:11506740"
     CDS             819462..820202
                     /locus_tag="MYCTH_2308077"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664868.1"
                     /db_xref="GeneID:11506740"
                     /db_xref="JGIDB:Spoth2_2308077"
                     /translation="MGLTYLADHILPHPAPDAAPATLTTSVVPTAAAAAASAAGPADA
                     ATTTAAAAVADGLLGDEEDSELGQTTNFRRWRVRRQFGKGKGKGKGKGKGKGKGKGKG
                     KGKGKGKGKGKGAGGAAGGAAGNGTDVGTGGGGATGNGTNVGVGAGGNAFGNGGDEGT
                     GTGAGTGFGSGAGNGAGTGTGSGSGSDAGAGNGTDSGAGTGFGGGSATDGGNDFGAGT
                     GSGTGTDTDAGTGSGFGGGTGTGADAGF"
     gene            820815..822546
                     /locus_tag="MYCTH_2308079"
                     /db_xref="GeneID:11506741"
     mRNA            join(820815..821274,821350..822546)
                     /locus_tag="MYCTH_2308079"
                     /product="serine protease"
                     /transcript_id="XM_003664821.1"
                     /db_xref="GeneID:11506741"
     CDS             join(820969..821274,821350..822282)
                     /locus_tag="MYCTH_2308079"
                     /codon_start=1
                     /product="serine protease"
                     /protein_id="XP_003664869.1"
                     /db_xref="GeneID:11506741"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="JGIDB:Spoth2_2308079"
                     /translation="MELITIFLCLATLLIAFPGTSAVAPIRNDRVLDELVVPDTYIVK
                     YKNGIDTLGRNEHEKDVNSRARKGSRRGILGRFDVAGLRGYVAELSTLDLDTLASFDL
                     IDYIEKDTVVKAAAVAAYPQPARRATVEQVNAPWGLARISHRSRGQTDDDSYYYSNTA
                     GSETYVYVIDSGIRVSHEDFGGRAVWGANFVAASRDTDEAGHGTHVAGIIAGQTYGVA
                     KKATVIAVKVLDRLGSGSSSGLVQGLDWAVRDARERGTANRSVINLSVSGPFSQAIND
                     AIQAATDAGLTVVAAAGNQGKDAWDQSPASAPSAITVGAIDRHDNRAVFSNWGESVDI
                     FAPGVEIESAFNNSDSDHSLMNGTSMACPHVAGLAAYFMARDGISGKEVAQKVLETAI
                     TGVGDRRMGADRIAYNGEAE"
     gene            complement(<823093..>823689)
                     /locus_tag="MYCTH_2067632"
                     /db_xref="GeneID:11506742"
     mRNA            complement(<823093..>823689)
                     /locus_tag="MYCTH_2067632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664822.1"
                     /db_xref="GeneID:11506742"
     CDS             complement(823093..823689)
                     /locus_tag="MYCTH_2067632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664870.1"
                     /db_xref="GeneID:11506742"
                     /db_xref="JGIDB:Spoth2_2067632"
                     /translation="MLVLFLLGLTAAASSRKRQATGEHTMGFIGCSMAENIAQGYVAV
                     GGTHMWGPYGTGGMVVQSWTDTNSASWRLFDQQAARYGRPAEVWVQICIFQNPGATYD
                     EVERLVANAREHAAPGARIWITGQPLYPDNPSSCFLAGPAGPQLTVDLAKRAAADASL
                     NVTYPGEFVLMRNEVQDGCHANAAGQRSLGEQALAFWG"
     gene            824469..826668
                     /locus_tag="MYCTH_2308084"
                     /db_xref="GeneID:11506743"
     mRNA            join(824469..824646,824816..825361,825466..825627,
                     825755..826464,826522..826668)
                     /locus_tag="MYCTH_2308084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664823.1"
                     /db_xref="GeneID:11506743"
     CDS             join(824587..824646,824816..825361,825466..825627,
                     825755..826438)
                     /locus_tag="MYCTH_2308084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664871.1"
                     /db_xref="GeneID:11506743"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2308084"
                     /translation="MVGVPGRSKACITCRKRRKGCDLERPACSQCRKAGLQCEGYSAP
                     RVFVISTPERRRAGYSARRDSPSRPDADHATEATTTTTVTNLRLLARPEEERRCIDLF
                     WEAYFPAGQPIPRAASRSYVCAWTETARRFYRDDDSLRHALWANCLLTTGRRHGAAWM
                     LREGSGAYGKALGDLRRSLQASSHRVRVDVPIATIKLLAMFEAFSQQGGSEPKAEDAQ
                     QHWQRHYAGELALFIARTPVAHVDGELHDVFADERVDMALSAVLRRERLVLSTPEWKT
                     IPWQAIPKDYKDILVDALVDIPGLVEDFDKMRLCAEEPRRSHLRLELVRKCRILDRQL
                     QTWVGLLTRLGAKVEEHSCLDPTGKDLVTHVAQVHGMSLYWAASLVLYTILRLVSGPR
                     ARLPEHADPAEHARNLVAAVAILLEPSSRLYGQQNAALPLEIAWQYANALRSVSPDSE
                     ALLGTIRALRRRLHTGAAAPVSDGAPIPASTSG"
     gene            complement(826669..827438)
                     /locus_tag="MYCTH_2308086"
                     /db_xref="GeneID:11506744"
     mRNA            complement(826669..827438)
                     /locus_tag="MYCTH_2308086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664824.1"
                     /db_xref="GeneID:11506744"
     CDS             complement(827067..827276)
                     /locus_tag="MYCTH_2308086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664872.1"
                     /db_xref="GeneID:11506744"
                     /db_xref="JGIDB:Spoth2_2308086"
                     /translation="MVRNQTNCVSPSTLSWSATSCAVSATARTVAFCGRRRRRRKDQS
                     NVGARGRRRARGSETHNYRFREEES"
     gene            830188..832539
                     /locus_tag="MYCTH_71222"
                     /db_xref="GeneID:11506745"
     mRNA            join(830188..830351,830496..830822,830884..832074,
                     832155..832539)
                     /locus_tag="MYCTH_71222"
                     /product="phosphate-repressible phosphate permease"
                     /transcript_id="XM_003664825.1"
                     /db_xref="GeneID:11506745"
     CDS             join(830279..830351,830496..830822,830884..832074,
                     832155..832357)
                     /locus_tag="MYCTH_71222"
                     /codon_start=1
                     /product="phosphate-repressible phosphate permease"
                     /protein_id="XP_003664873.1"
                     /db_xref="GeneID:11506745"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="JGIDB:Spoth2_71222"
                     /translation="MALHQFDYIFAIGLIFAALDAWNIGANDVANSWATSVGSQSVTY
                     LQAMLLASAMEFAGCVGVGARVADTIRTKIVDTSLFVDDPALLMLGMVCAVVASSLYL
                     TFATRFGMPVSTTHSILGGVIGMGVASVGAKGVQWVGSGSGTSAINSGVVQVFLAWII
                     APGLAGCFAAIIFLLTKYMVLIRSNSALWALRVVPFYFALTAMLLTMLLLWKGGSYEI
                     HLTDPEIAGTIVGVGAGFGLLVSLTLVPWMYRVVIKEDWQLRWYHIPLGPLLLRRGDV
                     PPPPEDAGPVVKNYYEGRMTKEEFEARKAAQRGDVEVVGGDAAAEKTASAEGAVAADK
                     SATAEGSDAASAERPNRSPLADVRSAPKKLVGPKPEGKWYEGRVLFWYVKWALLRGVD
                     QEVVNAKSTHNMLAKNIDEVHAYAQHYDNRTEYMYSFLQIMTAATASFTHGANDIANA
                     IGPFATVHQVWNDGALPAKGKSDVPIWILCFGGAMLVIGVWTYGYNIMRNLGNRLTLQ
                     SPARGFSMELGSAITVILATRLKLPVSTTQCITGATVGVGLCSGTWRTVNWRMVLWIY
                     FGWIITLPVTGIISGCLMGIIINAPRWGYSG"
     gene            complement(834190..835874)
                     /locus_tag="MYCTH_71219"
                     /db_xref="GeneID:11506746"
     mRNA            complement(834190..835874)
                     /locus_tag="MYCTH_71219"
                     /product="mevalonate kinase like protein"
                     /transcript_id="XM_003664826.1"
                     /db_xref="GeneID:11506746"
     CDS             complement(834779..835735)
                     /locus_tag="MYCTH_71219"
                     /note="orthologue of Saccharomyces cerevisiae Erg12"
                     /codon_start=1
                     /product="mevalonate kinase like protein"
                     /protein_id="XP_003664874.1"
                     /db_xref="GeneID:11506746"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="JGIDB:Spoth2_71219"
                     /translation="MERKVSSPMAPTFMVSAPGKVIVFGEHAAVFGKPAVAAAISLRS
                     YLLVTTLTKSRRTVTLNFRDIGLNHTWTIDSLPWPVFHHASKKKFYYSVIHSLDPELL
                     NAIKPHAEAVSRDLPEKQRRMHVRSATAFLYLFLSLGSSQSPGFIYTLRSTIPIGAGL
                     GSSASICVCLSTALLLQTRSLAGPHPDQPLKEAEVQIERINHWAYVGELCIHGDPSGV
                     DNTVSSRGKAVLFQKNTSGPSSVTPLVNFPKLRLLLVDTRQPRSTATQVGKVRRLKDS
                     HPTTTGLILDAIGQLTASALELLSSANFNGNGTCDALDRLGR"
     gene            838243..839442
                     /locus_tag="MYCTH_2308094"
                     /db_xref="GeneID:11506747"
     mRNA            838243..839442
                     /locus_tag="MYCTH_2308094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664827.1"
                     /db_xref="GeneID:11506747"
     CDS             838502..839416
                     /locus_tag="MYCTH_2308094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664875.1"
                     /db_xref="GeneID:11506747"
                     /db_xref="JGIDB:Spoth2_2308094"
                     /translation="MPNPHGSPTHFVLKLYDRRFGTFLRSNVHGQVVPHTQEIEAAFR
                     TFVMKGTMLAFLEWLEDTNKTRDMPMKPRHFLDDADNGPVKFEAALWAKCHENFERET
                     QAYTRLRDLQGKSIPRMLAHVCLAATDDEPVDALKEMSPELVPYLEVNGILLERIDGY
                     ELEDMTASPLAPPTHEWQRIVQSAVNLAHDINRRGIVMQDCDPRNVVVHEVSQTPHFV
                     DLAECRFRDEMEKYWHEWEWDDDEDWDPEIEYWKFVDDYDNPKDIGAPMVTRAKRERG
                     VDLQVEYPTCKALISHIRHRKAEVARKW"
     gene            <839508..>840532
                     /locus_tag="MYCTH_2128713"
                     /db_xref="GeneID:11506748"
     mRNA            join(<839508..839824,840054..840168,840299..>840532)
                     /locus_tag="MYCTH_2128713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664828.1"
                     /db_xref="GeneID:11506748"
     CDS             join(839508..839824,840054..840168,840299..840532)
                     /locus_tag="MYCTH_2128713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664876.1"
                     /db_xref="GeneID:11506748"
                     /db_xref="JGIDB:Spoth2_2128713"
                     /translation="METYLDKANPAGISVCTWGVETWEKLHGEGRALTKHTFHIGFCL
                     IDGGHYSCVLAHTVQGQRAVEGTIVNWSADKPTPREVLEFYKNAQLSVPDRQDFQPRE
                     YAMGPSGFIHAGVSLVTVDSALVEGAGDGGPGPAQGGCMLQVANGSPALLRFASFDAF
                     SIPYLAVYFFASGGVSTAGLRPVTVAGYSIKKEQERAAILPRNPGLIRASYRLGSKCR
                     PLR"
     gene            <844893..>845822
                     /locus_tag="MYCTH_2037479"
                     /db_xref="GeneID:11506749"
     mRNA            join(<844893..845044,845317..845360,845504..845571,
                     845721..>845822)
                     /locus_tag="MYCTH_2037479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664829.1"
                     /db_xref="GeneID:11506749"
     CDS             join(<844893..845044,845317..845360,845504..845571,
                     845721..>845822)
                     /locus_tag="MYCTH_2037479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664877.1"
                     /db_xref="GeneID:11506749"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2037479"
                     /translation="WARVAAKLPGRTNKDCRKRWINKVCGNLKRGAWDEDEDQRLRQA
                     VSKYGQRWTLVASMVGSRSSDQCAKRWQHRLDPRLEHEDWTPEEDDLLLENVQTYGRE
                     WKFIQEEDFPTRSSNELKNR"
     gene            complement(<847133..>854562)
                     /locus_tag="MYCTH_96206"
                     /db_xref="GeneID:11506750"
     mRNA            complement(join(<847133..847189,847338..847861,
                     847948..850422,850571..851145,851200..853052,
                     853151..853828,853918..>854562))
                     /locus_tag="MYCTH_96206"
                     /product="polyketide synthase"
                     /transcript_id="XM_003664830.1"
                     /db_xref="GeneID:11506750"
     CDS             complement(join(847133..847189,847338..847861,
                     847948..850422,850571..851145,851200..853052,
                     853151..853828,853918..854562))
                     /locus_tag="MYCTH_96206"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003664878.1"
                     /db_xref="GeneID:11506750"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_96206"
                     /translation="MSASYTRDILVFSGQGSKQHLVDSGAPDSLIALLGEKQKVAYST
                     FLRRAQDALLREYSSIKADSGSLGHGNQVEEEVFEKSEHLLVPPSMLQSHPVFETISL
                     YTRHILELMLYQSQQQQQRGTHVVRETTGICTGALAAILAAAFSSYDSDDFVRAAVEG
                     VRLAFWIGVRAASLSVERERLEESSGSSSCVLGVFGVTEKRMGELLKGYYAEESEDRH
                     GNVRISAVFSDVALSLSGDAADLQRVKTYLEGRSIECRWAHIHALYHGGSKSKRAVDA
                     TLSDAARRNIAFPGRKSLHASVISAADGAHMGSGSDSAAADPGGPEETKTNILLERAL
                     RNIFIDTVDWKGTSAGLRASILDRLEGDSSAAYRIIGVGPGSRSLLDPFRGDSAHPGL
                     GVIDNLAESLAQPAQDDIAIVGLSVNFPGAKGQEQFWQLLASGLSTVAEIPPSRFGVH
                     VQDSDEAHGRSRGNGHANCLDNSFDFDPAYFNVSPREAKSMDPQQRLVLMAALEALED
                     AGYAPDSTPTFQRERIGVYMGVATGDYVDNLRDDMDVYYSPGTLRAFIAGRVSYAFKF
                     GGPSMVTDTACSSSLVSIYHACRALRAGECGTALAGGVNTMSSPDMYNGLARAHFLSP
                     TGQCKPFDAAADGYCRAEGCGLVVLKRLADAVAEGDHIYAVIRAIGVNQCGKARSITH
                     PHANTQASLMRTVLASARASPRSIGVVEAHGTGTQAGDAAEMASIRSVFCPRPPDQPL
                     YVSSVKGNFGHSEAASGVAGLAKLLLMMDRRQIPPQTSFVNLNPKLPANRPGEVTIPT
                     RMTEWKEPPGQPTTPRRALVNNFGASGSNAALVLEEYVVPPPRGRPHSTNNNNNNNNK
                     RSHHLLNISAKTAKALEAARRDLLAFLSQNPDVGLQDLCYTANARRQEYPTHRWSAVV
                     SDRGDLAEQLGGGHHHPAKGATTTTATATAGGGLGLGLPAKTVFVFSGQGGVYAGMGA
                     ALLATVPLFRSIADRCDETLVARGFPPVSPFLAGSAEASSSSSSSSSSWSAEDQIIIS
                     QCACFVLEYALAETWRHWGVTPDLVIGHSIGEYAAFAFAGMIGWEDALLLLAGRARLL
                     ATRCPPQVTGMVACRLSRAAVEQLLADKADELAGITVSCFNSPSDSVLAGPVDSLARL
                     ARHCKDNGIRHKRLDVPYGFHSPALEPILSDHGRAARAVPFRPPSLRAGSSLRGRLFG
                     QSETVDGDYFVQHAREPVNFSGVVEDALPELAGSHPTFIEIGPSPSTESMLKQIINTS
                     LSYTFLGSLTPTRAAWDSLSSALRELYLRRYDIKWRRVYDGSQAKFVRGFPGHPLNLA
                     TYYVPYKPPSRQDKLLPGFFSGPQQPPPRPKYAFLTDVSPAVEDGSATRYASTAMEPI
                     KKFVDAHQVGDVPLFPASVYVEVVAQALAYHASLDIASNVFMFENVKFEHPLVCGDDA
                     AGGSSRQVIKTALNMQPVEGQSYVCSSGSGDTLCAGGVRSLEVGSQAVVDILARRRGR
                     VDRLRRSVDGAPRSLAESFSDRTIYHVIFPRVVRYDKPLMTLRQLTTVAAGSEGHGYF
                     TLPLPPNPGRYVSSPALVDTLLHAPGFMANTLVDADSACICVALEQALVPSDSPSLHR
                     QELQVYCSLVDIEHSLIADAYVLDAEGSIVGYVEGMCFKKLKLKPFKAHLSRQLARRR
                     PAAAAPAPAPAPVPAGPSSGSVGGGGRGRPVAGDYTTATTKTTATATEISSTVCSIVR
                     GLCGVDYEPTEATTLAELGLDSLLSVELSHTLAKTLRCTVSPDQLQECSDLAQVVQLV
                     AKNSPLQHQLQLQQHEQQQQQQPTAPPTTAAPSVLQFTPATSSLDSSASSSFQPDQPA
                     TPNTEYNNIATSSTTISTTTTNSNNINSNNNKPTTGNAGSAAAATSLPEFQSLFLAVC
                     GVLPEDEDDERSVPLSALGVDSLLSIELCQALRDKLGVTVEDHDAVGDLTYRQLHDMC
                     ACAAATKLSPGPASPSPEAAAPSPPPTPQTAPGIRQLQKRGDGSGRSGSGSGSGGPLY
                     LFHDGSGTCGMYARVGPLGRDVYGVPSLRSDAQTLEALAADYIRQANLGAPQGGPLIL
                     AGWSFGGVLAFEIARQLGGAVVKGVVLIDSPAPVDHQPLPAEVIHQVVSGRRSASASA
                     LASASAREMQEAVEANFKRFAAMLGDYSRRHHHHHHHRQSPSAGRSSSSSSSSSPPPC
                     VMVRCVKTMDRSALGGAHYPWLGDPAEADRSIRTWERLLGRQLPVLELHCDHFSPFEP
                     ENVGELTQHLRTACEMLEDY"
     gene            <855469..>859014
                     /locus_tag="MYCTH_2018746"
                     /db_xref="GeneID:11506751"
     mRNA            join(<855469..855777,856002..858491,858619..>859014)
                     /locus_tag="MYCTH_2018746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664831.1"
                     /db_xref="GeneID:11506751"
     CDS             join(<855469..855777,856002..858491,858619..>859014)
                     /locus_tag="MYCTH_2018746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664879.1"
                     /db_xref="GeneID:11506751"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="JGIDB:Spoth2_2018746"
                     /translation="QITSLLDLIEFNAEHNPDHVFCLQASVAPDRGPAVDTDLGRPAF
                     ESRTIRFRELDSAVATCAARLSNLRQLDDQGKPKTLALYLESDVGLFIHLAAVLSLDV
                     PVLLLSARLAAPSVQHLLDRTGCDTVLVSTRTRPILAGSVADHVRLQVAEPYLAFLED
                     SRDGNSINGNTNGSSNGSLIKTGRETRPWKSGKSSLILHSSGTTGFPIKPIELSSRYS
                     LVYAACHEFPEEDQIDWTNLSTLPLYHGFGLLAPCLSLSIGMTCCFPPSSIIPAGRST
                     LALMEEFDCRSLMTVPSIVGELLAVGGGAIAPEHGTRLAEAGIRILNHYGVTEIGAIA
                     SIFRPGPDYNWRYLRLRTDLNLELRPSDPSSSSSPSSSSSSSSSSSGNRWRLVGWPIG
                     WDGRPFEIQDELERNPDAPPGRLKVRILGRVDDVIVLKTGEKVLPLPLESALNAHPAV
                     KTAVCLGQGHFEVVVLVEPREEEQQQQQKEEEDLVNAVWETIAHINPTLDRHARVTSK
                     AAVIVKPAHKAIPRTDKGSISRRLVHDVFAEEMRAAYAAVESEAGGGGGSLLGDVESG
                     LRKMVAQVFTQGDAVDVHRDLFEQGMDSLQALRLARLVNSAVASVRPDQGGQSVASAE
                     FIYRHPSIAKLTKAVRELLPQDGLSSRDEGEEEEEEERGARMRSLASAFAASVTKIEP
                     PRARVLLTGPTGGLGVQVLSRLVKRADVDKVICVCRSSAAGAGAGGAASRLRAALSGA
                     GISLSESERDKIETVEDSRLQSDPATASRLAGVVTHIVHLAWPMDFHRTLDSFEPHLR
                     MLTALIELGRSASAHAADPARGRRQGRRRQRPVRLVFASSIAAVRHHRDGPRVPERIM
                     DDPATAAPIGYAEAKWVCEHVIASTADALRDEIEPVAVRIGQLSGPEHTGGIWKTGEH
                     VPALVKAGQKIGALPSLRGTISWIPMDRAARALVDILFHGERLNTPILHLENPVRQPA
                     RDVMDIIAYELGLRGPNRLLPYDEWLRRARETGTIDSLVDFFENHFRTLALGDIILDT
                     TESRRISETLRRSGGLGADLIAKYVRDWTKQGFLA"
     gene            complement(<859629..>862435)
                     /locus_tag="MYCTH_2119794"
                     /db_xref="GeneID:11506752"
     mRNA            complement(join(<859629..860252,860288..860600,
                     860725..860791,860876..861078,861178..861221,
                     861379..861839,862004..862069,862150..>862435))
                     /locus_tag="MYCTH_2119794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664832.1"
                     /db_xref="GeneID:11506752"
     CDS             complement(join(859629..860252,860288..860600,
                     860725..860791,860876..861078,861178..861221,
                     861379..861839,862004..862069,862150..862435))
                     /locus_tag="MYCTH_2119794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664880.1"
                     /db_xref="GeneID:11506752"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Spoth2_2119794"
                     /translation="MATKRPDYTWVNGYQQLPEHPKTNGSAVENDVPADDDPTAYVTP
                     PSVELVTSPAHNHFGVNVIRSWPTMYDGTNSPHGIPEWWKPKPQVDVLIVGAGPSGLG
                     LAATLARQGVSFRIIDKADAPLAAGRADGVQPRFLETIGKWGLASEVAEEGPIIERTA
                     MYKDGEKLIFNRSHQSDSRYRGLHVITQGQIERIYIRDLLRHKAIVERSRTLSAFEVL
                     PTDGSANDEPYPVRATVRNQKTGEEEAIQAKFLVGSDGGASSIRKSLGIPFDGHGCCA
                     IIPREDGYIRLYTQLDISHTGPISQSRQARDPTFAESGGKVEVHSITPEEVLEQANKV
                     FAPYKLKFGAPLSWFAIWKISERVARTYSSPDMWVHLAGDAAHVHSVLGAFGLNASIL
                     DVCNLGWKLGLASKGLADHKTLLPTYTSERRKHASRIIRVSGEYLRFISGSTLGVPDL
                     DEPEKLEAAQIDGQGQGPVSGSNGVHSGHNFVGRFFKTNGQFLLGVDCPYDESVVAPR
                     RSVDGSSGRAAAIEVRNGVRAPNPRVCFETEKTGYLYDALSGAGRFHLVVFASSLQGA
                     EVRRRVGEFARSLVDPEGFHRRFGGETLFQVVLVVKLMPWEFEQFEASDAGRELLAPL
                     RRFASTVVVFDDRSPDEDAHTTYGVNHRTGAVAVIRPDLWVGASAYPDETDKIAAYFE
                     GFLTA"
     gene            <863010..>864856
                     /locus_tag="MYCTH_2066662"
                     /db_xref="GeneID:11506753"
     mRNA            join(<863010..863397,863525..864010,864128..864184,
                     864294..>864856)
                     /locus_tag="MYCTH_2066662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664833.1"
                     /db_xref="GeneID:11506753"
     CDS             join(863010..863397,863525..864010,864128..864184,
                     864294..864856)
                     /locus_tag="MYCTH_2066662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664881.1"
                     /db_xref="GeneID:11506753"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="JGIDB:Spoth2_2066662"
                     /translation="MNGTNGTQAKTHGGALDQTSIQLLQLSGLIQTWVANYIAAKNDP
                     GAESQGSLPSKPLYDARRTLLAAAGMLTELVSDPSSRIIEVALQQFEARSLHLAAATR
                     VPDLLAERGEMGIDELSARVGVEKKKLSRVLRCLCSIHLFSEPREDVFANNRITAALV
                     GNDPLRAYVLLGGQDVYTASDYLPRTLRDPVKGPSYAVEVTPFQDAVGGTKAPRWTWL
                     EERPTIRDLLDGRNGPDGKPSPYPGNFGTEIRMLAEKVAAGHSDQERVPRPEHGLFGL
                     AMVGGGRVFGEAHLYDFPWASLGSATVVDVGGGMGGFALQLSHIYPDLEFVIQDRGPV
                     LEQGETELWPRENPAALRAGRVKFQQHDFFDENPVKGADVYWLRYIIHDWSDDYCVDI
                     LRAIRAAMGPRSRILICDQVMNTTGGCAELPSAPAPLPANYGYYTRYSHTRDLTVMSL
                     INGIERKPTEFRDLVERAGLHLNRFWECRSQVGLVEVVLPDSELRRS"
     gene            complement(<865944..>867290)
                     /locus_tag="MYCTH_54712"
                     /db_xref="GeneID:11506754"
     mRNA            complement(join(<865944..866492,866610..866728,
                     866772..866790,866867..866897,866960..867045,
                     867141..>867290))
                     /locus_tag="MYCTH_54712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664834.1"
                     /db_xref="GeneID:11506754"
     CDS             complement(join(865944..866492,866610..866728,
                     866772..866790,866867..866897,866960..867045,
                     867141..867290))
                     /locus_tag="MYCTH_54712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664882.1"
                     /db_xref="GeneID:11506754"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_54712"
                     /translation="MYLSEEWLAYERKLGFRPVIIGTAQEIRTGYNSLAQTIGKQLPP
                     HDPTLTTVSAEGHQVAVRIYKPREATERKLPIGIYAHGGGFVAGSKWERDTHNCRYIA
                     QNTPCILVSVDFRLAPEHPVPAQVDDVLAGYLWTRENIDALNGDPAKVFLIGASVGGG
                     LALSVALKLIARGQGGQVAGIVALAPITMHPEHVPDEFRADYTAYEENAEGPLINRAA
                     MYVFNSINGCDERKDDPYVFPALHPLLGSELPPTYISTCGADPLRDDGTVIQRALSRH
                     GVRCRLKNYEGLPHFFWIYPEIPTGDTFRADTVEGVRFVLE"
     gene            complement(867731..869443)
                     /locus_tag="MYCTH_2308099"
                     /db_xref="GeneID:11506755"
     mRNA            complement(join(867731..868826,869104..869443))
                     /locus_tag="MYCTH_2308099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664835.1"
                     /db_xref="GeneID:11506755"
     CDS             complement(join(868038..868826,869104..869142))
                     /locus_tag="MYCTH_2308099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664883.1"
                     /db_xref="GeneID:11506755"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2308099"
                     /translation="MGQQTRVAVVTGTNRGIGLAILRTLASGWAGPLVVYAASRSGTL
                     PSGVSAQPHVKVLPARLSLRDPDSIEALASRVAKEQGVVDVLINNAGVYHYREGISDE
                     ERAETLETNHRGTLRMCQAFLPLMRRPGGRVVNVSSQAGRLRWFAPHLRPRFLAKDLT
                     LDALDSLVREYDAAAARGDEVRLGWPAHAYSVSKAALNASTRILAKEHPGVLINCCCP
                     GWVSTDLGAQAGPPPKTPEEGARIPLHLAFGDIGDVTGRYWANDSTADTGVGKVQQP"
     gene            869574..870106
                     /locus_tag="MYCTH_2308101"
                     /db_xref="GeneID:11506756"
     mRNA            join(869574..869893,869973..870106)
                     /locus_tag="MYCTH_2308101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664836.1"
                     /db_xref="GeneID:11506756"
     CDS             join(869744..869893,869973..870068)
                     /locus_tag="MYCTH_2308101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664884.1"
                     /db_xref="GeneID:11506756"
                     /db_xref="JGIDB:Spoth2_2308101"
                     /translation="MESSGNENSTPSNASDVADRPDLLEKGVNAADPKSPEAEPEEKR
                     AMTGFRWFAFVVSTLTAIFVYSLDNTVVANIIPVCIP"
     gene            870312..872275
                     /locus_tag="MYCTH_2308103"
                     /db_xref="GeneID:11506757"
     mRNA            join(870312..870569,870662..871320,871388..871546,
                     871622..872275)
                     /locus_tag="MYCTH_2308103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664837.1"
                     /db_xref="GeneID:11506757"
     CDS             join(870346..870569,870662..871320,871388..871546,
                     871622..871926)
                     /locus_tag="MYCTH_2308103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664885.1"
                     /db_xref="GeneID:11506757"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308103"
                     /translation="MGKLYAIYNPKWVYIVSFIIFLAASALCGAAPTMEAEIVGRVFA
                     GAGGNGIYYGLLALLSMHTTTKERPQYLSYTGLVWGLGTVLGPVVGGGFALYDWRWGF
                     YINLLFGAILLPAYLWAIPSTAAMPDKTQWQKLVMLDWPGIVLSVGAMVTLVIAINFG
                     GVDWAWGSGASIALFVVSGVLWIAFGVQQTFCIFTDKEKRLFPSHLLRQRMPVLLFVA
                     CASVASVAYTSVYYIPLYFQFTRGDSAIYTAVRLLPYICVLITAMPLSGWYLSNYGWY
                     KPLYIGGSSIALLTSALMAHYVDRETAVGIFYVIELFLGGSTGAYTQSSFAVIQSAVP
                     PAEAGNGLALMLISQLGGMTLGLSISGAVFVNTAVRNLEAAIDLPRHELTQLVAGASN
                     NLLETLSPAMRIQILDIIVESWRKAFIIIYAGAAASLVAAIFFRNGKANVVAAGGL"
     gene            complement(<872347..>873124)
                     /locus_tag="MYCTH_2119798"
                     /db_xref="GeneID:11506758"
     mRNA            complement(join(<872347..872574,872635..872818,
                     872931..>873124))
                     /locus_tag="MYCTH_2119798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664838.1"
                     /db_xref="GeneID:11506758"
     CDS             complement(join(872347..872574,872635..872818,
                     872931..873124))
                     /locus_tag="MYCTH_2119798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664886.1"
                     /db_xref="GeneID:11506758"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2119798"
                     /translation="MSAGSSGLIERLPCGNVRKCIYSDRDYEACLRDLEREFRVYQKL
                     PQHDRLLQLIRHSPKEGLVLHLHLFHSHGIIHGDLKPENLLLDSNSRLKIIDFSGSSF
                     DGIVESAIESTRFFLPRPLKEPPTPYEDLSDDEVEARYSQQIFPSVQELPCGQVIMDC
                     WRCEIQTAEEVMMRLKGEMESALKASDLACSPRIAPPTKLP"
     gene            complement(874550..875357)
                     /locus_tag="MYCTH_2308106"
                     /db_xref="GeneID:11506759"
     mRNA            complement(join(874550..874974,875109..875357))
                     /locus_tag="MYCTH_2308106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664839.1"
                     /db_xref="GeneID:11506759"
     CDS             complement(join(874672..874974,875109..875273))
                     /locus_tag="MYCTH_2308106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664887.1"
                     /db_xref="GeneID:11506759"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Spoth2_2308106"
                     /translation="MTAPETTTTVRGSCLCGKIQFEMNLAKENNCLCFCNSCRKITGS
                     VGMANSWCKHEDLKFLTPPSLMSVYEDKSPDSGGTIHRGFCGTCGSTMISENRKLFPG
                     HWIVPVGALEFDPLTTGWRPGQEFYCKRKMPWFQTPDDTVKYHELFQRDNGNA"
     gene            <875771..>876482
                     /locus_tag="MYCTH_2111801"
                     /db_xref="GeneID:11506760"
     mRNA            join(<875771..875985,876212..>876482)
                     /locus_tag="MYCTH_2111801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664840.1"
                     /db_xref="GeneID:11506760"
     CDS             join(875771..875985,876212..876482)
                     /locus_tag="MYCTH_2111801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664888.1"
                     /db_xref="GeneID:11506760"
                     /db_xref="JGIDB:Spoth2_2111801"
                     /translation="MAVPAGPDPKRLKGQFPDRQDIYDVFRLFYYPPEGTVRYFDYVD
                     DNVDWQVTGQSRFSGHWYTKKDYYDATWAKINLLLEEPGYKLETGEIIVDPTTGWSVI
                     EMKTVGVKTKGGVPYNQHYSWHCRWDKNGKIVEAKAFLDLDHLEKVFGGEQARQGIAS
                     K"
     gene            complement(<877285..>878421)
                     /locus_tag="MYCTH_2128726"
                     /db_xref="GeneID:11506761"
     mRNA            complement(join(<877285..877344,877402..>878421))
                     /locus_tag="MYCTH_2128726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664841.1"
                     /db_xref="GeneID:11506761"
     CDS             complement(join(877285..877344,877402..878421))
                     /locus_tag="MYCTH_2128726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664889.1"
                     /db_xref="GeneID:11506761"
                     /db_xref="JGIDB:Spoth2_2128726"
                     /translation="MADKGTWPWNLPEVTPEQLLQEYHSHRDKQPILYNEAIDKNYSA
                     EQLPHNFTRVVEGDMIPVTNHAAQQLAKRCADLYDKFVASSRHHHKCEDTEEGPAMNN
                     NADAEATTSNDDENIDSNIASSQILHITTSDFIEFTTLFHNLSCLNQASHAGHSCLNG
                     HHDQRQLHTQHDIAPSSRDTNLPFLHHETFPEEAYQTRSPLAQDEPDAPLYNKDLLRA
                     QQPVAAAAAAAEVQKQGIEHGGLQHQQHQQQQPSPSHAMATDTTTSTTAAAAALEAVL
                     ARVRAIRRAVEGGSAAAAREGLRWLEGEVERMLEGCAAGRGDGTTSEDENRSGGHLDP
                     RARVAGQQDDAELELDAWLDLSRFS"
     gene            <880208..>882745
                     /locus_tag="MYCTH_2111803"
                     /db_xref="GeneID:11506762"
     mRNA            join(<880208..880328,880368..880525,880878..880905,
                     881009..881100,881283..881316,881386..881465,
                     881566..881639,881745..881856,882114..882413,
                     882635..>882745)
                     /locus_tag="MYCTH_2111803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664842.1"
                     /db_xref="GeneID:11506762"
     CDS             join(880208..880328,880368..880525,880878..880905,
                     881009..881100,881283..881316,881386..881465,
                     881566..881639,881745..881856,882114..882413,
                     882635..882745)
                     /locus_tag="MYCTH_2111803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664890.1"
                     /db_xref="GeneID:11506762"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2111803"
                     /translation="MLDEDYEVYRNSWKEGVRCGEMTVKLDLCSATQVFQRKTTCAEW
                     AEATSGRKESCCSSVAARTITFPFSVMMATTRPKRPPSPLRELHQFMLADVSALVEKY
                     GPLIRIAANKVLCTDVDTIYWISSVRSDYRKYSGKGVAQFEEVNFMNLDEKTHFYALD
                     AIGEIAWNDPRTIRKWPFYYLLPNDGSETGFGAIVCNAKKIVAKRLRPNADPKRDMLE
                     SFMDQGLRGEELVQELDAVTVAAAASDSGPTAASPVPLLRDAQARPLPYLQAVIREVL
                     RLFPPLCAPPVYKEMPRGGDTLCGQALPGGTLVATGNQQWQAGRAIALVEARKVIGEL
                     VRRYNWSLANPLDPPRIYNNVVWVVRDLWVKAERR"
     gene            885390..887639
                     /locus_tag="MYCTH_2308108"
                     /db_xref="GeneID:11506763"
     mRNA            join(885390..886807,886866..887639)
                     /locus_tag="MYCTH_2308108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664843.1"
                     /db_xref="GeneID:11506763"
     CDS             join(885745..886807,886866..887557)
                     /locus_tag="MYCTH_2308108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664891.1"
                     /db_xref="GeneID:11506763"
                     /db_xref="JGIDB:Spoth2_2308108"
                     /translation="MRLPPPGPPRDKAREKRLLDGLVHVLTDPVCKTFPNSLGCTAAE
                     PDPDPSPDPAPAPTPTPTQPAVTSAPVTKPPAQSSPVQAPQPTTNPQKSEDPVGQQPP
                     RPTETASTGSGKSDGPGKSDGSGGKSDPPAGSDSQGSGSNGDSSGSGSSDRGSSKTEP
                     GTTDGNSGSSSSDGTSGTGPNAGHGSGSTTGGDGGSNNTGGDKSAGGNGSGSEIGGGH
                     DGSQDSGNTPPTTHKQGDGEPHSGSGPATGGVDVDDDGVPVFPQKGTYNDTPTTPGGA
                     TTPGETATPGSLTGDGISHTDWGNLAAGNDATHGSGTNSGGAGSGGDGIDGSNGNGNG
                     SSSDGASHPSSLPGIIGGVVAILVLLFVLLALVLYKYRHKRRVQAFLAKYTPFRTSGY
                     TDIEKKRSSIGAGLLFTDGSHGDVLMQQNPSTFGYGTMVSSAVEQPHPAATPRERPDG
                     PAQILTTTLPARRPGSPGSPLSPFEVSPLSPGFPQSPPPAVARRSSQESVSGVSIASS
                     GVFSPSLLSWPAPPSAAPSTTTSPPPSAHGNLADLAAKYKPLTPTKPTDPLNRSSIRA
                     VSPAPASPSTWQKPADWD"
     gene            888558..890272
                     /locus_tag="MYCTH_2308111"
                     /db_xref="GeneID:11506764"
     mRNA            join(888558..889517,889636..890272)
                     /locus_tag="MYCTH_2308111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664844.1"
                     /db_xref="GeneID:11506764"
     CDS             join(888654..889517,889636..890040)
                     /locus_tag="MYCTH_2308111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664892.1"
                     /db_xref="GeneID:11506764"
                     /db_xref="InterPro:IPR005547"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="JGIDB:Spoth2_2308111"
                     /translation="MIAAETSLFNIPSTSLMATTRENAAPTPHRRPRLNSTNDKPLLQ
                     IRSHSQSRLSPSQRLHHRTRGGALPRHPRAVLQRTWVLPLALTLVVIAVYVADPNESN
                     VAHKFLFLSYKLDDQHEHVQYGKGPRDIAFVSFYTVFLTFIREFIMAMVLRPLARYCG
                     IRSRAKQARFMEQMYTVCYFAFAGLLGLYTMKQSPGLWYFRTRGMYEGYPHVVHTAVF
                     KFYYLFQAAYWAQQAIVMALGQEKPRKDFKELMAHHILTLTLIFLSYRFHFTYIGIFV
                     YITHDISDLFLAISKTLNYLDHPAQYATFALCIALWVYLRHYLNLAILYSVATEYSAV
                     GPFELDWAAQQYKCRVAQLGTLALLAALQGLNLFWLRCLLRTAYRYVVSGVAKDDRSE
                     AEEEEGEAGAESKVGEGMGGLEGNKSQDLR"
     gene            <891272..>897778
                     /locus_tag="MYCTH_2066488"
                     /db_xref="GeneID:11506765"
     mRNA            join(<891272..893349,893415..893784,893923..895746,
                     895941..897482,897650..>897778)
                     /locus_tag="MYCTH_2066488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664845.1"
                     /db_xref="GeneID:11506765"
     CDS             join(891272..893349,893415..893784,893923..895746,
                     895941..897482,897650..897778)
                     /locus_tag="MYCTH_2066488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664893.1"
                     /db_xref="GeneID:11506765"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="JGIDB:Spoth2_2066488"
                     /translation="MLRRRGGWSGSGTNRGGGSRPGGRGGFAPRPTKVCQHFLRGRCN
                     YGASCKYSHDHEHVKRAREEEASTPSETHQAREDYFDFKRQVRRRGLFISPAYSNMWM
                     EVAETWNLALKILESPNREWHQSVARDLADDEVGGPDFIQRTIELCTTTLGDGNCLKL
                     ARAFLKVITHQSMLRSLSIDSFLGTIYRMVAGSNGNRGIVFFSDLNRRLSRSSESPRS
                     FLALVVLSLYELFRRERKGLLNDALYSLLDALREKAARLASLAEEAGPDSVDLDAVGM
                     QIDIIRRMMDGARGGLSEGETAQAINTVGNTGAIGIRSTFPSEVVVPGGKHDNDFADI
                     TKIQIFPTLGEITCDVSEYLPTTDFTQPHFLRDPVRRHIDSAFRLLRHDIFGPLKQVI
                     GALLAQRNAADAVSSNRFITGNIKAHIYSGAGLQHVLVDKRDGFEAIASFTTPPQVRK
                     LTLPDQQRWWQASSRLEPGGLVCFVSARGNEKSFLMFVVTEKNTGEIKEGRNKSTLVS
                     DRFKPAVKVKLASETRKNLAVLNRMYVDREEGLLVELPGLIPDTFVPILGNLQRMVKD
                     GDLAFRQWILPSSIDNADDQPSARIPPPAYARKPGFKFRLRTITRDGQPTLSVNPAEC
                     TGDIATPETLEAATGLDPGQSASLIAALTREYALIQGPPGTGKSYVGVQLVRVLLDHK
                     HEANLGPILVICYTNHALDQFLKHLLDVGVDKIIRIGGQSRAEELEGKNLRVVSQETS
                     RTQVEQRILGKSYSEAEASLEKAGHHLKRVHQARRNKPGWRMLEPFLSRRYPRIARQF
                     GSQWLDEDGFELADGRDPRWALAGSWISELTELQSDRVFEMVSAARHHREAIQRVHDD
                     VSCRTLLRADVVGVTTTGLARNINMLCRLGVKVIICEEAAEVMEPHLISALMPGVEHF
                     IQIGDHRQLRPQIQNYLQFSMETAVGRAYQLDRSQFERRAVGEPGLRALPVAQLKVQR
                     RMRPEISRLIRRVYPDLVDHDCVKNLPSVVGMRDNLFWLDHDHPEDGKDDGARAKSHS
                     NAWEVSMAKALIQHLVRQGEYKSTDIALLTPYTGQLQKLRASLGSDFEVFLSDRDLET
                     LAKEGFEETPEEEPGTENTGLGLRKAVEKKRLLQTIRLATVDNFQGEEAKVVVVSLVR
                     SNSNAKVGFLRTENRINVLLSRAQHGMYLIGNAKTYENVPMWADVLQQLRAGNAVGAS
                     IALCCPRHPDTQLLCSEPKDFTIKSPEGGCSLPCDKRLEPCGHRCPAPCHSQRLHDAF
                     DCLEPCPRLRSTCQHPCPKLCGQECGPCNVKVDGVKLPCGHVRDKVLCHQTLDLKSIR
                     CSQPVVKEVPGCGHSVPVPCYRDVESEMFRCPTECIGKLECGHRCPGTCRSCRTLLDG
                     PGGGVVVFRHQQCNKRCDRPYGTCNHRCSKTCHQGESCGTCPERCEVRCPHSRCHQEC
                     REPCTPCIEKCAWRCEHRGSCSLPCAAPCNRLPCEKRCDKTLQCGHRCPSFCGEECPQ
                     QLCQICCTKRDARVDVMEFKMYHEIDLDETPIVVLGCGHFFTGETLDGLVGMKNVYTT
                     DNLGNYNGLRELSGELMSIPTCPDCRVPIRQFATRRYNRVVNKAVLDETSKRFLVGGR
                     EKLAELEKKTALVEKKLSDSTSDTMYSPDVSLGKKISERYKPAIQLEKESAALRKSME
                     AEHQPTKKLFDAVLTFQRLQRERSLEEKLRDLTLSEPQIATPELVVYDRQITLKAHRL
                     QLRLQEAMLRDTFILLSRLKNSAILANIPVQHPDKRSAAFLKQCRVLIDSATSAKLPR
                     LVIETILSYARVAELDGWYRRAFIMSETAAPTGNNNTGTGTTTTTNNTAAPLASDATG
                     GSERTSNVQAGEKTSSSRETAIGLLDRALDLCATIPGPDGAAYRAEVEETMRLFAEPH
                     YEAVTPAEIAAIKAAMVSGAGGLATHSGHWYTCRNGHPFAIGECGMPMERARCPECGE
                     VIGGTNHTPVEGVERDTRMELA"
     gene            complement(<898092..>900450)
                     /locus_tag="MYCTH_2068129"
                     /db_xref="GeneID:11506766"
     mRNA            complement(join(<898092..898422,898596..900012,
                     900070..900084,900150..>900450))
                     /locus_tag="MYCTH_2068129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664846.1"
                     /db_xref="GeneID:11506766"
     CDS             complement(join(898092..898422,898596..900012,
                     900070..900084,900150..900450))
                     /locus_tag="MYCTH_2068129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664894.1"
                     /db_xref="GeneID:11506766"
                     /db_xref="JGIDB:Spoth2_2068129"
                     /translation="MEESHLKLDGHDGVPGVKEGPATEHHAGAHDDFLATHPSSRPDA
                     SAGPEIHHRHQDSRRHHKPRKIVLCFDGTGNKFHGDDSDSNILKIFRMLDRTSSDQYH
                     YYQPGIGTYVVSHSLSHTGTVARVKSWYIKAKDSAIGSSFDQHVVGGYRFLMRFYNPG
                     DEIYIFGFSRGAYIARFLAEMLDYVGLLSHGNEEMVIFAWKSFSNWQSRQANHTPEGI
                     KKKKGMYEFMKGFRETFSRPVRRIRFLGLFDTVNSVPRFETAWMQRSKFPYTARTSAK
                     VIRHAVSIDERRAKFRQDLIYQSHDRCQKSKHHGSAYNKLREIREAHGRGSRVANEKT
                     PDVRGRRRRAELDVPDTPAPAPYRPRSRSARSHQTAESVFHDGKSVLSVAPHPHDEDH
                     DVESAAESEDETDQDIDEVWFAGNHADVGGGWEVLADSKPASHVPLVWMVHEAMKAGL
                     NFDPDKVREMGCAEALDDITCMTSADARENGQRATDGAAERPPIPDIVVRSPNTSTPK
                     LFQRAGFGKNTNRATNSTSNSSSSSSSSAGEPPLTFKEMMHRAYVARIHDCLKFGGGL
                     SWSSVLGWKVMEYLPFRRMDLQEDDTWKPIRWPLPCGEVRDIPANARIHSSVIRRMQL
                     DGSYRPGNLIIGGGGRGVRKAPEENGIGDWVCVDREGCPIGEVWMRRDAFEAMQQNGY
                     REKKQ"
     gene            <902568..906484
                     /locus_tag="MYCTH_2094824"
                     /db_xref="GeneID:11506767"
     mRNA            join(<902568..902868,902925..903169,903219..903411,
                     903471..903877,904098..905567,905635..905880,
                     905997..906484)
                     /locus_tag="MYCTH_2094824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664847.1"
                     /db_xref="GeneID:11506767"
     CDS             join(902568..902868,902925..903169,903219..903411,
                     903471..903877,904098..905567,905635..905880,
                     905997..906302)
                     /locus_tag="MYCTH_2094824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664895.1"
                     /db_xref="GeneID:11506767"
                     /db_xref="InterPro:IPR002007"
                     /db_xref="JGIDB:Spoth2_2094824"
                     /translation="MARIHNRGKANGAVGVDSINANSTASVDKAEKLASKAKPKPVPL
                     KLKPTKADRKGVANAFERHAQVIHAKVEPPASQAGAGTAPRRWGKLSTVLKTLRSNAP
                     DWKTLKTMILKKVKGELLTDDKTMLMEHIIQLVSNLPSDSKLRVELTNNFLSELWSSL
                     EHPPPRYLSDKYKYRQADGSYNNIMFPQLGAAGSVYARSVNASVLRPGALPDPNLIYD
                     SVMKRTEYKKHPNNVSSILWYWASIIIHDLFWTDHKDMNRSKTSSYLDLSPLYGSNQE
                     MQDTIRTFKDGKLKPDCFADKRLLGMPPGVGVLLIMFNRVHNYVCDNLIAINEDGKFT
                     PASPNLTGEEAATAWKRYDNDLFQTARLITSGLYINITLLDYVRNIVNDDKWIEEFYY
                     DLFGKPGSEVTVQDLIMGFAKFESRLPEDPLERPFNGFKRGPDGKFDDDDLVECITSA
                     IEDCAGSFGARNVPASMRAIEILGIIQGRKWNVAGLNEFRRHFGLKPYETFEDINSDP
                     GVAEALRRLYDHPDFVELYPGLVAEEHKQPMVPGVGIAPTYTISRVVLSDAVCLVRGD
                     RHYTVDYNARNLTNWGYNDVQYDLSINHGCVFYKLFIRAFPHHFKYNSVYAHYPMVVP
                     AETQKILKDLKRDHLFDFSRPTRIAQDVECTSVEAARRVFASPDKYKPSWHASVDALA
                     PEGKSKLSADAAIHDRHRREVSQPLATADFVSQVKAFYATVTEQLLDSQSYHLGGLKL
                     ADLVRDIGNIAPTRFVSALFNLPLQTEDNPKGIYREHELYVVLSVIAEAVFTNPDPVK
                     KFPLFEAAKTVAAQLASAVERTVKNPKAKKKDPLSTYGARLIKGLSKAGLNTHDITWG
                     HVLTSSAAIAPYQAKLFAEAVDFYLSPRGAPYLEAVRSLAAQPASEQADSLLLGYALE
                     AVRLSGSTKLHFEATAADSLPAEDGTQIQVQPGDRIAVTSSAASDSEVDPSRPRESYV
                     HLAGLPNSSFLGTREIGYAALTAMFRALFRRPNLRRAPGPQGELRRVVGVDGASPGAV
                     EYLREDWGVKGPWPVTMKVCWDENV"
     gene            complement(906830..906901)
                     /locus_tag="MYCTH_t163"
                     /db_xref="GeneID:11506768"
     tRNA            complement(906830..906901)
                     /locus_tag="MYCTH_t163"
                     /product="tRNA-Gln"
                     /note="Anticodon: CTG"
                     /anticodon=(pos:complement(906866..906868),aa:Gln,seq:ctg)
                     /db_xref="GeneID:11506768"
     gene            complement(907464..908421)
                     /locus_tag="MYCTH_2308115"
                     /db_xref="GeneID:11511504"
     mRNA            complement(907464..908421)
                     /locus_tag="MYCTH_2308115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664848.1"
                     /db_xref="GeneID:11511504"
     CDS             complement(907935..908267)
                     /locus_tag="MYCTH_2308115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664896.1"
                     /db_xref="GeneID:11511504"
                     /db_xref="JGIDB:Spoth2_2308115"
                     /translation="MKVWTRSSSTLELSSNDLPKKKSLLDTSPSGFANSPPPDAPPDG
                     LCDVLPNNDAAGAEPDGSGDAPLPKSPPPDAPPDSLGDLVHLWGFKQQQLERELSRWE
                     LVQSEEFP"
     gene            complement(908422..911545)
                     /locus_tag="MYCTH_2308116"
                     /db_xref="GeneID:11506769"
     mRNA            complement(908422..911545)
                     /locus_tag="MYCTH_2308116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664849.1"
                     /db_xref="GeneID:11506769"
     CDS             complement(908510..911458)
                     /locus_tag="MYCTH_2308116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664897.1"
                     /db_xref="GeneID:11506769"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2308116"
                     /translation="MEQENAFSEIAHPASVSRLFNHHRMDPELPSGYKWAEQKKLYCP
                     RNLLDPRLPGPITPTHNFGYVFCHRGLYERASGIVDNSVAAIDNGIRHGLFLHEVDAF
                     VLEQLDKAFVAHDKNPSRVTSKVQPWEFYPIHEILKTSLVTRRVEREAKNPDLTSKQS
                     DFATSYLETDGKIPSLFDIMWRESQKPSGITLQIDLREQDFAKAIAYYSYHISKVSLL
                     YKDRQGVHRSKGWELFRSTILKGYNKHYKSFNDLHEDVKKKSVEAYGSNYFEIRHLHV
                     FPPLIMVFFAKYLVKLARATPPVDDPQGDRNSYEHIRHTFMNQVLSFVGVGVNSYNFI
                     LEIVHSGLGLGYDIINKTARNPLNGELLTDEGVIFDSRVDRAMIDVSVELRKRYPKLL
                     FSSCTRLPDVITPKGEYKAWHETSRLVRWDDGEKGLAAKLRAIHGGLYPQCQLVVADD
                     PAAEIAARTWIDQKSGLDRSQLMHMTYTEWLARAPEDVVAAITKLNNQDFMPNKFGYP
                     TTPGASGKKRDRTIELNTKIRSWLEALLSPKPISNLDDWNQYSVDEHWHSAEDKSQQA
                     TAYNSQLSIISDDDRHHEGVTLTWENRPRNHFSSSTSSDPIILHIWGKEYMFENVVDV
                     KRSLASMAAYKAAEEGNEQMVRNLLAIGANIDAFTGFYGTPLAAACRRGHGTVVKLLL
                     DADADVNMRRFSGTPLELAAAAGHRDVVEMLLTVLKRKQAHCDISEKLYTGTALHEAS
                     AAGHEAVVALLLDSGADINFRERHTALERACHNHCKINVINLLLARGADVNAPGRNFG
                     VRSALESACHCGDLYVTTLLLRKGAVIDFPLDETFTPEIVSLLVKHKADVNNVTRKPL
                     SESGLKALRDTGRVLRDPLKENFKETSLRVRKQRKPAPSGPVKELPVPRELRDCGCLL
                     CFIDQNIQPTIERQLIDSALWRTKKRREPPATIDDPVSVTLREMGKLTLVDRPEEMYL
                     TYNFEYPPME"
     gene            912163..914340
                     /locus_tag="MYCTH_2308117"
                     /db_xref="GeneID:11506770"
     mRNA            912163..914340
                     /locus_tag="MYCTH_2308117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664850.1"
                     /db_xref="GeneID:11506770"
     CDS             912388..914274
                     /locus_tag="MYCTH_2308117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664898.1"
                     /db_xref="GeneID:11506770"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Spoth2_2308117"
                     /translation="MAGTALYTYNPIQPNQIRLVKFVQDGDHICAVLETFSFEEPLPV
                     YRSISYTWASDGGRPQKNFKIEIDKRQLPVLNTLQPFFQALRSRNMLFDGKWWWIDSI
                     CIDQANLEERAQQVGHMDVIYRQAESVIAWLGEASSDSELAIDFIKLLDKTSRRKLSV
                     AELRATLQQDHYRTHWKALTNFLSRRWWSRIWSVQEFVLAPSVTFWCGMRNVSRVAVC
                     RSIGIADKCTSTGIKETLAFTHANNRRRAWGLYKASRKPGASLSFSLLALAAYFCCMD
                     ASDDRDRLYGVMALATDRSMLEIDYSLRTEEVYTRFTRSFITHYKSLDIICFASTYTP
                     PSGSIRPSWVPDWQKRNPVVIPSMTSQSSKSHVGNLRSPRHLDIDPSVYYSACKNKEA
                     VYAFEGSALQVRGVVVDTIDGLAGSRQFEMVQSSEWNSTQSSCCSSFPCSTTAILESV
                     CRSLTFDRFDRFLRYPMPTADFFRDFIRLLNRIITASKESVPRELLYWFQCTRSLQIH
                     GRSFEDILHDSFQADDNSSGPAPNVDESQHKTFFGRFFDTVVRLSFRLMVSRSGRIGM
                     VVEKAIKGDLVCVLYGCSIPVVLRKSSDGGSYTLIGECYFDGCMDGSLLDQVGLEEST
                     FVLL"
     gene            <917461..>918108
                     /locus_tag="MYCTH_26583"
                     /db_xref="GeneID:11506771"
     mRNA            join(<917461..917559,917662..>918108)
                     /locus_tag="MYCTH_26583"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664851.1"
                     /db_xref="GeneID:11506771"
     CDS             join(917461..917559,917662..>918108)
                     /locus_tag="MYCTH_26583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664899.1"
                     /db_xref="GeneID:11506771"
                     /db_xref="JGIDB:Spoth2_26583"
                     /translation="MRSIAVSLPVLSGILALAMAGELPLTPVATYPPGRPSVFVLTQV
                     PAKPTQAGTPTSPEKCSQVAARITPKLTPRPTYPPSLKSMADKLGGVDRDTCGEMDFR
                     ARFRSAGLDELNRFNQARHSTFIVPIWAMVGELWAACGEQARKMPQVAQEPCYHWALE
                     LSKSSNASFGGGVSAKGNGKGD"
     gene            complement(947053..>948493)
                     /locus_tag="MYCTH_2135030"
                     /db_xref="GeneID:11506772"
     mRNA            complement(join(947053..947544,947623..947981,
                     948065..948132,948319..>948493))
                     /locus_tag="MYCTH_2135030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664852.1"
                     /db_xref="GeneID:11506772"
     CDS             complement(join(947088..947544,947623..947981,
                     948065..948132,948319..948493))
                     /locus_tag="MYCTH_2135030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664900.1"
                     /db_xref="GeneID:11506772"
                     /db_xref="JGIDB:Spoth2_2135030"
                     /translation="MVGLMPPPPGVTPDFYHTTAVQVRFIIVFAVTFTLATIALLLRL
                     YTRAFVVKSLGLDEPMPAGFGRSMYEVSPTQIVGYLELLLALALTYLWPPTLTKLSIL
                     VLYWRISPNKAFRISIIALAVALVGYTVTFSALFAGPCNPNLNTPESATCLNNIAVAQ
                     AVLNIVTDGIIIVLPIPTIHHLNMALKQRITVGLILGLGSAACVASIVRIAYVRAMVT
                     NPDFTYTQCAAAVWSLFEMNLGILCNALAALKPFVRTYLPGLFSSNGWGSSGRKTGQQ
                     GPSKRSKSSKWAHGYQLHSVGNGKTEQTAAKDNVVVVDHQFSVEYNTAKPNAVMTTGS
                     GGSTDSILTPQYPAQKPL"
     gene            complement(948983..950501)
                     /locus_tag="MYCTH_2308118"
                     /db_xref="GeneID:11506773"
     mRNA            complement(948983..950501)
                     /locus_tag="MYCTH_2308118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664853.1"
                     /db_xref="GeneID:11506773"
     CDS             complement(949258..950379)
                     /locus_tag="MYCTH_2308118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664901.1"
                     /db_xref="GeneID:11506773"
                     /db_xref="InterPro:IPR004119"
                     /db_xref="JGIDB:Spoth2_2308118"
                     /translation="MSFPSPPAGAKGALDSADPLPVVVEQVTPAWFTKILGRPVATAE
                     LVEPIHGTASKLLYKLTYEDSQDAESLPTHVCVKGGFNPDLVKLHPSLNAVYRREAEF
                     FYHIAPTVSMRLPPVWYAGSDTVTGQGIVVLDDLKAKGYKFGDPLEAWPVERVRAGVE
                     ELAKLHAKTWGAKPADFPWLKEGLSLREVILSLMAESEWPKRFFDEAAKPPVTDEMTN
                     RERMIRAFKTLWATTNQDHLCVVHGDSHIGNTFITPSGEPGFLDWQGLHFNSFLHDVT
                     YFIVGALTIEDRRANEVELFEHYLATLHKAGGPKLDKEAIWDDYRKHHFHGFAWALTS
                     PMMQPKDKVDAMTARHVAAIVDHKSLELLESLPGYVKEV"
     gene            954424..955385
                     /locus_tag="MYCTH_2308119"
                     /db_xref="GeneID:11506774"
     mRNA            954424..955385
                     /locus_tag="MYCTH_2308119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664854.1"
                     /db_xref="GeneID:11506774"
     CDS             954550..955308
                     /locus_tag="MYCTH_2308119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664902.1"
                     /db_xref="GeneID:11506774"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2308119"
                     /translation="MPPIRGHKVLVIGGSSGIGAAVAKLAGQEGASVAIASSNPTRVE
                     NAVQKLRAAVPEATFSGYTVDVNQDDVEERLDKLFADVTAGLGGQLDHIVYTANVIQF
                     TPLSSVTVPFLRSNVQFGYVVPLILAKLAPKYVRSSYTSSITFTTGRAAERPVKGVAA
                     LAGIGAGLFGITRSLALELAPVRVNLVSPGTTDTDIFGPPEVRAPRLAEEAKNSLLGK
                     VAAPEEVAEAYIYYMKDTNNTGSHISTSGGALIQ"
     gene            complement(<955617..>958088)
                     /locus_tag="MYCTH_103671"
                     /db_xref="GeneID:11506775"
     mRNA            complement(join(<955617..956628,956717..956947,
                     957039..957742,957819..>958088))
                     /locus_tag="MYCTH_103671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664855.1"
                     /db_xref="GeneID:11506775"
     CDS             complement(join(955617..956628,956717..956947,
                     957039..957742,957819..958088))
                     /locus_tag="MYCTH_103671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664903.1"
                     /db_xref="GeneID:11506775"
                     /db_xref="JGIDB:Spoth2_103671"
                     /translation="MKDLLPIPATDPTTATPDSQTHTDAAGDGPTLSHALAAETRGAQ
                     GPAQPNNNNSSVVDLGWNEKKENIAASPIEGMTNEELWLLVRRFNKQIYNVKATPYPP
                     PGGLDLNIAEDEEFSPDKLRANIERLYMTVGVGLLAASKHVARLRSWQERRRTTYLAG
                     AYFVAWAFDFLMPLLSVVVLALIGFPRARELLFPPAPLALVDSKTGGIQKPKAGVLGS
                     HDSATGALENHKGEAVEQEASNFVSGIASVAMSSAAYSDEDPGADTALDPTALATKTA
                     DARDKAGGEETGAKHDKTKVPMEKVMWNKMRPVMHTIGTVADTWERLANALSPIPLFP
                     SEVYRLRLVAILLPLLLGSSLFLTPYLVLKLLSFLAGAVFFGDPVISRCLDWLNRTIP
                     NWPELLQPRNTILNGVPTNAQLTLTLLRHGEVNHAPLPPPPPPSPRVTPPPPDKPAAL
                     SDGDLRAEAGGDSPLGVSNTAELDSAITYDPSTIPHETNNTTGPENHAAVRGERDRDR
                     DRDRDSAGSGATTSKHGHGHGHGHRILGFFKGGTTRGAVKTAVGADKLRAKTPGSAGA
                     RDHRLGVLAPGRRSGAGGGQQQEGHGPVPAGAGPAEFEARWEGHRGRVYVSASGATVP
                     VVAFGKSSPSTTTTTSSAAGRGGAAGGGTGTVGEEEELRPMWSVPAAEVVEMLKIGGY
                     AWKAKLVVGWSMGTEVKDGLVIRTVAGDEYKITAVPMRDELFNQLIALGGQKWEAR"
     gene            958600..960302
                     /locus_tag="MYCTH_2308120"
                     /db_xref="GeneID:11506776"
     mRNA            958600..960302
                     /locus_tag="MYCTH_2308120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664856.1"
                     /db_xref="GeneID:11506776"
     CDS             958912..960132
                     /locus_tag="MYCTH_2308120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664904.1"
                     /db_xref="GeneID:11506776"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="JGIDB:Spoth2_2308120"
                     /translation="MNGNDRVLQLSGSCNNYPWGKQGQQSLAARLCKTTAKDFEIKDD
                     EYYSEMWFGDYPDYPARVLETGKPLKDVLNENKERLLGKKVIDDELDGQLPFLPKILS
                     IAKALPLQIHPNKDLAAKLHAKDPDNFTDPNHKPEIAVALSRFEVFAGFKPLSEIEPL
                     FRLPALRPFVPDGTTQWTDKTLREVTRNILKGGDATVKRVQDGLLSTAKSDLGSAGYI
                     LDLLPRLQRQYGPQDPGSLVALACMNFLVLQPGDALFIPADGIHAYLSGDIVECMARS
                     NNVLNSGFCPPAERNSIDLFADTLTFRAHSRDDVVLPSAETPRSRTGKTRVYRPPVSE
                     FDMLRAELAAGEADEISESDGPGVLIVTKGSGRMEADGKKFELAEGAIYFVAPRVRVR
                     WETDTGMEVYMAVV"
     gene            <960557..>961619
                     /locus_tag="MYCTH_96182"
                     /db_xref="GeneID:11506777"
     mRNA            join(<960557..961315,961415..961440,961493..>961619)
                     /locus_tag="MYCTH_96182"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003664857.1"
                     /db_xref="GeneID:11506777"
     CDS             join(960557..961315,961415..961440,961493..961619)
                     /locus_tag="MYCTH_96182"
                     /note="Contains conserved domain SET[pfam00856], SET
                     domains are protein lysine methyltransferase enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664905.1"
                     /db_xref="GeneID:11506777"
                     /db_xref="JGIDB:Spoth2_96182"
                     /translation="MRTSPRTMILTSLALLQLALSSPHSSTPPLPPAQCAPGNFPSPF
                     NPNLTTCLDSAILLPSAWHPWTHRPHCVEAADNSPWCVFTRAALHSSISVVTTPDEAA
                     GALNPLRHVLDDDDDDDNNDDDNTADSPKGRRRPYEVRDVPGKGKGAVATRRIGKGTA
                     VLADHAAVLAAVEYPADVMREEVQELLAVAAAQLRDPGAVEGLARRGARQGRKDYGGD
                     GEVVEMSEMEDIMLTNTFGVTVGGKEYMALFPNLARFNHACKPNAFINFSQRTLAMTV
                     WAARDIEPGEVRNCKSDAAIAASSNCT"
     gene            complement(<967626..>967841)
                     /locus_tag="MYCTH_54995"
                     /db_xref="GeneID:11506778"
     mRNA            complement(<967626..>967841)
                     /locus_tag="MYCTH_54995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664858.1"
                     /db_xref="GeneID:11506778"
     CDS             complement(967626..>967841)
                     /locus_tag="MYCTH_54995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664906.1"
                     /db_xref="GeneID:11506778"
                     /db_xref="JGIDB:Spoth2_54995"
                     /translation="YPDNILISSKTIDEHRKYVKVVLDTLYIYKLLVNEEKSKFYVRK
                     TVFSGYKISLGQIRIEPLNVKAIKNWL"
     gene            complement(<1005044..>1005277)
                     /locus_tag="MYCTH_2067028"
                     /db_xref="GeneID:11506779"
     mRNA            complement(join(<1005044..1005116,1005153..1005190,
                     1005203..>1005277))
                     /locus_tag="MYCTH_2067028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664859.1"
                     /db_xref="GeneID:11506779"
     CDS             complement(join(1005044..1005116,1005153..1005190,
                     1005203..>1005277))
                     /locus_tag="MYCTH_2067028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664907.1"
                     /db_xref="GeneID:11506779"
                     /db_xref="JGIDB:Spoth2_2067028"
                     /translation="VGLILDLKKYIFTIKEVKYLNYIIEVYLDPKKLAAICNFLGFVN
                     FYRDFIFNFSKLTIPLI"
     gene            1019193..1019855
                     /locus_tag="MYCTH_2308122"
                     /db_xref="GeneID:11506780"
     mRNA            1019193..1019855
                     /locus_tag="MYCTH_2308122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664860.1"
                     /db_xref="GeneID:11506780"
     CDS             1019543..1019770
                     /locus_tag="MYCTH_2308122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664908.1"
                     /db_xref="GeneID:11506780"
                     /db_xref="JGIDB:Spoth2_2308122"
                     /translation="MYEVPARLYYHIGNLDKALEYTLKVTHELDAFGASDEAGQAKIE
                     MLKGVIQRLEREIKEKENREAPRKENGRNED"
     gene            1020418..1021930
                     /locus_tag="MYCTH_71204"
                     /db_xref="GeneID:11506781"
     mRNA            join(1020418..1020916,1021014..1021419,1021540..1021930)
                     /locus_tag="MYCTH_71204"
                     /product="polysaccharide lyase family 1 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664861.1"
                     /db_xref="GeneID:11506781"
     CDS             join(1020449..1020916,1021014..1021419,1021540..1021676)
                     /locus_tag="MYCTH_71204"
                     /EC_number="4.2.2.2"
                     /note="CAZy_ID 267939"
                     /codon_start=1
                     /product="polysaccharide lyase family 1 protein"
                     /protein_id="XP_003664909.1"
                     /db_xref="GeneID:11506781"
                     /db_xref="InterPro:IPR002022"
                     /db_xref="JGIDB:Spoth2_71204"
                     /translation="MRFSFLTVASALAPLTAAFPFGSFGLASWDVEGFAKDNPIGVTT
                     GGEGGSTVTVDNAADFKAAVAGDEPKTVLVKGEINLPSRPKIGSNKSVIGVGRTAHIT
                     GSGLDVFNSTNVIIRNLKISFIEDNDCITIRNSTRVWVDHNEFASDITKGPDAYDGQV
                     DIIRGSDWITVSWNYFHDHWKSSLVGNDTTFRDIDFGHLHVTYHHNYWRNEGTRGPAG
                     RFGHQHVYNNLYVDFLYQAIHSRSDNQVLVEGNVFRGKTREALSTYGLVIPDDSPNTC
                     TCGDEELDGYANLGAKNDWGKATVNITQVGNFRKAPYKFKLTPLPLVEPIVKLGAGVG
                     KI"
     gene            complement(<1022103..>1022488)
                     /locus_tag="MYCTH_2111820"
                     /db_xref="GeneID:11506782"
     mRNA            complement(join(<1022103..1022377,1022440..>1022488))
                     /locus_tag="MYCTH_2111820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664862.1"
                     /db_xref="GeneID:11506782"
     CDS             complement(join(1022103..1022377,1022440..1022488))
                     /locus_tag="MYCTH_2111820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664910.1"
                     /db_xref="GeneID:11506782"
                     /db_xref="JGIDB:Spoth2_2111820"
                     /translation="MPQYKGGDQVRYKPVGGNRIGHASPDSRPPESVGTVKGVLMEPG
                     NQAGRNMSASAEQPQYEVRDLGQDYLELKYGPWALALPNYLKIENANTSKTTTIYEAN
                     ILGSV"
     gene            complement(1023641..1024746)
                     /locus_tag="MYCTH_2308126"
                     /db_xref="GeneID:11506783"
     mRNA            complement(join(1023641..1024407,1024472..1024746))
                     /locus_tag="MYCTH_2308126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664863.1"
                     /db_xref="GeneID:11506783"
     CDS             complement(join(1023742..1024407,1024472..1024636))
                     /locus_tag="MYCTH_2308126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664911.1"
                     /db_xref="GeneID:11506783"
                     /db_xref="JGIDB:Spoth2_2308126"
                     /translation="MSADNIKPSAGSMVDYDVELPKFYRNPNEPEHYRLSKAGIEACK
                     SKKPAVPPWLISFRFRTRYISAFATQFDSDRPHILDLQICPSRVARFFGACVNLLPTF
                     AQSWIRAMMPEWFLPSRVILKAQKRYESGEANEELFDTETRAYDRLKPLQGTVIPKCY
                     GLARYNGLRAMILERLGGVSLASPQGATLTLEEISALMQPCHRAMHAYGVHHSDPQPS
                     NYQLVDGRLMALDLEYVEWDLPDEKNILFMRTNIYDLSIRYLGMQKYYHRGEGLLEPA
                     "
     gene            1025340..1026550
                     /locus_tag="MYCTH_2308128"
                     /db_xref="GeneID:11506784"
     mRNA            join(1025340..1025976,1026055..1026286,1026348..1026550)
                     /locus_tag="MYCTH_2308128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664864.1"
                     /db_xref="GeneID:11506784"
     CDS             join(1025441..1025976,1026055..1026286,1026348..1026359)
                     /locus_tag="MYCTH_2308128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664912.1"
                     /db_xref="GeneID:11506784"
                     /db_xref="JGIDB:Spoth2_2308128"
                     /translation="MPSAGELILQNSTNEIDNPKYITRSDKEWAHEYAGIENILLHTT
                     PGYGGNTVHATFDSAFLPLDDDEERRMTEPANPPNERSWRLETEADVEHWWHTEVSDV
                     VLAAWARYPGIVQTCHTKPLSDVNIPENVDATYAIYIGNQRKPVVIGEMKRNLINRRE
                     WEAGNVTSSQQKLARELRGYADRYECPQMFCWDGETLLMLQFRATSPWDIRRADCAVD
                     CWVIPITKSTCSLRYALYRLLVQGFRRCQAAAAARPIQADG"
     gene            complement(<1027011..>1027522)
                     /locus_tag="MYCTH_2023929"
                     /db_xref="GeneID:11506785"
     mRNA            complement(join(<1027011..1027295,1027391..>1027522))
                     /locus_tag="MYCTH_2023929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664865.1"
                     /db_xref="GeneID:11506785"
     CDS             complement(join(<1027011..1027295,1027391..>1027522))
                     /locus_tag="MYCTH_2023929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664913.1"
                     /db_xref="GeneID:11506785"
                     /db_xref="JGIDB:Spoth2_2023929"
                     /translation="RGVIAWLPAKRFIKPKSVPNLPPGVFNHPVLIYQTTSEQADVFL
                     ITSFHAGESLTGKFQSDAEFRSRQMPIDPAPPHPDNGVRLTLARGRVWPKESYVSISL
                     FTVPISILREETSGPWALSPESLAALDDIVAKLPHLR"
     gene            1030146..1031981
                     /locus_tag="MYCTH_2308129"
                     /db_xref="GeneID:11506786"
     mRNA            1030146..1031981
                     /locus_tag="MYCTH_2308129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664866.1"
                     /db_xref="GeneID:11506786"
     CDS             1030316..1031851
                     /locus_tag="MYCTH_2308129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664914.1"
                     /db_xref="GeneID:11506786"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="JGIDB:Spoth2_2308129"
                     /translation="MTVSSLTHPPFAHELLIAQLAVQRAALVTKRILASVNAAARITA
                     SPPTLSPSSSDLDTCASPASSPGDHTTTTRSSSISQYLHPTTAASSSYFPASTSPWTP
                     LSPHSPSTSPPLPAAAAGDPQQQHEHHHQLLPQYSAAGEAEANANANEPPRRLSVAKR
                     DASPVTVADLAAQALLVAALRAAFPADAVLGEEDASALRADPLLAARVWDLVDAARLE
                     DEASERLLGPRPRDLAEMMALIEFGGGGGGGEGGGEGGGGGGGGGGGAMSAEEALAAG
                     RRVWCLDPIDGTSAYMQGGQYAISLALLDCGREVVGVLGCPNWRFEEGLPAGQWRVRE
                     HAVDEDGMGLMLSAVRGQGATVRPMGPGVLREGRRLDRGRGKATVDLRDVHFVDSEKS
                     PATLTEKVRELARLAGASHRGTNLYSSHVRYAAVVLGGREFVQLRWPKPEKGPWSIWD
                     HAGSQLIYTESGAGKVTDLYGKPIDFTAGCKLSNNRGLITADESIHDQILALVDRMRN
                     AEV"
     gene            complement(1031989..>1036646)
                     /locus_tag="MYCTH_2135036"
                     /db_xref="GeneID:11506787"
     mRNA            complement(join(1031989..1032337,1032430..1032523,
                     1032600..1032731,1032850..1033209,1033300..1033532,
                     1033650..1034151,1034243..1034617,1034708..1035417,
                     1036496..>1036646))
                     /locus_tag="MYCTH_2135036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664867.1"
                     /db_xref="GeneID:11506787"
     CDS             complement(join(1032018..1032337,1032430..1032523,
                     1032600..1032731,1032850..1033209,1033300..1033532,
                     1033650..1034151,1034243..1034617,1034708..1035417,
                     1036496..1036646))
                     /locus_tag="MYCTH_2135036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664915.1"
                     /db_xref="GeneID:11506787"
                     /db_xref="JGIDB:Spoth2_2135036"
                     /translation="MIDQDGLVRGHRRCRVAGLSRWLESEVTLCSELNIKYEMEKKAG
                     DKNVEHGCAPMGLYIVDDAYVDPVPPADAWAAFLASRFSKRKELYEKFSDHEREIVRK
                     ELRRIRHLREYFEEHRLSGTDSTTLLASLEKAHHAWRSQAGRGCKEELHRLEVGIARS
                     SGYRRQQLNRQRLILKKVEQWSQPNYQYEELRNSVAPESFVPGLDAIDYNVDDNPAEP
                     NYGYNGWIMAFKKGKGGVTLDHPLCHGKFPHQKIAMQKLLYDEERTPLKRSPDRTQLR
                     YFHLQANNMKWDAIARYYEEDSSQLDPTRGLSQRGLYQPSTKKTQSNTEKLLKRELWH
                     GQERGGGSNHLPPHSRQIRPRCAFVPSAPWKEDTGDQPGSTPQDHGQGQGQVRHSEGS
                     LQETTETYLRSSESRDIVLFMPYLHWEIEKRLARMTNVIRKTQHVHERQFAFERDSKR
                     RGTWSSVVERARAMASRMDSTASELGGWSYDAPPWRPQSPLGRYIWLAAKLYQLIDEA
                     ADWRLITDHLCTQSPLHPRRTLEQYYNWTSEDTAHRDRQQVVYRGTRMRNDPEAIPRV
                     VVVDQLWLWILDENTILTAFPRRWGRNNPDPSAVHRAIRDRLGAADTKQITSIYELAL
                     VIIDECSKVFFDRTKPDLRPEVVDMFGSAISNISEKKTEAYERFGRDVKRMNNQDPLQ
                     TDEELLRKTLNIKFEWSVLMEAQNVIDQLQIMQEIFTQQITVMGDFEKALRGLSSDPP
                     DGLKTAIDRAGQLILDMKLRRDELANLEKRQANTRSQLRELLDMKQQQAGIIEAKAAI
                     RRADETVIQGRSIVVFTVVTIFFLPLSFFATVFGMNAQELDSGTMSMGTQFMWMFVLS
                     SIVITLSLALAFNEQARQWVFRAFRSCFVFLIRPVVNRNKNDSSNLAAASPRAIREFM
                     LTKQKEWEGTDGATSTGSLPLHRNEEPKKGVTARLTQLWRRESV"
     gene            complement(<1036774..>1037552)
                     /locus_tag="MYCTH_2111826"
                     /db_xref="GeneID:11506788"
     mRNA            complement(join(<1036774..1036871,1036937..1037080,
                     1037480..>1037552))
                     /locus_tag="MYCTH_2111826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664868.1"
                     /db_xref="GeneID:11506788"
     CDS             complement(join(1036774..1036871,1036937..1037080,
                     1037480..1037552))
                     /locus_tag="MYCTH_2111826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664916.1"
                     /db_xref="GeneID:11506788"
                     /db_xref="JGIDB:Spoth2_2111826"
                     /translation="MAAVQILSAVDTAFGPFPGVLSTERKHPSSIPIFLQGILAWSTF
                     CPGVGALRLFADLFSFAIIVDFPFFKLGPTWACFQLFCAAGSGLMITILLPALQTPLD
                     EA"
     gene            complement(1038650..1040553)
                     /locus_tag="MYCTH_2308133"
                     /db_xref="GeneID:11506789"
     mRNA            complement(join(1038650..1038870,1039037..1039997,
                     1040078..1040553))
                     /locus_tag="MYCTH_2308133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664869.1"
                     /db_xref="GeneID:11506789"
     CDS             complement(join(1039091..1039997,1040078..1040427))
                     /locus_tag="MYCTH_2308133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664917.1"
                     /db_xref="GeneID:11506789"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2308133"
                     /translation="MARTNAQKGACDRCRGQKLRCTWDPNEPQCQRCARANAVCTIPP
                     PRPMGRPPRRQNRSQSTSSHSCAQSPGAPGGGQGMYCWNEQNATPTPPISDGDTDITM
                     NSASVLSDPPEFFPWFPEHDGLNLFAPRSTTVIAPMAVSPPMSTGTATTDSSRPFGLQ
                     SEMLTPPLDAGGKLAEENQSNHGCIHEGHPIDLATTKVEETSGDQEQIQLLTQLCELN
                     VALFQHPLHRERDKSYLRPAMTPNSDDMSQPQAGSSPSAGNSPASSDGSSIADLNIGD
                     LRTGSLFQLTCRLKDIITRIRAHDEATAHGPKRYDPSTALMALSCYTRLDLLFSRALD
                     ILVRLRNSGPIPESMRYLMPELVIDGFSMAGTLDLQLSFLIHLHEQARDRIRTCIRSA
                     GGPARVGRDKGDSIRQGAPAPVTIGS"
     gene            <1044391..>1045594
                     /locus_tag="MYCTH_2119814"
                     /db_xref="GeneID:11506790"
     mRNA            join(<1044391..1044442,1044807..1044987,1045049..1045247,
                     1045286..>1045594)
                     /locus_tag="MYCTH_2119814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664870.1"
                     /db_xref="GeneID:11506790"
     CDS             join(1044391..1044442,1044807..1044987,1045049..1045247,
                     1045286..1045594)
                     /locus_tag="MYCTH_2119814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664918.1"
                     /db_xref="GeneID:11506790"
                     /db_xref="JGIDB:Spoth2_2119814"
                     /translation="METPPPGPRAMMVDIGEQQIVHNEGCDLHYGYQDKGPLITFIPG
                     GNGHGRQFNKMMAALSGRFTCVTFDRRQMSASRVPWASTSPSFFGSSGGGFFAFQFAL
                     DFPDMADHLIATVGLLPDASALLDWFNHLLEVYETRGLEETSGIPKTEPPEPENVRIF
                     WANEIPVLVAYIPNFCRLKENKTSSGLMRRIRCRDPFFARATVEQAKILDCPLHVVPG
                     HHQWFEIETKEFHFPDMLETLIRKRNGS"
     gene            1047461..1050784
                     /locus_tag="MYCTH_2308135"
                     /db_xref="GeneID:11506791"
     mRNA            join(1047461..1048765,1048919..1050784)
                     /locus_tag="MYCTH_2308135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664871.1"
                     /db_xref="GeneID:11506791"
     CDS             join(1047557..1048765,1048919..1050607)
                     /locus_tag="MYCTH_2308135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664919.1"
                     /db_xref="GeneID:11506791"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="JGIDB:Spoth2_2308135"
                     /translation="MDEKSSLPAHRESPAPTSGRPRWRRQKPRRSSALRFLALGCLCF
                     IAFAQWKQLSHRPLPPRNPDITLHGLSVKRLQDDLATCAKLRKTPQDPIGLGRERNAR
                     YIDGHAPTLIKNATVWVGEPAPGTPPDAARKGAGYSWIKADVYLEHGLIKRVEDNIEL
                     FTVAWDTEVYDAKGRPLTAGIIDMHSHAGVDSLPSLRGNEDTNEMASDITPYVRSIDG
                     ILPLDHQIQVIKSGGVTTSLVLPGSANNMGGEAYVIKHAVGRPDGRNETSAADMLADP
                     DRNWRFMKMACGENPKRVYGDPGKQGPTSRLGESWEFRHAFEQAAKLVREQDDWCDAA
                     AARGVHHMKSYLPQELRWESLGALLRDQVRLNTHCYTIPDLEAFVDHTNEFKFKVRAF
                     HHAHQTYLVPEILKRAYGREPPASALFADNMWYKAEANTASEYAGKILYDNGLTPIYV
                     SDNPVLNAQHVVFEAAKAYKYGLPYHAALASVTTAPAERLGFGNRLGKVKPGFDADVV
                     VWDSDPLSVGAAPVQIWIDGTAQYEDPVELKKPAPEPIVPDESLSKIPEGPVAMDEVI
                     FTGVSKVLLNKNVESLSANNIVVVSKGKVTCIGACESELRAAAESNTPVVKLKNGYLT
                     ESFTVFGSKIGLNAVDAESATDNGASGSAFTRAEDGLALDTQKTNVSYAYGVTKAISA
                     PKLSGQDTNHGTSVGFLTGALTPLSEHAVFASDAAVHYTLTPSVKSASLPDVSSISAA
                     VAALRRKLLAAAVAARAAAPVDDRYSEDAYLRRVVNGSLPLVVTVHSADTIAALLKVK
                     AAVEKELEEQKEGAPARRLRLVIHGGAEAHLLARELAEAQVGVVLAPLLSYAASWDQR
                     RALTGAPLTRGTAADRLLDAGVPTAVGPDEDWVVRDLGLLAGIVWKNGEGRVDERAAL
                     RLVGANLYDLLGLEEPGVDQGHFVVWEGSPLEIDGRLKAVGGGRGWVDVWE"
     gene            complement(1050786..1051865)
                     /locus_tag="MYCTH_2308138"
                     /db_xref="GeneID:11506792"
     mRNA            complement(join(1050786..1051709,1051798..1051865))
                     /locus_tag="MYCTH_2308138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664872.1"
                     /db_xref="GeneID:11506792"
     CDS             complement(1050886..1051647)
                     /locus_tag="MYCTH_2308138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664920.1"
                     /db_xref="GeneID:11506792"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="JGIDB:Spoth2_2308138"
                     /translation="MADATFDAPRTLRPPGRIVFQDSDTVRKLGPAWRLQREVEAMDF
                     VRRHTSLPVPAVLEIHLEPSGDNEHGWFVMERLPGSELGVAWPNMSEGARGETIRQLR
                     SYFEQLHNLRPDGAGWIGSCSGGPAYDHRLDNRSTCGPFSTVGDFHDLLVAPLKECPR
                     PEWVEKYRPRLPDNHEIRFAHADLSWENILLDPDTGHVTGILDWEMAGFWPAWWEYRK
                     ALFGARCQPWWTQVLREIMTGYPEETEVDMDLEMF"
     gene            complement(1051822..1052880)
                     /locus_tag="MYCTH_2308139"
                     /db_xref="GeneID:11506793"
     mRNA            complement(join(1051822..1052338,1052425..1052880))
                     /locus_tag="MYCTH_2308139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664873.1"
                     /db_xref="GeneID:11506793"
     CDS             complement(join(1051997..1052338,1052425..1052787))
                     /locus_tag="MYCTH_2308139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664921.1"
                     /db_xref="GeneID:11506793"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2308139"
                     /translation="MGDCWHCDRYFEHSRSLHQHAQSKHPDTYCTRCRRFFSSTRAKQ
                     QHVANSKFHNFCERCPDQPDFASLAELNDHAETVHYCCTVCDYCFNNPDQLAQHDVDE
                     HNLCETCGTYFSSPSNLKSHLQTHAEKTVSCPGCPKMFVSKSAMVLHLEAGTCESGAD
                     CDRVTEIAFECFLSWRYTCDDNPDFPFKCPTCETPFAWISGLLQHVESDSCSEALAMG
                     TPLGKFLRFLRSQIQA"
     gene            complement(1053283..1055883)
                     /locus_tag="MYCTH_2308140"
                     /db_xref="GeneID:11506794"
     mRNA            complement(join(1053283..1054173,1054322..1054995,
                     1055069..1055333,1055391..1055687,1055748..1055883))
                     /locus_tag="MYCTH_2308140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664874.1"
                     /db_xref="GeneID:11506794"
     CDS             complement(join(1053424..1054173,1054322..1054995,
                     1055069..1055333,1055391..1055648))
                     /locus_tag="MYCTH_2308140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664922.1"
                     /db_xref="GeneID:11506794"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Spoth2_2308140"
                     /translation="MEQFIIDNAERYKKLVATFKPSASATQQKRATDAASPDIVVCAR
                     VRPMLEDEVAQGFPVGVHIRSGTNTVDLHELQQPVRGLPRIRSSEYTLDSLYGPEAST
                     NQIYEDLVKPLVPWAWGGGVGTVFAYGQTSSGKTLTVSGLERHVAETLMDGSLDGERK
                     ISMSIIELTGQTAYDLLNDRKQISILEDSFGVTQMAGALEYQVTDKETLLGYIDAAAS
                     LRRTTPTLRNDNSSRSHAICRMRFENPALPEAQDGLLYLVDLAGSEAARDKVAHDTSR
                     MKEAREINSSLSVLKDCIRGRAVADADAFAGRSSKKPAYIPFRQSTLTKTLKHVFDPA
                     SSRSCRTVVVACVNPCLADIGASKNTLRYAEMLRVAVPKAKPVEYSPSVPATWKNEQL
                     RDWIQRESGDPAIAPELLAPTETGPQLLRLPSPEFITRCLKSPGVSPEQAQAFQTKLW
                     KLHIDSQRALASANKIATQQQQQQKGEEGGLPGLMSRMERLDCSADPEPDAGAVPFRQ
                     RIRPGMVVGWTPPPEYAMFAQAAGGGKAYAMIMCPARAAGPRTRDVLGNLVADKLATT
                     AAARGEGNDTDGSGGSGGGVGGGGGGSDENDDAYLCALVMPSLLPGSYAIAPWRQVVV
                     KVKEMESEVFMEWDEASRYYYMTV"
     gene            1062886..1064880
                     /locus_tag="MYCTH_2308143"
                     /db_xref="GeneID:11506873"
     mRNA            join(1062886..1063481,1063620..1064880)
                     /locus_tag="MYCTH_2308143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664875.1"
                     /db_xref="GeneID:11506873"
     CDS             join(1063144..1063481,1063620..1064754)
                     /locus_tag="MYCTH_2308143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664923.1"
                     /db_xref="GeneID:11506873"
                     /db_xref="JGIDB:Spoth2_2308143"
                     /translation="MGFYSPPPPARPFSEDKPTLLISWWITSMCAVVVILRLIGRYIR
                     VETLFREDKIAAAALIPLFLRMALVHPVLLYGTNNVLIDEAHPLTDAEINRRSIGSRL
                     VLATRIVQPAILWLFKAATLAFFDRLVGISGRSRYTLLLRSTRVALAATFVAVFVADL
                     AECRPGGPGRAWQVVPDPGPRCRQGSAYLVTAAAAGALTDLLLVVLPVPVVARSRLSA
                     GRKTLLCLLFCLHLVTAAVSVCRVPAVLDEGGYQATRTMWASVEVLAATFAANALTIG
                     TFVRDTGAKKTKRFRYPAPAGWAADGESEVAVRSGGARSRRGGGGGKKVSWDDPDSDD
                     EEDEVRAVRAMPSTTTLLITTTTTTATGREAEYPRGTDDDTKQAAVLDDDRERAGSRT
                     ESVDSLIPRNRANTPAADAGGVVRTTTIEVSVSSAAAAAERGGRADGEPHAGLMLRPA
                     EAVVTVSAKGHGRGSSIPLQKLDPLPDMDVDHNKGGPRNA"
     gene            1066333..1069272
                     /locus_tag="MYCTH_2308145"
                     /db_xref="GeneID:11506874"
     mRNA            join(1066333..1066675,1066871..1067592,1067750..1067959,
                     1068061..1069272)
                     /locus_tag="MYCTH_2308145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664876.1"
                     /db_xref="GeneID:11506874"
     CDS             join(1066883..1067592,1067750..1067959,1068061..1069156)
                     /locus_tag="MYCTH_2308145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664924.1"
                     /db_xref="GeneID:11506874"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2308145"
                     /translation="MELHKDHDIEMNPLGRARSAPEGNPFAPYGGRSIISSAGARPGS
                     SRSVPGGTKSGSGTAAGAGGMRARVDRFIDSFKREDGSSERSLRRGSRDIDGYHDDIS
                     DGYDAGRRPPAGTAAAAAAATGVVRGNGGARYYDLRAANIRTASSLLARELKGRHLQM
                     IAISGSIGTGLFVASGQALSQGGPASVLVAYLLVGVMLWCTVQALGEMAVVFPVAGSF
                     SAYSTRFLDPSWGFAMGWNYALQWIVVLPLEIIAGALTIRYWNPELNSAIFVTVFLLT
                     IVAINLSGIKGYGEAEFIFAIVKVTAVVGFILLGIVINIGGTPTSGYIGGKYWQDPGA
                     FNNGFKGLCTVFVKAAFAFAGTELVGLAAAETANPRKSLPTAIKQVFWRITLFYIVSL
                     VLVGLLVPHDEARLLGATSMADASASPFVIAIESAGATILPSVMNGVILVSVLSVGNS
                     SVFGSTRTLAALADQGQAPRIFGYVDRRGRPLVAVLAVSAVGLLAYLAADRRTGAHGG
                     GGPVFDWLLAISGLSTVFTWSSTCLAHIRLRRAWARRRRSLADLPFRAQAGVVGSWIG
                     LACNLLVLVAQIWVALSPLPRDDDRPRTGAERAETFFLNCLALPVVLVFWLGHKLWFG
                     TRFVRLDDMDIDTGIRDLGRLGGIIKAQEEEERRSWPRWKRFYRLIC"
     gene            complement(<1071041..>1072103)
                     /locus_tag="MYCTH_2128762"
                     /db_xref="GeneID:11506875"
     mRNA            complement(join(<1071041..1071212,1071266..1071348,
                     1071430..1071631,1071694..1071912,1072066..>1072103))
                     /locus_tag="MYCTH_2128762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664877.1"
                     /db_xref="GeneID:11506875"
     CDS             complement(join(1071041..1071212,1071266..1071348,
                     1071430..1071631,1071694..1071912,1072066..1072103))
                     /locus_tag="MYCTH_2128762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664925.1"
                     /db_xref="GeneID:11506875"
                     /db_xref="JGIDB:Spoth2_2128762"
                     /translation="MKAEKKMEAEDCIDHLPPFPSAAPIPSGCTSIRLPCSAGPRHAG
                     CNTALPASGSSGSSGYGRRPPVTSRVGEYAIPWNVYPASASGREEGSPRWPLFRRLGG
                     HAGSARSKGLAGGVIGIFYAGAFVIPVGESIHTFFQPKDGSFVTPPFMTFHKHGTAGF
                     GTIANAERFLFNDLDADSAKHNNAYSALPCAYLVLDGDLTLPLEYQEGTARFLSSQSG
                     DTSIYHCPAGHSPQLSWTS"
     gene            complement(<1072331..>1073068)
                     /locus_tag="MYCTH_96162"
                     /db_xref="GeneID:11506876"
     mRNA            complement(<1072331..>1073068)
                     /locus_tag="MYCTH_96162"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003664878.1"
                     /db_xref="GeneID:11506876"
     CDS             complement(1072331..1073068)
                     /locus_tag="MYCTH_96162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664926.1"
                     /db_xref="GeneID:11506876"
                     /db_xref="JGIDB:Spoth2_96162"
                     /translation="MNHRSRFVPDPAYSINPYQQQQQQQQQQPPQSQGMMSSQRLSSV
                     PSSVPGVGQTPMQSSMSPSTMWTANFANGPIIEDLCAPPPPIAMFTPPMNAIHQPMPM
                     VAMHPGAMPQVQNVYGIRQPAPHPFPRGVHPGQGPPMHGMPSSRVVGSYPPYASQQAG
                     IGIVYPPPPQMDLGAMMARPRLDTGFASTIPAAPVPSAAGNAAEMGQMAAPNNMNGSP
                     AGEGMPSMTPAEEEALREFLSPDLGKP"
     gene            complement(1074992..1076214)
                     /locus_tag="MYCTH_2308147"
                     /db_xref="GeneID:11506877"
     mRNA            complement(1074992..1076214)
                     /locus_tag="MYCTH_2308147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664879.1"
                     /db_xref="GeneID:11506877"
     CDS             complement(1075099..1075884)
                     /locus_tag="MYCTH_2308147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664927.1"
                     /db_xref="GeneID:11506877"
                     /db_xref="JGIDB:Spoth2_2308147"
                     /translation="MPSFTSRHYTPERFRSISKPEDDIMEDITQTTTGMKLSPTSPGA
                     VAMVPSDGSLLDYFDLPSPPSTPHRPTDTLAYSSLNSFSSSPASRSPGQMARRHSSSG
                     APDSSRPKSSLPRWPTASQRINRLPIRSRSRSTSSSPLSSSPLSDPFSSPSSASSSSS
                     SSPSSPPTRPSTSQLPEDVEMSGMNPMGLGGPFAPPPQPPPIIRPARRTPYYPPNSSR
                     NVDRTRVYMNRGPHFVPNWTPISSLPRHVQLQIEERMTRFTAI"
     gene            complement(1076996..1077857)
                     /locus_tag="MYCTH_2308148"
                     /db_xref="GeneID:11506878"
     mRNA            complement(1076996..1077857)
                     /locus_tag="MYCTH_2308148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664880.1"
                     /db_xref="GeneID:11506878"
     CDS             complement(1077176..1077628)
                     /locus_tag="MYCTH_2308148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664928.1"
                     /db_xref="GeneID:11506878"
                     /db_xref="JGIDB:Spoth2_2308148"
                     /translation="MASTKANCPVVGTTNTTLPPSHPDIDLSKPGQICPVVGATTDHH
                     ANLHKHPAVPIPKGRSPSDASACPVISGRLVNEEKSKAMDDDVCPVVGTATTVLPPDH
                     PPTDNKDDEAVCPVTKAKVGHHKGKLHGHPDVSRAGEGAVCPVSGVKV"
     gene            1078863..1080600
                     /locus_tag="MYCTH_2308149"
                     /db_xref="GeneID:11506879"
     mRNA            join(1078863..1079049,1079198..1079810,1079914..1080600)
                     /locus_tag="MYCTH_2308149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664881.1"
                     /db_xref="GeneID:11506879"
     CDS             join(1078968..1079049,1079198..1079810,1079914..1080124)
                     /locus_tag="MYCTH_2308149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664929.1"
                     /db_xref="GeneID:11506879"
                     /db_xref="InterPro:IPR001425"
                     /db_xref="JGIDB:Spoth2_2308149"
                     /translation="MISPDQVNEMLYPASTTSKPGPIPTVVPNPTEYQLAGDVGHRTL
                     WVLFAAMTITTAVFALLSWNVPVAKRVYHVTTTLLALVSALAYYAMATGYASSLSCRP
                     VRDSHGDHLPDTFHDACRQVYWARYLDWAIANSLLLLNLCLLAGVDGAHTLMAIVAHL
                     VTILGGFAAAYAAERTGQMWGWFVIACLGYLFVVWHVGLHGTRSVKAKGARVSKLWAS
                     LSIYSLAVLAAYPIAWAITTLARKTDVNTEIIVYAVLDALTKPVFGLWLLISHRAIPE
                     SNIEIAGWWSQGSSAEGRIRISDEE"
     gene            1081698..1084346
                     /locus_tag="MYCTH_84047"
                     /db_xref="GeneID:11506880"
     mRNA            join(1081698..1082144,1082243..1082278,1082475..1082524,
                     1082606..1082647,1082720..1082852,1082927..1083650,
                     1083730..1083786,1083918..1084346)
                     /locus_tag="MYCTH_84047"
                     /product="amino-acid permease"
                     /note="Has EST support"
                     /transcript_id="XM_003664882.1"
                     /db_xref="GeneID:11506880"
     CDS             join(1081863..1082144,1082243..1082278,1082475..1082524,
                     1082606..1082647,1082720..1082852,1082927..1083650,
                     1083730..1083786,1083918..1084192)
                     /locus_tag="MYCTH_84047"
                     /codon_start=1
                     /product="amino-acid permease"
                     /protein_id="XP_003664930.1"
                     /db_xref="GeneID:11506880"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Spoth2_84047"
                     /translation="MPHQVSPERTMSDEKLDIRDGRRSSNVEVPNLSGWSSWFGGPGV
                     TIGPRIAPVLSGISLGSDSDTDQSSRAILDKQLAAEDGHAIKYRTCSWQKTAGLLFSE
                     YICLAIMSFPWSYSVLGLVPGLILTVVIAGIVLYTSLVLWEFCLRHPEVRDVCDIGQM
                     LFWNKKWAWWATAAMFILNNTFIQALHVLVGAKYLNTMTEANDVACRTVSFGVVATII
                     CWVCSLPRTFDMLSKLGTASAFFTFVSVLLATIFAAVQAHPAGFDPRSSYTKPDGTTG
                     IGGNPIVTAVPVVGTTFVNGLGAFLNISYTFIGQITLPSFIAEMRDPRDFPKALWACT
                     IAEIILFSIVGSVVYAYVGNQYMTAPAFGSLEPLFKKVSFSFMIPTIVFLGVLYASVS
                     ARFIFFRIFQNSRHKNEHTVVGWVTWASILLATWIVAFIIAQVIPFFSSLLSLMSSLF
                     DSFFGFIFWGVAYFRMRRADGSIAVVKEHTVAGYLLGSLNVFIILVGVFFLSVGTYAT
                     VESIILEFESGAVGSVFSCASNGL"
     gene            complement(1085963..1088200)
                     /locus_tag="MYCTH_112306"
                     /db_xref="GeneID:11506881"
     mRNA            complement(1085963..1088200)
                     /locus_tag="MYCTH_112306"
                     /product="methionine synthase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664883.1"
                     /db_xref="GeneID:11506881"
     CDS             complement(1086679..1087833)
                     /locus_tag="MYCTH_112306"
                     /codon_start=1
                     /product="methionine synthase-like protein"
                     /protein_id="XP_003664931.1"
                     /db_xref="GeneID:11506881"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="JGIDB:Spoth2_112306"
                     /translation="MPLPAGVYRADHVGSFLRPQPILRARETLDTATPISAADLRKLE
                     DEHITEVVQKQIASGLQSVTDGEFRRAWFHIDFLQHLSGVERHGSLSSTNVTSHGVTP
                     PKLAVVGKLGHPQPIQVEDYKFVESVRQKVAAGSDKKITTKVCIPSPTMVHFRGGREA
                     ISTEAYPTLEPFFDDLVKVYQAEIADLYAAGCRFVQLDDTNLAYLCDAGMRAEAAKRH
                     GEDPQKLTKQYAALINAAISQRPKDMVIGIHLCRGNFRSQWFAEGGYEPVAEVLFREL
                     DVDVYFLEYDDARSGDFSPLRFLPENKTVVLGVMSSKKAELDDKDAIIRRLNEAAKFC
                     PRGLDQLCLSHQCGFSSTMEGNDLSEEQQWAKVRLEVEIAKQVWGEDLSV"
     gene            complement(1089259..1091445)
                     /locus_tag="MYCTH_2308157"
                     /db_xref="GeneID:11506882"
     mRNA            complement(join(1089259..1090628,1090695..1091445))
                     /locus_tag="MYCTH_2308157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664884.1"
                     /db_xref="GeneID:11506882"
     CDS             complement(join(1089459..1090628,1090695..1091189))
                     /locus_tag="MYCTH_2308157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664932.1"
                     /db_xref="GeneID:11506882"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2308157"
                     /translation="MSSSEKEATGPVAAHVGNLATTQDVEKIEAPVTWKAYLICAFAS
                     FGGIFFGYDSGYINGVLASKLFINAVEGAGKDAISESHSSLIVSILSCGTFFGALIAG
                     DLADFIGRKYTVILGCLIYIIGCVIQIITGLGNALGAIVAGRLIAGIGVGFESAIVIL
                     YMSEICPRKVRGALVAGYQFCITIGLMLASCVVYGTQNRQDTGQYRIPIGIQFIWALI
                     LGGGLLCLPDSPRYFVKRGRLADATSALSRLRGQPEDSEYIQVELAEIVANEEYERQL
                     IPSTTWFGSWANCFKGSLFKANSNLRKTILGTSLQMMQQWTGVNFIFYYSTPFLKSTG
                     AIDDPFLMSMVFTIINVFSTPISFYTVERFGRRTILFWGALGMLICQFLVAIVGVTVG
                     FNHTHPAPTADDPEATLANNISAVNAQIAFIAIFIFFFASTWGPGAWIVIGEIFPLPI
                     RSRGVGLSTASNWLWNTIIAVITPYMVGEDRGNMKSSVFFVWGGLCTCAFVYTYFLVP
                     ETKGLSLEQVDKMMEETTPRTSAKWKPTTTFAASHPTDLKQGEAAV"
     gene            complement(1096256..1097083)
                     /locus_tag="MYCTH_2308162"
                     /db_xref="GeneID:11506883"
     mRNA            complement(1096256..1097083)
                     /locus_tag="MYCTH_2308162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664885.1"
                     /db_xref="GeneID:11506883"
     CDS             complement(1096332..1096790)
                     /locus_tag="MYCTH_2308162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664933.1"
                     /db_xref="GeneID:11506883"
                     /db_xref="JGIDB:Spoth2_2308162"
                     /translation="MAPIVPVRIQLPADLDVNKCLFPSRTPQACPRCNSTNDTTAAAA
                     AAAAAADDPAHGPPLHRTRPQRGQAAASAALVSTPARPTGAAFPGQLSELAEEGGGAT
                     KEELFGRAVAAARLRELVHRDRRWPRLCAVLVLVGACLGGWWVVCGRQLH"
     gene            complement(<1098327..>1098761)
                     /locus_tag="MYCTH_2119829"
                     /db_xref="GeneID:11506884"
     mRNA            complement(<1098327..>1098761)
                     /locus_tag="MYCTH_2119829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664886.1"
                     /db_xref="GeneID:11506884"
     CDS             complement(1098327..1098761)
                     /locus_tag="MYCTH_2119829"
                     /note="CAZy_ID 267772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664934.1"
                     /db_xref="GeneID:11506884"
                     /db_xref="InterPro:IPR005132"
                     /db_xref="JGIDB:Spoth2_2119829"
                     /translation="MLVPTFTPLLALSTTILGAVTATPINTNGAPEAANPTKRAVLTS
                     GRFTYYNPGLGACGHSNGDGDLVVALSHADFDPSTPNGNPNNNPLCGRRLRASYAGRS
                     VDVTVVDRCVACNSGDLDLSPAAFQALADLSVGVIGGTWNWI"
     gene            1100019..1102334
                     /locus_tag="MYCTH_2308163"
                     /db_xref="GeneID:11506885"
     mRNA            1100019..1102334
                     /locus_tag="MYCTH_2308163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664887.1"
                     /db_xref="GeneID:11506885"
     CDS             1100215..1102131
                     /locus_tag="MYCTH_2308163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664935.1"
                     /db_xref="GeneID:11506885"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR013595"
                     /db_xref="JGIDB:Spoth2_2308163"
                     /translation="MDCERAPLIEGKLLAVDGSSPPPAPWKNPLKNNQATKRRHPLRG
                     FLKAILTISPLLLVTGYAFFQPKLPFRHPVQPPDPPQPVRYPGEHISWTPCGTIDNRA
                     LECANLTVPVDQFDTNSSVEASSHDDDDDTDNDNHHKHHQPGDTFTIPLLRLRSANAT
                     PSTRNLLLNPGGPGGSGAAFLYQRGAQLATLVGDGFHLLSFDPRGVNGSTPLATCYRS
                     EEDRRALSSRARTARRPVEDSGELWAWTGSFVRACDDVMGGAGAGAHVNTPQTAADMN
                     SILDAVGQRALYYWGFSYGTILGQTYATLFPDRAERVIIDGVANQFDWYESRLDAEMI
                     ADTDRVLEGFVDECVRAGEERCALAAMATSKEELLDLLLERVARLRDDPVGVYVNETQ
                     WGVLDYWTLWYNGVFPALYKPAVWGELADRLAALFRGNATAAWLAYGTKPAWDSLGDA
                     FKFISINDGVSGPDKWPMDRLELLDYLLPFFNQSLFGEAQLDYYFSKQAWTIPHAHSY
                     VPRRRVRTAHPLLILSTTYDPVCPLVSAKGAADVFERSRLVEVKGYGHCTLAVPSRCV
                     ARHVRDFLYDGKLPDDGHVRCEPDANPAFAKPEEADALLEAQSLSEEDRRVWKAQQEL
                     ARDITWLGPWRGAW"
     gene            complement(<1102468..>1110571)
                     /locus_tag="MYCTH_2128775"
                     /db_xref="GeneID:11506886"
     mRNA            complement(join(<1102468..1103108,1110559..>1110571))
                     /locus_tag="MYCTH_2128775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664888.1"
                     /db_xref="GeneID:11506886"
     CDS             complement(join(1102468..1103108,1110559..1110571))
                     /locus_tag="MYCTH_2128775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664936.1"
                     /db_xref="GeneID:11506886"
                     /db_xref="JGIDB:Spoth2_2128775"
                     /translation="MGARVPDEQTPSATSSSGCRPGNDIDVSGFEVADIGSTHLLADN
                     KFAAARPHLLLVTQDGYRRQHERLGSHDFAVLCQVLSALRRRERHLANLQLRHRQRMQ
                     LAAQALAGLPRPARRRLCAVAGPAHDPATWPALPFKRFIHRFGGEFPSADALTGIYYE
                     TLLSQGERAVGYQPDEGGNKAVPHDVVLDRKWILVVPRRNAGLIGVVVNAAAMLGMV"
     gene            <1138924..>1139091
                     /locus_tag="MYCTH_2066922"
                     /db_xref="GeneID:11506887"
     mRNA            <1138924..>1139091
                     /locus_tag="MYCTH_2066922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664889.1"
                     /db_xref="GeneID:11506887"
     CDS             <1138924..1139091
                     /locus_tag="MYCTH_2066922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664937.1"
                     /db_xref="GeneID:11506887"
                     /db_xref="JGIDB:Spoth2_2066922"
                     /translation="YLNNILIFSKMIDKYRKYVRVVLDVLYIYKLLVNKEKSKFYIRK
                     TVFLGYKISLE"
     gene            1148509..1150328
                     /locus_tag="MYCTH_2308164"
                     /db_xref="GeneID:11506888"
     mRNA            join(1148509..1149752,1149838..1150328)
                     /locus_tag="MYCTH_2308164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664890.1"
                     /db_xref="GeneID:11506888"
     CDS             join(1148604..1149752,1149838..1150107)
                     /locus_tag="MYCTH_2308164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664938.1"
                     /db_xref="GeneID:11506888"
                     /db_xref="JGIDB:Spoth2_2308164"
                     /translation="MRVNVLLATAAALAPLVAGAGTAASASKMEELMDIKTKQWDEAR
                     AKGLFGGSLLYRKITSKQACINGVAGKGTAAYRCNNVDLHGFLSHEDLGSSTKAGNDV
                     WGWTSPDGREFGIVGQTDGVGFVEVTRGGKLEYLGRLDTQTTATSWRDIKVIGHHAYI
                     GAESDGHGLQIFDLNRLLSVKPWWNPVFWRPRTFSKERDLTALFTGFGASHNLVAHEE
                     AMMIYAVGGRSGANARNTTCAGGMFMVDVSDPANPVSPGCIPHDGYVHDAQCVVYSGP
                     SEKYRGRQICFNFNEDTLTIMDVTDKKNPAVVSRTPYHGAAYTHQGWLVDHTQTFLLL
                     DDEKDELDGTDPAADGHTTTYIFNVTNLEGPINTGIYKSPARSIDHNQYVVNGLTYQA
                     NYGSGLRIVDVSGVELDPTGGNFEEVGFFDCHPEDDEVGGVIKFLGTWSVYPYFKSGY
                     ILLNSIERGIFSLKYTGRKARY"
     gene            complement(1150329..1153205)
                     /locus_tag="MYCTH_2308165"
                     /db_xref="GeneID:11506889"
     mRNA            complement(join(1150329..1151149,1151267..1152650,
                     1152721..1153205))
                     /locus_tag="MYCTH_2308165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664891.1"
                     /db_xref="GeneID:11506889"
     CDS             complement(join(1150493..1151149,1151267..1152650,
                     1152721..1152956))
                     /locus_tag="MYCTH_2308165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664939.1"
                     /db_xref="GeneID:11506889"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Spoth2_2308165"
                     /translation="MAQAVNRIRGAFAPPRKGETFELRAGLVSQYAHERKEAIQKTIM
                     AMTLGKDVSALFPDVLKNIATSDLDQKKLVYLYLMNYAKTHPDLCILAVNTFVQDSED
                     PNPLIRALAIRTMGCVRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAKLFDLNPTM
                     CIENGFLETLQEMIGDPNPMVVANSVQALSEINETAPETKALVVTPATLKKLLMALNE
                     CTEWGRVTILTTLAAYPPTDVKESEHICERVAPQFQHVNPSVVLAAVKVVFAHMKLIN
                     PELVKQYLKKMAPPLVTLVSSAPEVQYVALRNIDLLLQAKPDILSKELRVFFCKYNDP
                     PYVKLQKLEIMVRIANERNFDQLLSELKEYALEVDMDFVKRAVKAIGQVAIKIEAASE
                     KCVNALLDLIATKVNYVVQEVIVVIKDILRKYPGYEGVIPTLCKYIDELDDPNARGAL
                     IWIVGEYAEKINNADAILSGFVDLFPEEFTQTQLQILTAVVKLFLKKPSSNQGLVQKV
                     LQLATAESDNPDIRDRAYIYWRLLSGDLDIAKNIILAQKPPITTTVNSLPPVLLETLL
                     AELSTLASVYHKPPETFVGKGRFGAEAIQRAAIQEQRQNAAENPIAASVAAAASAGGA
                     GAAAPQSNIENLLDIDFDGAAPASAEQNPAGTGTPDRVASPVSTGGFGAPPSGGMADI
                     MGLFDAPAPGPAAGAGAGGAAAAGGGGGGALSDLMSGFEGLDLSGASAPPPPRQQLGH
                     GNGNASGGKGSDDLLGLF"
     gene            1153400..1154091
                     /locus_tag="MYCTH_2308166"
                     /db_xref="GeneID:11506890"
     mRNA            join(1153400..1153478,1153526..1153603,1153668..1153988,
                     1154045..1154091)
                     /locus_tag="MYCTH_2308166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664892.1"
                     /db_xref="GeneID:11506890"
     CDS             join(1153476..1153478,1153526..1153603,1153668..1153745)
                     /locus_tag="MYCTH_2308166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664940.1"
                     /db_xref="GeneID:11506890"
                     /db_xref="JGIDB:Spoth2_2308166"
                     /translation="MANFPNLRRLFIEARTDDEERDISRRAFYNAVLFLGSVAVFSLI
                     AQRINARS"
     gene            complement(1153981..1154078)
                     /locus_tag="MYCTH_t162"
                     /db_xref="GeneID:11506891"
     tRNA            complement(1153981..1154078)
                     /locus_tag="MYCTH_t162"
                     /product="tRNA-Ser"
                     /note="Anticodon: GCT"
                     /anticodon=(pos:complement(1154043..1154045),aa:Ser,
                     seq:gct)
                     /db_xref="GeneID:11506891"
     gene            complement(<1154361..>1155763)
                     /locus_tag="MYCTH_55542"
                     /db_xref="GeneID:11511503"
     mRNA            complement(join(<1154361..1155494,1155560..>1155763))
                     /locus_tag="MYCTH_55542"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664893.1"
                     /db_xref="GeneID:11511503"
     CDS             complement(join(1154361..1155494,1155560..1155763))
                     /locus_tag="MYCTH_55542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664941.1"
                     /db_xref="GeneID:11511503"
                     /db_xref="JGIDB:Spoth2_55542"
                     /translation="MPPAKATDKAIARELANVVREIYNSPKRDELTVNYARKNVEDRL
                     GLEQGFLKEGDWKAKSKQIILDTLNELETADEPQDAAPTSKQKAKPAQKQSSNARRKR
                     GEKAPTQSDAESNAEQQSDVEDEPAPPAKKRKLVKRSKKSQAPSESEDNASGPSDQEA
                     APKLKAKRQSKKPTNGDSELSDAPADSSTTKPSSEQREAPKPSSEDGESELSEVIDEP
                     PKRKQKPKTKPDPEAKPSSTTAAADDSSSELSSVIDEAPPPKRKRNPKKAAGKQSTSA
                     PADSPDEAQIKLLQSQLNKCGVRKVWAVEFKKHGADTPKAKIKHLKQMLADVGMTGRF
                     SEARAREIREMRELQADLQDVIQGEKSWGVGGGGRGTRRRAAAQAAGRGMRVDESEGS
                     GGDESEEGGSSEGKGGSGEGSDDEGERRPAVRKKGPAKRRADLAFLDDESESD"
     gene            1156819..1158210
                     /locus_tag="MYCTH_2308168"
                     /db_xref="GeneID:11506892"
     mRNA            1156819..1158210
                     /locus_tag="MYCTH_2308168"
                     /product="asparaginase"
                     /transcript_id="XM_003664894.1"
                     /db_xref="GeneID:11506892"
     CDS             1156962..1158137
                     /locus_tag="MYCTH_2308168"
                     /codon_start=1
                     /product="asparaginase"
                     /protein_id="XP_003664942.1"
                     /db_xref="GeneID:11506892"
                     /db_xref="InterPro:IPR000246"
                     /db_xref="JGIDB:Spoth2_2308168"
                     /translation="MAASGSYLLSLTTLAHAFTHTQLHKPLLSLLALHGTVRGILAHP
                     NPNPNLPFVINTWSGPFTAATDAAYYTLTNATGTGSPIAALDAVVAGCSACEQNQCDG
                     TVGFGGSPDEACETTLDALIMDGTTLNSGAVAGLRRIRDAIAVARAVLERTRHSLLAG
                     DLATRFAVEMGFGPEGDLSTPESRALCEDWRRGGCKGNYRVNVEPDPETSCGPYRPVP
                     LLAGRGIRLEDGQASHDTISMVVIDRNGTMAAGTSTNGARFKVPGRVGDGPIVGSGSY
                     VDGDVGGCGATGDGDIMMRFLPCYQAVENLRLGMTPTEAAEDAVRRMLRKYPTISSGV
                     VVVNNKGEHGAAGSGWTFTYSFRGGKMDAAEVVSVPPLAGLPVGRIRMESDNALREL"
     gene            complement(1159175..>1161900)
                     /locus_tag="MYCTH_2139973"
                     /db_xref="GeneID:11506893"
     mRNA            complement(join(1159175..1160241,1160305..1160619,
                     1160693..1160951,1161088..1161680,1161847..>1161900))
                     /locus_tag="MYCTH_2139973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664895.1"
                     /db_xref="GeneID:11506893"
     CDS             complement(join(1159915..1160241,1160305..1160619,
                     1160693..1160951,1161088..1161680,1161847..1161900))
                     /locus_tag="MYCTH_2139973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664943.1"
                     /db_xref="GeneID:11506893"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2139973"
                     /translation="MALSKLSVGQALALGFASLILYVVSHVLYNLFLHPLRRYPGPLL
                     MRATRWGYALRHMAGTLPFDMLALHKRYGPVVRVAPNELAFSDPRAWRDIMGHRSGGG
                     GGGGGSGGGGGGSMIVEGGEEMLKYDRFYRPVEGVTTDIVNAGREEHALLRRSMAHGF
                     SDRSMREQQPLIQGYVDLLIRRLREKSEGGSKAVDLAAWYNYTTFDVIGDLAFGESFG
                     CLDSSDYHPWVKAIFEVARAGTVFQSLAHYPAIIKLVLALIPSRFKEEREKHMRMTME
                     KLKRRMQAGKERPDLVEGLLKRADEWGLTLEKLQANSAILIIGGSETTATLLSGVTYL
                     LLTNRQAMEKLTAEIRGSFKSEDEINFTSVSTLPYLLACLDEALRMYPPVPTGLPRVV
                     PKGGANIAGNYVPEKTVVAVHQWAMYHNDDHFKDPFVYHPERWLGDPAFAGDRKDAFQ
                     PFHLGPRNCLGKNLAYIEMRLILTRMLWNFDLRIAEDSLDWMSKQRIYNLWEKGKLNV
                     YLTPVAR"
     gene            1162811..1164241
                     /locus_tag="MYCTH_2308172"
                     /db_xref="GeneID:11506894"
     mRNA            1162811..1164241
                     /locus_tag="MYCTH_2308172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664896.1"
                     /db_xref="GeneID:11506894"
     CDS             1162967..1163884
                     /locus_tag="MYCTH_2308172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664944.1"
                     /db_xref="GeneID:11506894"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308172"
                     /translation="MSGPIVVRLPRRISKSRFLSMGAISWVYRITESIVVKYSRDIGA
                     GEIERDNAIYDIFEQYTPCPYVIQSFYRTANANFLPFMLASLDTRLKRNQRREKHKVL
                     QVLRIEERHLIERWAAELCAAVAWIESLGLVHGDLRPPNILFDEQDHLKLTDFDCVAR
                     IGDASSGNAPPWARLYPDPLTGKGRWGLYGPKTEQFAIGSLLYCMTRGHEPYGHPDDN
                     PELDVVRLFKEGVFPRVYAESDELDRIINRCWTGYYESIKDLAEVATHLPGAKDMGTA
                     TTFSAEYCAQKRNECCQLVREGFLEIDDV"
     gene            1167070..1169654
                     /locus_tag="MYCTH_2082262"
                     /db_xref="GeneID:11506895"
     mRNA            join(1167070..1167769,1167852..1168224,1168292..1169654)
                     /locus_tag="MYCTH_2082262"
                     /product="glycosyltransferase family 20 protein"
                     /transcript_id="XM_003664897.1"
                     /db_xref="GeneID:11506895"
     CDS             join(1167460..1167769,1167852..1168224,1168292..1169204)
                     /locus_tag="MYCTH_2082262"
                     /note="CAZy_ID 267889"
                     /codon_start=1
                     /product="glycosyltransferase family 20 protein"
                     /protein_id="XP_003664945.1"
                     /db_xref="GeneID:11506895"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="JGIDB:Spoth2_2082262"
                     /translation="MMPGVVDHSATSSGRLLLISNRLPITIKRTDNGQYTFSMSSGGL
                     VTGLSGLSKTTSFQWYGWPGLEVPEAEAGPMREQLKEQYNAIPVFVDDELADRHYNGF
                     ANSILWPLFHYHPGEITFDESAWAAYREVNRLFAQTVIKDVQDGDLVWVHDYHLMLLP
                     QMLREEIGKSKKNVKIGFFLHTPFPSSEIYRILPVREQLLLGILDCDLIGFHTYDYAR
                     HFLSSCSRILSTATTPNGVDWNGRFVTVGAFPIGIDPDKFVEGLKKESVQNRIAALKR
                     KFEGVKLIVGVDRLDYIKGVPQKLHALEVFLTEHPEWIGKIVLVQVAVPSRQDVEEYQ
                     NLRAVVNELVGRINGKFGTIEFMPIHFLHQSVSFDELTALYAVSDVCLVSSTRDGMNL
                     VSYEYIATQRERHGVMILSEFTGAAQSLNGSLIVNPWNTEELANAIHDAVTMSPEQRE
                     ANFRKLERYVFKYTSAWWGQSFVTELTRISAADESKEDKGTSSAKRALRNAADDVGDV
                     ANQAIHGAQEAVGGGSDEKKESE"
     gene            1169922..1172629
                     /locus_tag="MYCTH_2308179"
                     /db_xref="GeneID:11506896"
     mRNA            join(1169922..1170517,1170664..1171641,1171768..1172629)
                     /locus_tag="MYCTH_2308179"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664898.1"
                     /db_xref="GeneID:11506896"
     CDS             join(1170157..1170517,1170664..1171641,1171768..1172393)
                     /locus_tag="MYCTH_2308179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664946.1"
                     /db_xref="GeneID:11506896"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308179"
                     /translation="MYLAYKYAKKRYKERQAREAEQQTPAARTASTGQDGAPWDEARG
                     LTAYSDGPGVPAPYDPSPLAAHDETELEDTADDRAEKKRRRTYRLKIILGLFLPFALQ
                     ALDTTIIASALKFIAEDFHELKQLNWIITAFNLTSAAFLPIFAQLADTLGRHATLQTA
                     LVVITVGSALCTGSPTSAFPVLLLGRALQGVGAAGVNISVRTILADRVSLAEYAKNWT
                     TFAIVSGVSFGLGPVAGGYLTQISWRWCFAINLPVGVAGIALVALLLRKELVGPLAIE
                     DVLRTAGGDGVAAGDETAAYAGRRRDPGTGIGRFLLRLGTLDYGGQVLFLFGFGLLIL
                     GFTWAGGTYAWGSAPVVATLAVGGVLAVAWAAYEWAMAPGRAAARAFPMQKAMMPWRL
                     LTHKDVGLLLGINFASGAAMFAIMYFMDLYFTLVKGHSSSEAGIALLYYLPGLGVGVY
                     ANMFFMNVRPRQTLPSLMLGTTCSAVGISVVAWACHTDYTNLIYGMMALTGFGVGLTI
                     NPGTLHALAYVPGMTAAISCLSAFCIPFGGSITLTIMTTVFNNRSGPDHQDPRTGIVW
                     AFISVMPIMWLAVLITTFLGNVWLGKDGNHELVRECWFWNTLRGRRLERVKVARMEDA
                     AGAVGSKGDINMDVVRQHGVMPKTDVEQGR"
     gene            complement(<1172942..>1173259)
                     /locus_tag="MYCTH_55928"
                     /db_xref="GeneID:11506897"
     mRNA            complement(join(<1172942..1173019,1173104..>1173259))
                     /locus_tag="MYCTH_55928"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664899.1"
                     /db_xref="GeneID:11506897"
     CDS             complement(join(1172942..1173019,1173104..1173259))
                     /locus_tag="MYCTH_55928"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664947.1"
                     /db_xref="GeneID:11506897"
                     /db_xref="JGIDB:Spoth2_55928"
                     /translation="MPSELRDKNNEPINVGDHVFARARGGIHEGDVEKIVTSKEDAEK
                     EGVKHPPKVLYTDQHGHHVQHNPGVLQHGEYKK"
     gene            1173709..1173799
                     /locus_tag="MYCTH_t135"
                     /db_xref="GeneID:11506898"
     tRNA            1173709..1173799
                     /locus_tag="MYCTH_t135"
                     /product="tRNA-His"
                     /note="Anticodon: GTG"
                     /anticodon=(pos:1173742..1173744,aa:His,seq:gtg)
                     /db_xref="GeneID:11506898"
     gene            <1174904..>1177540
                     /locus_tag="MYCTH_96141"
                     /db_xref="GeneID:11511476"
     mRNA            <1174904..>1177540
                     /locus_tag="MYCTH_96141"
                     /product="glycoside hydrolase family 67 protein"
                     /transcript_id="XM_003664900.1"
                     /db_xref="GeneID:11511476"
     CDS             1174904..1177540
                     /locus_tag="MYCTH_96141"
                     /note="CAZy_ID 267800"
                     /codon_start=1
                     /product="glycoside hydrolase family 67 protein"
                     /protein_id="XP_003664948.1"
                     /db_xref="GeneID:11511476"
                     /db_xref="InterPro:IPR005154"
                     /db_xref="InterPro:IPR011099"
                     /db_xref="InterPro:IPR011100"
                     /db_xref="JGIDB:Spoth2_96141"
                     /translation="MRMRSLLVLAAIGLAAAEDGLNGWLRYARIKGARDFHDRLPSTI
                     VALNATEGLPVYTAGQELAQGIEGIFGKKVDLDVDLATAGAGKSNGKGKGNGKGKGKG
                     NNGHGHDRDTTATVGTVAAYVDSNPGAAAAGIPELADDGFYLRVSRGNVLILGQNERG
                     ALYGAFHYLSLLAQGNASDYTLASNPDAPIRWVNQWDNMQDGGTHGSVERGYGGDSIF
                     FWDGKVRDDLTRAGLYARLLASIGVNAVVVNNVNADPKTLTPENMDGLARIANAFRPY
                     GVQLGVSLNFASPQTLGGLDSFDPLDERVVEWWRDITDALYERIPDMAGYLVKASSEG
                     QPGPLTYNRTLADGANLFARALKPHGGRVLFRAFVYDHTSLDEDKDWKADRAKAAVEY
                     FDGLDGKFEDNVVIQIKYGPIDFQVREPASPLFSRLVRTASALELQITQEYLGQQAHL
                     VYLAPMWKEILDFDFRVDGRPSRTADILNGKRFGRRRAGGYAGVANVGTNTTWLGSHL
                     AMSNLYAFGRLAWDPSSEPESVLRDWIRLTFGDDPKVLDVITRMSMASWPAYENYSGN
                     LGIQTLTDILLGHYGPNPASQDGNPWGQWTRADADSIGMDRTVWNGTGFSGQYPPEVA
                     ARFERIETTPDELLLWFHHVPYTHVLKSGKTVIQHFYDAHYEGSAVAQTFPRLWETLR
                     GRVDDERFEHVLFRLEYQAGHALVWRDSINNFYFNKSGIPDARGRVGHHPYRIEAEHM
                     RLDGYVPYDVSPFEAASGARCVVTRDNSTATAATASVELRHVPTGTYDVAVNYYDMAI
                     GNSTWELYIGRRRVGRWKGDLEYNLGRAPSPYIDGQTAARVTFRRVHIERGSTLKIVG
                     RPDGLEPAPIDYVSILPLGIVD"
     gene            complement(1178206..1181190)
                     /locus_tag="MYCTH_2308183"
                     /db_xref="GeneID:11506899"
     mRNA            complement(1178206..1181190)
                     /locus_tag="MYCTH_2308183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664901.1"
                     /db_xref="GeneID:11506899"
     CDS             complement(1178576..1180816)
                     /locus_tag="MYCTH_2308183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664949.1"
                     /db_xref="GeneID:11506899"
                     /db_xref="JGIDB:Spoth2_2308183"
                     /translation="MCTYDYTPYTGCEDGPQHYYIQWVKCDIAVERGRYCSLDASQKV
                     EQLRKLSVNVLSCPLHGPIAVQQFVLEAANARLPEKERERSRARSNARRGPVSRGRTP
                     RRDPPDTGAGEPVRRQVRKRRSRREIAVGSPDSELSDASSSSRRRVDGWATRRGHQDA
                     AHERRTTRDAQPHGHRRSASADAGVAIPSHPPPPLSMRHGQSEVSLPLKTGFGAEGKE
                     DDQGSTTGRRQSRPRNSLDTGRAALGIVGLPSSPDMHRRGSIDRAKSELGLKPGVESA
                     PEPMPASKSAVSPASDSSPDQNPDLPFSTPGRLGRRTGTRSIRDRSVDTTMRRIDEDV
                     AQDENTGATQDTAASTTRSLLSTTGSSAPQQQGQDAHSHRRSNSRPRLNSLQIPPVPQ
                     RQSTSNKCQQEAYSAPTAIPPETDFNLPIPTTRQRRAGSLRHIDLPSPTTTTNIQQHS
                     PPTPRLTGGDGGAGAETASIRSARSSRRCLEDQVAEARKWAAAREHLPAPASLAARPS
                     MSEMNLPLPPSGPAGPAGERDRERGSVDSGYLSGGGHQHQAQAQPQPQHPRPHQKLQH
                     SPHYIPPEQLWNRGDVARATAAASAGGASGVSPTEASSSRGGGGKLQKAPPPLPQPGQ
                     GQQQQQQLQQQSVQGQWQGLGLGLVQGAGGGPQQQQQQQQQQHTRPVPAPLNLANSGS
                     GTGMPASLASPGLRSDTSVDGGGSIGKGAKATLLQRMGLRKKFSGLISRDRERAGQRS
                     EVGVES"
     gene            complement(<1190402..>1198406)
                     /locus_tag="MYCTH_2128790"
                     /db_xref="GeneID:11506900"
     mRNA            complement(join(<1190402..1190412,1197902..>1198406))
                     /locus_tag="MYCTH_2128790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664902.1"
                     /db_xref="GeneID:11506900"
     CDS             complement(join(1190402..1190412,1197902..1198406))
                     /locus_tag="MYCTH_2128790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664950.1"
                     /db_xref="GeneID:11506900"
                     /db_xref="JGIDB:Spoth2_2128790"
                     /translation="MAPTPTLPQVIFHLLARQEQQQPTATVVVDSGSSDGDSGSSSGS
                     SLNGGAIAGIVIGSIVGILLLWWIIRACAQPHSPDSSRQGWYDDTALPPAAPLPRSSR
                     SGSRSADYGRHHHYHHHNHSSRRSGSRHHSRRRSSNPRPVVIEEKYALRRPSATYVYP
                     PVEGRRSRNFF"
     gene            1200461..1201561
                     /locus_tag="MYCTH_2308185"
                     /db_xref="GeneID:11506901"
     mRNA            join(1200461..1200760,1200871..1201561)
                     /locus_tag="MYCTH_2308185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664903.1"
                     /db_xref="GeneID:11506901"
     CDS             join(1200520..1200760,1200871..1201313)
                     /locus_tag="MYCTH_2308185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664951.1"
                     /db_xref="GeneID:11506901"
                     /db_xref="JGIDB:Spoth2_2308185"
                     /translation="MYNNTRERGIRHNNNPNATTAGAPGGMTYGQSAASGPAPTTAGH
                     HKHDMLNKLDPRVDSTHDRQPMTQASSNIPEGTYGPHSSRLANALDPRVDSDLDSTRA
                     GRSQLAGAEGSLSGGTTGTTGTMGAAGTAGGYGVAPEGTYGTHSSRLANALDPRVDSD
                     RDRDRDRGLGGPGTAGPPAAAPVPAGAGATATRTAGPHKSDLMNKLDPRVDSTTGAWK
                     GGTGSRGAY"
     gene            complement(1201523..1204605)
                     /locus_tag="MYCTH_2308188"
                     /db_xref="GeneID:11506902"
     mRNA            complement(join(1201523..1204240,1204393..1204605))
                     /locus_tag="MYCTH_2308188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664904.1"
                     /db_xref="GeneID:11506902"
     CDS             complement(join(1201809..1204240,1204393..1204411))
                     /locus_tag="MYCTH_2308188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664952.1"
                     /db_xref="GeneID:11506902"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="JGIDB:Spoth2_2308188"
                     /translation="MFVLRNVGKLLFGSSNQESMIELPQGQLYLVRPLSPKGYSELIF
                     KDASARIRRTAQDYHYQLVVQRVYEEGEAELLAEEGEDAEADADVLAGERDEKTFLLD
                     EALHFRVENREGSERVLAWRDLSGDAGDVYEFVCDPTIQPSQVEQFEQIARRCQYERK
                     YRKPHTTATEEDLAQFQFDEQPIPQASPIHSPTITRSLDPSDSMVLGKPAANTRVKRE
                     NVRETGTTPANTSKENDMKPPAVSAHPEAREILAAEVAELHFFDFPSGTFVLQDAAVT
                     ATVTEIGDWQYWLQVKSSDRDWLGIPVVADINPVFNFEFLSFIFNQFTDDGSAYSWLL
                     RFKDQPTLERFQDGLLQALWEQLNETKWSKIKDKERDYVADAFNDLTMEDSEQAEEEE
                     EEQEEHAEEDEEEEDDRPRSEHYDSDEDADDVEYKPKDNDVNKQLAVGYKHDRSFVVR
                     GSKIGVFKHTPDNHLEFSTNISKVETPKGELFSPKKVMLHNEDRNLILQKDSEPNKLY
                     RMDLEYGKVVDEWTVHEDIPVVTFAPENKFAQMTHEPTFLGISKNALYRVDPRLSGTK
                     LVDAQLKQYVSKNDFSAIATTGKGYIAVASNKGDVRLFDRLGINAKTHIPALGEPIIG
                     LDVSADGRWVLATCRTYLLLIDALQKSGKNEGKLGFEKSFAADDKPQPRRLALTPEHV
                     AQFAYETGKGVNFTPAKFNTGEGAEETSIITATGPYIIEWSLKKVLSGRKAPYLIKRY
                     TDDVKADDFKFGTDKNVIVALPHEVNMVNHARLKRPTRESIAGDFGIAGRRGSGRIGT
                     PRSGRYKLGKEDVVKEAF"
     gene            complement(1204860..1207059)
                     /locus_tag="MYCTH_2308190"
                     /db_xref="GeneID:11506903"
     mRNA            complement(join(1204860..1205317,1205371..1205939,
                     1205994..1206086,1206136..1206659,1206735..1207059))
                     /locus_tag="MYCTH_2308190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664905.1"
                     /db_xref="GeneID:11506903"
     CDS             complement(join(1205014..1205317,1205371..1205939,
                     1205994..1206086,1206136..1206659,1206735..1206834))
                     /locus_tag="MYCTH_2308190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664953.1"
                     /db_xref="GeneID:11506903"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2308190"
                     /translation="MRLNHAFGTAAVALLGSGFAQASDESVRQVAIVGAGAAGSSAAY
                     FLRQFAAEAGVHVNVTVFEKTDRIGGRTLTTNPFNDPTQRFEQGASIFVKVNHILYNA
                     MTEFGLSPSYRDADVDSVMGIWDGDRFVFTIDQNAPSWWKILKVIRKYGISGPRKVQH
                     LTATTVAKFLRLYEPQFFPFESLTQRAEDLGLLEVTGVTGEQYLEANDVDARYARGLV
                     QASTRVNYASNLAQIHGLDTMVSMAADGALAVEGGNWQIFHEMIQRSGAVVALNTTVI
                     GIDKVSDSTTSQQRYAVQTRSGSALDSSTTHPVTFDHVVLANPFQFSGISVGEGVLET
                     AIDEIPYVQLHVTIFTSPYRLSPEFFGLPTSAKVPGMVLTTLAQSDTPSSGVGGVGKA
                     GFLSVSMLGQATNPQTKRREYVYKIFSPEAVTPEFLSRLLGRSVPSGFTGSDSPISWY
                     LPHVFNSYPRALPRVTFQDPVVGAGVYYTSGMESFISTMETNALMGKNVARLVVDDMQ
                     GATVAKSKNGLAWEEKQSILV"
     gene            1207477..1209719
                     /locus_tag="MYCTH_2308195"
                     /db_xref="GeneID:11506904"
     mRNA            join(1207477..1207688,1207745..1207839,1207900..1207921,
                     1207980..1208216,1208267..1209266,1209321..1209719)
                     /locus_tag="MYCTH_2308195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664906.1"
                     /db_xref="GeneID:11506904"
     CDS             join(1207647..1207688,1207745..1207839,1207900..1207921,
                     1207980..1208216,1208267..1209266,1209321..1209559)
                     /locus_tag="MYCTH_2308195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664954.1"
                     /db_xref="GeneID:11506904"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2308195"
                     /translation="MSAAQLLNPKAESRRRGEALRVNISAGEGLQDVLKSNLGPLGTI
                     KMLVDGAGQIKLTKDGNVLLREMQIQNPTAVMIARAATAQDDICGDGTTSVVLLVGEL
                     LKQADRYIQEGLHPRVITDGFEVAKNAALKFLDQFKLPRDVDRELLLSVARTSLATKL
                     SGSLAQKLTPDIVDAVLAIYQPPAKPDLHMIEIMKMQHRTASDTQLIRGLALDHGARH
                     PDMPKRVENAYILTLNVSLEYEKSEINSGFFYSSAEQRDKLVESERRFVDAKLKKIVE
                     LKKQVCGNDGKKNFVIINQKGIDPLSLDVLAKNGILALRRAKRRNMERLQLVCGGVAQ
                     NSVDDLSPEVLGWAGLVYEQQLGEEKFTFIEDVKEPKSVTILIKGPNQHTITQVTDAV
                     RDGLRSVYNMIVDKSVVPGAGAFQVACAEHLKSDAFRKTVKGKAQYGVDAFADALLTI
                     PKTLAANAGLDVQDSIAKLQDEHRDGNVVGLDLATGEPMDPTLEGVYDSFRVLRNCIA
                     SSCGIASNLLLCDEMLKARQMGRSGGPGPGMEGPEE"
     gene            1209721..1211234
                     /locus_tag="MYCTH_2308197"
                     /db_xref="GeneID:11506905"
     mRNA            1209721..1211234
                     /locus_tag="MYCTH_2308197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664907.1"
                     /db_xref="GeneID:11506905"
     CDS             1210091..1211188
                     /locus_tag="MYCTH_2308197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664955.1"
                     /db_xref="GeneID:11506905"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="JGIDB:Spoth2_2308197"
                     /translation="MVLLLQLNAELPDRFPTHERRLYVFACKRKSCRRKDGNIRAIRG
                     IRVSAEAPSSSVRNDPAPQAAAPPKASSQGLGEALFGVKPAATAGSAARANPFATSSS
                     SPTNPFAPKASSSTPANPFAKAHPATEPPKPDIGQTTADLPKTFAETLSLNNPQEQQA
                     PVTHGPPSPPEPWPELSAQPAPYPVRWLADAEYETLDPIPLPAVPTGPTAMDIDSGEG
                     SGGSGKEDKEVFESTMDATFQKFADRVGQNPEQCIRYEFAGEPLLYSKGDAVGKMLHV
                     SEKEGKVSTGKGMPRCENCGARRVFEVQLMPHAIQELECEEDGLDGMDWGTIIVGVCE
                     RDCQERGVRVGEAGYVEEWAGVQWEELTMKR"
     gene            complement(1211236..1212488)
                     /locus_tag="MYCTH_2308199"
                     /db_xref="GeneID:11506906"
     mRNA            complement(join(1211236..1212044,1212261..1212488))
                     /locus_tag="MYCTH_2308199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664908.1"
                     /db_xref="GeneID:11506906"
     CDS             complement(join(1211492..1212044,1212261..1212424))
                     /locus_tag="MYCTH_2308199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664956.1"
                     /db_xref="GeneID:11506906"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="JGIDB:Spoth2_2308199"
                     /translation="MNGEDPQERPEQIRNIINGLERYNPQAAEVLEAYLQQQCEEKFC
                     DCNANRALLKLYQLNPDRIKDEVITNILVKAMTQFPSPQFDLALHLLSPSHSNPGPNS
                     TSDLAEAVSKLRVLNSQLESAQYGRFWATLDSDDIYADLTTDIVGFEELIRLRIAQLV
                     SQAYREVQVSVLEGWLGLDSEEAVKKFVVETCGWKVGEDGMVQIPKNPDNEAKKTEIR
                     EDVTVDMFSRVIKRSWEDSA"
     gene            1213810..1215619
                     /locus_tag="MYCTH_2308202"
                     /db_xref="GeneID:11506907"
     mRNA            1213810..1215619
                     /locus_tag="MYCTH_2308202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664909.1"
                     /db_xref="GeneID:11506907"
     CDS             1213939..1215582
                     /locus_tag="MYCTH_2308202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664957.1"
                     /db_xref="GeneID:11506907"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="JGIDB:Spoth2_2308202"
                     /translation="MLIALSRAFLLSKPPGAEFATKDPKALAKLKKEELAEIWARSEE
                     LVKASYARHPDYNDLIPVLLEIGISEELLVRCGLTLHIPLRPMLGNITRDLSEMLTKL
                     QGRDFTCEYKYDGQRAQVHCDSNGKVSIFSRHLELMTDKYPDLVALVPKIRGEGVESF
                     ILEGEVVAVDRATGELKNFQTLTNRARKDVAIGAITIDVCLFAFDLMYLNGQPLLDQP
                     FRHRRDLLRSLFVEIPHHFTWVRSLDATSQDSESVLEFFKSALDSKCEGIMVKTLDNL
                     PDLEYCGDKEGPEQTGPELNSSFTAKNSGSKSKRRDNGGSSNNNNNNNNNGPPKSRRK
                     PLLATYEPDKRLDSWLKVKKDYSSSSDTLDLIPIAAWHGQGRKAKWWSPILLAVRNEE
                     TGCLEAVCKCMSGFTDAFYKANREFYDDGDEDSGVGRGRRNTHARKPGFVEYAGGVPD
                     VWFEPCEVWEVAFADITVSPTYTAAIGLAKEDRGLSLRFPRFLRKREDKGIEEASTSA
                     YLAALWRKQEARAPQAAETAGQAAEEDELDDEEAAAAEE"
     gene            complement(1215591..1216871)
                     /locus_tag="MYCTH_2082283"
                     /db_xref="GeneID:11506908"
     mRNA            complement(join(1215591..1216159,1216219..1216871))
                     /locus_tag="MYCTH_2082283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664910.1"
                     /db_xref="GeneID:11506908"
     CDS             complement(join(1215658..1216159,1216219..1216742))
                     /locus_tag="MYCTH_2082283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664958.1"
                     /db_xref="GeneID:11506908"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Spoth2_2082283"
                     /translation="MADAPVTLLPLGAIIQEFRIGGLNIVQGFPEQSHYESYNAPYFG
                     ETIGRVANRIKGAQVDSLNGGRSYKLAANNGPNNLHGGVVGWGKKIWNGPTPVGVRQI
                     PGIEGLDGGESVKFSLVSQDGDEGFPGTVEASVVYTVGKQVQDGKEVLVLGFEYEAEL
                     VDGADETVINMTNHSYFNLTGGPSIEGTVVTLATNSYLPVDDGGIPTAGPKPFGKVEV
                     TKPFTLGAQEPDIDDCFIVNEASNTIPIDTRSNPLTKLVSAHHPESKIHLEVLSTEPA
                     FQFYTGKYIDVPEVAGVPPRKARSGFCVEPSRWVNACNVDEWKSQMLLKKGEKYGARI
                     VYRAWKE"
     gene            complement(1217793..1218508)
                     /locus_tag="MYCTH_2308205"
                     /db_xref="GeneID:11506909"
     mRNA            complement(1217793..1218508)
                     /locus_tag="MYCTH_2308205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664911.1"
                     /db_xref="GeneID:11506909"
     CDS             complement(1218027..1218347)
                     /locus_tag="MYCTH_2308205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664959.1"
                     /db_xref="GeneID:11506909"
                     /db_xref="JGIDB:Spoth2_2308205"
                     /translation="MSITGNNNNGQNYDTHHRTPRSRRRSQFHSQATCKFRKWPTLAG
                     VLCIVDQLQNRVREQELHIVWMEEQQQRINQLQDALTKLTLDMAYKMQAEDASLSPVV
                     FPLS"
     gene            complement(1218920..1220400)
                     /locus_tag="MYCTH_2308206"
                     /db_xref="GeneID:11506910"
     mRNA            complement(join(1218920..1219399,1219541..1220400))
                     /locus_tag="MYCTH_2308206"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664912.1"
                     /db_xref="GeneID:11506910"
     CDS             complement(join(1219302..1219399,1219541..1220171))
                     /locus_tag="MYCTH_2308206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664960.1"
                     /db_xref="GeneID:11506910"
                     /db_xref="JGIDB:Spoth2_2308206"
                     /translation="MIVPESLLSCFCGAELQHQPENHHCGNNLKYTLINEKPGLEPVP
                     STAATPRLHPACPYLDGNDNKNDDDDELTRRADRILTVLLTAPRPADPSEADLTSGAA
                     AAAGLRAQDWTSYLAERVLHALERKLGDVLAEHSSADRSGWGGALADAYDYAVELIKR
                     ELRELWEYAKAHPYETAATVLLTLVSLGVLARLLPLIVRALGFGELGPIEGSFAAWWQ
                     RLYGGYVPKGSLWSFLQRMGMTWK"
     gene            <1221706..>1222501
                     /locus_tag="MYCTH_96130"
                     /db_xref="GeneID:11506911"
     mRNA            join(<1221706..1221956,1222351..>1222501)
                     /locus_tag="MYCTH_96130"
                     /product="uncharacterized protein"
                     /note="Has EST support. In first exon only"
                     /transcript_id="XM_003664913.1"
                     /db_xref="GeneID:11506911"
     CDS             join(1221706..1221956,1222351..1222501)
                     /locus_tag="MYCTH_96130"
                     /note="has a string of 18 glutamate residues in a row. A
                     polyglutamic acid can act as a template for core histone
                     organization (Stein, A., et al. (1979)PNAS 76,5000-5004)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664961.1"
                     /db_xref="GeneID:11506911"
                     /db_xref="JGIDB:Spoth2_96130"
                     /translation="MGNIESFSRGVLALLNEFKKVVGQYLPNDSRWEACLSGRFNRWR
                     SGEIRLIISFRRVGIGRCNEAGRDRLVPLHRLRLWLARARPVTGRPPTLTQDHERPTQ
                     EEEEEEEEEEEEEEEEEEFPTNRDGGYIHEG"
     gene            <1222656..>1222996
                     /locus_tag="MYCTH_2119852"
                     /db_xref="GeneID:11506912"
     mRNA            join(<1222656..1222660,1222713..1222862,1222930..>1222996)
                     /locus_tag="MYCTH_2119852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664914.1"
                     /db_xref="GeneID:11506912"
     CDS             join(1222656..1222660,1222713..1222862,1222930..1222996)
                     /locus_tag="MYCTH_2119852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664962.1"
                     /db_xref="GeneID:11506912"
                     /db_xref="JGIDB:Spoth2_2119852"
                     /translation="MSGKNLVLSAATKTTNWKRPDLAVHAMKAPLEEAVAANESILPR
                     NTAEVILRTAVCVDSSGNFIRTVHLPTGK"
     gene            complement(<1223200..>1224402)
                     /locus_tag="MYCTH_103628"
                     /db_xref="GeneID:11506913"
     mRNA            complement(join(<1223200..1223625,1223680..1223891,
                     1223942..1224231,1224293..>1224402))
                     /locus_tag="MYCTH_103628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664915.1"
                     /db_xref="GeneID:11506913"
     CDS             complement(join(1223200..1223625,1223680..1223891,
                     1223942..1224231,1224293..1224402))
                     /locus_tag="MYCTH_103628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664963.1"
                     /db_xref="GeneID:11506913"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_103628"
                     /translation="MARLLTTDAVLLGRISSYTVIKELHRAADEGAVYLARNRDGENC
                     IIKSIRGHWRLRNEADILKRYQSETPFLRPLVDEIREPADPPSIVLRYLDSDVLTESN
                     KKRLSRPEIKQVARCVLEALRVLHRDGMVHTDVKLDNVFVNYGQGGQRFCEVQLGDCG
                     GVVSQESSFAKEGHLIGAGFTRSPEATFQLPWTTATDIWSFGTALLSLVLGGGYHLFN
                     PKVEGVGPEDDAYEFTVLKRMHKFFGPFPQSFSDFNDQDTMTIINFINQQEPPAKPFA
                     RAGPREIPPADKEFILKIMKLDPRDRPTAEELLADAWFTEESSDTRAPLPGEVGEPGK
                     SKHPGEEGPGT"
     gene            complement(1225368..1225462)
                     /locus_tag="MYCTH_t161"
                     /db_xref="GeneID:11506914"
     tRNA            complement(1225368..1225462)
                     /locus_tag="MYCTH_t161"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:complement(1225428..1225430),aa:Pro,
                     seq:agg)
                     /db_xref="GeneID:11506914"
     gene            1225918..1225988
                     /locus_tag="MYCTH_t136"
                     /db_xref="GeneID:11511502"
     tRNA            1225918..1225988
                     /locus_tag="MYCTH_t136"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:1225950..1225952,aa:Gly,seq:gcc)
                     /db_xref="GeneID:11511502"
     gene            1226570..1227655
                     /locus_tag="MYCTH_2308208"
                     /db_xref="GeneID:11511477"
     mRNA            1226570..1227655
                     /locus_tag="MYCTH_2308208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664916.1"
                     /db_xref="GeneID:11511477"
     CDS             1226790..1227503
                     /locus_tag="MYCTH_2308208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664964.1"
                     /db_xref="GeneID:11511477"
                     /db_xref="InterPro:IPR005128"
                     /db_xref="JGIDB:Spoth2_2308208"
                     /translation="MAYNEMFQYSIISALMDGVASHGPPVARILEHGDHGLGTFQNMN
                     GEMIVLDGQVYQMKADGSVVHIKPTDTITPFATVTRFKPTEQRRATVVGKAGLEALLT
                     GLFPNAKNHFLAVRMDGVFRKVNVRTAGGQTKPREGMVDVCARQTVHTFAGVKGTIVG
                     FRCPQYVMGINVAGDHFHFIAEDRQRGGHILEFETEGDVDITAAQMSNFHLELPTEDD
                     EFNDAELKLQAQGIKAVEG"
     gene            <1227773..>1230058
                     /locus_tag="MYCTH_2119855"
                     /db_xref="GeneID:11506915"
     mRNA            <1227773..>1230058
                     /locus_tag="MYCTH_2119855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664917.1"
                     /db_xref="GeneID:11506915"
     CDS             1227773..1230058
                     /locus_tag="MYCTH_2119855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664965.1"
                     /db_xref="GeneID:11506915"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Spoth2_2119855"
                     /translation="MRRFFRRHRKTSAKNDDLQQKQRPTMSLSIKQLATTPGSHMCTS
                     TCQGISGLPPEYHEFVIAQLTQRLGATPEKLMIEGFAMSNVQTVPGQGSDVVSEPELL
                     HKRAIEGNTEFARMPLPLSETYRYPPLATGHARFLRLGRLGSHPLACLESHSLESPPP
                     YIAISYCRGSTSAQRGLVLDMQGFSVSETVLEVLNQVQAWQHATRSNELLWIDQICIN
                     QSDYNEKLDQMYRMGDIYYKAEKVFIWLGPAANQSDLAISNMKKMLGEVMALNQATAT
                     RADAPNGITAARINEIHGQLYGHLFLRPWFRCLWTVQETLLARRLVVMCGNQEVDLVL
                     LAELATQILTYGSLDIIQFPGACEEDLTNALVAFVNLYTLRDTDVPTGQMLHLSMSGF
                     RDLVSEARSRQCTMAPDRVHALMGVAPPRIREYMAGVCQNGGANHRDIWHLYTHFTKC
                     MLDNDSKWRFLSSAPSRDRPTELPSWVPNLDSQPPFASKLSGDFSAGISSATRHLVDR
                     TVSAEELVARGFRLDVVAEIVPQTAFTEAAQNTRHNEVYGDAAREWEQACLRLCQRVY
                     GLGPEQLPRLHIDILLAQSSSSAARPALGSNGGGGGDGDKGGDAALEAYHLFWAGCRL
                     RNEALRQIREGGFPVPEHLSHLPDAAERFADRAVRAWRNALSADEYALLLGFTSAMKA
                     ACSGRPYISTRRGLLGLGCPGVQAGDVVCILYGTTVPYVLRPRPDGAMSLVGDAYIHG
                     AMDGEALAWPDKEPGEMIRIR"
     gene            complement(1230618..1230688)
                     /locus_tag="MYCTH_t160"
                     /db_xref="GeneID:11506916"
     tRNA            complement(1230618..1230688)
                     /locus_tag="MYCTH_t160"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:complement(1230654..1230656),aa:Gly,
                     seq:gcc)
                     /db_xref="GeneID:11506916"
     gene            1232471..>1233793
                     /locus_tag="MYCTH_2144658"
                     /db_xref="GeneID:11511501"
     mRNA            1232471..>1233793
                     /locus_tag="MYCTH_2144658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664918.1"
                     /db_xref="GeneID:11511501"
     CDS             1232699..1233793
                     /locus_tag="MYCTH_2144658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664966.1"
                     /db_xref="GeneID:11511501"
                     /db_xref="JGIDB:Spoth2_2144658"
                     /translation="MADSPFTTPKRKRSEMLNDDALKLNIATQFTFDINSKADDGNAS
                     PRTRVAHRFRGLALGGGGGGVSAPLAELSGIVDDDAEEGSRKRIKLPDIEMPDVDSLA
                     ATDSDLIPRGSHGGRRLSQNSICIALDDAVVSQSETIGHTGADDNDNDNDNDNDNDNN
                     NDVESNSASTPSLTPPSPPSTITSRPQPRPRPRSKKHRTPGRRRAGTPPFPSRYALSA
                     SSSSSSSSSSSSSSASPTIIDPVRASLTWHDDEITIYDPDDSDDDGTGINGIGFKPTP
                     AIAYARAMRRRQQLVEYRKREERESRAKRTARRRGAVADSLASAGGLAAPAGSAAGDL
                     VAASGVGKKGKAQRRKVRFLEMDGPELIGV"
     gene            complement(1234284..1235219)
                     /locus_tag="MYCTH_2308209"
                     /db_xref="GeneID:11506917"
     mRNA            complement(join(1234284..1235082,1235153..1235219))
                     /locus_tag="MYCTH_2308209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664919.1"
                     /db_xref="GeneID:11506917"
     CDS             complement(1234381..1234950)
                     /locus_tag="MYCTH_2308209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664967.1"
                     /db_xref="GeneID:11506917"
                     /db_xref="JGIDB:Spoth2_2308209"
                     /translation="MSTQQPSSRSHAPADPNRSWIQQTDAAPPSTSQPPRPPVPPPNP
                     QLQPSPTDGQQSPTRQPTIVDAMQTIKPSDFLTFHQAPCARTGLLTGIGAGAAVGALR
                     WILGLPVPRAANWAVGTGVLGAIGQYEYCQFRRHQEREKVKRVVEVYAAKQAREKKEK
                     EEQERREREKALAKEREEAEKRRRWWRFW"
     gene            <1235704..>1242617
                     /locus_tag="MYCTH_2139989"
                     /db_xref="GeneID:11506918"
     mRNA            join(<1235704..1236323,1236375..1236520,1236568..>1242617)
                     /locus_tag="MYCTH_2139989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664920.1"
                     /db_xref="GeneID:11506918"
     CDS             join(1235704..1236323,1236375..1236520,1236568..1242617)
                     /locus_tag="MYCTH_2139989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664968.1"
                     /db_xref="GeneID:11506918"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="JGIDB:Spoth2_2139989"
                     /translation="MPNTSLRRPQKGYRRGGKVAYHGPRTRTFAATSNARGEATSIDE
                     KWERTALAHQIDENMGFARYDAGRKREGWLVNVQPTSIDDPRVPGGGGRAALDCYFIE
                     EDGSTFKATVEYDPYFLIACRKGHETEVEEWCKRVPGGGVIKNIRRVEKDDLKMPNHL
                     LGYRRTFLELRFHNVQDLMAARRDIMPIAEKNKKGMDAMDTYAEVATANGNFDLFDDD
                     PRADDRRNNASFAEASDFIVDIREYDVPYHVRVMIDLDIRVGNWYFVEAKNGVTTVTR
                     NEERLAPADPVVMAFDIETCKAPLKFPDPAVDQIMMISYMIDGQGFLITNREVVSEDI
                     DDFEYTPKPEYPGPFMIFNEPDEKAVIERFFLHVKEARPTVIATYNGDFFDWAFVEAR
                     ASVNGIDMYHEIGWKKDSEDQYKSNYSVHMDCFHWVNRDSYLPQGSRGLKAVTVAKLG
                     YDPDELDPELMTPYASERPQTLAEYSVSDAVATYYLYMKYVHPFIFSLCTILPLGPDD
                     TLRKGTGTLCEMLLMVQAYKNEIVLPNKHVAPKEAFWDGHLLDSETYVGGHVESIEAG
                     VFRSDIPVNFAVDPAAVDELLRDLDAALTFSITVEEKKSMEDVVNYEEVKEQIAAKLR
                     DLKETPNRHERPLIYHLDVASMYPNIMTTNRLQPDSMITESDCAACDFNRPGKTCDRR
                     LPWAWRGEYLPPKRDEYNMIRHALENEKFPGKTANSPMRSWQDLSEDEQANLIKKRLQ
                     LYSQKVYHKIRDSTTIIREAIICQRENPFYINTVRDFRDRRYDYKGKAKVWKGKTEAL
                     KSSGASASEIENAKKMIVLFDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGVTCLTG
                     ATIIQLARSLVERLGRPLELDTDGIWCMLPATFPENFAFKLKNGKKLAISYPCVMLNH
                     LVHARFTNHQYQTLVDPKTFKYETHSDNSIFFEVDGPYKAMILPTSKEEDKNLKKRYA
                     VFNEDGTLAELKGFEVKRRGELKLIKIFQQQIFKFFLEGTTLAECYAAVAKVANRWLD
                     VLHNKGSTLADEELMELISENRSMTKTLEEYSGQKSTSITTAKRLADFLGEGMVKDKG
                     LNCKFIICARPKGAPVTERAVPVAIFSAEEETKRLYLKKWLKEEPADTDPRALLDWDY
                     YLERLGSVIQKLITIPAALQKVRNPVPRVPHPDWLQRRINLKDDKMKQKKLTDIFGST
                     TKGGPLEEISLSSTNLMGDVEDIGQLLKPKTISSAISASQKAPVAQKRKSPEPAETQD
                     PFATLPKKMPSPSEDYPAFLEYQKLKWKLQKQARARRRHLFGDRRSNIQSSIQQTFRN
                     QAEMTFRNTWQLLQLRATDSPGIVLAHVLIDSKIHSVRINVPRQVFLNLKSQELPDIE
                     VEGCQVEQVHHTLPNGHSSVHLFKLTVPEAIYYAESEKFSLLFNHPSVEGVYEKQLPL
                     NLRAVLQLGNRCTVDQSQPGVLGKGLDHGFDLSSLTRPTKPNPYLEGARMSYIYLSHI
                     SAGERQIFGLFSTTSDKAYVIIQQRSKDGGQDLPNISKLYSDFLARRNREEPEDSSWQ
                     ECFSYQEKLSFKVTQVTTRRKAFLEVGDVVKKMKKEESGPTLMVIQSSQRNLLVHDIP
                     ILGEFPVLPLRYDPADGALPPLGWQTVVARRLVNHYLSLGSWINHLTALAKYGDVPLC
                     NLERDDPRFLIDVAYARRLQANNVVLWWSDSPRPDHAGYEKDDVAGPLERVQMPSVNN
                     PGTFASVCIDLEVRNLAINTILTSSLINELEGADSISFNPAADGAGDGNEGLFADNAF
                     ANAGVLVLREMVKSWWAEACKGSTMADVMVQHLVRWVESPASCLYDRALHYYVQMMSR
                     KALLQLMADFRKVGSNVIYASPNRLLLQTTKSEVGNAYAYAQYILKSIKGKPLFHFID
                     LEIKEYWDYLVWYDEFNYGGKACQQVVEKDEQDLQMIMHWQMATFLPVRLQPTFRDWV
                     VEFIELMHSIKRPATGSDPTATPRLTQLPIRNGNAGLAEDAPGQIILGKAFEKPLKKE
                     IASLVATQKRELLHPELAADYTFPSLPGSHLAHLTPQSSLITNTTNGNNNNNHPTASA
                     NPVLELVKSLMQVLSLDKNITLEARLLRKELLALFDVREFSKEGTFQNPSESLRLAQL
                     SCDNCTMARDLDLCRDEDLLPPPPSSEGGGGGAGGGAAGDWSWRCLFCETEYDRNEVE
                     ERLLGEVEGLVVQWTTQDLKCARCGALRVNEFMEHCTCSGEWKESVSRGEVMKRLGVY
                     RNVAKFYGLRMLGDVVDGVLGGL"
     gene            1243167..1244990
                     /locus_tag="MYCTH_2308212"
                     /db_xref="GeneID:11506919"
     mRNA            join(1243167..1243298,1243353..1244990)
                     /locus_tag="MYCTH_2308212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664921.1"
                     /db_xref="GeneID:11506919"
     CDS             1243382..1244905
                     /locus_tag="MYCTH_2308212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664969.1"
                     /db_xref="GeneID:11506919"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Spoth2_2308212"
                     /translation="MLSDQEIERAAGQLAEFKRSDTLSRLLDQYSVLIEEYKRLKSDY
                     EEEREAREKYKQMAKDQERNPFVLVLIDGDGYVFNDTLLSQRAEGGSLAAQMLNDEVK
                     ASLRRKGLEHCQIMVRIYANVLGLSKALAKTGVVSSDSRSLAPFIASFNRSYGLTDFV
                     DAGQLKENVDFKIRALLRLYADNSQCKHIYFAACHDVGYVSELMPFMGNSSKFTLVNT
                     PGNLFHDEFGKLGMGIEEFRNVFRHSPIDGSAAHPQDNSNLGGASRTVSVPSLPPKSP
                     TKSSATSTADQEQKKACLFFSMGKCRYGKSCRMLHVSPTTEPQNTKQSTDQPSSHSPK
                     KLENSAASLDLQLSKLPIEEEIPDGCVMVNENNHRIDPRLPFASAGVINRLKTRVNKR
                     RICNRFHLQGFCEAGDRCEYDHETLDQDLLPALVRLARSQPCPRRGECRLEGCSRGHI
                     CQNLECRHRGGKLHCRIPYSAHLEPLIVARYIPSVPRQSRQANSDSGSSATSDSISE"
     gene            complement(<1247288..>1249342)
                     /locus_tag="MYCTH_54010"
                     /db_xref="GeneID:11506920"
     mRNA            complement(join(<1247288..1247403,1247482..1248028,
                     1248161..1248502,1248605..1249015,1249169..>1249342))
                     /locus_tag="MYCTH_54010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664922.1"
                     /db_xref="GeneID:11506920"
     CDS             complement(join(<1247288..1247403,1247482..1248028,
                     1248161..1248502,1248605..1249015,1249169..1249342))
                     /locus_tag="MYCTH_54010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664970.1"
                     /db_xref="GeneID:11506920"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_54010"
                     /translation="MGRVEGSTSALSVHLEQGLLPEEVEWKPGKKEYAVMITLAIISL
                     MVALDATILVSVLPTLAVDLGGSASDAFWAGTSYLLSCAVCQPFIAALSDIFGRKEML
                     FASICFFTLGTILCAPVAKNFTVFFVGRSIQGIGGGGIITMGQVIFADIVPLRQRPKY
                     FSLVLAAWALGSVLGPLIGGLFVEHAIWAWCFYINFPFCGIGLVLVPIYVKLTTAKTS
                     LGSKLGRVDWVGGFFFIGGLTSFLVGISWGGIQYEWKSVQSVTPIVAGVAGVAIAVIW
                     EIYGAQEPFLRPSLFHTPSALATYACALFQGFILFCALYYIPFYFAAVKFEAPTQSGL
                     DIFPVSCLLLPGSIVISLLTTRTGRYRWAIWSGWVVTAIGCGLLVLLDDDTKTPVWAV
                     ILAIFGIGHGMLLTSVNVGIQAVSRVEDAGRAAAMYAFMRTLGMSIGVAVGGTVFQNV
                     MINKLKELGLPASIAHDSEAFVQTLARMGPQDPKRIASIQAYLAGFHGVYWTITGAAI
                     ASFFISLVIKRHSMDKLLESNF"
     gene            <1252327..>1253895
                     /locus_tag="MYCTH_103620"
                     /db_xref="GeneID:11506921"
     mRNA            join(<1252327..1253019,1253134..1253283,1253527..>1253895)
                     /locus_tag="MYCTH_103620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664923.1"
                     /db_xref="GeneID:11506921"
     CDS             join(1252327..1253019,1253134..1253283,1253527..1253895)
                     /locus_tag="MYCTH_103620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664971.1"
                     /db_xref="GeneID:11506921"
                     /db_xref="JGIDB:Spoth2_103620"
                     /translation="MGKEPSGFTIPGFICLAPSIYVQDARLTGDGYSAGGGGGGGEAM
                     FSGSSFCLPLGPAAQPSSRRPDTAPPDLIVITSWTGAAAKHVAKYTSAYNALYPGVPI
                     LLITTAVSDLVLRSTKQKLKALAPAVAYLLSEEPAAGAPYPARTASSSSSSSSPFSSA
                     FPSQPYHYVTGHPYQPPPAPLQVTTVSANTTSPTRPRFSSLLLHAFSEGGAHKAVLLA
                     RAYLSTATAAAAELPVHALILDSTPGTSASLTRLANGVARALPPGTPRLVARGVAAGL
                     VGVSAADEVVWWRDVHRHAVESAAARPASSSSSSFSVDAAAAAGLEEEEKGGGGGPGV
                     GSLVVRFKRTGHCAHAKGAVNGAVYWTAVRRTWEMRVDGGMGLRMGLGRRLSLDSLCL
                     QEEEDDEGLQL"
     gene            complement(1254665..1255619)
                     /locus_tag="MYCTH_2308215"
                     /db_xref="GeneID:11506922"
     mRNA            complement(join(1254665..1255088,1255165..1255619))
                     /locus_tag="MYCTH_2308215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664924.1"
                     /db_xref="GeneID:11506922"
     CDS             complement(join(1254788..1255088,1255165..1255361))
                     /locus_tag="MYCTH_2308215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664972.1"
                     /db_xref="GeneID:11506922"
                     /db_xref="JGIDB:Spoth2_2308215"
                     /translation="MEGAARPRIGTTVTPAGTFFSTSIRRAVVNMLVRREEDCHPEGG
                     IDRCKKPWVSSKATWIVVGVLAGLIVLVTVSVLLFFHFRGRRRERHEDLEDRFHNADY
                     GLDELPGGGKKSRPRPDDGFSSSQSESPAGYGRRSRDPLQVGSEPKYPSPGHLNGRQN
                     QFERQ"
     gene            1257159..1261503
                     /locus_tag="MYCTH_2135067"
                     /db_xref="GeneID:11506923"
     mRNA            join(1257159..1257436,1257526..1258399,1258458..1259478,
                     1260040..1260101,1260178..1261045,1261134..1261503)
                     /locus_tag="MYCTH_2135067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664925.1"
                     /db_xref="GeneID:11506923"
     CDS             join(1257245..1257436,1257526..1258399,1258458..1259478,
                     1260040..1260101,1260178..1261045,1261134..1261428)
                     /locus_tag="MYCTH_2135067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664973.1"
                     /db_xref="GeneID:11506923"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="JGIDB:Spoth2_2135067"
                     /translation="MSVNPGTLRGAPGRGQGRGTIPFASSPAGQSAIPRPVHDGPSAA
                     SEAGGSTVSASRQKQSKRDEAIRRKMENDLSKKKHLTTRARQSRKAPPGTVLALRPSQ
                     ALQIKPQTTVAEAAQLMAAKREDCVLVTDEDDRIAGIFTAKDLAFRVVGAGLKPTNVT
                     IAEIMTKNPLCARTDTSATDALDLMVRKGFRHLPVMDENQDISGVLDITKCFYDAMEK
                     LERAYASSRRLYDALEGVQSELGTSQPQQIIQYVEALRSKMSGPTLESVLNGLPPTTV
                     TVRTSVKEAAQLMKENHTTAVLVTDQGAITGIFTSKDVVLRVIAPGLDPATCSVVRVM
                     TPHPDFAPMDMSIQAALRKMHDGHYLNLPVMNDSGEIVGMVDVLKLTYATLEQINTMN
                     TTDNEGPAWNKFWLSLDHETESMVSGDGSHHHTNTNARSLMSPDMTRSERHVTDSVAP
                     GDSASHAGLESPRHSAVGAGTPELPPSEVPFPFKFKAPSGRVHRLQVIAAHGMAEFVA
                     NVTAKLGSEVDAIGGAPVVEDGKLSGGYALSYLDDEGDSVSITTDQDLLEAIVLARHG
                     RRDKVDLFVHDPKEPPIAPAPAPVPAPAAAEPAVLSTPPASSVVRERGKGALDAEDDS
                     EDDGDVSEDEDAPVRRGRHARTRTAQQLHHHHHQQAEQVIAGVPNELLLPGAIAMLAV
                     VIAGVFTISRLSSRERRPANDFSINISAMILRNFGRRVLAAPISRSCLRSLSSSASRP
                     ANAPTTFAEPAQKTQTQDPAPAAQQTTTQAYAAAQAAARQAELAQIPVNYAEYMHQRE
                     HTRDIGSRVESRYHPDQMLLDPPHDATLEMLMAAQVHMGHHVSQWNPANQRYIYGERA
                     GIHIISLETTATHLRRAARVVEEVAYCGGLILFVGTRKGHMPAVVRAAELAKGYHLFQ
                     KWTPGAITNRDVILANGALKIVDERDRELPGFETHLRDRRPVQPDLVVCLNPLENFPL
                     LHECGIANIPTIGIIDTDADPTWVTYQIPANDDSLRSITLIAGVLGRAGERGQQRRLA
                     DAQEGITTWRTPRDIAHFIDKDAENKAREALAAAESAAAEGVLDEKPLTREDFMTDEE
                     LLREMMDTPGIAPRP"
     gene            1262631..1264556
                     /locus_tag="MYCTH_2308224"
                     /db_xref="GeneID:11506924"
     mRNA            join(1262631..1262884,1262971..1264556)
                     /locus_tag="MYCTH_2308224"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664926.1"
                     /db_xref="GeneID:11506924"
     CDS             1263020..1264411
                     /locus_tag="MYCTH_2308224"
                     /note="Contains conserved domain zf-H2C2[pfam09337],
                     His(2)-Cys(2) zinc finger"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664974.1"
                     /db_xref="GeneID:11506924"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="JGIDB:Spoth2_2308224"
                     /translation="MLKDKEVISDPQRQYEIARSVHNQAHGGINKTTATIAERYHWSR
                     IKETVSDVIRNCSECKDTNKTSSSQNQQPSPGTGVNGLKRPNPNAASSASACKRASPS
                     PSAPGAGLDFAAAAAGAQRPPPVADPSHMSPFNVPAHQQYADPSAIAISILPPPSHHH
                     PLPSPTDTAMTGHDVMSRDTHDPMLQQLHPHHHPPTAHPVTLPHTIPVPDYQPIDPQI
                     IAQSSASADLHHHSHTHEHSHHHYSFSQPSPPPSHHQQHDHPHHDPDTDADAETFQAL
                     LNAAVTDDDEEEDANGSQLAVGVSSASPGIQRHDIGDDRERGNIPSPGGPVTHTASMS
                     AHHDHQHQHQQHQHHHHPPPPPPEHTTPQPREGTKAEQEEEDEAVDRDLEMLIESQED
                     DEPLPAEHEDPELSGKASGRGDALPPVDVEMDIGTGGDTGAAVPVAASPGKVEDVAGS
                     LAGGPAQGVARRG"
     gene            complement(1264811..1267094)
                     /locus_tag="MYCTH_2094933"
                     /db_xref="GeneID:11506925"
     mRNA            complement(join(1264811..1266238,1266290..1266611,
                     1266669..1266835,1266894..1267094))
                     /locus_tag="MYCTH_2094933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664927.1"
                     /db_xref="GeneID:11506925"
     CDS             complement(join(1265100..1266238,1266290..1266611,
                     1266669..1266835,1266894..1266939))
                     /locus_tag="MYCTH_2094933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664975.1"
                     /db_xref="GeneID:11506925"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2094933"
                     /translation="MSFGGQTPTIIVLKEGTDTSQGKGQIISNINACLAVQATIKSTL
                     GPYGGDLLMVDANGKQTITNDGATVMKLLDIVHPAARILVDIARSQDAEVGDGTTSVV
                     VLAGEILKEIKEHVEAGVSSQIIIKGLRRALTMAVNKIKEIQISTDEANRRDTLSKLA
                     GTAMTSKLIKRNTDFFTKMVVDAVLSLDQEDLNEKLIGVKKIPGGSLTDSLFVNGVAF
                     KKTFSYAGFEQQPKSFTKPKIVCLNVELELKAEKDNAEVRVGQVSEYQAIVDAEWQII
                     YKKLEAIYKTGAKVVLSKLPIGDLATQYFADRDIFCAGRVSAEDMERVVQATGATIQS
                     TCSDIRPEHLGTCGHFEERQIGGERFNFFEDCPEAKTCTLVLRGGAEQFIAEVERSLH
                     DAIMIVKRAIRNKTIVGGGGATEMEVSAYLHRFADQDVRNKQQAIIKSFAKALEIIPR
                     QLCDNAGFDATDILNRLRVEHRRGNTWAGVDFQNEGVADMMERFVWEPALVKINALQA
                     ATEAACLILGVDETIRNEESQQPQAPSKPLPPGAAQRALRGRGRGMPRR"
     gene            complement(1297704..1299086)
                     /locus_tag="MYCTH_2308229"
                     /db_xref="GeneID:11506926"
     mRNA            complement(join(1297704..1298173,1298313..1298408,
                     1298466..1298842,1298901..1298968,1299036..1299086))
                     /locus_tag="MYCTH_2308229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664928.1"
                     /db_xref="GeneID:11506926"
     CDS             complement(join(1297714..1298173,1298313..1298408,
                     1298466..1298842,1298901..1298960))
                     /locus_tag="MYCTH_2308229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664976.1"
                     /db_xref="GeneID:11506926"
                     /db_xref="JGIDB:Spoth2_2308229"
                     /translation="MGMGKHIWELDYDTFKDTMKLMMLGGALTYNLTTMFIKLSILSF
                     YLRFSVETPFRIAVYVVMFISFGYSIPNAFLFLYVCRPIRSYWDWTIPGTCINQQAIF
                     DASNILNMVTDYLILLLPFWMLRPLRIPLSKKLGIGFVLAAGGFVCGVSTMRMVTGMT
                     GANNPDITWHYPVNLIWCLVEEYIGIICACLPCLKAFTKHFCPSLFLFSPDFDNRIAA
                     SFPFASRSRLDGSKTAGGGNEKRNGADNATAADGDAKDDGGRSAWWRLVDAALGSGSS
                     RSGTKTGSRVTGTRDSKLRSGERPSSSLDVDVEAGKWPNSEKAPGVVTATEGAS"
     gene            complement(1299088..1299676)
                     /locus_tag="MYCTH_2308231"
                     /db_xref="GeneID:11506927"
     mRNA            complement(join(1299088..1299157,1299226..1299676))
                     /locus_tag="MYCTH_2308231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664929.1"
                     /db_xref="GeneID:11506927"
     CDS             complement(join(1299099..1299157,1299226..1299421))
                     /locus_tag="MYCTH_2308231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664977.1"
                     /db_xref="GeneID:11506927"
                     /db_xref="JGIDB:Spoth2_2308231"
                     /translation="MSSASETIIPAAPPPPGVTPNFENPESSSHQLIIVSVVFPVFSF
                     FFLIPRLYLASFILRKWHTDDYLICVAAAGQSGLAFSVGS"
     gene            complement(1300705..1301627)
                     /locus_tag="MYCTH_83980"
                     /db_xref="GeneID:11506928"
     mRNA            complement(join(1300705..1301029,1301176..1301278,
                     1301378..1301488,1301555..1301627))
                     /locus_tag="MYCTH_83980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664930.1"
                     /db_xref="GeneID:11506928"
     CDS             complement(join(1300924..1301029,1301176..1301278,
                     1301378..1301488,1301555..1301594))
                     /locus_tag="MYCTH_83980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664978.1"
                     /db_xref="GeneID:11506928"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="JGIDB:Spoth2_83980"
                     /translation="MVKKRKNNGRNKKGRGHVNPIRCSNCSRCTPKDKAIKRFTIRNM
                     VESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVR
                     YNKDGKKITPTQQAKTA"
     gene            1301777..1302611
                     /locus_tag="MYCTH_2308236"
                     /db_xref="GeneID:11506929"
     mRNA            join(1301777..1301921,1302173..1302611)
                     /locus_tag="MYCTH_2308236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664931.1"
                     /db_xref="GeneID:11506929"
     CDS             1302179..1302562
                     /locus_tag="MYCTH_2308236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664979.1"
                     /db_xref="GeneID:11506929"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="JGIDB:Spoth2_2308236"
                     /translation="MQIFVKTLTGKTITLEVESSDNIETVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAV
                     LKYYKVDSDGKIERLRRECPNETVG"
     gene            complement(1302623..1304730)
                     /locus_tag="MYCTH_2308241"
                     /db_xref="GeneID:11506930"
     mRNA            complement(join(1302623..1303846,1303931..1304730))
                     /locus_tag="MYCTH_2308241"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003664932.1"
                     /db_xref="GeneID:11506930"
     CDS             complement(join(1303022..1303846,1303931..1304317))
                     /locus_tag="MYCTH_2308241"
                     /note="CAZy_ID 267877"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003664980.1"
                     /db_xref="GeneID:11506930"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="JGIDB:Spoth2_2308241"
                     /translation="MGGGPTDGYRSVAYFVNWAIYARKHRPQDLPVERLTHVLYAFAN
                     VRPESGEVYMTDSWADTDIHWEGDSWNDTGTNLYGCLKQLNLLKRRNRNLKVLLSIGG
                     WTYSSNFRQPASTPEGRQKFATSAVDLLSNLGFDGLDIDWEYPQNAAEAADFVSLLAE
                     VRGALDKHAAKVSATSPPHFLLTVASPAGAQNYEKLDMAGMDRYLDFWNLMAYDYAGS
                     WDRVAAHQANLYPCQTHAGSCSPFSTDAAVRAYIDRGVPPGKIVVGMPLYGRSFENTD
                     GLGKPFSGVGEGTWENGVHDYKKLPLEGAEVRVDESAGGSYCYHAGRRVLVSYDTVDM
                     ARQKAQYIKDRKLGGGMWWESSADKGGGESLITNVVDVFGGTTALEWRENCITYPFTK
                     YDNLREGFPNN"
     gene            complement(1306083..1307523)
                     /locus_tag="MYCTH_2308245"
                     /db_xref="GeneID:11506931"
     mRNA            complement(1306083..1307523)
                     /locus_tag="MYCTH_2308245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664933.1"
                     /db_xref="GeneID:11506931"
     CDS             complement(1306294..1307121)
                     /locus_tag="MYCTH_2308245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664981.1"
                     /db_xref="GeneID:11506931"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="JGIDB:Spoth2_2308245"
                     /translation="MSSPESPWPSPYRAAISFTMDNLGEAQDVLKGAWPHPIGTHPAV
                     TDQLPRMLALLDRYRIRATYFAEAWSLGVYPATVEALARAGHEVAWHGFQHEVWSGLD
                     EAQEAESFRKSWEAARAHGVDYVGFRPPGGRINERTWRLLKEYGVEYVSPLGEFGLGK
                     EGVAVLPFDWRAVDAFWYMEKFDRIRKEYGENEDVRGPKEFQTWLRKEIDEVVRTGGY
                     MSILFHPFLQTSEERFEVLEEVLKRISEDKSIWVAPCREVAEWVKKHPHLFQSGPAA"
     gene            <1307927..>1311959
                     /locus_tag="MYCTH_96111"
                     /db_xref="GeneID:11506932"
     mRNA            join(<1307927..1308357,1308429..1308676,1308742..1308766,
                     1308826..1309416,1309478..1310149,1310663..1311299,
                     1311397..1311559,1311640..>1311959)
                     /locus_tag="MYCTH_96111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664934.1"
                     /db_xref="GeneID:11506932"
     CDS             join(1307927..1308357,1308429..1308676,1308742..1308766,
                     1308826..1309416,1309478..1310149,1310663..1311299,
                     1311397..1311559,1311640..1311959)
                     /locus_tag="MYCTH_96111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664982.1"
                     /db_xref="GeneID:11506932"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_96111"
                     /translation="MADPLGTLANVLAVLKLAAAATQYIKEVKNGSSERLRLRDELRS
                     TTCLLEMLKDRLEDGESAEDGDEASLKPPSISSLAAEDGPLALFKRVLEDIIDKLAPK
                     DRLRRLAQPFTWPFDKRDVAELLATLERLKSHFNLIMQNDLVELAKLSHLKLDNIQRQ
                     IETATSRSLDNEAEKIILWISPLSYRARHLDVLNTARPGTGTWFLHHPVFNKWVNGEL
                     NVLWCPGIPGAGKTILACPSIISSLVIDNLESHHGSATSLCTYVYCSYEKRREQTPVA
                     LLSSILQQVLQQSRASTLPEEVLSLYRLHSKHGTRPTLAQVTETLRAVTASFTVFRVI
                     VDALDECAESDDDALRFISAVRSLGPSVRLLCTSRFSSVFERYFAEADSIEISARSED
                     IRLYLDSEIQQHSRLARHIHDDPALKQDIIDAITGEFRGMFLLAKLHLESLSTKINRK
                     AVRLALKTLPATLDATYSEAVQRIHNQAPDLVEVAKSVLFWVICAKRPLTVLELRQMY
                     ATLELPDHTPLEDDDLPDGELLTSTCGGLLLVDGEAQTVRVVHYTAQEYFERTHVQEL
                     EAARLSLANASLAYISLPNFSDGPCATDTAMARRLEQFPFLDYASRYWGVDIGSFSSA
                     TNDPVWAKLDSFFSNQSAHEVAWQVQNLPRVRNHAGRRASLAASRKGMLQVIRRLEAD
                     YRTVAERPLQRHTRIREEAEGSNSTVNGVAVSEEHQELTDPARPEEDDARDLPDWLTV
                     TNGFSKLFEFEATIGKGHFAEVCKYRNRVTKVAVAVKIFKYRPDAKLPRMPYSLRNEV
                     ELLRKMQGEPHPAILNLIEVFLDFTRRQLLVVTELADAGDLFTLVVSKGKLSEEETRR
                     VFAQLFSAVEFLHARGWVHRDIKPENILIFDQETLSIKLADFGLAKELPVDSSRWAYN
                     ATLCGTPSYVAPEVLAESQTRKCGTPTDIWSCGVVLYICLCGFPPFSAELKTEDFPYD
                     LGEQIRRGLFFYPSPYWDPISDPALDLIDNLIVVDMAQRFSARQCLEHPWMTSTGH"
     gene            <1382264..>1383790
                     /locus_tag="MYCTH_103611"
                     /db_xref="GeneID:11506933"
     mRNA            join(<1382264..1382632,1382730..1382836,1382976..1383414,
                     1383473..>1383790)
                     /locus_tag="MYCTH_103611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664935.1"
                     /db_xref="GeneID:11506933"
     CDS             join(1382264..1382632,1382730..1382836,1382976..1383414,
                     1383473..1383790)
                     /locus_tag="MYCTH_103611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664983.1"
                     /db_xref="GeneID:11506933"
                     /db_xref="InterPro:IPR001464"
                     /db_xref="JGIDB:Spoth2_103611"
                     /translation="MSAQPPYYGQQQPPKGYSAPPPGSAPPSGYGPSNPGTPYQYPPP
                     GQAPAPQQPYYGYQPGGQSGQYPPQQYPPSAPYGQQPPQSAPYGQPPPPPLSGQYNAQ
                     PPYGQPPAGYGPPPPPPQGYPGQQWQQQFSPQGAPGYSVPPVPLTPASPGYDPAQKAW
                     CGTTTRTFIRNLADDIKSETRGELETALLALIRGPLAQDVYLLDKSLNRVGTDEDTLM
                     DVLLGRSNADLRAITAEYRRTTGRDLLADIKSDVDEALFRLCGMVLAGARAEEAAPVL
                     AHEIDAKVTELQRATEGTTIGANAVAVAQRKYRRALDDVVEKEFRGDMEDALLRMLAE
                     ADDPAAADALRLRKALTGRKDKLFINRVVSLYWNFPRLASAKDAYRKRYGTTLARNVK
                     DLLKEDFEAVVLALLRDN"
     gene            1384005..1385484
                     /locus_tag="MYCTH_2308246"
                     /db_xref="GeneID:11506934"
     mRNA            1384005..1385484
                     /locus_tag="MYCTH_2308246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664936.1"
                     /db_xref="GeneID:11506934"
     CDS             1384297..1385307
                     /locus_tag="MYCTH_2308246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664984.1"
                     /db_xref="GeneID:11506934"
                     /db_xref="JGIDB:Spoth2_2308246"
                     /translation="MEELNLLILGAGWTATFLIPLLQSRNISFAATTTTGHPVAGVPT
                     LPFKFDPSAPEHETRSAIAALPRARHILITFPLIGAGPSRLLLSTYTETHLTSVSTAQ
                     PDDGTGPFRFIQLGSTGIWQQQQQRQQQQQQQKHQEAPTPTSPWLTRHSPYARDNPRA
                     VAEDELLALGGCVLNLAGLWGGTRAPRRWARRVAPTKEALRGKASLHLVHGADVARAL
                     VRLVEGDAVGSLWDRAGRGQRWMVTDGFVYDWWALVVGWADSAAAEEEEEEEEEGEGE
                     GEAEAEVGAEPTERARWVFELMREHGIRALPRPMETLGRCYDTREFWEAFGLVPLKGR
                     MC"
     gene            complement(1385575..1385645)
                     /locus_tag="MYCTH_t159"
                     /db_xref="GeneID:11506935"
     tRNA            complement(1385575..1385645)
                     /locus_tag="MYCTH_t159"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:complement(1385611..1385613),aa:Gly,
                     seq:gcc)
                     /db_xref="GeneID:11506935"
     gene            <1386492..>1387506
                     /locus_tag="MYCTH_96108"
                     /db_xref="GeneID:11511500"
     mRNA            join(<1386492..1386603,1386689..1386825,1386905..1387408,
                     1387450..>1387506)
                     /locus_tag="MYCTH_96108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664937.1"
                     /db_xref="GeneID:11511500"
     CDS             join(1386492..1386603,1386689..1386825,1386905..1387408,
                     1387450..1387506)
                     /locus_tag="MYCTH_96108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664985.1"
                     /db_xref="GeneID:11511500"
                     /db_xref="JGIDB:Spoth2_96108"
                     /translation="MEKFISDSLLSSSTRFMDVLRRVCSRLVDRLDRHIHEAGLDQQN
                     LEIRAHFANNDIDPRSTDDDATGLLVGETASICSNSESVYSCSNLNRLHGTSRYRIPA
                     RSVREQVRAAPSPGDPGDAQYPKYHGGYEHWEHIYKLRSKPPWVEFPILTHRNGRIWT
                     QGQPPGPVRAVYNNADRSKFDVVYHDRSAARRGVDNGFTKAIYRPGRRPLNSPNQERT
                     NVPDTSYHCTHVPSGLHGTPEVCSLSSGTESRTKECGDSGEPDSGGSSVVS"
     gene            1388180..1390875
                     /locus_tag="MYCTH_2308247"
                     /db_xref="GeneID:11506936"
     mRNA            join(1388180..1388447,1388520..1390875)
                     /locus_tag="MYCTH_2308247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664938.1"
                     /db_xref="GeneID:11506936"
     CDS             join(1388398..1388447,1388520..1390734)
                     /locus_tag="MYCTH_2308247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664986.1"
                     /db_xref="GeneID:11506936"
                     /db_xref="JGIDB:Spoth2_2308247"
                     /translation="MQPVPRTRRTPQNTQHTYSLGRRIHDVKTYPVRSPQGATILIYG
                     HENGITVVWRGGRRLKPAKQSASEKQNGANSENAVMVIDSDDETPSSAAFVDKPEFLD
                     TPTTDAPVPEITQTLDLALGTAVLHVAVLPMAATSAEDAAGNGANILKSKIVFAVTCA
                     TTDVYVITLPLTPPSHESKARPELRKNLLAGNAGTGVWGETLTLLTGPTRPCGGLAIT
                     LVKHKPGSRSRSTERPAGQAAPATRVIVAAHSREASGILRLWHVALDAKPGTVNRVEP
                     FQTEYLPSPLSSITFNPTHTTQLLTVTSSQAARIYDYATAALPSDDASEGPFPTQGSW
                     LLSLYAPFARGPSMSTTRKPIVGAEWITHGRAILVLLADGQWGIWDIDGASPSAGGTG
                     TGSLFSKASAGLRGSAITNFSVSGHLEGTSPLRNPGTQKSSTAPGATGDFVPMTPHAR
                     RDAVTSATAGGPEKLATVRGGITVAQLAPQGTGPGEESAVLWLGGTDPVVSVIPVISR
                     FWDSQLRRAAGGGVNLWSGAQPTRMLRLADLGAGLLGERCTGAAAIPKPGRAATTNGS
                     SAAKDGSSNRAEGLPIEVLVQGESRLVVVHESEDSSSLTSRLLGARRKPRADLGPTRA
                     ILAYPRPDLPASSNNVSFNLSIAQPRSRKTGGLFQTRLRPSSAKGSFDQSVDVLPSTE
                     VPDETQSALSSQQGMMFVNDLSFAADQPDDELEVEGRDIEQELLDIMEIDRELVQMDR
                     ERERGTKRVFFEED"
     gene            complement(1391079..1392422)
                     /locus_tag="MYCTH_108781"
                     /db_xref="GeneID:11506937"
     mRNA            complement(join(1391079..1391925,1392071..1392422))
                     /locus_tag="MYCTH_108781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664939.1"
                     /db_xref="GeneID:11506937"
     CDS             complement(join(1391687..1391925,1392071..1392296))
                     /locus_tag="MYCTH_108781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664987.1"
                     /db_xref="GeneID:11506937"
                     /db_xref="JGIDB:Spoth2_108781"
                     /translation="MSGLTQKTAAVARRVVTTTTTTSSFSSSSSTTTLSRAAFTTTAR
                     HQKSTVEAAKETLKTVDRKVSDKLVDGINIGTEYANKMKEAASDIKQGKVTGKAAELR
                     GEVAGQAKDKASSLAGEAKGVAGEAKGKARGVKEEVEGKAREVKGEVKEKLS"
     gene            complement(1392896..1394370)
                     /locus_tag="MYCTH_2315847"
                     /db_xref="GeneID:11506938"
     mRNA            complement(join(1392896..1393741,1393897..1394370))
                     /locus_tag="MYCTH_2315847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664940.1"
                     /db_xref="GeneID:11506938"
     CDS             complement(join(1393129..1393741,1393897..1394318))
                     /locus_tag="MYCTH_2315847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664988.1"
                     /db_xref="GeneID:11506938"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Spoth2_2315847"
                     /translation="MPPRFTLTLNASAALRIGRSVVRHVRYSTEANTGPLIRVTNLPA
                     PNSGHIRILELNRPAARNAISRALLSSLRDEIDAVHEQYDAATGEELPTPSWNKRFGG
                     VAGDDQKGPTRALILASAVDTSFCAGADLKERKSFTQEETAAFLLNLRTTLTSLSALP
                     IPTISAISSLALGGGLELALATHFRVLTSNAVVGLPETRLGIIPGAGGTYRLPALIGI
                     PRARDLILTGRRVSAPEAYFLGLADRLVEVAPESEEQAKEWDAMEDSAREKAVLDVAR
                     RAALSEAVRLATEICEGGPIAIRAAIRAVEEPREAVENQMYERVVGTEDRDEALRAFA
                     EKRKPVFKGR"
     gene            complement(1395150..1397355)
                     /locus_tag="MYCTH_2315848"
                     /db_xref="GeneID:11506939"
     mRNA            complement(join(1395150..1395915,1395974..1396446,
                     1396505..1397355))
                     /locus_tag="MYCTH_2315848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664941.1"
                     /db_xref="GeneID:11506939"
     CDS             complement(join(1395901..1395915,1395974..1396446,
                     1396505..1396889))
                     /locus_tag="MYCTH_2315848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664989.1"
                     /db_xref="GeneID:11506939"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_2315848"
                     /translation="MKSMVFAAALVALADALPDNPLSFRHWKRNNIVNRYVKGKEQPI
                     EPPTLGAPTVQGCFKSAGNMTMVDTPEFNSIDKCGKDICASKGYTAAGSSGGNQCWCG
                     YVYPPKSDLVDDDNCDVGCTGFGQHACGGIDYWTIYNTGVNLAVKYMEDQKSSTSSSS
                     TATPTHTSEPEKTLIVTASPTSSSDADEDKGGGTNVAGVAAGVVVGVVVVAALIGGGF
                     VYMRRKRNKEIEEEHRRNAAVNAFIGKTPRSSGGTSMSDSRLDPILAARRMSDGSIAD
                     NQDYSRRILRVTNA"
     gene            complement(1398750..1402945)
                     /locus_tag="MYCTH_2308258"
                     /db_xref="GeneID:11506940"
     mRNA            complement(join(1398750..1402518,1402586..1402945))
                     /locus_tag="MYCTH_2308258"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664942.1"
                     /db_xref="GeneID:11506940"
     CDS             complement(join(1399076..1402518,1402586..1402808))
                     /locus_tag="MYCTH_2308258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664990.1"
                     /db_xref="GeneID:11506940"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Spoth2_2308258"
                     /translation="MHTPRFIETATPLHVGSFDPAVSLTEDLPKEVDADILLLGCGDV
                     RNILYTIFVERGLPERKLDFTACDVDEYVIARNVLLLTILLDNEEAVSLRQTWHIYYD
                     LYLENHDVLLVENQAKKLYELSQSLQTWQASPYGTTLRFCDEKTLLLVHDIWAKYAQQ
                     ARWRDPGADRDRWALFRDRLRDAKTKQSHARQATRQSVSRSCAPLAMQMANDLLSLTE
                     EHWELGVSGNPRTASQEIPNPIFAVPLTTLSELKYPTNPLLGFHLAVAQAELTELSPL
                     YLEQQDSGSLQDRHRLFEMAFLQFRNWAEAFVEAAPRTTVRFTASECFAFCYTLRYNS
                     KTGETCAHHYRGKHGFDVLRLADSEYGVNGSAPRRFDAVDASAFSRHVSILDLLVSAG
                     PLLKDTASSTLYTACRHHMNNPGNFEELLHGHSTTISLLLGLVPAEYWTNAKAVSTAD
                     QVLTAWAGDQETPETKDAVLWSRTAWRQSKHMVGCPSLPSLHAEVLDLVNLLFGVYST
                     TLSKIPVSEDIPVLPHEPIAIAALMHSICDRAGVDSAQVWDNFLLRIKNDASTKDTAL
                     RLLGALTMHSPTLNYQLSSGFAIAEAESTTVPAFRKWSTILDTLAITMVVPPELWKRL
                     IRFPAQAGPGRGSPIEIIGRLRFHTPDASPTADEDSLYHETHFSFGTVEKRGSPDQDD
                     FTIYVREDEAGWNGTSPMVISYHVPTEYVRARYSPATICFSSLRLAYDRTILGNDTEL
                     AGWAHEAPLHDEEHVFITKYQPGKVGRGITEGMLRSIRDSTGSAQDISPPETSLTADF
                     GPSGDIVSITGRLNITSADARQMLSDKIPLRLKQVSPFTIDIIFVPPKRDLLRIPLTF
                     PAPVLQDGSKSRIARKSCYIEITAPLAEPSAHPAILETYLLHAINNPSPQQPPSTVNI
                     PHINLDALPILSLSDKGRIRFMTTLTSLMFSTRERRLREAQASASSRKAVSSARLDFK
                     ESLFTIFMLSSGLQGGETGLFALTRGSEGIHMLLFVSAIRLDGAHGGVVLDAAVLPFT
                     KKLIASGELAEFLILLRTLECCTLTVGEEELALWKRALPALAERCRTWSHNGEAGCEY
                     YEKGRVPVSLADGDQVLCKCGQGKLPDTFVSLPEWETAAKYATRVAISPLYASALVEE
                     LIEPGLAKEVAEEMTGRKLAVKRCRNCGKAETEEGVKLKKCLRCLEVLYCSAQCQKRD
                     WAKHRMECEESEVYSKE"
     gene            complement(1403441..1406767)
                     /locus_tag="MYCTH_2308260"
                     /db_xref="GeneID:11506941"
     mRNA            complement(join(1403441..1405505,1405567..1406412,
                     1406481..1406767))
                     /locus_tag="MYCTH_2308260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664943.1"
                     /db_xref="GeneID:11506941"
     CDS             complement(join(1403611..1405505,1405567..1406299))
                     /locus_tag="MYCTH_2308260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664991.1"
                     /db_xref="GeneID:11506941"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2308260"
                     /translation="MSGLHARQRQHRRQNSTPSAFDTVKIAPLPNIQQRRPISHRRGL
                     SLDTRGQRLAPAPPPDTSVPQEYNPISMPATDPEPARTPQRTPRSSIDRSPFIEQDAG
                     DNFLISPQVTPQSRRFTDAVSDCPQFADFSGLPFDPYSTPAGFFDRPVSRLSSDGIEP
                     ATDFNFFNSDTALSTPSFIAFPESSPGGPDQGWGSESETASTHSRRSSRRISNGLMDR
                     IANLEAMGGDFGAAERPCTPSSQLTNDCFPQTPTEGSLKQEPAPLQPPNRFTEGYDES
                     MEETLKPIRATKNNRNSGIFQDLRQQAEAMAQTPPRTNSIPMALTAQGLRTPDFMNMR
                     NISAEFKKIEREFSGMPASPTNAPSMFPFPKADNDSGGRPEFPSLGTDAQNPIPRLGP
                     PAPVSKSTSRRGSPHRRTESIASITSAASIADINIEETRTETGVTLEDIAAYIQGPDP
                     SDGKWRCLYEGCNKIFGRKENIKSHVQTHLNDRQYQCPTCKKCFVRQHDLKRHAKIHT
                     GIKPYPCECGNSFARHDALTRHRQRGMCIGAFDGVVRKVVKRGRPKKIRPDMDERRDK
                     AERTRRKNKLTSANSASSQSGYSDISGANSPNNEFDGLLDDDKFQDILSSSIASLSNP
                     MSTATMNPSTLAVSTAPMPASSGSASTTTTTTTMAEVFQRALSPSAMSSYSHASHASS
                     YHHHPSNPVTSDRSQAGADGDIQNPPSPAKSVSSHYSHATTTPPDLSSPRSPPPLLAS
                     CSTPFFDDLNDDVTHNSSSSNHSSSTAATTTSANRNNAADADLSDISIGGLGGGYHHG
                     LAALEAQHDMLLGFHPHHSRNHGADGLVPLDGAGGGAAGGAGLKFEKLGFEGLKFEDE
                     GFDPVSMFTSGEDVFFGTT"
     gene            1408504..1409952
                     /locus_tag="MYCTH_2308261"
                     /db_xref="GeneID:11506942"
     mRNA            join(1408504..1409507,1409565..1409952)
                     /locus_tag="MYCTH_2308261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664944.1"
                     /db_xref="GeneID:11506942"
     CDS             join(1408742..1409507,1409565..1409602)
                     /locus_tag="MYCTH_2308261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664992.1"
                     /db_xref="GeneID:11506942"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2308261"
                     /translation="MIAVPTASLKGKVALITGAGRGIGRGVALELARRGASVVVNYVS
                     SAGAAQEVVKEILSYNNGARAVAIQADVSKVSEIERLFAEAKRAFGRLDIVMSNSGTE
                     SWDKIEDVTEEKYDYVFNLNARAQFFVGQAAFKNLEQNGRLILMTSIAAGLMGVKNHV
                     LYNSSKMAVIGMVKAFATDFGVKGITVNGVAPGGIKSDMFTQNAWHYIPGGTPDLPAA
                     KIEQMMAENCPLGRCAEPEDVARVVAFLSSEDAGWVNGQIITISGGSSQ"
     gene            1410559..1411100
                     /locus_tag="MYCTH_2308263"
                     /db_xref="GeneID:11506943"
     mRNA            1410559..1411100
                     /locus_tag="MYCTH_2308263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664945.1"
                     /db_xref="GeneID:11506943"
     CDS             1410688..1411062
                     /locus_tag="MYCTH_2308263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664993.1"
                     /db_xref="GeneID:11506943"
                     /db_xref="JGIDB:Spoth2_2308263"
                     /translation="MSHVNGQGSPDPRNAPAFPARSRQAGLAVEDDKKRALRERVEVL
                     EAQDLDQLERDLKGFSDAFNRRLQALVNENRPVNPRSAEPQSQLTDHNSPFGSEVITQ
                     PRRCSAHFCVAAPTNLPMRLEG"
     gene            complement(1413723..1414671)
                     /locus_tag="MYCTH_2308266"
                     /db_xref="GeneID:11506944"
     mRNA            complement(join(1413723..1414203,1414283..1414671))
                     /locus_tag="MYCTH_2308266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664946.1"
                     /db_xref="GeneID:11506944"
     CDS             complement(join(1413763..1414203,1414283..1414453))
                     /locus_tag="MYCTH_2308266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664994.1"
                     /db_xref="GeneID:11506944"
                     /db_xref="JGIDB:Spoth2_2308266"
                     /translation="MRFKAPQLGAMGVTFTIMRACQFASLITVTGLCANFINGIATTE
                     HKPPAELIGTLTVEVTAVIYVTITYILYYDSMLPLLVAGILDSLLLVASIVIAALVGK
                     PLAALDCSALPSPVPVIATFFSSSSSTSAHPIRATVITQTLPYSSFVALDQPTCYEIK
                     AVWGLSIAQCVLFAFSGLVCVGLWHRLRRQASAGSSGPKDIEG"
     gene            complement(1416255..1417649)
                     /locus_tag="MYCTH_71063"
                     /db_xref="GeneID:11506945"
     mRNA            complement(join(1416255..1417025,1417086..1417158,
                     1417226..1417388,1417458..1417649))
                     /locus_tag="MYCTH_71063"
                     /product="tyrosinase-like protein"
                     /transcript_id="XM_003664947.1"
                     /db_xref="GeneID:11506945"
     CDS             complement(join(1416307..1417025,1417086..1417158,
                     1417226..1417388,1417458..1417615))
                     /locus_tag="MYCTH_71063"
                     /codon_start=1
                     /product="tyrosinase-like protein"
                     /protein_id="XP_003664995.1"
                     /db_xref="GeneID:11506945"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Spoth2_71063"
                     /translation="MGASATFNIPAFEQSAIDSGLALAGLNGIALLQSATRYGGSCNL
                     GNVKIRREWRTLSKAQRKSYIKAVQCVQAKPSRLAEGIAAGSKTLFDDFVYVHMNATL
                     FIHYTGNFLIWHRNFIHVYEKELNACGYKDALPYWEWGFDVEAPHLSPVFDGSDTSMS
                     GDGEFVPGPPLELLVPGNAEPVVLAKGTGGGCVKTGPFANMTVRLGPITQPDPTADNP
                     RCLKRDLNADAGKRFSSFRNTTNLIINSPTIEYFRTTMEGHPNYVPNSLGVHGGGHFM
                     ISGDPGADAFISPGDPAFYLHHAQIDRVYWIWQMLDFENRQGVFGTNTMLNYPPSENT
                     TVEDTVDVGHLGGPIKIKNLMSTTGQNGSPLCYIYL"
     gene            1419532..1421666
                     /locus_tag="MYCTH_2308269"
                     /db_xref="GeneID:11506946"
     mRNA            1419532..1421666
                     /locus_tag="MYCTH_2308269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664948.1"
                     /db_xref="GeneID:11506946"
     CDS             1419720..1421579
                     /locus_tag="MYCTH_2308269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664996.1"
                     /db_xref="GeneID:11506946"
                     /db_xref="JGIDB:Spoth2_2308269"
                     /translation="MDNAVQPSASTFRDYYAKGYRAWQRLHRKAASSIEFPTNLVDFE
                     HACSRHPYLHSSVKLEPGYNYYAKGTSTWRPSNGDGTCDLRPFQRPYSLPVTAHRPIP
                     VSVEPSPERFPTWFAAQESHLGVLTLAWAYVLSARWAEIVPGATGPEYTDSCAIWKNS
                     GTASADLCARGIPVDIGPASDRAARWWAAILAPHQGWTSGIRHEDRLRPAPWSTNLVQ
                     TGRSFLLSRTSTTETPRNISPPSFRDAAYYISTYSAHHGAEDLSRAAFAAALMLPSAS
                     RFKSTISLPAPQLTTNYSGRKQPSSWVPTAPPWGDDVHQLDRLLTLSCNNFTQSLLSS
                     VIFEPGIPCNVCGAWIQGAFAVLDSEPVKANLQVLTFTLMARNPKLGFLWLGATLLGI
                     HNFILQGMRAVLYPVDLTLAGWTDTLMSFIQEPVSDLTDIALADGAITRADECRLMFL
                     SQSLDHTNPPIVPFQPFGMTALADCNLEVQEHACCGSRHQLSYAGWTWDCRDGMLPPY
                     EIPSVPEENILHPADEGQEIEVDYTYMDREKDSSEGVTRSIFLWLRGTDGFPIAERNI
                     REHEWIDNLYESDEESDSPEGDGRSTAVRRDVGPRTIESWIARTLTFRRNSFY"
     gene            <1422333..>1422722
                     /locus_tag="MYCTH_54036"
                     /db_xref="GeneID:11506947"
     mRNA            <1422333..>1422722
                     /locus_tag="MYCTH_54036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664949.1"
                     /db_xref="GeneID:11506947"
     CDS             <1422333..1422722
                     /locus_tag="MYCTH_54036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664997.1"
                     /db_xref="GeneID:11506947"
                     /db_xref="JGIDB:Spoth2_54036"
                     /translation="KFIASYLCSYGAQTRAGRLFNMAAADAPDCGEWLLYSHDTAQAF
                     AKHIDNTVNSSVLFADIATTIDGGPNASAAQQAAALISCGTDGGSLGVAVNASHPTYK
                     GSTCPAGYTTSGILVKTVASGVYDLGL"
     gene            complement(1425917..1426790)
                     /locus_tag="MYCTH_2308271"
                     /db_xref="GeneID:11506948"
     mRNA            complement(1425917..1426790)
                     /locus_tag="MYCTH_2308271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664950.1"
                     /db_xref="GeneID:11506948"
     CDS             complement(1426014..1426433)
                     /locus_tag="MYCTH_2308271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664998.1"
                     /db_xref="GeneID:11506948"
                     /db_xref="JGIDB:Spoth2_2308271"
                     /translation="MGSALSRCTSRSPGHSPSGLSVPDIGQKTLDRQPNWLVPPARWR
                     TKPVNQQPVRYRTPTPYPKNHRKPMVDSTENVDGSSIPEKASTFEAPAVSHLDMRSSH
                     RRQSLAESRNPNFQKPQPALRITWEVSPRLNRFERVV"
     gene            complement(1428094..1428826)
                     /locus_tag="MYCTH_2308272"
                     /db_xref="GeneID:11506949"
     mRNA            complement(1428094..1428826)
                     /locus_tag="MYCTH_2308272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664951.1"
                     /db_xref="GeneID:11506949"
     CDS             complement(1428448..1428627)
                     /locus_tag="MYCTH_2308272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003664999.1"
                     /db_xref="GeneID:11506949"
                     /db_xref="JGIDB:Spoth2_2308272"
                     /translation="MKFALPDSTTFPPFSFSFSSPLLIGLTFWRKSDSRVRFVRETFH
                     VGLRQELGAAECQEL"
     gene            <1430637..>1431561
                     /locus_tag="MYCTH_2067533"
                     /db_xref="GeneID:11506950"
     mRNA            join(<1430637..1430691,1430786..1430998,1431122..>1431561)
                     /locus_tag="MYCTH_2067533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664952.1"
                     /db_xref="GeneID:11506950"
     CDS             join(1430637..1430691,1430786..1430998,1431122..1431561)
                     /locus_tag="MYCTH_2067533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665000.1"
                     /db_xref="GeneID:11506950"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Spoth2_2067533"
                     /translation="MPPTLVLIRHAQAIHNVDPNHSLQDPPLTDLGRRQSADLREHLR
                     SSLPADRKVQLIVTSPMRRALQTCLVSLDWLIDEGVPVMPDARWQEPYRKPCDTGSPP
                     GQLAAEFPDIDFSPLDPAYPDKTSPAGAAYRYDRGAVLGRAQSALADLYERDADVVVV
                     VSHSGLLRTAVAGRWFANADYRIFDFAPREVEREDEPYRLVEWESTRGRGGMGRSEEA
                     AVELGEGLPTHGDAAGS"
     gene            complement(1431712..1434379)
                     /locus_tag="MYCTH_2308276"
                     /db_xref="GeneID:11507029"
     mRNA            complement(1431712..1434379)
                     /locus_tag="MYCTH_2308276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664953.1"
                     /db_xref="GeneID:11507029"
     CDS             complement(1432017..1434017)
                     /locus_tag="MYCTH_2308276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665001.1"
                     /db_xref="GeneID:11507029"
                     /db_xref="JGIDB:Spoth2_2308276"
                     /translation="MTSSPTPRDIRRLASDHDFVYGAHPAPRRLGWWPFVATHLSLPA
                     ALIAGIIFVVVAIAYTSELSQQMLECPQWANHCRTADDWTVKNLGTVQGIITMVYMIG
                     MASLAYAALGLCEATVWPLLKIQSFTINGLNAYLSVTRGSVMLAPRAVMSVRSTAAGF
                     VLACALVVTLLPFAAPPLIGHAYSPTYQAVELESNYTSGGGISELYAQTNPATSVMVR
                     VLAEYNTWATEPSSEPMPEYRDWYIDRAALDKRGDFTATAVRFQTSISCRPRQVEQLN
                     KDNVWWNAFRTNLTHARKPPQNQTEDVEQEDASTEVWVSPQAQLTLWADSYEFVSDRR
                     TRSTLVFAALNGTIEGGSITPIILGNLTTAFSVACDVEIEAVDDVLSVGNPPISSSSS
                     SSDTAAARLPVLSSTETLALSPDVSPQTRLNELLLWFAVAPLLTGISVDGTQPMFANS
                     SATGLPLAHTTSSALPGSAGSNHWTIPGLEAFIRLSIGALAQATTATANGAASGVTVL
                     TTSKQTRKLERARALLLVIPPGAAVLAAAAAGVFGAALHARLRVPVMRLAGSDLGEVL
                     KSSQTAGLREVAGTDAAKPYLPHELGAVRVRYGVDPAGVAGFVDVGHGSSSSSSSSSS
                     AAAAAGAVTAGEEQEKEGKKKWARMGKGKGKGEATGGGERGK"
     gene            complement(1434855..1435925)
                     /locus_tag="MYCTH_2308278"
                     /db_xref="GeneID:11507030"
     mRNA            complement(join(1434855..1435463,1435550..1435925))
                     /locus_tag="MYCTH_2308278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664954.1"
                     /db_xref="GeneID:11507030"
     CDS             complement(join(1435097..1435463,1435550..1435803))
                     /locus_tag="MYCTH_2308278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665002.1"
                     /db_xref="GeneID:11507030"
                     /db_xref="JGIDB:Spoth2_2308278"
                     /translation="MTNIYNTNLGYGAVLAVACVITAIILLCPILDIVCIVKRARRTL
                     SPPFFLGVNITQGLFYIVNFALTMAGPRKGAVVIVISVFILLSFLGLLFYASVVYHQY
                     RTGSLAGTYIPTVNPEMHNLVASNTSYPRIADPPAPLQFAYAQKEYPKSTATYYDLES
                     VGRVRQFGPPGYAPANAACEPFRPADSKTDEPGQQLENRVHPRSAV"
     gene            <1436929..>1438378
                     /locus_tag="MYCTH_2030078"
                     /db_xref="GeneID:11507031"
     mRNA            join(<1436929..1437011,1437085..1437220,1437293..>1438378)
                     /locus_tag="MYCTH_2030078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664955.2"
                     /db_xref="GeneID:11507031"
     CDS             join(<1436929..1437011,1437085..1437220,1437293..1438378)
                     /locus_tag="MYCTH_2030078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665003.1"
                     /db_xref="GeneID:11507031"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Spoth2_2030078"
                     /translation="AAIAIAAPTLPLKICLTHLPNPAPKGSPHPALARSQHTLTVIRN
                     KAFIFGGQDASGALCPPGIHTITLPAAPTQEEGEEGGEPDAGAAYTCYPPYTLQDAST
                     GETLVPQPRAGHAACARGGRYLLVQGGRGADGRPVEEGNCIWQWDCEGLSWAKLRGPS
                     QLGVEMAPGRWGHWMFADEDQGFLVMVGGKTRDDGGGDGGGSEREAWMYDLHAAAWTT
                     LPRLTARPLAAAYAAGKIYIISSGEGDIAPGDAKLGGMVHFLDMRESPTEREKPGALA
                     WQSVRFPANPLAPGPQPRAGGALVPLRTGHGRVYLVYLFGCSDEGGRKGEKEYYSDIW
                     TLQLPAQTRSAAAVKDKIREKLPRFESGEFRWAEAEIVPTEQIAAGGKVHPGPRGLFA
                     ADACLDGHGVMLWGGINAKGEAEGDGWVLRLAHGYADSDRYE"
     gene            1439900..1442188
                     /locus_tag="MYCTH_2308280"
                     /db_xref="GeneID:11507032"
     mRNA            join(1439900..1440400,1440460..1442188)
                     /locus_tag="MYCTH_2308280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664956.1"
                     /db_xref="GeneID:11507032"
     CDS             join(1440258..1440400,1440460..1442008)
                     /locus_tag="MYCTH_2308280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665004.1"
                     /db_xref="GeneID:11507032"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308280"
                     /translation="MANDVPPLAHNVDRDSDEISLGAQAGVQGVEALAKVWTKSHLIL
                     AYVCIWCIAFVDAMQQGMSTTLTPYVTSSFSSHSLTAATSIFSSLIGGLFKLPLAKIL
                     DVWGRPQGFVTMMVCLTIGLIMMAGCNSVETYAAGQVFYWVGYNGITYTISIFIADTS
                     ALKNRALMFAFVSSPYIITVWIGGPLADAFYNGPGFRWGFGAFAIITPAICSPLLALF
                     YINYRKARKMGLIPDRKSDRTLLQSLRHYAIEFDLVGLILITAGMALLLLPFNLYTRQ
                     AEEWRSPMLIAFFIVGGLMLIAFALYEKFLAPKTFIPYELLMDRTVLGACTLAGVLFV
                     SFYIWDSYFSSFLQVVNGLDMTKSSYILNVYSIGSCFWSLVAGVLVRVTGRFKWLAVY
                     FGLPVTILGVGLMAYFRQPDVNIGYIVMCQIFIAVAGGTLVICEQMAVMAATTHQYIT
                     VVLAVEAMFASVGGAIGSTVAGAIWNGVFPKKLAQHLPPESQGSLTTIVGSLEKQLSY
                     PMGSPTRTAIQHAYGDAQRIMIIASTVIQVISVASVVVWKDFRVKDFKQVKGLVI"
     gene            <1442369..>1443908
                     /locus_tag="MYCTH_2128843"
                     /db_xref="GeneID:11507033"
     mRNA            join(<1442369..1442906,1442996..1443738,1443834..>1443908)
                     /locus_tag="MYCTH_2128843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664957.1"
                     /db_xref="GeneID:11507033"
     CDS             join(1442369..1442906,1442996..1443738,1443834..1443908)
                     /locus_tag="MYCTH_2128843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665005.1"
                     /db_xref="GeneID:11507033"
                     /db_xref="JGIDB:Spoth2_2128843"
                     /translation="MVLFMPYLHWETDRGRARSAKIVKGARKYNLSSIRDVVDRAKNR
                     LARTETHVTVAPSWESQPQPSTPGQHIDRRRALGHALRCASALLEAMNSHVEEQLTMR
                     YLHAEPPLHPRRTLDQAYYGVLRSTGARDRDQAVYRGTTTQPHQCVGPEACPQCKEDI
                     RKTPRILMVDQLWLWCLDEKTIITSFPRRWGRNRPDSSAIYKSLGTRLRHARRGESSS
                     AYDLALMIIDETSRVFFDRTKTDTDQPNLVELFNAAIRDLTYKQTAAFNQLLIYTHLA
                     SRDYRRQRYLSSDGPTQNHLLNINPEGELLKEVKDTQDELHIMIRIKEQHQAVVESFV
                     KHIRRAVTPLVRAHRPFAAQTSPGWDAALGAASLERSGLHHSQDPDLGGIREEQQRQS
                     AQRTLNKTDVLLEDIDERIGELRALQQNAQNTSSALKDLLTLKQHQAGVIEAREAVKQ
                     A"
     gene            <1443937..1444694
                     /locus_tag="MYCTH_2308281"
                     /db_xref="GeneID:11507034"
     mRNA            <1443937..1444694
                     /locus_tag="MYCTH_2308281"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664958.1"
                     /db_xref="GeneID:11507034"
     CDS             <1443937..1444316
                     /locus_tag="MYCTH_2308281"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003665006.1"
                     /db_xref="GeneID:11507034"
                     /db_xref="JGIDB:Spoth2_2308281"
                     /translation="MFTVVAIVFLLLSFCASVFGMNATEFSADARLPLVAELRVMLPV
                     SAGVILVSFALAFSRGVLSNGAAVLARPQRGQLRVEHGGDLDRRQNGAVPARARDGRP
                     GEPAPGPRGDGDVRHEDGGAQEG"
     gene            1445371..1446719
                     /locus_tag="MYCTH_2308282"
                     /db_xref="GeneID:11507035"
     mRNA            1445371..1446719
                     /locus_tag="MYCTH_2308282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664959.1"
                     /db_xref="GeneID:11507035"
     CDS             1445393..1446361
                     /locus_tag="MYCTH_2308282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665007.1"
                     /db_xref="GeneID:11507035"
                     /db_xref="JGIDB:Spoth2_2308282"
                     /translation="MAALPPGDFHFFPVPGAPINPPPIVLTRSTTWTYCGPLLTLGND
                     DDNNNNNKNNKNNDDATAAAAAATAAAKLPPTFAAWSAHTLAPGSAPLLPRLVPFLRA
                     THVFLRRHGVHHYWLTLRASKPTHDFDTARWHTDDDFFEPPRGASSTSDDSSSSGSSS
                     SSTRIRWKLCGTLQGPGTLFAAEAARPHACAVVRCAACGRRGEAVREEARAGLAGARV
                     AQTASGGAEIAFFRLGEEEGAVHSEPPIDRDRVFVNVVPGTEADLRALMARWGMEFPR
                     SWTLGVPVTILPHTGDGDDDDDAAAAGGESKTEEVLPSARHLEAAA"
     gene            1448012..1449602
                     /locus_tag="MYCTH_2308283"
                     /db_xref="GeneID:11507036"
     mRNA            1448012..1449602
                     /locus_tag="MYCTH_2308283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664960.1"
                     /db_xref="GeneID:11507036"
     CDS             1448283..1448813
                     /locus_tag="MYCTH_2308283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665008.1"
                     /db_xref="GeneID:11507036"
                     /db_xref="JGIDB:Spoth2_2308283"
                     /translation="MRFSLWTTSALAVAASAQKEAPARQQIKIDAVFPRNETYREARI
                     FPIIFAVQNMTAIRGSNATFELSWGIQRLNDGYSPAGILPDEGSFLLRPNDTEPARGS
                     EDKNKYMFQWYLFRLTDEGGHLHSCVPPKETDSHSSANGLMIFQAKWNAYLRFHGLED
                     ADYLRKVATSRSAPSS"
     gene            1449604..1451087
                     /locus_tag="MYCTH_2308284"
                     /db_xref="GeneID:11507037"
     mRNA            1449604..1451087
                     /locus_tag="MYCTH_2308284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664961.1"
                     /db_xref="GeneID:11507037"
     CDS             1449861..1450931
                     /locus_tag="MYCTH_2308284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665009.1"
                     /db_xref="GeneID:11507037"
                     /db_xref="JGIDB:Spoth2_2308284"
                     /translation="MHSSSRIATITTLLGALTGAALALVQPGQQQPQPQPPAVTPPAV
                     LHPAAARFLRLDDRDGLSDLVSDEFSSLRGDVSDVPGDVSSHISEVTRALSTISTGDV
                     AKSSTCWQLYNSFAQSVGQPQPPETNTALASWLASSVLHVGGVLAGNDRDGDLLTATE
                     LIQSSLTTECDPSLTATVTPPASLSSAWSTWKEHSSAWIAQAVPAAHSIADRCGGVVG
                     AQVQMLIVTDSESCTKAVLDLVHAVHGGGGNDGDHGHTSGGGGSHTTSASEASTTSSV
                     SPSLTSGASEPYVSPTGGAGGGGGGDDDGNGGSEEEQPTGTADSGRTTGLPTAGAPKE
                     TGLAVFMVAAAAAVAGAVVVGL"
     gene            complement(1451088..1451762)
                     /locus_tag="MYCTH_2308285"
                     /db_xref="GeneID:11507038"
     mRNA            complement(1451088..1451762)
                     /locus_tag="MYCTH_2308285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664962.1"
                     /db_xref="GeneID:11507038"
     CDS             complement(1451443..1451742)
                     /locus_tag="MYCTH_2308285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665010.1"
                     /db_xref="GeneID:11507038"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2308285"
                     /translation="MPRNWTCLQTLEGHTRAVYSIAWSHDATKLASAVDFDTFGPWIT
                     RQGEERLRLPPEYRPSSAAIIIWDLDSHRLCFRPHLVSSVRRQQSYRVAALSVSY"
     gene            complement(1452087..1452600)
                     /locus_tag="MYCTH_2308286"
                     /db_xref="GeneID:11507039"
     mRNA            complement(1452087..1452600)
                     /locus_tag="MYCTH_2308286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664963.1"
                     /db_xref="GeneID:11507039"
     CDS             complement(1452277..1452462)
                     /locus_tag="MYCTH_2308286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665011.1"
                     /db_xref="GeneID:11507039"
                     /db_xref="JGIDB:Spoth2_2308286"
                     /translation="MNQQQISTTLLGHKIVLQDVVANIAGIVKWAEEVVRSAVRDLPY
                     ASIVMAGVSLFLPLQRS"
     gene            1454537..1455717
                     /locus_tag="MYCTH_2308287"
                     /db_xref="GeneID:11507040"
     mRNA            1454537..1455717
                     /locus_tag="MYCTH_2308287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664964.1"
                     /db_xref="GeneID:11507040"
     CDS             1454715..1455284
                     /locus_tag="MYCTH_2308287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665012.1"
                     /db_xref="GeneID:11507040"
                     /db_xref="JGIDB:Spoth2_2308287"
                     /translation="MSYEMSNTQNMTYPYPPPATAVAVPQPKSRFSKWWPLGFFIAAI
                     LLIIIGGALVGAWTANADCSYDDYYYSCDHNTGMLWGAVACFVIGGLLKLTAWILLIV
                     WCVKRSTRVPTSVSYSYQPLNYAGPVPTAAPAPPAPLYQSGAPYQNAPPYQSAGAPPA
                     PQQKDAVRYCAQCGSGTTSPYCPQCGVKV"
     gene            1455714..1457019
                     /locus_tag="MYCTH_2308288"
                     /db_xref="GeneID:11507041"
     mRNA            join(1455714..1456103,1456173..1456211,1456298..1457019)
                     /locus_tag="MYCTH_2308288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664965.1"
                     /db_xref="GeneID:11507041"
     CDS             join(1456210..1456211,1456298..1456991)
                     /locus_tag="MYCTH_2308288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665013.1"
                     /db_xref="GeneID:11507041"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2308288"
                     /translation="MIDPAIRIRRAIHANDAMLVRRILKSHPHLLHNPDHSPAGNANS
                     NLHLAASLGHLAICELLVELGHEAEGPALNDDHQTALMLAAAGKHTDVVFFLCKHDPG
                     SILRQDVRGRDAIMEASLSGDDTALQILLTYAPGGAAAALARADVDGNTALHYASSTG
                     NVTILRTLLAAGADPARKNAWDWTAEAYSATVQTEVYFRSLVDEKDNRKEGVKREGKV
                     VKPAATWWGGGWN"
     gene            <1458546..>1459190
                     /locus_tag="MYCTH_2067913"
                     /db_xref="GeneID:11507042"
     mRNA            <1458546..>1459190
                     /locus_tag="MYCTH_2067913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664966.1"
                     /db_xref="GeneID:11507042"
     CDS             1458546..1459190
                     /locus_tag="MYCTH_2067913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665014.1"
                     /db_xref="GeneID:11507042"
                     /db_xref="JGIDB:Spoth2_2067913"
                     /translation="MPYYYPSGPAPPQPVIFYGPPCYPPPPYTPSAVVGGPQQQQQVG
                     YGAAVAVDAQGVVYQYVSGLAGSGRFPGPAPVVDPDFPAANHINSTGGAGVEPLFNYF
                     FPTEHAKVIVLKCPVPPWTLVAGTYADLPFHAAKVPANVTMAELLVGFGADNPDKARN
                     QFWEVYPQGGGKWGWKEHCTGDDEVMMARTVRDMGWVEKRDGAVQTVYLWISKS"
     gene            1459631..1463435
                     /locus_tag="MYCTH_2308290"
                     /db_xref="GeneID:11507043"
     mRNA            join(1459631..1460035,1460129..1461217,1461394..1461813,
                     1461971..1462251,1462324..1462524,1462679..1463435)
                     /locus_tag="MYCTH_2308290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664967.1"
                     /db_xref="GeneID:11507043"
     CDS             join(1459839..1460035,1460129..1461217,1461394..1461813,
                     1461971..1462251,1462324..1462524,1462679..1462962)
                     /locus_tag="MYCTH_2308290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665015.1"
                     /db_xref="GeneID:11507043"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2308290"
                     /translation="MASERRSERVEQRRRRKIPLACEPCRERKSRCDGAKPICSTCQR
                     RSLSLHHCVYTLENARTASNEAYIKVLHDRIRRLEKTCTAHGLPIPPLDSTEEAEDAS
                     GPPPVTLSPSPLHPGKRPSETSIPVPRPAHGLRDHDSPPNLRLQVTVTSPNPDHERLE
                     ATESTAGVTAMGTVATEHDVSQAFEAANEFYGSSSAASFMKEAYTSVKPQRPRHQEAN
                     PANVPAFSVNFARTGPRGRAQFAQADKFALPPRHLADHLLSRFWERVYWLYPLFDKAT
                     FLRAYESLWRPSHEQPAEPSLPGLGLGSSPGADAGTIVFHCALNTMFALGAQFSDLSL
                     GDKASAIETFFNRGKAFVGLDFIDMHNVGVVQSLLLMALFLQSTPFPSRCWNAVGLAC
                     RVAQGLGLHTDTDRTSRPPLETEIRRRTWHGCVILDIMTYGRPTMTAHLPDLPLPSTV
                     EFGEATLETPRQHRAGPQDDGVPSKMCFYVEHIRQCRILGEILSNVYQPSAGGTGSGP
                     PWWFDQKSRGMDAISDLDAKLSRYERELPPIMSWTSPCDISGLDKDRQLVITAQRTVL
                     RGSFLYLRLMLHRPILTQLCANNTEPSPGTGTGTGTEPSSPARQGAAVPATAGQELFT
                     SFAAGCARICLGAAMDLIELVHSTYLTNTTGGWWWDGLYAFTAGLAVIVGYLSPPLLA
                     SVDRQRLERSWMLCQGILAHLTSFSISAQRSLRLLQKVHADVMSRSSAASDKDQDPPP
                     PLRPPTMSANNHDTATTAHADAAAGSGQQGPATQAEEAPLDLGSSFQFQLPAGTDMFG
                     AGLVFNWDQSLDMIPGGLGMDIYQY"
     gene            complement(<1463476..>1465384)
                     /locus_tag="MYCTH_54721"
                     /db_xref="GeneID:11507044"
     mRNA            complement(join(<1463476..1463879,1464028..1464862,
                     1464911..>1465384))
                     /locus_tag="MYCTH_54721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664968.1"
                     /db_xref="GeneID:11507044"
     CDS             complement(join(1463476..1463879,1464028..1464862,
                     1464911..1465384))
                     /locus_tag="MYCTH_54721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665016.1"
                     /db_xref="GeneID:11507044"
                     /db_xref="JGIDB:Spoth2_54721"
                     /translation="MTSPRDNSDDINTTSTSANDPDDVHQADRPSYSTFACIGTGFSG
                     ICLGATLARWYGLTAGGQGGHHHLRLFSRDPGPGGTWLVNDYPGAACDVPSALYSFSF
                     APNPAWTRVLPPAAELRAYLAAVADRYRVTDGMVFNADVFRCVWIEDRAVWRLWVRRE
                     ERGRGGKWKVRVLVHECRYLFSATGLFTQPRELDVPGLERFRGPVFHSARWRSDVDLT
                     GKRVVLFGNGCTAAQIVPAIAGRVRHLTQVVRSKHWVYPPIDRRIPGAVRALLAAVPG
                     LTRLQRFLVYVLAEASWRGFKLTEDGARYRRKMRERAEEYMRRTAPAEYHDMLIPDFE
                     VGCKRRIFDSGYLETLHAENVTLTDEPVAEILPDGLRMRSGTVVEADVIIMANGFATN
                     QYLPGVEVVGRDGETLAQHWESFGGPEAYNCTSLSGFPNMFFLLGPNTATGHTSAVMA
                     IENAVNYALRVLRPALDGRAGVVVSLKRPAEEAFARRIQSALRRTVWSSGCSSWYVRG
                     PGGKAWNAMTYPWSQARYWYESLFPVWRDWEYTVRFFFNISHLIIVLLFLSHFRSFFV
                     RSPN"
     gene            complement(<1466282..>1469638)
                     /locus_tag="MYCTH_2067426"
                     /db_xref="GeneID:11507045"
     mRNA            complement(join(<1466282..1466399,1466460..1466644,
                     1466756..1468150,1468307..>1469638))
                     /locus_tag="MYCTH_2067426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664969.1"
                     /db_xref="GeneID:11507045"
     CDS             complement(join(1466282..1466399,1466460..1466644,
                     1466756..1468150,1468307..1469638))
                     /locus_tag="MYCTH_2067426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665017.1"
                     /db_xref="GeneID:11507045"
                     /db_xref="JGIDB:Spoth2_2067426"
                     /translation="MDSQLSRDQIVIDILHNHAVRQYNRYLETRELEVLQTAIQAARV
                     SANLIPPLRSHPRRTDILRTYHKLLCEHLEQTSNRMDMADALLTIDRALAFLPDDDPY
                     ATEAMNLMVSIYQVRPPQSRQPEDARAEDVHERDGRRTQILLFVADLFLGYFEKHGLD
                     DDLEQGCQLLRRALERAPNDTPRLFFWYGKLGYYLQNVYDQNQDADLLTESIEICRRG
                     LAVVPDGDGASRAALLETQANALQKRAKRNSRIEDLDAAIGLSFDAVAVTPDSPKKNQ
                     YLTNLGCRLEDRFDRLNRVEDLRDAIRVSRSALPTPSGHAPADLLTNGIKHNIGVKLL
                     KLYNVDKQDATFDQAFSLLREAVETMQPPGDAPALWLNSLASAYRSRYWRNREENLDY
                     LNTAIDRQAEAMERLSRKSPSWPGYARNMAWLLRERAERTRNQGDLREALSFDRSVPL
                     YLESLDDPLGEPMSRMVAAVQLMAIFRERGEYARAVEIGEQVLDILRRTNTRLLSRED
                     QQRLTADFSDIAVETCALSIRAGESPARALELLELGRGLILGLLIEDRSDVSGLAATR
                     PEHAARYGRLRDVISRPVDTGVDDVALRQAMVRQRDSQVRELDGLISEIRQLTGQKSF
                     LQGPTAEEVKSLAASGPIVVVNVADERSDAILVTASTIRLVHLPKLRKGEVQAWLDKK
                     PTRFDTRSEFGKKNRMCREYLAWLWTACAEPILRALHLLDNPPPIEPTRVWWIGAGLG
                     AFLPFHAAGDHRPSSVANAYTYTISSYTPTTRALAYAQQRASFLRNLPPTTTTTTTTT
                     TTTTTKPSLLVALMPTTPPTNKDKRNPPLPTTATELARITTAFAPSHAVVPLRHPSTE
                     TVLANLPHCEIAHFACHGVSDRSNPSESHLILQHQPPPSERDPSPVAVADLLTIACLS
                     ACSTAESRAKRLVDEVIHLASGFQVAGFPHVVATMWPAELEASVEVAGRFYNRLAEAV
                     VVDDGVVAAVLREAVMDAREKWPLQPLRWAGYVHFGV"
     gene            1470325..1471345
                     /locus_tag="MYCTH_2308295"
                     /db_xref="GeneID:11507046"
     mRNA            1470325..1471345
                     /locus_tag="MYCTH_2308295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664970.1"
                     /db_xref="GeneID:11507046"
     CDS             1470436..1471260
                     /locus_tag="MYCTH_2308295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665018.1"
                     /db_xref="GeneID:11507046"
                     /db_xref="JGIDB:Spoth2_2308295"
                     /translation="MPQNILLPQGLLPTTSMRLGRFIVTVDDPHLSPFHDPKIEVRPD
                     SDIFKSTFLNYDGDQQAGSGNKFAAGLPSLLNGSVTRKTGRSCAVRADSVTTYQLINP
                     VPRFREAVRDDATRKWFEGRKDEGCDDFYFVVGYHVMANAVIEIGKEKSSGASGRLNV
                     PVSMALAAGGIPLPVGGITDPQFEAEYERSRGGTVRFEAPGERVSALQYRKVSFKWFS
                     SRNIDRATLAKDNVWESLLRVKGETGEEEEEEEDMAQVELEEDEEEGDKTVAENLR"
     gene            <1472749..>1475384
                     /locus_tag="MYCTH_103590"
                     /db_xref="GeneID:11507047"
     mRNA            join(<1472749..1473140,1473212..1474286,1474526..1474612,
                     1474713..>1475384)
                     /locus_tag="MYCTH_103590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664971.1"
                     /db_xref="GeneID:11507047"
     CDS             join(1472749..1473140,1473212..1474286,1474526..1474612,
                     1474713..1475384)
                     /locus_tag="MYCTH_103590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665019.1"
                     /db_xref="GeneID:11507047"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Spoth2_103590"
                     /translation="MATTTETAPLSAPVPVELPEASRFLNDSQWKVLMSLMDAIIPAV
                     RIRDSAGDTKAAQDASTTHLPGAEYSETAAKLRKAVTPLDPSSEILEAYLAERPSESP
                     AFAQLLTLILSNIPPSKQREFRILLSVLNTRPGSLLLTSRATPLPSLRLSERVKILQS
                     WSNSPLWSLRSLFKSMTTLGKLAFIRSSANFPALTGFPAVPRDWTSGSTSHPYEFLQF
                     EAASGTGKAPVEISTDVVIVGSGCGAGVVAKRLASEFGPSLGVLVLEKGRHLDARHFP
                     LSQATGLATLFEAGGVVETDDGSMTVTAGSCFGGGGTVNWSAALQTQDVVRAEWARTH
                     RLPFFESADFQACLDRVWDAMGCTGDKVAPNHANRVLLEGARKLGYQAKVVPQNCGGS
                     EHHCGYCTLGCWKGEKKGPVNGWFPDAAEQGVQFVERMTVKRVLLDHKKGKKVARGVQ
                     GVWKSRDGREVEVIVRAKKVVLSCGTLWSPVVLMNSGIKGGSLTSVVSSFENLDSKGH
                     GVKLEAMSMMPSFCLPFLPWASGTDYKVLAAHYRRLNTFIAICRDRDMGSVYRDPTTG
                     RPRIVYTPSDFDRAHNLRGVLELCRILYAHGAREIHPSIAGFPPFIRRTKEEDNKPEG
                     RDKDKDKHKDKDEDEEKEKREFEEWLGRLKAHGNKPPATPFASAHQMGTCRMSARPKE
                     GVVDPRGRVWGAEGLYVADASVFPSASGVNPMVTTMAIADWIGQGVCEDLKKDGIPSK
                     L"
     gene            complement(<1475651..>1476767)
                     /locus_tag="MYCTH_2128856"
                     /db_xref="GeneID:11507048"
     mRNA            complement(join(<1475651..1475725,1475788..1475860,
                     1475942..1476107,1476707..>1476767))
                     /locus_tag="MYCTH_2128856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664972.1"
                     /db_xref="GeneID:11507048"
     CDS             complement(join(1475651..1475725,1475788..1475860,
                     1475942..1476107,1476707..1476767))
                     /locus_tag="MYCTH_2128856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665020.1"
                     /db_xref="GeneID:11507048"
                     /db_xref="JGIDB:Spoth2_2128856"
                     /translation="MTFGSSDIYVVLVELSLGAGMITDIAQFGNLAAYGYPVATNRSE
                     LIGCSSFFGTRACNRTGELVVPDLVDPSAQRRQTVYSNIAFPILSFAVEAIANQSFPD
                     AGLAFIPPNDIWWSADLGFEGP"
     gene            complement(1477313..1479616)
                     /locus_tag="MYCTH_2308296"
                     /db_xref="GeneID:11507049"
     mRNA            complement(join(1477313..1477609,1477711..1479056,
                     1479121..1479616))
                     /locus_tag="MYCTH_2308296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664973.1"
                     /db_xref="GeneID:11507049"
     CDS             complement(join(1477426..1477609,1477711..1479056,
                     1479121..1479258))
                     /locus_tag="MYCTH_2308296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665021.1"
                     /db_xref="GeneID:11507049"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Spoth2_2308296"
                     /translation="MNVTDLSMGSRPMNAKELTDKAKNFDWNPRIGFKYWARAAETIY
                     HEGQVYLREGNVPKAYLVLFRFSTLVLEYLVKHPEAKEPESKRALKPLQRRIPRVIEQ
                     LETLRPEIDDTYDRWMRITAAQRDTLRSGEPFPAASSSTYAKHAANDPALSWSYASPA
                     NILDVQDHQDLAVDLAKKEMRRRRQASGLVGEDYGRRDSVQRGGQDRETGTIRLVPQD
                     MDDDELRRQMEATRRQLDRSDDYARGYDDEDYIRPSTYYYPSITKSSPLKYERPVSRG
                     RPEGPRLQPPRPPKERHVDRAPIEPPPRPDKDLYLERESPPIGPPPRPDKEPLALVTP
                     PYSSRPSEERPAIPSKLNAEPAPQKRITFRPAGYLENGDPIRPVFLPSTLRHKFLKLA
                     ADNTRRGLEMCGVLCGTTVNNALFISHLVIPEQRCTPDTCETENESVMLDYCITNDLL
                     VIGWIHTHPTQTCFMSSRDLHTQAGYQVMMPESIAIVCAPKYEPSWGIFRLTNPPGLP
                     HILSCQRTETFHQHSVDNLYVEAGSPQGHVYESKALEFEVCDLRPGH"
     gene            <1480421..>1481153
                     /locus_tag="MYCTH_2111918"
                     /db_xref="GeneID:11507050"
     mRNA            join(<1480421..1480472,1480528..>1481153)
                     /locus_tag="MYCTH_2111918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664974.1"
                     /db_xref="GeneID:11507050"
     CDS             join(1480421..1480472,1480528..1481153)
                     /locus_tag="MYCTH_2111918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665022.1"
                     /db_xref="GeneID:11507050"
                     /db_xref="JGIDB:Spoth2_2111918"
                     /translation="MADFDISGSSSEQLRCKASVEASVEFLSLSLGRLSIPADVCLFS
                     LLSKCFARIKTIFGLNDPFNVLGEPSTLERILNSIFDTGSLPLVTEKTIRITAGLDDH
                     DRSCLFIQAIAGMVLIFRRLSHAGGVVSNRLLSRELQLFAESEQRRAVLDKIGSSHVF
                     SSCYTKSAIVDFVMAAIDDQNSGLRDCFALSGAGEFLLSDNVAWVSDRPCKNMGLPWG
                     FTIMTLN"
     gene            complement(1481226..1482045)
                     /locus_tag="MYCTH_2308301"
                     /db_xref="GeneID:11507051"
     mRNA            complement(join(1481226..1481418,1481476..1481600,
                     1481655..1481725,1481791..1482045))
                     /locus_tag="MYCTH_2308301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664975.1"
                     /db_xref="GeneID:11507051"
     CDS             complement(join(1481298..1481418,1481476..1481600,
                     1481655..1481725,1481791..1481851))
                     /locus_tag="MYCTH_2308301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665023.1"
                     /db_xref="GeneID:11507051"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="JGIDB:Spoth2_2308301"
                     /translation="MADVQAKLQALSEEFTKLQQELQEAVQSRQKLEAQKQENLGVQK
                     EFSKLKDDETIYKLIGPVLLKQDRVEAESTVKGRLEFIEKEISRLESHIKETQGKMDK
                     KKSEIIQIQASAQAGAAPQAAKA"
     gene            1482200..1484130
                     /locus_tag="MYCTH_2308304"
                     /db_xref="GeneID:11507052"
     mRNA            join(1482200..1483122,1483188..1483638,1483699..1484130)
                     /locus_tag="MYCTH_2308304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664976.1"
                     /db_xref="GeneID:11507052"
     CDS             join(1482479..1483122,1483188..1483638,1483699..1483920)
                     /locus_tag="MYCTH_2308304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665024.1"
                     /db_xref="GeneID:11507052"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="JGIDB:Spoth2_2308304"
                     /translation="MSNTDFLDRAIKQVRLAIDADNAAQYEKAYQLYYQALELFMLAL
                     KWEKNPKSKEMIRAKTGEYMDRAEKLKAHLADVEAERKKPGMVGANGTTTGGTGKGKE
                     AGEDGGETLDEDSKKLRSALAGAILQERPNVSWDDVAGLDQAKEALKEAVLLPIKFPH
                     LFQGKRQPWKGILLYGPPGTGKSYLAKAVATEAKSTFFSVSSSDLVSKWMGESERLVR
                     QLFAMARENKPSIIFIDEIDALCGPRGEGESEASRRIKTEMLVQMDGVGKDSKGVLIL
                     GATNIPWQLDAAIRRRFQRRVHISLPDFAARTTMFKLAVGDTKTALKPEDFRELAKAA
                     EGYSGSDISIVVQDALMQPIRKIQQATHFKRVIVDGQRKLTPCSPGDPDAEEMTWEKV
                     PSDELLEPMVEKKDFIRAIKASRPTVSQADLERNEAWTKEFGSEGA"
     gene            complement(1484130..1486157)
                     /locus_tag="MYCTH_2308306"
                     /db_xref="GeneID:11507053"
     mRNA            complement(join(1484130..1485723,1485836..1486157))
                     /locus_tag="MYCTH_2308306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664977.1"
                     /db_xref="GeneID:11507053"
     CDS             complement(join(1484340..1485723,1485836..1486005))
                     /locus_tag="MYCTH_2308306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665025.1"
                     /db_xref="GeneID:11507053"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="JGIDB:Spoth2_2308306"
                     /translation="MVVVNYLLFESAVGFSLFEVVHQADTVGLELPEVKDAMKSLDKF
                     GKMVKLRSFNPWTSAAHGLEAINLISEGIMPDHLKNTLELNLPQTSGKKSKIVLGVVD
                     KRLAGEISAAFPGVQCEAADTSEVVAALLRGIRLHANKLLKGLQEGDIGRAQLGLGHA
                     YSRAKVKFSVHKNDNHIIQGIATLDALDKGINQGAMRVREWYGWHFPELIRIVSDNAT
                     YAKLVLAIGDKRNLTDESVDDLANVLNQDQDKAEAIVQAAKISMGQDISETDLQMVKD
                     LALNVSKMADYRRVLAESLDKKMGDVAPNLQVILGTPVAARLISHAGSLTNLAKYPAS
                     TLQILGAEKALFRALKTKGATPKYGLLYQSSFIGRAGPKVKGRISRYLANKCSIASRI
                     DNFSEKPTRRFGEVMREQLEQRLEWYAKGTQPMKNIDAMNKAIKAVMADGDEMDVDDE
                     KVDHPPAKEKKEKKEKKDKEEKKDKEGKKEKKDKKRKSVGGEDVEMADVNGDGEKKKK
                     KKRKSAAAE"
     gene            1487306..1490818
                     /locus_tag="MYCTH_2308309"
                     /db_xref="GeneID:11507054"
     mRNA            join(1487306..1489485,1489540..1489799,1489865..1490818)
                     /locus_tag="MYCTH_2308309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664978.1"
                     /db_xref="GeneID:11507054"
     CDS             join(1487471..1489485,1489540..1489799,1489865..1490469)
                     /locus_tag="MYCTH_2308309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665026.1"
                     /db_xref="GeneID:11507054"
                     /db_xref="JGIDB:Spoth2_2308309"
                     /translation="METAVPSDAQKPKEATIPSPGRPILPTGHTTIASVAKETLPDSS
                     LEDPNPEGDIRESWVSFASTAASRDSAVPSLFSARASTASAATRYSVRQSVIESADSR
                     SNLPAYAEKRKDSHPQSPRYCCTFCDAAFDTKTEWKIHEFEFHDRRERYMCRNCSAVF
                     LRATLLAEHLEHDHGLEPTTGVSEPVEYRHIRSAWGCGFCGAGFDSRTDYLEHVGQHY
                     DEGKEMAADWQHTRVIEGLLRQPKIAPEWLALVTKEERARGAKLRFLWDPHTTGRSTD
                     ESGPQCLQDMLEFFATGTRGANEVTVVAFSSAHVRLEDNVSDLISRLFLRDPRAKSTE
                     TSPDRIRFSPELQPSTPGMEDDVISPMSPLPAPLRSPTAPPQVPGPVPPPTGLRPQAP
                     SIFPLPFRLAETLNSSKLSVLRHIESSRCLGPSSEATSVGSLERQALDMLPFQPSRDT
                     PPISTQGTSESRPRHLQSTEEISWASDKRKAIIAAASLKPHTSSSTLSTHTRDSSLGF
                     GDSTSEVLSDDSLSEPDYWVEPGGLPTATKRWRSTFQQTVDRGMARLWVRYNKHWEAL
                     VRRCVGETSTDTAHSLETSRRMRKATASRHALSKGFRTNRLMSQEEEEGEDDENDGSR
                     PASSLSKRSSGTAKRFACPFRKHNPLIYNIHDHEVCAIRSWSTISRLKEHLYRRHYKA
                     HCQRCKQTFSDARRLAEHEMSVVACEVLDVAPPSDITADQEKQLKSRKHTARRQTDEE
                     KWRDIYRLLFPKEEIPSPYPEAADDMAPANSESHVNLQFHHFLLSEMPALFTRTAEEH
                     AGRPLQAQEGLTMEAIPGIIEDALRKAFRAWEARGSDLPTREASVASMSFLPETPASL
                     AYNFNQSTRTQQDAQPQAMEHGYSQSHYGNANFAVRASQTTTNPDDSGFADGSLFMSG
                     PPVNFNTFAPEYGRAAWDSDFGLLGVGSYGTDVNHGTHFQGFQDS"
     gene            complement(1490837..1492843)
                     /locus_tag="MYCTH_2308311"
                     /db_xref="GeneID:11507055"
     mRNA            complement(join(1490837..1491774,1491875..1492077,
                     1492179..1492275,1492373..1492843))
                     /locus_tag="MYCTH_2308311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664979.1"
                     /db_xref="GeneID:11507055"
     CDS             complement(join(1491204..1491774,1491875..1492077,
                     1492179..1492275,1492373..1492719))
                     /locus_tag="MYCTH_2308311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665027.1"
                     /db_xref="GeneID:11507055"
                     /db_xref="JGIDB:Spoth2_2308311"
                     /translation="MKWTAKSAFLALSAVAEAAPQFGGIGQMTMLRFGCSQVVIDRID
                     PLVNPGQVPSPHIHQIVGGNAFNVTMPTDDVSAHASCTTCQFSEDFSNYWTANLYFKA
                     RNGSYKRVPQGGAAYQFGDVFSTQTDGGILVYYVSQQPGRVTAFKPGFRMLVGDPNMR
                     SRPDTKLKRQNCYRCYTGPNFGGDIGAPCMDDSVDSEALPNKPCPGGIRSNVLFPTCW
                     DGKNLDTPNHQDHVAYPTTGPENFLSIGGNCPSTHPVRIPQLMYEVVWDTTGFNNQNE
                     WPQDGSQPFVLSTGDPTGLGQHGDYVFGWQGDSLQRAMDTAGCFGARCADLKTQTIES
                     AKACTVKQAAKENYDVCTYLPLPLLDSCLLFSSSSSSSSSSSSSSSSSSSSSSSSSSS
                     SSSSSSSLYPTFP"
     gene            complement(<1495555..>1497809)
                     /locus_tag="MYCTH_2119902"
                     /db_xref="GeneID:11507056"
     mRNA            complement(join(<1495555..1496258,1496297..1497704,
                     1497777..>1497809))
                     /locus_tag="MYCTH_2119902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664980.1"
                     /db_xref="GeneID:11507056"
     CDS             complement(join(1495555..1496258,1496297..1497704,
                     1497777..1497809))
                     /locus_tag="MYCTH_2119902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665028.1"
                     /db_xref="GeneID:11507056"
                     /db_xref="JGIDB:Spoth2_2119902"
                     /translation="MLTLACHPCWWVRDTTLSEYLEACHNLLYANFKVEVNEKFTSKG
                     SITSPVGRRIPPRLEPWDDFLEEQRTIFGTLLSKFPAHTAAFRSQHYLRTRGKVIAAR
                     SIGDEEALKLVYQDLVTEPVTLISQRLQDKDSIRAEFDIGAGIAFETRLNALGEANRE
                     STERPRTPDGMANRFRPDQICAYRRDGADPDQRTMAFIIEQKAPHKLTMPHLRSGLRA
                     MNIFEEVVNRPTSPPQEDKEALFQYHADRLVAAALTQTFDYMSQAGLTYGCLTTGQGF
                     VFLKIDWTDPITLLYHLAEPGPEVDEHRENFLCCTAVSQMLAFTILALDSGATGERGQ
                     DKRQRAIKKLKTWNVDWELILRSIPPTERTAPPTSPAYQPRTYKGVDRSPYLLRPARS
                     RAAGRPRCRPGPAERDRSPEFDEEGSEPRMPDTPSPVQPRNAQRAPARRPRGNNGNAG
                     SSSSGSRSSNRRYCTQNCLRGLVAGMFLTRNRRHPLDHASWLGLLREQLRRTLDDGVV
                     PLRKQGARGVLFQVTLLAYGYTFVSKATTARFVPELEHEAQVYERLRPLQGDRVPVFL
                     GAVDLRQVGRRYYYDIDVQLVYMMFVSWGGCSLDEVEVSDMAKLEREVMRAVRALHPH
                     GVAHTDMRDANILWNAETERAMVIDFEQAVLAEPPRRGLGPIVPNKRALRANVDTKTA
                     VAGPKSKQDAILLKMQQEDILGAKYALYWPRK"
     gene            <1501469..>1502451
                     /locus_tag="MYCTH_96070"
                     /db_xref="GeneID:11507057"
     mRNA            join(<1501469..1501486,1501552..1501562,1501593..1501599,
                     1501780..1501821,1501879..1501902,1502086..1502354,
                     1502418..>1502451)
                     /locus_tag="MYCTH_96070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664981.1"
                     /db_xref="GeneID:11507057"
     CDS             join(1501469..1501486,1501552..1501562,1501593..1501599,
                     1501780..1501821,1501879..1501902,1502086..1502354,
                     1502418..1502451)
                     /locus_tag="MYCTH_96070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665029.1"
                     /db_xref="GeneID:11507057"
                     /db_xref="JGIDB:Spoth2_96070"
                     /translation="MLTSPLYYLPVKGAYYTVLIPKFSILATFAPALAYTNENISTLV
                     NTNATLIAHVLGTLLPASYTRLSASIYPVPMPINFGRSYARRSSLPAECIIYLVRDRD
                     DPTLTTITIVLEGEDKEEKVVKYVYNAVVTCP"
     gene            <1514598..>1514903
                     /locus_tag="MYCTH_2065815"
                     /db_xref="GeneID:11507058"
     mRNA            <1514598..>1514903
                     /locus_tag="MYCTH_2065815"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664982.1"
                     /db_xref="GeneID:11507058"
     CDS             <1514598..1514903
                     /locus_tag="MYCTH_2065815"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665030.1"
                     /db_xref="GeneID:11507058"
                     /db_xref="JGIDB:Spoth2_2065815"
                     /translation="YRYFVRVYIDDIIIFSKIEEEYLEHLYTIYKILNKAYIYINVTK
                     SFIGYLAMRLLRYIINGKGITKTNDYIATFKKLKFLDTLDSLEHYLRMARWLRKGIP"
     gene            complement(<1520967..1521799)
                     /locus_tag="MYCTH_108765"
                     /db_xref="GeneID:11507059"
     mRNA            complement(join(<1520967..1521021,1521073..1521799))
                     /locus_tag="MYCTH_108765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664983.1"
                     /db_xref="GeneID:11507059"
     CDS             complement(join(<1520967..1521021,1521073..1521356))
                     /locus_tag="MYCTH_108765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665031.1"
                     /db_xref="GeneID:11507059"
                     /db_xref="JGIDB:Spoth2_108765"
                     /translation="MDSRIEELERELRAAREAAALEKARAEAEKAQADAEKGASGRGE
                     GMSGRGEGTRRRGEGASGSGEGASGSGEGTSGSGEIASGRGEVASGSATACGIRTVGG
                     TPGPEVTVCRS"
     gene            complement(<1521841..>1522520)
                     /locus_tag="MYCTH_2128866"
                     /db_xref="GeneID:11507060"
     mRNA            complement(join(<1521841..1522053,1522248..>1522520))
                     /locus_tag="MYCTH_2128866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664984.1"
                     /db_xref="GeneID:11507060"
     CDS             complement(join(1521841..1522053,1522248..1522520))
                     /locus_tag="MYCTH_2128866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665032.1"
                     /db_xref="GeneID:11507060"
                     /db_xref="JGIDB:Spoth2_2128866"
                     /translation="MAAKPSREAVSGGPACSALRSSAGPPRGDKAAPTGQRRRIPAAS
                     ASKSTHFETGCRQHVMSIIVYPGSLEQPKKAPSGRFCLQLLREATFNGPMVEKSCSDN
                     PAVFVEGSALPDPSYTLIGTSFATAKTLAIAHYTGVACAIADTSSTKLSGKCLKEPRD
                     T"
     gene            <1523067..>1523736
                     /locus_tag="MYCTH_2066269"
                     /db_xref="GeneID:11507061"
     mRNA            join(<1523067..1523301,1523492..>1523736)
                     /locus_tag="MYCTH_2066269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664985.1"
                     /db_xref="GeneID:11507061"
     CDS             join(1523067..1523301,1523492..1523736)
                     /locus_tag="MYCTH_2066269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665033.1"
                     /db_xref="GeneID:11507061"
                     /db_xref="JGIDB:Spoth2_2066269"
                     /translation="MAARLGFQSVSDLEEWEEEIVLDHFANFIFDYLAHGYTVQPDKR
                     ELVEYIDLGKAVAERITMLEQRRFEQVLDPDKSDWTARDHYKQFVVGVVSDDLWLSMY
                     DIDGAVICKRGWTARATTIKMVKYLEFLIQEWRKGAGDTQYGEKTMRGRTPRSGRRN"
     gene            complement(1524046..1524879)
                     /locus_tag="MYCTH_2308313"
                     /db_xref="GeneID:11507062"
     mRNA            complement(1524046..1524879)
                     /locus_tag="MYCTH_2308313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664986.1"
                     /db_xref="GeneID:11507062"
     CDS             complement(1524347..1524778)
                     /locus_tag="MYCTH_2308313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665034.1"
                     /db_xref="GeneID:11507062"
                     /db_xref="JGIDB:Spoth2_2308313"
                     /translation="MKFTAAALALAASAIAAPSKGGESCEFGTYRCTTPNTGIEICNI
                     SGKWELVGDCPEGTACDNLPGGNGVVLPYCTNTAKVQARNGRPGQSPGEKCTTPGRYD
                     CFGPYAIQVCDTQNILQFVGNCPERSHCEYLNGIPYCVASV"
     gene            complement(1527492..1529448)
                     /locus_tag="MYCTH_2308314"
                     /db_xref="GeneID:11507063"
     mRNA            complement(join(1527492..1527521,1527589..1527697,
                     1527764..1528941,1529116..1529448))
                     /locus_tag="MYCTH_2308314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664987.1"
                     /db_xref="GeneID:11507063"
     CDS             complement(join(1527904..1528941,1529116..1529373))
                     /locus_tag="MYCTH_2308314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665035.1"
                     /db_xref="GeneID:11507063"
                     /db_xref="JGIDB:Spoth2_2308314"
                     /translation="MSSATTALSPAASGEAGASTGPGDGGAEAIQGVPISEHAAYLAQ
                     VYIGVSAVLLFLCLVAFVTRVYQRIRPVWKAGLDDYFIVAGFVLTIADYAMLMPLMVP
                     KAGLISLERSTLAGKNSWLAISVWGLSMSCIKISIALTLLRIQGKERGWRIFLYSVMA
                     ISALYGVGNTLFNLVIACRPLEAAWNPFLPGARCVSVQVMRGISNLGAAVNITTDVLL
                     SLAPATFLRKLNRRLRERVFVCVLMGMGLFASVFSVIKTVIVKDWGDPNKQGDFWAQG
                     VSISTFTVLEQLLGVLAACVPAMKGMLQRCLGAFGLSLTENKSHQRSGYYAAGRSGTA
                     TGVGVASRAGGGEGVVVGGGSVLDPTETYRSHKGGNHRFSSRGGKTDIYDDETCIDLP
                     DLSRPGSTKSVGDRSLDNGQGGSSREHSVEQLPAHAIQN"
     gene            <1548184..>1549770
                     /locus_tag="MYCTH_96065"
                     /db_xref="GeneID:11507064"
     mRNA            join(<1548184..1548366,1549237..1549446,1549528..>1549770)
                     /locus_tag="MYCTH_96065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664988.1"
                     /db_xref="GeneID:11507064"
     CDS             join(1548184..1548366,1549237..1549446,1549528..1549770)
                     /locus_tag="MYCTH_96065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665036.1"
                     /db_xref="GeneID:11507064"
                     /db_xref="JGIDB:Spoth2_96065"
                     /translation="MVQNGGDFDLDIDMATDVTAEQLLTQLGQLQQRIQELDQRDKAA
                     QARIKELENREKYSQKLNVTEVAATSYEDKDSDTDSLGHDGNGEDEQAPYSELVTVDP
                     ETGLAEWDMAGEYAPPISILPTLRQWGFTERIEWYRNEVFRLNTELRERNGRLTRLAQ
                     QSDEMKDEMRELRRIVETIKGEQPVTYDGPDSYAEHFDDQQLSHDVRNPEY"
     gene            complement(1554110..1554813)
                     /locus_tag="MYCTH_2308322"
                     /db_xref="GeneID:11507065"
     mRNA            complement(join(1554110..1554476,1554528..1554727,
                     1554781..1554813))
                     /locus_tag="MYCTH_2308322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664989.1"
                     /db_xref="GeneID:11507065"
     CDS             complement(join(1554151..1554476,1554528..1554606))
                     /locus_tag="MYCTH_2308322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665037.1"
                     /db_xref="GeneID:11507065"
                     /db_xref="JGIDB:Spoth2_2308322"
                     /translation="MMEGLNKCQNCVRMGKKCSGPNVTDALLSNLSEQEKVSKEIAET
                     EALLAQTLSRLSRLRRLQQSLRDRGAEVFRRGIARLEEEEEPDTPPPMSETQTLTGQA
                     QALGTFDVLDWESIGLDPGPNSSGFPSFSVGE"
     gene            <1611085..>1611527
                     /locus_tag="MYCTH_2128874"
                     /db_xref="GeneID:11507066"
     mRNA            join(<1611085..1611171,1611201..>1611527)
                     /locus_tag="MYCTH_2128874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664990.1"
                     /db_xref="GeneID:11507066"
     CDS             join(1611085..1611171,1611201..1611527)
                     /locus_tag="MYCTH_2128874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665038.1"
                     /db_xref="GeneID:11507066"
                     /db_xref="JGIDB:Spoth2_2128874"
                     /translation="MATLSLYDTTIVCGTHALDTLLDLLKEAQARIFPDMVPLSLQVL
                     IVCKFYKQFVTYPTGRIVEGAEDDGENKTLEELVERVEKTLGLLETVSRDEIDGTALK
                     TTTVEVVPYGSFNVTPEYFILIYQLPTLYFHLVTA"
     gene            complement(1641764..1644107)
                     /locus_tag="MYCTH_2308330"
                     /db_xref="GeneID:11507067"
     mRNA            complement(join(1641764..1642263,1642350..1643123,
                     1643234..1644107))
                     /locus_tag="MYCTH_2308330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664991.1"
                     /db_xref="GeneID:11507067"
     CDS             complement(join(1641941..1642263,1642350..1643123,
                     1643234..1643618))
                     /locus_tag="MYCTH_2308330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665039.1"
                     /db_xref="GeneID:11507067"
                     /db_xref="InterPro:IPR010856"
                     /db_xref="JGIDB:Spoth2_2308330"
                     /translation="MAAMNNLGKAEGDISDTFTSLSGKKTPPLPDRFRELKLRLVSGH
                     EDAVIASWKRLLAALQNENELIARTGPAIIPEVRFSHLQDDLEALKPEIKKRGVAVIR
                     GVIPEDEARSYKFEIEEYVRQNPHTRGFPPSEPQVLEVYWSPAQVRARAHPNLLATQR
                     ALMTTLWHAASDPSAPVSMHTPLSYADRLRIRRPGDAHFALGPHQDGGSVERWEERGY
                     GRGGVYDAVFRGRWDGGNSKKAGEGGAGYDPFDAAPRVRAVTDLYGGLGACSMFRMFQ
                     GWLAISRSGPLQGTLLVNPLVKETGVYALLRPFFAAKRGLEELDGNRERYLDEDNWEF
                     TGGERMTSEIQGAAMGCAQEFPEGAHPHLELEKTMVHVPEVRPGDYVVWHCDTIHAVD
                     KKHAGTSDSSVLYIPVCPTTVASAEYVARQRAAFLRGTPAPDFPGGEGESRHIGRATE
                     EYVKKYCDPLGVQSIGLDRLATVEDDTPGGKAAVEEANRVLGF"
     gene            1644547..1647357
                     /locus_tag="MYCTH_2308333"
                     /db_xref="GeneID:11507068"
     mRNA            join(1644547..1645970,1646039..1647357)
                     /locus_tag="MYCTH_2308333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664992.1"
                     /db_xref="GeneID:11507068"
     CDS             join(1644863..1645970,1646039..1647198)
                     /locus_tag="MYCTH_2308333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665040.1"
                     /db_xref="GeneID:11507068"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2308333"
                     /translation="MSPAPPFLGDLNPEGILVEATMVSSQKTPPADDEPGHQDIGFLP
                     PTPPRQSKESPTRGRATTCTGSPKLCEDKTGPYFSVPREDGTRLTIHVQDTAKFAAIA
                     QILVTRELAEKIMPSDAEWRAMRDLYLTKIHPIFPIYEKSALMDLPQERGLRELIQAS
                     VCLAAATDPETHNLLTFKSQSHGEARSHKVVPYDDYSRDMASFINKRLVELQESRQIP
                     LTNQIQVMALTCLYWQPTSPTERFEPLTLYAKLVSLVHTHGVHLGILARGHSECCSEG
                     RGKRIFKCLYALDRLLAAISARPLMFHNVDLTQIPHPDEQDSPIFRLFISLILLLDQV
                     FELYRPRPKFTCIDMPVFERMAIEAGAQSEPEGLLVTLEVLYHAISVLSVRMPRHRFR
                     TAPECDTLHRISTHHLPPNSMNARRSHSADRILDVIKDYKLSPMPFVAYASTLSLSVA
                     YRKWRFSQLPTFRTRGGADFKKVLPVVQELGAIWTTARINGELGQCVLLKLDRNEIIN
                     RKRARETAEGSGTKRVRAGPLGDANEQEAAAEEPNGAVERTQAEVMTQATPAPTPSSA
                     NTPPEKPCSSHISRDRTAQDLGAGSNSFLGASANHRDPLASHTASFLADRPQQRSLPL
                     TWTSCRTADKMHHSSNTPVVPPNPPWAASVKDGMTQPNPTQQLAISQGDGCNQSDDAI
                     PLPRDVLEQPARLNETSPLAGLSEGSMEDFMIDDDALFRSWDPRFAQSVDFSFSSILD
                     PGNPFAWPEYCNYTT"
     gene            complement(1648750..1648823)
                     /locus_tag="MYCTH_t158"
                     /db_xref="GeneID:11507069"
     tRNA            complement(1648750..1648823)
                     /locus_tag="MYCTH_t158"
                     /product="tRNA-Val"
                     /note="Anticodon: AAC"
                     /anticodon=(pos:complement(1648787..1648789),aa:Val,
                     seq:aac)
                     /db_xref="GeneID:11507069"
     gene            complement(1650776..1652909)
                     /locus_tag="MYCTH_2308335"
                     /db_xref="GeneID:11511499"
     mRNA            complement(join(1650776..1652573,1652633..1652705,
                     1652772..1652909))
                     /locus_tag="MYCTH_2308335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664993.1"
                     /db_xref="GeneID:11511499"
     CDS             complement(join(1651041..1652573,1652633..1652705,
                     1652772..1652815))
                     /locus_tag="MYCTH_2308335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665041.1"
                     /db_xref="GeneID:11511499"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2308335"
                     /translation="MTDSLADKLSASTLNDGPGPDDWKKNLRIPAKDTRQQTEDVTNT
                     KGLDFEDFGLKRDLLMGIFEAGFEKPSPIQEESIPVALTGRDILARAKNGTGKTAAFV
                     IPALEKINPKVSKIQCLILVPTRELAMQTSQVCKTLGKHLGINVMVTTGGTGLRDDIV
                     RLQDPVHIVVGTPGRILDLAGKQVADLSECPMFIMDEADKLLSAEFTPVIEQLLRFHP
                     KDRQVMLFSATFPISVKDFADKNMSSPYEINLMDELTLRGITQYYAYVEEKQKVHCLN
                     TLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCFYSHAKMAQQARNRVFHDFRNGV
                     CRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRYGHLGLAINLINWDD
                     RFNLYNIERDLGTEIQPIPQTIDKSLYVYENPETIPRPISNFNKPAAIQQQQQQQQQQ
                     QQQQQQQQQQQQPQKSSVQVQSSGAQQGEWQGQANRQNGSGPSGTQGRGGYQGNRGPT
                     GGHRGGRGRGYQGQGGRQNYGGQRGGRSQGPGQAPGAGPQA"
     gene            1653409..1654668
                     /locus_tag="MYCTH_2308336"
                     /db_xref="GeneID:11507070"
     mRNA            1653409..1654668
                     /locus_tag="MYCTH_2308336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664994.1"
                     /db_xref="GeneID:11507070"
     CDS             1653584..1654474
                     /locus_tag="MYCTH_2308336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665042.1"
                     /db_xref="GeneID:11507070"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2308336"
                     /translation="MPLKLPATSLCSSRSVLSVFYTPSSASSLCRPRDRRSVAPLSQC
                     AQHWQSYATVSDGQRGDKPNNTDYPKWPTSANPTPYEILGHPRDCPYNKARYFQLAKL
                     YHPDRHHHTSGDGIPQVTKLERYRLIVAAHEILSNPQKRRLYDLYGFGWENQTDPKIR
                     HREADRAWRQEPGNPSMNATWEDWEQWHQQRNGSGGKQEEVFTSNIAFMAIVSAFLIV
                     GTWSQMTRAGTNSISIIEMRDQQHAAISRELQERRNQRARLDREARVESFVRQREFEK
                     WAHDPPGHGLRAPGDSEVSN"
     gene            <1655423..>1656553
                     /locus_tag="MYCTH_96059"
                     /db_xref="GeneID:11507071"
     mRNA            join(<1655423..1656152,1656240..>1656553)
                     /locus_tag="MYCTH_96059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664995.1"
                     /db_xref="GeneID:11507071"
     CDS             join(1655423..1656152,1656240..1656553)
                     /locus_tag="MYCTH_96059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665043.1"
                     /db_xref="GeneID:11507071"
                     /db_xref="JGIDB:Spoth2_96059"
                     /translation="MGRQRDKNATQMRSLATFRRFKEFPAEIQQQIFIEAMDLPYFHT
                     VIVKRVDNRVTGTWSLSFYPDDPKSRDRSGHRLYEKMASVDPAAAAAMRYERQTRLGQ
                     LPFKKLRAPVDYERDLVVLDFRKCKGRTLGYLHPDNQILNPTGSAFDANAVAMQLEKI
                     QKVAVVWNDQQPLCHDSSNNFRCPDPSSPVHEPHRNWCMCPEELFGLLNCFPELRQFY
                     LLIPLGKKTNPQQLHVEDLIEDTYKFNDQHLYPVFHGRGRSFVHAGQLRSWEGRNHES
                     NDNELSVFQLSPHRVHPSMLEMLRELRDDSFLADDVETLPEAERVELSQKYRLSRKER
                     ENLVFGVLLQCKT"
     gene            <1659889..>1661403
                     /locus_tag="MYCTH_2045175"
                     /db_xref="GeneID:11507072"
     mRNA            <1659889..>1661403
                     /locus_tag="MYCTH_2045175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664996.1"
                     /db_xref="GeneID:11507072"
     CDS             <1659889..>1661403
                     /locus_tag="MYCTH_2045175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665044.1"
                     /db_xref="GeneID:11507072"
                     /db_xref="JGIDB:Spoth2_2045175"
                     /translation="DLPIALRRTRRSIGICSSKPGESSKSASPCASPRRPTKATPAVR
                     TPDSRKRGVRFSDPGPSIAGGGDSELSTGLTPMIRRTSLRSSQMSRRHSTPGRLFPAS
                     RGTSADPDVRALPAGGEVYFLPLRQVLDGRIKRRIRRNGLSEEMNTISAERKRRAEET
                     KAEIERLKAELARKDEEIQRLHDETVVLDTERVWELEQQVASLKRELASRSGVQQQDL
                     PSSPASEWTRAAPNSCQDDYMELDIGDDLEEFGEATRAELECSTPTRRMLASFPTPPA
                     TSPEPQPPQTPCRRSFGTPRSHVGVQATFPDPDKQQLERELKSLQLEVTKLTATLESY
                     SSLASRLSDKRLNLPPSERPSTADSAEDLEAHLNTVLQTLSDRTAALAELDSSLKGLG
                     FPGSDAFEVVESLRASFRSARLELEYITPGEITLPLTGAGAAVLDLVLSRLRALAQRN
                     RDADEAIDEHRATEFSLRQQLSARVTAMDRLAAQLTASERAARDKDAPHRRARGR"
     gene            complement(<1662366..>1663271)
                     /locus_tag="MYCTH_2128884"
                     /db_xref="GeneID:11507073"
     mRNA            complement(<1662366..>1663271)
                     /locus_tag="MYCTH_2128884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664997.1"
                     /db_xref="GeneID:11507073"
     CDS             complement(1662366..1663271)
                     /locus_tag="MYCTH_2128884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665045.1"
                     /db_xref="GeneID:11507073"
                     /db_xref="JGIDB:Spoth2_2128884"
                     /translation="MAHQTFPQFRRLPTEIRVMIWELCLPQRVIRLSSLVIAHSHHHY
                     HDAALDPTIERLLRFVFSRSCLVSYVCRESRAVATMRRVPVTDLDLPWLGRGTWFDPR
                     TDTLMLDCDVFFAHSRFWLQLRRKLFPGPRVATSRVRLAVVKDLATWYFNYLQLRHRQ
                     GSDQNDRRDRPDEGDGAPLPAIRQISWAVEMKEVYLPLPMRDVAIRAGWAGPLREAAC
                     RQVEVRQGGLLERLERLAIPHVMDMREAGTMVAEALDCWANEYSKIVAMSRALGFEGS
                     EKEWRKNGGGPYPVFTTCMCDSRQW"
     gene            <1665521..>1667269
                     /locus_tag="MYCTH_103571"
                     /db_xref="GeneID:11507074"
     mRNA            <1665521..>1667269
                     /locus_tag="MYCTH_103571"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003664998.1"
                     /db_xref="GeneID:11507074"
     CDS             1665521..1667269
                     /locus_tag="MYCTH_103571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665046.1"
                     /db_xref="GeneID:11507074"
                     /db_xref="JGIDB:Spoth2_103571"
                     /translation="MWDSIEDPSKRREIRYGNNIYVLFRALLHCKRFYGQDSLWVAIA
                     RGFNTSPTIVRVTSEILTQARREQRSKPIKDIPDTARAADEWIDFLDTYDPRLRSLSD
                     PEVYNVSEAFFKAQEKKHLNAARVPTNPRQRPLYITNLDRRSPERSLDGGSAPIQSPP
                     VQLENLRESDRHRGRSPPLRRKRSASPEEGVSSKIRRTDFDTRRDPRLEPEKHGALDK
                     LPTIQPTRSPPRVNQPRAAQPAQPVKPVQPVQSTPQPAGPEGNEPLAKSPGLSARVAQ
                     VVPQQTTPANSGVAPGEPAQSKLSAQPVSQTPSSIPKEESSSPKAPAPPDVDDASALK
                     ARIVSLEKQLEEAESKRTNPTPVLSSPLPSQLGEDMVALKKEMATATNAVSTIMESMH
                     DIVDNLQSLQGEISALVAEQKDLKTTLPQSISSSNDGTKNPSFDLNAILQPLQNLDNT
                     VNALRAEVSELKRNQAALSAPTSQTTGNDTKQLETLLQSHTARLDKLSQQMASLQQAQ
                     QQQAQRHSPQPQGQPQSLRQAMAAAERDLKHHLATVQALYHRGGAGRAVTDRTADLLV
                     TLSEAVRAAQAGQAGI"
     gene            complement(1667875..1668844)
                     /locus_tag="MYCTH_2308340"
                     /db_xref="GeneID:11507075"
     mRNA            complement(join(1667875..1668298,1668385..1668844))
                     /locus_tag="MYCTH_2308340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003664999.1"
                     /db_xref="GeneID:11507075"
     CDS             complement(join(1667892..1668298,1668385..1668574))
                     /locus_tag="MYCTH_2308340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665047.1"
                     /db_xref="GeneID:11507075"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="JGIDB:Spoth2_2308340"
                     /translation="MTSLLPLIQDILPMILPASVTVTKAADILPGETGSSETAAATPG
                     VRVISRNAVVGKTDKMCTSILILKPNSSSSVRHHGEQGTCLSLSRHLSYVCTYPQGCA
                     QPSEATPSKPPWEETIIYAVSGKGAILSQPTGDDEEPERHDLDPGDFAFIPAWTEHQA
                     VNDSEVDWHLVIIRSGSHPVEVNLTGWGGAEIKEPPRQ"
     gene            1669512..1672055
                     /locus_tag="MYCTH_2308344"
                     /db_xref="GeneID:11507076"
     mRNA            join(1669512..1669880,1669938..1670918,1671029..1671556,
                     1671653..1672055)
                     /locus_tag="MYCTH_2308344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665000.1"
                     /db_xref="GeneID:11507076"
     CDS             join(1669679..1669880,1669938..1670918,1671029..1671556,
                     1671653..1671777)
                     /locus_tag="MYCTH_2308344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665048.1"
                     /db_xref="GeneID:11507076"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2308344"
                     /translation="MAEVGRDEGHDPFAQAPQQGSDGVYNTHEDAEPESVDYSPLSFV
                     GTESTSGTRSPGRRDKGKAEERLAIDFENNTCPLISLPAELLGSILTYLAPEDLCRVS
                     GTCRTLYAHATDDRLWRAHVQDNVPGQEVTSSYPFASFRELYAALDPHWFVTKYKFWF
                     SDTGLPGRMIVARYDQRRGCIEGYQLLAHNQNSSFHTWHAHGDTILSSFNPKVKLHLD
                     NPVLRLPARLPNNHDNDSEGIVVLRPNHKDTDVPDGDGSGTSGTSGTGSSGSTGSGSG
                     SGSGSGSGKPNGLDQQARANRFQSSILMYTNTSSLQNSFIYARSLSPDDMAERARSHF
                     PYGHVWPPPTIPSPHRVLGAGLERHTSLRDRDRAHSRRDVYDRAFRIHKCIHVNNLDD
                     YIAPGILPINWPPLAHQWLLQLDQAMHRANPLSAARVPLGEEVSTYATLDPAQYTPTQ
                     TKPWRGIWVGDYGAHGCEFLWIHQPDDDDDDDDPSPAAVERPEDESDEAYAARRRDAA
                     VYRGRLEAVKLTGDANVPRGEVSFVVDDLGPGGLIRTETAAPFEGARVVSSRGHIANN
                     GFSSHTYVDSELFLISSDLLAHNWLALGHISYFKRVDIDSLIVPE"
     gene            complement(1672056..1675052)
                     /locus_tag="MYCTH_2308345"
                     /db_xref="GeneID:11507077"
     mRNA            complement(1672056..1675052)
                     /locus_tag="MYCTH_2308345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665001.1"
                     /db_xref="GeneID:11507077"
     CDS             complement(1672334..1674616)
                     /locus_tag="MYCTH_2308345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665049.1"
                     /db_xref="GeneID:11507077"
                     /db_xref="InterPro:IPR000572"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005066"
                     /db_xref="JGIDB:Spoth2_2308345"
                     /translation="MITPTPNPFTGRALRDFGRRHFAGQAICRPVRVQPRNLHISVPR
                     ASKNGTGRTPHPELPTARRLPFQARAAPLSVLLGGGLVASFLAYSQFGEESRALQGAA
                     PASTDDRDPSLPRFRLADVRKHDGSSSEPWVIFEDKVYDITDWVPAHPGGDVILRAAG
                     SSIEPYWNIFTIHKAPHVREILQQYLIGFIDVADLGPDGRPAAEAIEDPFVNDPVRDP
                     RLITHTEKPRNAEPPNEELDRAFHTPNELFYIRHHMWVPTVDAEKADEHVLSIELPDG
                     ETKKYTLGDLKKKFPTHKVTAVLQCSGNRRNDMTRHAGKTNGLQWGVGAISNAEWEGV
                     RLSDVLADAGLKVRDATSPTRKGTSAASGDNELDANTLHVQFTGLEAYGASIPLNKAL
                     DPRGDVLLAFGMNGETLPRDHGFPLRAVVPGHVAARSVKWLSKIIVSDEESHSQWQRR
                     DYKSFGPNEGPNPDWDRAVSIQEMPVTSAITGVWVGDCVRKGRVPWMNPSRIPQPAKS
                     SSSPILDMAAVSKRVGFTPEPTSSDTTTTTTTTNNNNNNEKNLSPSPCPPTTPADEPI
                     AMQGYAYSGGGRAITRVDVSLDGGKTWDQAELVNDCADPASPCFGNKSWTWTRWRYVG
                     ALPVLSLPTEEGPAPAAGGGAEETGAGGCHGGDRKTSRKHCTTLVVKATDDAYNTQPE
                     SHRGIYNVRGNLATAWHRVKICPRCTGPSEDGTSDGRGLTWSTGETYGCGFKKEAEEV
                     REGMRRQGVVGNGNGGEEKK"
     gene            complement(1675698..1680231)
                     /locus_tag="MYCTH_2308347"
                     /db_xref="GeneID:11507078"
     mRNA            complement(join(1675698..1676526,1676583..1678011,
                     1678070..1680231))
                     /locus_tag="MYCTH_2308347"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665002.1"
                     /db_xref="GeneID:11507078"
     CDS             complement(join(1675869..1676526,1676583..1678011,
                     1678070..1679624))
                     /locus_tag="MYCTH_2308347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665050.1"
                     /db_xref="GeneID:11507078"
                     /db_xref="JGIDB:Spoth2_2308347"
                     /translation="MNRSKGRQDQGDSGAQQLPDVFHTPLGGFSSGTNERWLPLYGYQ
                     GVVWFRADLLYTFVDAVDRLLCLDNRAGVTYSLYLLDKRKDYTAQSERDEFLSDLEGN
                     GVTIWATGPGDYSNDMVAWEWIVDRLGAVEDESEARQKVLFVAGPGDPIPWTWQPDES
                     HRVLKVSLSWTEIPKMNRPDIAYLRMPENPEDVVHTNEYGPWIASVCRVLAAGRIPGR
                     PGYPAIPDAWFTVGGHGAGDQEIGTYGGQAFLPQLWDIVVAKWRDDPGSLLELKARTG
                     PEDEAKVSDRWHLFVPGLACPYEKQYVLHDEVDDVGLVRRRILDLVRCSASHESYSKL
                     QSLEVYLPGTGFSLVTVEGPELVVSLTGRDDVDSAFQPLVDRMVRWRKWLESKPGVPP
                     VTNGLGLFPQFLSIRPVFERYTIRDEGEIHEPVVWNPDTTTVARFRILAGRILAMLSN
                     RTYSSAAAWIAITQSRSTEQAGGGSDPERSRPRLLISPGTTEEEWQLIRRMIVNPEVF
                     ISQLDTRTLPRFGDLNTEQPFGYRDVYETPDPLLYHAIDPDQIPATKRHYDWQSAEED
                     VSEQLKTLQPWEIQPESLSTLYAFENFPLRPPPGTKLPQIEQTLQHPEEQYLEAQAKA
                     AAATSAQMPQSSLNNPSFRPTTDIQRGQRLREYSYAHPLDVHMHMSVPINAPPVDRLL
                     DLGHNSVPVVSLSVLTPTEVRRLQQDYHKMRNLALSRIERCPYPGCDAAYPANQQSAM
                     EQHLKEKHVAEKCNFCDEPLFAHWPPQQKYKHIAQRHSDILRSILSQEQDAVVQVPDT
                     GRTDRAREGRWNFCSRCGRDHTVLDAPADRQHHDNVCYPGVQDQEQDWAACGVCGDRI
                     TLPDASLQGHDEHREAAPGEKPFCEKCAIPLGLFSRAYATRHGNFCKGHGRDNAQFCP
                     WCSIQLADDFDARLKHIDGCARKPFPNAEGPIDAARRAYFLPEPSRISSARGQMGVQD
                     GKRRKTGNAGEAADEVGRRPAKKIKVNVPPPRPRTRQERSAREPSDSPLSSPPSSSHS
                     KRSAEAWLPPPPPPPPPPPATSPPPPPPATTPAATAPVPARSKAAGKRGKAKGQTRGG
                     QGQKKTPAKAPTKRARAASAGSAATTRKTAAASKSPGGGTPAPAMRTRYRTRASAAAA
                     GPASVTADAEGPAPAGGVSAKAARVVSPYADPLVRGASPARETRTLPARDGRRLTATL
                     RSAGPGTRS"
     gene            complement(1681257..1683203)
                     /locus_tag="MYCTH_2308351"
                     /db_xref="GeneID:11507079"
     mRNA            complement(join(1681257..1681979,1682057..1682288,
                     1682351..1682459,1682529..1682675,1682754..1682797,
                     1682928..1683203))
                     /locus_tag="MYCTH_2308351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665003.1"
                     /db_xref="GeneID:11507079"
     CDS             complement(join(1681484..1681979,1682057..1682288,
                     1682351..1682459,1682529..1682675,1682754..1682797,
                     1682928..1682994))
                     /locus_tag="MYCTH_2308351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665051.1"
                     /db_xref="GeneID:11507079"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="JGIDB:Spoth2_2308351"
                     /translation="MATLLDQLRTLSSVDCDTLDAQVAEQFGPFVDCTSNQAIAFAEL
                     SKVGSDGKPLHRQLIADSLKVAHWQFGKQKDATLEELAVELMMVNLSLRMAPHTTGYV
                     HVQTNPKLAYSAEKTAKNAERIISHFKQLAPDFDTSRVCIKIPSTWEGLQACRELEKK
                     GIATLATILFSLEQTALAAAAGCRYIAPYVNELRVHFDSGYTDPDPALAFTGVAQAYL
                     DSLPDNSDTYDSSGSGSNGGGKRTKVVAASLTSVDQVMQLAGVHHITIPPRLLAELAS
                     TPAASWRGAPAQAARAVGAAGVVAPPAGEVRRGLEAAVRDEALWRMAFTRAEGGRCEG
                     KLAQALSIFADMQERLEEIVRRAERGEEGA"
     gene            1684112..1685975
                     /locus_tag="MYCTH_2308352"
                     /db_xref="GeneID:11507080"
     mRNA            1684112..1685975
                     /locus_tag="MYCTH_2308352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665004.1"
                     /db_xref="GeneID:11507080"
     CDS             1684734..1685894
                     /locus_tag="MYCTH_2308352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665052.1"
                     /db_xref="GeneID:11507080"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="JGIDB:Spoth2_2308352"
                     /translation="MSASLPPDASARLADTAARAPADSLRRTLSALLSLSKPRLTVLV
                     VLSAMVPYALYPVPAFLSPTALAASTPSLSPLTLLFLTTGTALCSAAANALNMLYEPD
                     TDARMSRTRTRPLVRRLLSTRAAVAFAVGCGLAGTAALYLGVNPTVAFLGAANIALYA
                     GAYTPLKRLSAVNTWVGAVVGGIPPLMGWAAAAGESATGDGTWRELLFASDGSSLGGW
                     LFAGLLFAWQFPHFMPLSWGIRDEYKAAGLRMLCWTNPARNARVALRYSLVFFPLCLG
                     LCAAEVTEWSFALTSLPVNAWLVREAVMFWRYEGHKGSARSLFWASVWHLPVIMVLAL
                     AQKKGMWARVWKSVAGEPDEEEDEFDYDEDEAAEWVEHARPGNVGPAVGTRR"
     gene            complement(1687788..1689283)
                     /locus_tag="MYCTH_2308354"
                     /db_xref="GeneID:11507081"
     mRNA            complement(join(1687788..1688538,1688607..1689283))
                     /locus_tag="MYCTH_2308354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665005.1"
                     /db_xref="GeneID:11507081"
     CDS             complement(join(1687954..1688538,1688607..1689077))
                     /locus_tag="MYCTH_2308354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665053.1"
                     /db_xref="GeneID:11507081"
                     /db_xref="JGIDB:Spoth2_2308354"
                     /translation="MSYYQNPRQQLSGFYGDLSTTGAGGIPMPGYDPYAVNAVPPLQI
                     PTTGTAIGGPVGGALPTQHRASSGAWNQEDDRTLLTLRAMGKNWNQIQREAFPGKTGN
                     ACRKRHERLMERRGQNDFDNRKLERLCKEYMSMRKEIWQPLASRCGEKWNVVEMQCMS
                     NGLKNIQSHARAYARRERLESGQPLTTYGDPDGALDCLTPVDDVDVADQSYSSPETGG
                     STTGTHSTPGGSSGSAGSAAGYLSSHHHSAHAHHHSQAAAAAGYGHGYGAPYGHHQHQ
                     QQAQAHHGHGYSNSVSSTGTVGGYGTASQQAGAASAGSASGSASQGASPYLGHSGRLP
                     SVGDMGIDAIMNRGQGS"
     gene            <1695213..>1697452
                     /locus_tag="MYCTH_96047"
                     /db_xref="GeneID:11507082"
     mRNA            join(<1695213..1695423,1695533..1695755,1695870..1696010,
                     1696116..1696524,1696638..1697198,1697282..>1697452)
                     /locus_tag="MYCTH_96047"
                     /product="sugar transporter"
                     /transcript_id="XM_003665006.1"
                     /db_xref="GeneID:11507082"
     CDS             join(1695213..1695423,1695533..1695755,1695870..1696010,
                     1696116..1696524,1696638..1697198,1697282..1697452)
                     /locus_tag="MYCTH_96047"
                     /codon_start=1
                     /product="sugar transporter"
                     /protein_id="XP_003665054.1"
                     /db_xref="GeneID:11507082"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_96047"
                     /translation="MGAGGGGDAGAFYDAALKKRQAMMGKSGPSALLKNFRVFRIAAF
                     ACIGGVLYGYNQGMFSGVLAMPSFNSHMGEYTTNQTKKGWLTAILELGAWLGTLLSSF
                     LAEVLSRKYGVLVACAVFMLGVVIQTTAVSAGHNSILAGRFITGMGVGSLAMIIPIYN
                     SEVAPPEVRGALVATQQLAICFGIMISFWIDYGTNYIGGTGEGQSDAAWLLPVCLQLA
                     PAVILFVGMIFMPFSPRWLINHGREEEARKVLSELRGMPPDHELVEIEFLEIKAQSLF
                     EKRSIAEMFPELSERTAWNIFKLQFVAIKKLFQTKAMFKRVIVATVTMFFQQWTGINA
                     VLYYAPFIFQQLGLDLNTTSLLATGVVGIVMFIATIPSVLWVDRAGRKPVLTIGAIGM
                     ATCHIIIAVLVAKNINQWAEQRAAGWAAVCMVWLFVIHFGYSWGPCAWIIVAEIWPLS
                     TRPYGVALGASSNWMNNFIVGQVTPDMLEGIPYGTYILFGLLTYLGAAFIWFLVPETK
                     RLTLEEMDVLFGSEGTAAADYERMEEINNEIGLNQILRGEGRVTAPSTSDAEKPKGAE
                     QMETV"
     gene            complement(1698361..1701847)
                     /locus_tag="MYCTH_2308360"
                     /db_xref="GeneID:11507083"
     mRNA            complement(join(1698361..1701608,1701681..1701847))
                     /locus_tag="MYCTH_2308360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665007.1"
                     /db_xref="GeneID:11507083"
     CDS             complement(1698530..1701331)
                     /locus_tag="MYCTH_2308360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665055.1"
                     /db_xref="GeneID:11507083"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Spoth2_2308360"
                     /translation="MQELFERIQERSDEKITEVSLSYLEIYNETIRDLLVPGGSKQGL
                     MLREDSNQAVTVAGLTSHHPKDVQEVMDMIVQGNEYRTVSPTAANAVSSRSHAVLQIN
                     VAQRDRNADVNEPHTMATLSIIDLAGSERASATKNRGERLMEGANINKSLLALGSCIN
                     ALCDPRKRNHVPYRNSKLTRLLKFSLGGNCKTVMIVCVSPSSEHYDETQNTLRYANRA
                     KNIQTKVTRNVFNVNRHVKDFLVKIDEQMALINELKAQQKDAEKTFFAKFRKQMDKRD
                     AVVREGILRLRAAYDNASSERQEKVNLMKKLKAIERRIGLLSAWIAAFDSVCDARGDE
                     EAMPTNLAAMRKTAHGILMELESSRHHIHQRLERANWERVLDIALNHSISQLPTGDGI
                     VDGSERDTLAREVEMLKASFMRDAYREVLEQDKAGDAAVVQVLLNAQFDILSSLSETL
                     GMSEEEAVAKAKTMVNRLLETGYSAASHVVKPDGSSMMPVEPFSPSKRGTPKRKKSLS
                     INTKPISGPILAATRQALTSPVRASPRRRKVAARKSVSFTPVKKKHGVRWRDDESEQG
                     TLADYEKTPKKFDSPSESSPEKSLPPQPPVPSYLNQTDSPQHSSPNLNPPDVSSLSLG
                     KPNRFQAGFLSKTRASQQNNDSADGSPVPPTLSLNLAGSSDTEDRPSPLRSLPVSRAT
                     NSLSPPAAGTNGSPKPSASMLSTLSENSRNENEPPRRASPSSRLPRVSTGSVSGSDSE
                     LDPLKIRSALQLAKRRERLSLLSGTPASVGRRVSSVGSNPSGVGGINLGGHRRASASY
                     SGPAHAHASTSNGISRHRRGSTERGSRRSPPRPIPITCSPPSASASGSGVGSSPSGAS
                     GRYQDGSSFLGGPGRNLTPGQARRMNLGGSLRMERGGSPSAVVKGAGGASAEDGSASA
                     GVGGKARRITIGAGPGGVF"
     gene            complement(1703091..1706714)
                     /locus_tag="MYCTH_2308362"
                     /db_xref="GeneID:11507084"
     mRNA            complement(join(1703091..1704341,1704461..1706195,
                     1706304..1706714))
                     /locus_tag="MYCTH_2308362"
                     /product="glycoside hydrolase family 115 protein"
                     /transcript_id="XM_003665008.1"
                     /db_xref="GeneID:11507084"
     CDS             complement(join(1703155..1704341,1704461..1706195,
                     1706304..1706612))
                     /locus_tag="MYCTH_2308362"
                     /note="CAZy_ID 267946"
                     /codon_start=1
                     /product="glycoside hydrolase family 115 protein"
                     /protein_id="XP_003665056.1"
                     /db_xref="GeneID:11507084"
                     /db_xref="JGIDB:Spoth2_2308362"
                     /translation="MLTAGVKGALWLAFGSVVAALGQESIISTNAHGAHFQIAGGHVG
                     KGQILVSSNDYWGVIRAAGDLAVDFGRVTGTNYTLSNGERNAAPATYTYHPVNNKNNT
                     YYSTTGTANFTGPAYADPDPEKVVIIAGTIGHSKVIDKLIASRSLDVSRVKGKWESFT
                     SQLVKNPVPGCKQALVVAGSDPRGTIYGIYDISEQIGVSPWYFWADSPPRKHKNLYVT
                     TKKKVQGPPSVKYRGFFLNDEQPALTNWVASHWQDTPYGPGYGAAFYGLIFELLLRLR
                     ANYLWPAIWATMFEVDDPANQPLADAFEVVIGSSHTEPLMRAQNEFGHFYEGPWAYNL
                     NNKTIDDYFRYGVQRAKPYARNSLWTMGMRGTGDTAIEGLGVEYIVEMLQTLVKNQRQ
                     IMAEGLGIKDITTVPQMWCLYKEVMSYLSAGLQVPDDVTLLWADDNWGNVRRLPLRNE
                     TQRHGGAGIYYHFDYVGGPRDYKWINTIQLTKTAEQMHMAYARGADRIWIVNVGDMKA
                     LEIPISHFFDLGYDAERWHVDSTREWAEAWAAREFGPARAREIADVMMKYGMYAARRK
                     YELVEPWVYSVINYNEAEAVLQQWAELVADAQAIYDELPAEAKPAFFQTVLHPALAGE
                     IVHQINVGGARNMLYAGQKRNAANKAIQDVLAYSAADANLTRRWDALLDGKWKHFMDQ
                     THLGYDGYWQQPMRNALPPMVYVQTDFTSLAGEIGIGVEGSNATVKGDDRWHANSGND
                     LTLPPLDPYGPATRYIDIFSRGSEECSWTLSSSKPWLKLSQSTGVVGPNRPDTRVLVS
                     VDWKSAPPAPYSETVQINITTQCTGMDRYGFGDPHVLVPVTVRGVPKSFKRGFVESDG
                     TVAFAAEHYSRIVEPASKGNGKGKGKGNDEDVTYHTFASYGRTSSGVGLVPLGAEKLA
                     REEAPALEYDLYLFTNTSAANVTLYLSPALNYLGDATPLEYAVALFPASSSSGPSPED
                     DDDAVAVKHVQPVGATEGGNMPRGWDGAVADGVWGLTGGYTTSSFEVAREGAYKLRVW
                     ALMPGVVVQKVVVDLGGVRPSYLGPPESFLVGRDRIGARNGTSFLG"
     gene            complement(1707874..1709961)
                     /locus_tag="MYCTH_71014"
                     /db_xref="GeneID:11507085"
     mRNA            complement(join(1707874..1708093,1708152..1709051,
                     1709130..1709506,1709608..1709706,1709761..1709961))
                     /locus_tag="MYCTH_71014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665009.1"
                     /db_xref="GeneID:11507085"
     CDS             complement(join(1708467..1709051,1709130..1709506,
                     1709608..1709706,1709761..1709827))
                     /locus_tag="MYCTH_71014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665057.1"
                     /db_xref="GeneID:11507085"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_71014"
                     /translation="MGKKKRGHPDIEELLARPWCYYCERDFEDLKLLISHQKAKHFKC
                     ERCGKRLNTAGGLSVHMNQVHKETLNCVENALPNRQGLDVEIFGMEGVPEDIIQQHNQ
                     RIIQNFYTAQAERQAATGNPPRGSSGGQGPTKKIKYETPEEIKKRLAEHRAKLAAQKA
                     AGANGVPATAAPANGPSPAQGTSPFPAPQPGYPYPAPPGGAVVAPYPANQTYPPTAAA
                     FPPGASPPPGATTTAPFPLPARPPSGSAGAPPGAPPGVPPYYYNGAPAGYPAPGVPGA
                     PGSAPGATGAAPSTVDELVANAARQSSGAGGDEIDQMIRMAEAGIKPGAAPAAGKTED
                     AGAGEKKKKGTRMVYGDTEVSPEEKMAMLPRYRWVEEAAAA"
     gene            <1711636..>1712601
                     /locus_tag="MYCTH_55982"
                     /db_xref="GeneID:11507086"
     mRNA            <1711636..>1712601
                     /locus_tag="MYCTH_55982"
                     /product="glycoside hydrolase family 62 protein"
                     /transcript_id="XM_003665010.1"
                     /db_xref="GeneID:11507086"
     CDS             1711636..1712601
                     /locus_tag="MYCTH_55982"
                     /note="CAZy_ID 267829"
                     /codon_start=1
                     /product="glycoside hydrolase family 62 protein"
                     /protein_id="XP_003665058.1"
                     /db_xref="GeneID:11507086"
                     /db_xref="InterPro:IPR005193"
                     /db_xref="JGIDB:Spoth2_55982"
                     /translation="MRPTRPGIVLLATATSVAGQSCELPSSYRWTSTGALAQPKSPWV
                     SLKDFTVVPYDGQHLVYATTNDGTNWGSMGFSLFSDWDAMGSATQTGMSSSAVAPTLF
                     YFEPKNVWILAHQWGPTAFSYRTSNDSTNPNSWSQPQPLFTGTISGSSTGPIDQTLIG
                     DDQNMYLFFCGDNGKIYRASMPIGNFPGNFGSESTVVMSDSTNNLFEAVQVYKVNGRQ
                     QYLMLVEAIGAQGRYFRSFTATRLDGEWTPNAVSEASPFAGKANSGASWTNDISHGEL
                     VRLSADQTFPIDPCNLQLLYQGRDPSSGGDYNRLPYRPGVLTLQR"
     gene            complement(1713132..1715289)
                     /locus_tag="MYCTH_2095026"
                     /db_xref="GeneID:11507087"
     mRNA            complement(join(1713132..1715022,1715078..1715178,
                     1715233..1715289))
                     /locus_tag="MYCTH_2095026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665011.1"
                     /db_xref="GeneID:11507087"
     CDS             complement(1713622..1714755)
                     /locus_tag="MYCTH_2095026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665059.1"
                     /db_xref="GeneID:11507087"
                     /db_xref="JGIDB:Spoth2_2095026"
                     /translation="MDSTMDRLLARKKSSSNLSWERSNLTLSSTPSDQKPREEKSAPY
                     RDQRYETLLELKGNSYMAKDPLGLSSASKDLCRSLLEKPQPVPSDTLFRDDIFETTCQ
                     KIHNRNESRVIRDISRLIVPSAESLATFGAKHLNILTESVNEGWNNSIPITTPRPQPD
                     YSVGFRRDAFTEDQLAKLSPFIGDFITGDQSFFMATYYIYFPFLTCEVTALDIADRQN
                     AHSMTLAVRAVVELFRAVNRENEVNRKILAFSVSHDHRSVRIYGHYPVITRKDTKYYR
                     HPIHTFDFTALDGKDKWTAYRFTRNVYDVWMPKHFENICSAIDQLPSDLDFVPPLSGA
                     TGLSQDLGNLMSEAGSASEHAAQQGVTPDTSFTVPEGGKKRKR"
     gene            <1716317..>1717134
                     /locus_tag="MYCTH_96041"
                     /db_xref="GeneID:11507088"
     mRNA            join(<1716317..1716493,1716887..1717047,1717095..>1717134)
                     /locus_tag="MYCTH_96041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665012.1"
                     /db_xref="GeneID:11507088"
     CDS             join(1716317..1716493,1716887..1717047,1717095..1717134)
                     /locus_tag="MYCTH_96041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665060.1"
                     /db_xref="GeneID:11507088"
                     /db_xref="JGIDB:Spoth2_96041"
                     /translation="MVSEDSSLDVGKKTLLEKGFVHWEDPGLGENISMMAQKGSAFWT
                     LDGLDFCMQNVLYEALLGKGSEAKYYGGSHLVDLPVEKTGYNFYSTPRPALDQAGLVG
                     DDIKFKAGGGVVIFDALLRLEIK"
     gene            complement(<1717390..>1718394)
                     /locus_tag="MYCTH_2067839"
                     /db_xref="GeneID:11507089"
     mRNA            complement(join(<1717390..1717763,1717911..1718028,
                     1718068..>1718394))
                     /locus_tag="MYCTH_2067839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665013.1"
                     /db_xref="GeneID:11507089"
     CDS             complement(join(1717390..1717763,1717911..1718028,
                     1718068..1718394))
                     /locus_tag="MYCTH_2067839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665061.1"
                     /db_xref="GeneID:11507089"
                     /db_xref="JGIDB:Spoth2_2067839"
                     /translation="MQLQLLSALFLFGTGIQALPASAAQDQTTSISSSTCTTSSSSSS
                     STATPTPYDFTAGAVPSYPIHPSCNSTLRRQLERALDETVALAAHARDHILRWGVDSP
                     FVQKYFGVLLASTAAPLGWYSRVVAADKGGMTFRCDDPDRNCETQDGWAGHWRGENAT
                     QETVICPLSFSKRRWLDSVCGLGYTVAGSPLNTFWATDLLHRVLHVPRISEGVVEHYA
                     EDYEGVLELAATDPARSAIDSNTLQYFAIDVYAYDIAAPGVGCTGKPEKSEESD"
     gene            <1720200..>1721461
                     /locus_tag="MYCTH_2119925"
                     /db_xref="GeneID:11507090"
     mRNA            join(<1720200..1720227,1720285..1720703,1720760..>1721461)
                     /locus_tag="MYCTH_2119925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665014.1"
                     /db_xref="GeneID:11507090"
     CDS             join(1720200..1720227,1720285..1720703,1720760..1721461)
                     /locus_tag="MYCTH_2119925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665062.1"
                     /db_xref="GeneID:11507090"
                     /db_xref="JGIDB:Spoth2_2119925"
                     /translation="MAFAGQNWKERTNWDELCSYATELNHGLCCHLLPDLTNGLHHVA
                     RVLEFEDGSRWLARIQMAASTKTTAAKLQNEIDAMMLIRERTRIPVPRVFGYRIDDNH
                     SIGCAFSLTEFLPGNVATDFNGGYATHQGQIPAQHRKNFYRSVARIHVQMASLRFHKI
                     GTIVRAEDGSYTVGPFTDIGGPFDTATDFFEAWADYAKFPLSPDKIRKSMQGGPVEEV
                     LTSILEFPSTVRAMAHQLSSSDQGPFPVVHADFFHSNIIVDQGYNILGVIDWEGACTV
                     PWELVEFPLFLEIVPRPMDAPWNYDDENGQPLDEGTRLRWQERSEYTQMVAEAEKSEL
                     TDSKLSETLADQRAQNLAYALRVYRNPGKLGFYTKIFQKEELKDEQAE"
     gene            complement(1721406..1723067)
                     /locus_tag="MYCTH_2308372"
                     /db_xref="GeneID:11507091"
     mRNA            complement(join(1721406..1722116,1722269..1722700,
                     1722801..1723067))
                     /locus_tag="MYCTH_2308372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665015.1"
                     /db_xref="GeneID:11507091"
     CDS             complement(join(1721658..1722116,1722269..1722700,
                     1722801..1722833))
                     /locus_tag="MYCTH_2308372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665063.1"
                     /db_xref="GeneID:11507091"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2308372"
                     /translation="MVSIKTVAVLGGTGNLGPAVIRELVASGFAVTAVTRAEGGAGAR
                     EVPAGVAAVKSVDYGSLDDLTAAFQGQDAVVSTVATAAVGGQRLAVDAAVAAGVKRFI
                     PSEFGINTRKVRDTPIGKILAGKIAIVDYLEQVAAKGSGLTWTGVSTGLFFEWGLERG
                     GLGIVNLKDKTATVIDSGDEKWYASTLAQIGRVVAGILKSPDETANKYLSTASFNLSQ
                     NELIALVEELTGSKLSVTKVSSADLIRAGEEKLTAGNFGAFLDLLRAHNNADGAGNGL
                     PEEQSDNGLVGVPYEEVRASVEEWLRREGVL"
     gene            complement(1723561..>1726566)
                     /locus_tag="MYCTH_116956"
                     /db_xref="GeneID:11507092"
     mRNA            complement(join(1723561..1724167,1724251..>1726566))
                     /locus_tag="MYCTH_116956"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665016.1"
                     /db_xref="GeneID:11507092"
     CDS             complement(join(1723991..1724167,1724251..1726566))
                     /locus_tag="MYCTH_116956"
                     /note="Contains conserved domains: pfam02940,
                     mRNA_triPase, mRNA capping enzyme, beta chain and
                     pfam09770, PAT1, Topoisomerase II-associated protein PAT1
                     Members of this family are necessary for accurate
                     chromosome transmission during cell division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665064.1"
                     /db_xref="GeneID:11507092"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="JGIDB:Spoth2_116956"
                     /translation="MDLRGMLNDNVPPANPPTLPPQLQQPTQRPSQQPTLPSTPVQAK
                     PPQSFRDYSQTQLSPGLHASHDYGAHHAPSGSFASPSQYQAPHSISYASRPPPQLQQA
                     SSSDLRSPSLGSGSAASPYRQTPSASMNSASGYSFPSQHNPTSPVQRHQYPPTGAYHR
                     DSYPQSAASAGMTGPPNASPYVQGSHIPQTPPVATPGTGHSYLHRTQSMQSTPTPASA
                     HSQSAQYGAPFAQGSPVAAPRPLQQPEPYQRQSSQPPTPGGAGPLSARPAQVSGYGPP
                     SPYQQRLPGPGIHSTSHNTSPPPPPPPSLPRHLNSQSGQDSHSQDSARVPQQQNERER
                     SLSVSPKTRVPSLPSSSGRPGTSVSEPEPRPNQAPPAPTMIERAATPAKRKLDDRELR
                     PDELEKRETRPPPFENQNGRAAAPDADASAQRPAMPTKTTKKRTVYRTIPPWAQSLKD
                     RAPAHPNRVLYQPIPHTGPHINGKADRPFARPERMQSRHASPEEKRAAGPITPAPSIP
                     PDAGIQWGLLGPWEASITNSVPQEQFSKAIADFLFQYVILNEDMGEIQSRGVKFEVEA
                     KLGMLIDKDTNKRVRLPVQSECVLSDGGNWLGFRSSMTEHQHKSFNEFLNFLVQQTHP
                     ANKANAALPRPRLPIDYRHRHEVDRFFELPASVRDRLLPVCVAKPIASRGHGAKVRVT
                     YDQKTNKVIGKIVKARIADMSLHFPDLPLDCRISINLEMDWDGTVEELERMASSTGRP
                     PTPARMKDRLSYKHGCYQIDLTQVTQNVTGVGNTQRTEKEHELEVEVDPAPIIEQGRR
                     AMEGQPHQYVDVVDGLVNNIRILARKAREFGA"
     gene            1727820..1731928
                     /locus_tag="MYCTH_2308377"
                     /db_xref="GeneID:11507093"
     mRNA            join(1727820..1728148,1728205..1731148,1731213..1731928)
                     /locus_tag="MYCTH_2308377"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665017.1"
                     /db_xref="GeneID:11507093"
     CDS             join(1728009..1728148,1728205..1731148,1731213..1731626)
                     /locus_tag="MYCTH_2308377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665065.1"
                     /db_xref="GeneID:11507093"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="JGIDB:Spoth2_2308377"
                     /translation="MPGLVSATGVLGFLADEEPELKVFALKTLNDDIDTVWTEVAGAL
                     SQIEALYEDESFPERQLAALVLAKVYFHLQDYNESMTFALAAGPLFKLDAPGEFEETI
                     ISKCIDQYIAVSSSRHTPAKLSKNDIELPALATTFGSGSLDGSALISATTPFSQSTLP
                     SKSLLSRNSVDNTILDPSFQPTKEGRSASVAQITDQSTWTALESVIERLFENALAEGK
                     YRQVVGIAVEAKNLDVLRRVIKRASEDGKRDKTKAQEGAQGPAEDLMDYALTICMDIV
                     QERGLRTEMLRLILDLLNDIPNPDYFAIAKCVVYLDSDEEASSLLMQLITRGDKSAIA
                     TAYQIAFDLYDNGTQEFLAKVIKSLPSGELPKKKEAAQGGEGARESDPLLENQENSEE
                     ELPEEVAKVYRNVRSILDGSMTIRLNLEFLYRNNHTDLSILNRVRDSLEARNSIFHTA
                     VTFCNAFMNAGTTNDKFFRDNLEWLGKAVNWSKFTATAALGVIHRGNISQSRKLLEPY
                     LPKQGGVSSGSIFSQGGALYAYGLIHANHGADALEYLRTMFNAADEEVIQHGGALGLG
                     IAGMACGDEQIYEELTKVLFADSALNGEAVGLAVGLIMLGSGNAKALETMFTYAHETS
                     HEKIVRGCALGMALIMYGRQEGADSMIEGLLNDPDPTLRYGGILTVALAYCGTGSNKA
                     VRKLLHTAVSDVNDDVRRIAVMSLGFILFRKPGSVPRMVELLAESYNPHVRYGSAMAL
                     GIACAGTGLDEAIDLLEPMMKDPTDFVRQGALIALSMIMVQQNEAMNPKVATIRKTLK
                     KVVGDRHEDAMTKFGAALALGILDAGGRNCTIGLQTQTGNLNMAGVVGMAVFTQYWYW
                     FPFTHFLSLSFAPTSIIGLDHDLEMPNIKFYCATRPSLFDYPPEQEVKVEEGPALVTT
                     AILSTTAQAKRRAQKKERAQRRESMDIDTPTVTKIPAPSGDKMEVDEEKAAKADEQKE
                     KEGEAGADKDGSAGPDAKKKAEKEKVGYEIENMSRVLPGQLKYISFPAGRYKPVKKPT
                     GGPILLHDTQPDEPKTLVEEKLKKVATERAPIAGATTGAGATPRNAAQSLLSNWSSRA
                     MGGGGGMPELNELLQLTARGAEGRAGQVGGGAAADSGSGAAAAAGVLTAVDEDNEGDE
                     EAPAPAEFEYFTDADEDEE"
     gene            1732475..1734102
                     /locus_tag="MYCTH_2308378"
                     /db_xref="GeneID:11507094"
     mRNA            1732475..1734102
                     /locus_tag="MYCTH_2308378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665018.1"
                     /db_xref="GeneID:11507094"
     CDS             1732814..1733848
                     /locus_tag="MYCTH_2308378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665066.1"
                     /db_xref="GeneID:11507094"
                     /db_xref="InterPro:IPR013897"
                     /db_xref="JGIDB:Spoth2_2308378"
                     /translation="MAHKYVIRVTAGPDYDLSSHIEVPVNSAEPVHIASDLVDADLCV
                     RVQSYRGLPRGAPKSSPYFDAEPHRDNGDQYSIAMRFQLKRPPTVPDQPLTNGEEEEE
                     EDGGGEAAADEAGLAEDGEEEEKKKKTEADTEEQRPAGVLGTDLQFGNDLDHPIRDRL
                     PPGFGTAMNIVKWWIDPGLEGDPYADAPYLYGPALSSFNVVHVGEGEQDEARGGLWFE
                     EGGDEAGAEWRRRIGAPEDARQRMKWALKAENKEKWTWEYGRTYGVDFFNPYIDFNDF
                     ALRLPGFNLPIIKYWDGQGLRYAASYVFFLLLALLLVFRFTRHHATHYLRNCALRDCF
                     SNKRNNSYKL"
     gene            complement(1734103..1737037)
                     /locus_tag="MYCTH_2308380"
                     /db_xref="GeneID:11507095"
     mRNA            complement(join(1734103..1734375,1734470..1737037))
                     /locus_tag="MYCTH_2308380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665019.1"
                     /db_xref="GeneID:11507095"
     CDS             complement(join(1734358..1734375,1734470..1736218))
                     /locus_tag="MYCTH_2308380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665067.1"
                     /db_xref="GeneID:11507095"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308380"
                     /translation="MMMKKKNRSKNNSDSLPAPPNLEPYSDPQTWPSSRKYLLLILAC
                     IGTWQTAYTAGAYSPPQYLIQAGLAGHPSIEAVLTGITTFCLGFAFAPMVLAPLSEMN
                     GRYPVFVAAGVVYVAFQAACALVSTLAGMLVARLLVGVGASVFSTMVGGVIADMWDAR
                     GRNTPMALFSGSVLAGTGVGPLVGAVMAQRMADAGRWRWIFWHQVIMGGAMMLFVVVF
                     FRESRGSVLLSRKARALNRWYEELEEHGYFGVWVAEDGSLGDGSPPLGDAADEEKGPA
                     SALEQGRTARRLKRIRWRVKEDEERASLGQMIATSVSRPFHLLFTESVVFFFSLWVAF
                     AWGVLYLTFGSIPLVYQRVYGWSLEDAGYIFVSLIVGAVFATAIGLWQDRLLYHPKWA
                     ASPASGNAVDINNSSETSDDSSNKHVSSSSSSSSPPAAATSSLSDRILAFLRRRFPAS
                     APESRLYFTCITSTFLPIGLFIFGFSSRPDTHWIGPAIGMVLATMGILSVYLAVFNYF
                     ADTYHKYASSALAAQSFCRNVLGGAFPLVTRPLFTNLGPARAGAVLGSIGTALTVVPW
                     VLVFFGDKIRARSPFASQSTSA"
     gene            complement(<1737939..>1739132)
                     /locus_tag="MYCTH_55568"
                     /db_xref="GeneID:11507096"
     mRNA            complement(<1737939..>1739132)
                     /locus_tag="MYCTH_55568"
                     /product="4-O-methyl-glucuronoyl methylesterase"
                     /transcript_id="XM_003665661.1"
                     /db_xref="GeneID:11507096"
     CDS             complement(1737939..1739132)
                     /locus_tag="MYCTH_55568"
                     /codon_start=1
                     /product="4-O-methyl-glucuronoyl methylesterase"
                     /protein_id="XP_003665709.1"
                     /db_xref="GeneID:11507096"
                     /db_xref="JGIDB:Spoth2_55568"
                     /translation="MVHLTSALLVAGAAFAAAAPMNHIFERQDTCSVSDNYPTVNSAK
                     LPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRV
                     TVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSR
                     GQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCSRNGKG
                     AFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFD
                     PHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPN
                     NMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAG
                     APTLA"
     gene            <1740925..>1742073
                     /locus_tag="MYCTH_96032"
                     /db_xref="GeneID:11511470"
     mRNA            join(<1740925..1741025,1741243..1741817,1741914..1741963,
                     1742035..>1742073)
                     /locus_tag="MYCTH_96032"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003665020.1"
                     /db_xref="GeneID:11511470"
     CDS             join(1740925..1741025,1741243..1741817,1741914..1741963,
                     1742035..1742073)
                     /locus_tag="MYCTH_96032"
                     /note="CAZy_ID 268067"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003665068.1"
                     /db_xref="GeneID:11511470"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_96032"
                     /translation="MALQLLASLALLSVPALAHGGLANYTVGDTWYRGYDPNLPPETQ
                     LNQTWMIQRQWATIDPVFTVSEPYLACNNPGAPPPSYIPIRAGDKITAVYWYWLHAIG
                     PMSVWLARCGDTPAADCRDVDVNRVGWFKIWEGGLLEGPNLAEGLWYQKDFQRWDGSP
                     SLWPVTIPKGLKSGTYIIRHEILSLHVALKPQFYPECAHLNITGGGDLLPPEETLVRF
                     PGVYKEDDPSIFIDVYSEENANRTDYTVPGGPIWEG"
     gene            complement(<1742342..>1747125)
                     /locus_tag="MYCTH_54167"
                     /db_xref="GeneID:11507097"
     mRNA            complement(join(<1742342..1742680,1742732..1744785,
                     1744840..1745731,1745794..1746454,1746563..>1747125))
                     /locus_tag="MYCTH_54167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665021.1"
                     /db_xref="GeneID:11507097"
     CDS             complement(join(1742342..1742680,1742732..1744785,
                     1744840..1745731,1745794..1746454,1746563..1747125))
                     /locus_tag="MYCTH_54167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665069.1"
                     /db_xref="GeneID:11507097"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_54167"
                     /translation="MASSAAAHGSRRPPTRPIISADRNHHRIIQLDDFSSHIASAEQQ
                     PPPAGPVSAAAKSSFKHLFTFTPARHIPLVALSFTTAALVAAGRTAYAVLLGRIFDVV
                     TRFGTGLLSPADFLAQISQWAVWLCVLGAGMWVVSTVDAAAWVVGGELRARTARREVF
                     WRFLMGKEVGWFEAREEGVGGLTASVATQTRELQTATSQTLGYIVCDVFVFAACLVVA
                     FVYSYKLTLVMLATGVPSALILWRISRFLDPAIEAQKRELAQAAKYVTAASTAIDLVK
                     VYNAADHEAFNFTSAIRRSARYYSRQAMCNCGQMGYVKLWMITLFVLGFSFAVVQVKN
                     GELSPGDALTTFYAALIAFQSIEMLGPHWLVLAKGMAAGQLLRGLVDESGSGQLERTA
                     GCLKPSGCRGIIEMNNVSFAYPSNFARAVIRPSNLRFEPGRLTFVIGRSGSGKSTLGS
                     LLVRFYEPLTGQIMLDDNPITAFDLNWLRQNVTLIQQSSSIFGDSFFKNVALGAMEPD
                     NVPLDAVQSACSMALLQSTISSLPNGLDTTIGPGGYGLSGGQRQRLALARAKLRDPPV
                     LILDEITSGLDPVSRNLIMEGIRAWRKDKTTIIVTHEVGDIKDDEYVYVLADGSVAQE
                     GLKREVAKDESGLFASFVASAETACSGTDSETESETESESDSSDDGPLQESQYARSPR
                     GALISNQRMPVGLFQRISLGPRATIAQESICRSITHKMATDDEPVTVNISRPSSIRII
                     AQQGLAAQRSRTLNARQALRTDLDPELQVSLDSLDRFFLEHLAKPRGRESPSKGTQLP
                     SLAAILKTVWPTLDRTGKAQLIAGIALCLVVAGSNPVFSFFFANLIGQFWNMEGQESS
                     VPKWAGLLAAIAAIDASATFFGYFLMEQVAQKWVNNLRAEAIKRILRQPKSWFDRANH
                     SPARITQCLDRNAEEMRKLAGMFVPLLLTISTMMLSSLIWALVVRWDLTLVTLAGVPV
                     VIAAARANSLTSDKWEAACDQAAAATNAIFSEALANIRVVRALTLERYFSNKFSRSAA
                     ATYHLGVKRAGFIGFFYGLHQSIVFFLTALVFFYGAKILGEEGTTVTDVVRVINLLLF
                     SLGTAVAMLGNVPQIAAAKATAVQMLYYANLSHAASHESRGERRLFTPLPVRMTNLRF
                     AYPSAPQTQVLRNINLQFDAGTCTAIVGASGCGKSTIVSLLLRLYDPLQEETDPARAA
                     HRSESGAPISPTPESPSTPRCQRSSPFPSATATTNTTTNTPPLTYASVPSSHVHTPSL
                     RARIAYVPQTPVLFPGTVRANLTYGLHEGSPLRAEANVVLAAQQAGIHPFVASLPQGY
                     DTPLGGDGGGGIGGGIGGGGPAAVSGGQAQRLCIARALARRPRLLVLDEPTSALDAEA
                     AAEVRRLLRRLVEGGGMAVVVVTHSKEMMRMADRVVMIEGGVVAEQGGYDELMTAPGG
                     KFRALVEGGVWTAGEGGYAEEMEGKGKGKGKRKKKKEKKEKRGAAGWRDVERSREEAL
                     RRLEGKSD"
     gene            complement(<1747611..>1748280)
                     /locus_tag="MYCTH_2025277"
                     /db_xref="GeneID:11507098"
     mRNA            complement(join(<1747611..1747674,1747729..1747765,
                     1747849..1748158,1748224..>1748280))
                     /locus_tag="MYCTH_2025277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665022.1"
                     /db_xref="GeneID:11507098"
     CDS             complement(join(<1747611..1747674,1747729..1747765,
                     1747849..1748158,1748224..1748280))
                     /locus_tag="MYCTH_2025277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665070.1"
                     /db_xref="GeneID:11507098"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="JGIDB:Spoth2_2025277"
                     /translation="MSRPVPNTFQAEQADNLEDIEKQFAVKVVQHMQTYWSILERVKG
                     SSLRLTKLDDEIYEHLKRDFPDFDPAETIDEDKMKSKEGKERWRNFMMAYEKKVDDYN
                     FGTMLRANPKWEYGKDETIFVPRMQFYAVEIARNKLGLNDWIYEQAQKEKASKS"
     gene            1749614..1750976
                     /locus_tag="MYCTH_2315869"
                     /db_xref="GeneID:11507099"
     mRNA            1749614..1750976
                     /locus_tag="MYCTH_2315869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665023.1"
                     /db_xref="GeneID:11507099"
     CDS             1749895..1750920
                     /locus_tag="MYCTH_2315869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665071.1"
                     /db_xref="GeneID:11507099"
                     /db_xref="JGIDB:Spoth2_2315869"
                     /translation="MKYLLECLNPGDKPIRMNSPLYLREAWPVNRLRKPEVWSARSFD
                     SLESVLSSLDSYISACSAMRADVLATLFLTRRFHVVYSPCMGNSTQPAATHYMNKYGS
                     LMASITLEVDFTKLAGSWRPEAVHLDGLRGLDGVKRLVDTFVQSQLTRSSNTPIRDLR
                     VLVRRYHGFRPQTLPAPPSPPPSFSFSSFSSPSSNFSSPSTSPVSTTRSRIASAIRSR
                     LRRRRSTNALASAPSTPPPTPTPTPTTTRWEEYSPAAHVRHALSALPSLGPVVSRLSL
                     SGAPADFSAELAAEWPRRAARAPSGGGKGEGASSPPVLRVDGVVRLGWGGVMRRGGTR
                     GRRRRRV"
     gene            complement(1751410..1752983)
                     /locus_tag="MYCTH_2308390"
                     /db_xref="GeneID:11507100"
     mRNA            complement(join(1751410..1752425,1752508..1752983))
                     /locus_tag="MYCTH_2308390"
                     /product="glycoside hydrolase family 114 protein"
                     /transcript_id="XM_003665024.1"
                     /db_xref="GeneID:11507100"
     CDS             complement(join(1751577..1752425,1752508..1752726))
                     /locus_tag="MYCTH_2308390"
                     /note="CAZy_ID 267959"
                     /codon_start=1
                     /product="glycoside hydrolase family 114 protein"
                     /protein_id="XP_003665072.1"
                     /db_xref="GeneID:11507100"
                     /db_xref="JGIDB:Spoth2_2308390"
                     /translation="MKRAVFLLAAASAIRGSLAQVRVPPNFEVGVKWQIVIQSTIDVN
                     PPLEPADAVVWDLDLYHVARTPEVVSHLRENNPNTILICYFNAGLTQKSDCDYETRWE
                     KSGLLGNVYDPEEPQFDDERWVNIKNQTARDWIKERITLARDVGCDGVDPDNIDGYHN
                     DEDGNNGTGWDLSRDDYVSFVRELAEHAHGLTTKRNYTLLIGQKNAPDLVEDVGDLLD
                     FAVLEDCKSLNGGGGDDDDDNDDNNDDAPFCGEFQHYIERGRPVFSIEYPSTLGDDET
                     GECNAGGASKAQYEASCDASTARGNSDFSTVLKIQGGVGELNGCTQYCDGLQPGTGIV
                     VTATDSELDGNECPPEATGSS"
     gene            1825867..1826778
                     /locus_tag="MYCTH_2308392"
                     /db_xref="GeneID:11507101"
     mRNA            1825867..1826778
                     /locus_tag="MYCTH_2308392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665025.1"
                     /db_xref="GeneID:11507101"
     CDS             1826211..1826747
                     /locus_tag="MYCTH_2308392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665073.1"
                     /db_xref="GeneID:11507101"
                     /db_xref="InterPro:IPR011118"
                     /db_xref="JGIDB:Spoth2_2308392"
                     /translation="MRFSLYMALISTLAAVAECSSFQQQCSKLASKLKIENATAWFSE
                     YVAAGTNMSFPDTDPSCAQGSLVVDVDFCRVAPYVATSHRSGISMEAWLPKNWTGRFL
                     STGNGGLNGCLSYDDMAYTVELGFSTVGAKNCHNGHNGTSGAPFLNNPDVLVVDFAWP
                     SVHTNAVVGKQISEARRT"
     gene            1828003..1829636
                     /locus_tag="MYCTH_2308393"
                     /db_xref="GeneID:11507102"
     mRNA            join(1828003..1828311,1828485..1829636)
                     /locus_tag="MYCTH_2308393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665026.1"
                     /db_xref="GeneID:11507102"
     CDS             join(1828126..1828311,1828485..1829492)
                     /locus_tag="MYCTH_2308393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665074.1"
                     /db_xref="GeneID:11507102"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2308393"
                     /translation="MAPKTPLPPVPTVAETLKHPAYPTATWNLEPDRKGLVPVAEGRG
                     GPFNMSWEIHGVGPIRLILIMGLGGFRTAWQRQTLHFGHERRDRYSVLLIDNRGMGDS
                     DKPLMRYSTSEMALDIVEVLASPDVGWLPSSYPLPPSPPAPAPAPAPERTLHVVGISL
                     GGMIAQELAVVLAEYLSSLSLICTAAVVENTASFAEHMAQRASLILPKSVDRSVADAA
                     RRIFAPSWLALPDDVRLPDPATTPKCKPPRAAAAEGGSGSGSGSGNGGEGEGGGRYLK
                     FETNAQRFVAQELHKRLDPAGRFTLKGFLLQLIAAGWHRKTPAQLAAMADRVGRDRIL
                     VMHGTEDGMISVPHGRKLIDYVRPAKGIIVEGMGHAPLVERWEWFNQVIEEQCLLGER
                     LDGRA"
     gene            complement(1829636..1831878)
                     /locus_tag="MYCTH_2308395"
                     /db_xref="GeneID:11507103"
     mRNA            complement(join(1829636..1830181,1830239..1830815,
                     1830886..1831878))
                     /locus_tag="MYCTH_2308395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665027.1"
                     /db_xref="GeneID:11507103"
     CDS             complement(join(1829780..1830181,1830239..1830815,
                     1830886..1831631))
                     /locus_tag="MYCTH_2308395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665075.1"
                     /db_xref="GeneID:11507103"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="JGIDB:Spoth2_2308395"
                     /translation="MAEESKQVDPTKEQAAQEAADQTADATSKQAAPESEDESGSEAD
                     VGATQTAAGGGGEGAVKKKKKKGKKKKVKQTLSDALGRGGPSAAQAEADPKKALEGLT
                     PQQISEFIALNPALANELLGGEGSSDITSKAIEAFKKLKLQDIMTGLASSGKNRKDMA
                     SYKFWSTQPVPQFGEEEPKLIEEGPLKIQKVEDIATEPIPLALEPFRWVTMDLTNDSE
                     LEEVEKLLYGHYVEDDEAMFRFRYSKSLLKWSLLSPGWRKEWHVGIRSGNTLCAFISA
                     IPTEMRVRDKIIRSSEVNFLCVHKKLRGKRLAPVLIKEITRRVNLEGIWQAIYTGGIV
                     LPRPVSTCRYYHRALNWMKLYEVGFSPCPPNSKPAYQARKYNLPDHTSTRGLRELEAK
                     DLEAVHDLLERYLKRFDLTPVWDRTEAEHWLLHKKDSQDEQVVWSYVVEDENGKITDF
                     FSFYCLESSVIQSTKYSSIRAAYLFYYATEVVFTAPDDRSALKARLNALMADALILAK
                     RHNFDVFNALSLMDNSLFLEQQKFGPGDGQLHYYLFNYKANPIHGGVNKRNQLEEGVS
                     SGVGFVML"
     gene            1832208..1833898
                     /locus_tag="MYCTH_2308397"
                     /db_xref="GeneID:11507104"
     mRNA            1832208..1833898
                     /locus_tag="MYCTH_2308397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665028.1"
                     /db_xref="GeneID:11507104"
     CDS             1832478..1833677
                     /locus_tag="MYCTH_2308397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665076.1"
                     /db_xref="GeneID:11507104"
                     /db_xref="JGIDB:Spoth2_2308397"
                     /translation="MGKPSTSSLPGIAGSSSEADAVSLHTQPGEHAYDDDVPELQPAD
                     LPPPYSDIEPGTADNEPVLPTIARPSYILVDLAEKDLYTVDANTGAESFMCEILDNDP
                     VLLERQIKLSAAKPPRPSVRIRGTRSQTVRENGKSERKTVTDFDVVVELTPYLFSDAP
                     RGQSWRRLRTVENTEKTRRGTIFPKRAPGVRRDIEISNPKPALAEWCHRYCASHAGVK
                     AFVLRRQVTGFDQEKLKLKLETLVRGTNYRGHIDITFPVKDDYVVVYNACRVNRWRLT
                     PWIVWFCYLTFLWLFTWPFLFFRTKWFEVAIAEWPFSVTEANGDKRYVSMSEEHIYNL
                     WGRAISRAVLSKRQGTLSEEDLIASQTTPDEPFAGLLEHAPRFLRDGVNAISAVNRQL
                     GWGGDSW"
     gene            complement(1833899..1835713)
                     /locus_tag="MYCTH_2308400"
                     /db_xref="GeneID:11507105"
     mRNA            complement(join(1833899..1834203,1834261..1834983,
                     1835065..1835262,1835340..1835413,1835483..1835713))
                     /locus_tag="MYCTH_2308400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665029.1"
                     /db_xref="GeneID:11507105"
     CDS             complement(join(1834121..1834203,1834261..1834983,
                     1835065..1835262,1835340..1835413,1835483..1835589))
                     /locus_tag="MYCTH_2308400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665077.1"
                     /db_xref="GeneID:11507105"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2308400"
                     /translation="MTNVASSLVPILVLGLPLGLYTLFLSLSTIPYFQRNFLYAHKIH
                     TLWWGNINEPEQWGFAKNQVTPFYLTTADNQTLYAWHILPLPLYVQHEDKLSSQPSGF
                     CHDITATENFRLLRDDPTAKLIISFHGNAAQLTQGRRPPHYHTLTSLHSPYHLLTLDY
                     RGFGLSSGTPTERGLILDAAAALRWAVDTAGVPPSRIVLVGHSLGTAVAAAASELLTL
                     HEGWDFAGVVLVAGFSSLPEMLSGYAIAGWLPVLRPLTWWPWLSNKLMARVVDTWDSA
                     GRWRDVVRAVKERRGRLRLSLVHAKDDWDIPSHESDKLFRAAVEGLVGGGMGEEQFEA
                     EKRKRMVIKGKNSFTATWKEGDIVVKQELFPHGGHNGVLTHTPVLMAVMRSFGLDDQS
                     AP"
     gene            1836191..1839366
                     /locus_tag="MYCTH_2308402"
                     /db_xref="GeneID:11507106"
     mRNA            join(1836191..1836769,1836837..1839366)
                     /locus_tag="MYCTH_2308402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665030.1"
                     /db_xref="GeneID:11507106"
     CDS             join(1836522..1836769,1836837..1838880)
                     /locus_tag="MYCTH_2308402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665078.1"
                     /db_xref="GeneID:11507106"
                     /db_xref="JGIDB:Spoth2_2308402"
                     /translation="MEKKRKLPARAAARAEQAAKKRTVTPPQRSATPAPTTEPEPTPV
                     DDVPPPLPKSVTAGKPLPTVDSPQPDDLPTSEFQTVTESGVLAESLSRSRQKWTMEGI
                     FEKYWSKPTKKKGVVIEEPNNPPKESMMKLGQVTITVEPHVFEATMFAVKDPKPAPPP
                     PPPTQRPIMQYGPPNGMMPPPPPPPPTPAPASSTPASAPPPAPAQSSAQVQSQGPPPA
                     DSKPPAQTQTHTPAQTPTLPTAQPNAGQSAQDAVRPGPTLPPAAGRPVASPRGMETVL
                     SPSTSTPLVPQNSPPIAQPQPPRPTPPPSYSHPTVPAPGPAPGPVPGPTRPVTTATSN
                     PAPSTAPAVPAHAPAPAKPPPGTDPIILMLAEKAGTDPQLRDLMKRVAQGEAAKHELE
                     RFQAIIDAITAESKRNGSTSGPSADRLLVDGRTVRYFADEVRAILDIVLSSNPKQTSA
                     DLRPPAGSDPLVVMLVKAALDDSRTRDIVRRIAENKAQFADATDLKIILDGLRTKLIK
                     DRERQQTQSPVPASPVSAKPNGASNGPAAPSPAAQIPPPQTALRSKGPPPPPQKPDIS
                     AIVLEFAGGTGDRYLFPKFSLLEYVPVPSGQQVIASFLLVRKGSQAEYPMADPELDYY
                     QPLTIRLFTSTGRHLEHLARVVAPPDEVKRYMNDVMTKMTRAEYVLLAMRLPRRDGSE
                     DDKDNEREGKQPNGGAVKDKDQENGLEKVQKPAQPPAVLWTTTASKSETKDVTARGKG
                     SGKPMDADEQYQSFIASVSRKEA"
     gene            complement(<1854034..>1855726)
                     /locus_tag="MYCTH_55717"
                     /db_xref="GeneID:11507185"
     mRNA            complement(join(<1854034..1854678,1854844..1855099,
                     1855177..1855262,1855322..>1855726))
                     /locus_tag="MYCTH_55717"
                     /product="glycoside hydrolase family 28 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665031.1"
                     /db_xref="GeneID:11507185"
     CDS             complement(join(1854034..1854678,1854844..1855099,
                     1855177..1855262,1855322..1855726))
                     /locus_tag="MYCTH_55717"
                     /EC_number="3.2.1.67"
                     /note="CAZy_ID 268068"
                     /codon_start=1
                     /product="glycoside hydrolase family 28 protein"
                     /protein_id="XP_003665079.1"
                     /db_xref="GeneID:11507185"
                     /db_xref="InterPro:IPR000743"
                     /db_xref="JGIDB:Spoth2_55717"
                     /translation="MKSLALFLSAAASLVSASAIALDREAIPAGASITFPRHESQFNP
                     SVTLEGRGHGRGHGREKDNWGNAVEKDRQKVTIRASKHDRDDISDDFLWALKKANHGG
                     LLHLQKGKKYVIGKKLDLSFLNDIYVKIDGELKFTNDIEYWQANNFYYDFQKSITFWV
                     WGGKDIKIYGSGVINGNGQAWWDGFSGHEILDPDNEYYRPILFLTDNATNVEVRGLHL
                     KDSPCWTNFFVRSKNIVFDDVYISAVSTNASTLPKNTDGFDSLNVSGLTVLNTRVNVG
                     DDCFSPKPNTSDILVRNLWCNGTHGVSMGSIGQYAGVLDYIADAHIENVTLLNGENGA
                     RLKAWAGPDVGYGYIRNVTYKDIRVENTDSPIVLDQCYFNVNETVCAQYPSRVNITDI
                     NFINVRGTSSGKEGRVVADLTCSPGATCTGIHLEGIDITSPKGSPPQIVCENIEGDIG
                     VDCIPKDEADYSG"
     gene            1857517..1861556
                     /locus_tag="MYCTH_2308407"
                     /db_xref="GeneID:11507186"
     mRNA            join(1857517..1858112,1858215..1860447,1860510..1861556)
                     /locus_tag="MYCTH_2308407"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665032.1"
                     /db_xref="GeneID:11507186"
     CDS             join(1857747..1858112,1858215..1860447,1860510..1861165)
                     /locus_tag="MYCTH_2308407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665080.1"
                     /db_xref="GeneID:11507186"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="JGIDB:Spoth2_2308407"
                     /translation="MASNAPFQFAGDSESDDDNFNPAPADMSDEEEDAAADAGNSDRR
                     ASSPAADDGQNEMEEDDDRPTKAGKKRPREDDDEEENEGEEEEDEEDAEKNGDDQDEE
                     EEEEEEEEEEEEEEEDEDVHRHRRKRRKDHRAAFFDIEAEVEDEDEAEDEEKEGEEIE
                     DFIDNAHPDDIADSGHLDDDRRHRELDRRREIEASMDAEKQAEILRARYGKRAPARGY
                     GEMTVVPKRLLLPSVDDPGIWAVKCKEGKERDIVFSIMRRIEERAGGKDELPITAAFE
                     RGGPNSVMKGYIYVEARRQNDILIALDGVLDVYPRTKMILVELKDMPDLLRVNKTPSL
                     EPGAWVRLKRPAKHAGDLAQVLDVTENGLEARVRFIPRLDYGVRDDTSSSLTADGKRK
                     RPGMPGPRPPQRLFSEAEARKRHPRYIQGNPQTNTWTYMGEDFENGFQVKDIKIQHLE
                     IKDVNPTLEEVTKFASGSEDGTENLDLKALAASLKDSNASSAYLPGDVIEVYEGEQQG
                     VVGKAVSVQGDIVTLKVTEGDLAGQTIEVPNKGLRKRFKTGDHVKVIGGSRFRDEVGM
                     VVKIVDDRVTILTDQTNTEVTVFSKDLREASDIGGQGSLGQYSLLDLVQLDPTTVACI
                     VKVDRESMVVLDQNGDTRQVMPSQIANKLPKRRTAVAADRNGSEIRLDDVVREYGGQQ
                     RQGKIIHIHRSFIFLHSNATTENAGVFVTRAGNVTTVAAKGGRTANTNSGPDLSTMNP
                     ALKRNPAQNQPMQPPKTFGRDRALGQTVSIRRGGYKGLMGIVKDTTDTDARVELHGKN
                     KIVTVPKADLIFKDKVTGKTIDIYSRSGGPGFGGLGRGGFGSGDRPGGSRTPMGAGGG
                     ERTPAWGVSKAAARTPAWGRAEASGSRTPAWGDGSRTVNPYDGSRTAYGDGSRTAYGG
                     ATSYGGSRTPAWSSSAKTPAHDGFGHGSKTPAYGSSSSDPWGSKTPAYGASAPTPGAS
                     GGDSWGYTPGPSGGSHAYDAPTPGAGLGAPTPAALNAPTPGAYSAPTPAAASAPTPGA
                     WQGGWGADAAPTPAVGAPTPAASGGYYGAPTPAAYGGAPETPAASGEIRYADDD"
     gene            complement(<1861728..>1862665)
                     /locus_tag="MYCTH_103537"
                     /db_xref="GeneID:11507187"
     mRNA            complement(join(<1861728..1861876,1861956..1862093,
                     1862186..1862527,1862611..>1862665))
                     /locus_tag="MYCTH_103537"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003665033.1"
                     /db_xref="GeneID:11507187"
     CDS             complement(join(1861728..1861876,1861956..1862093,
                     1862186..1862527,1862611..1862665))
                     /locus_tag="MYCTH_103537"
                     /note="CAZy_ID 267811"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003665081.1"
                     /db_xref="GeneID:11507187"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_103537"
                     /translation="MKLSAAIAVLAAALAEGHYTFPSIANTADWQYVRITTNFQSNGP
                     VTDVNSDQIRCYERNPGTGAPGIYNVTAGTTINYNAKSSISHPGPMAFYIAKVPAGQS
                     AATWDGKGAVWSKIHQEMPHFGTSLTWDSNGRTSMPVTIPRCLQDGEYLLRAEHIALH
                     SAGSPGGAQFYISCAQLSVTGGSGTWNPRNKVSFPGAYKATDPGILINIYYPVPTSYT
                     PAGPPVDTC"
     gene            1864150..1865438
                     /locus_tag="MYCTH_2308413"
                     /db_xref="GeneID:11507188"
     mRNA            1864150..1865438
                     /locus_tag="MYCTH_2308413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665034.1"
                     /db_xref="GeneID:11507188"
     CDS             1864246..1865400
                     /locus_tag="MYCTH_2308413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665082.1"
                     /db_xref="GeneID:11507188"
                     /db_xref="JGIDB:Spoth2_2308413"
                     /translation="MCKIRIIHFSEHDVRIPIATDPFSAPGGKDDFICSNEVARCACN
                     SPIAGILVAPEADESGRRPGSSSSSNNHYARCPWHRCCVTVYQVLLCQWYWNHAEEAA
                     LQGDGDGDEDEDVDEEPETWCPNRMVLHEHHPIGMLLSPHSPSGDAAEWDETREPFSP
                     GCFPAGDLLYSDEILDDGDGADAVPPPPPPPPPDGLQSDRYEVQALGRLLRARKETLA
                     RAVALASEMVESLAGDLEGVRCLGAADAVAFLARIRSAGRVVDLIEDTELGAAELYRD
                     MVRRVRSVLAALGRVPAPGGTVASHDGTFSISRAQLDLADLDPHEVLEVCDGPLKRSG
                     ELRERLAEIATLVARLPRELERRRRRRRRQGSRSGLDQHPAVRRRRCQSV"
     gene            1866007..1867940
                     /locus_tag="MYCTH_2308415"
                     /db_xref="GeneID:11507189"
     mRNA            join(1866007..1866691,1866852..1867214,1867291..1867940)
                     /locus_tag="MYCTH_2308415"
                     /product="glycoside hydrolase family 79 protein"
                     /transcript_id="XM_003665035.1"
                     /db_xref="GeneID:11507189"
     CDS             join(1866175..1866691,1866852..1867214,1867291..1867874)
                     /locus_tag="MYCTH_2308415"
                     /note="CAZy_ID 268069"
                     /codon_start=1
                     /product="glycoside hydrolase family 79 protein"
                     /protein_id="XP_003665083.1"
                     /db_xref="GeneID:11507189"
                     /db_xref="JGIDB:Spoth2_2308415"
                     /translation="MARKITRLGALCAAIAAQGAEAAVSFAIPNKAGTGAQLYAPLDP
                     APVGISFEFFAFPSYFTNVTATKQCLANWKDLTGVWPPIRIGGTTQDRASYDSSTSAY
                     VVYSVANPADAPATLTFGPKFMTLAGTYPGSVVVGLNRGKNNIDNTIAAAKVAVSEVT
                     NLLAIELGNEPEYYPKDGQPIASGTWNPSVDAASQVDWSIRVGSAVGKRNIIQAGNWN
                     QPPPEWGAAQLIASENATASQYIRHYAHHNYPGGDVQKLQSHSQTSSNVRSMFAADVA
                     AVKQQTGKEYVLGETNSVSGGGAANVSPTFGAALWTMDYALRAAAHGISRVYFHHGTV
                     GNCQYCFWGRYSMGAPYYGATAAVALAAGASSIAALDAGTDGYAAYVTFDAAGAPLRA
                     LLYNSDYYAGGGAEPRSSQQFTLTGLRGDRVRAKRLTAASSLSRADRGNDISFGGQYW
                     VNGTCVVGGEEVFETVEVAGGRATFDIKAAEALLVYL"
     gene            complement(1868145..1868243)
                     /locus_tag="MYCTH_t157"
                     /db_xref="GeneID:11507190"
     tRNA            complement(1868145..1868243)
                     /locus_tag="MYCTH_t157"
                     /product="tRNA-Ser"
                     /note="Anticodon: GCT"
                     /anticodon=(pos:complement(1868208..1868210),aa:Ser,
                     seq:gct)
                     /db_xref="GeneID:11507190"
     gene            complement(1869551..1872582)
                     /locus_tag="MYCTH_2308418"
                     /db_xref="GeneID:11511498"
     mRNA            complement(join(1869551..1870704,1870769..1872204,
                     1872351..1872582))
                     /locus_tag="MYCTH_2308418"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665036.1"
                     /db_xref="GeneID:11511498"
     CDS             complement(join(1869836..1870704,1870769..1872204,
                     1872351..1872397))
                     /locus_tag="MYCTH_2308418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665084.1"
                     /db_xref="GeneID:11511498"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308418"
                     /translation="MSLIPYHPREGREIVLRHHNAIVVRDPSSQRLEIRGLQLHECPT
                     CHRPLRSASPDRHYESNQHGDSYVDPNYFRMLRASHSLRSASTSHSPPSPIRRLVVPL
                     PAAVHDEGESHAEFLSSSPAPQSGGRIKREAFSPNYFDTFFIEERELGRGGKGVVLLV
                     RHEIDGCNLGHFACKRVPVGDNHAWLEKVLVEVELLANLAHPNLVSYRHVWLEDVQLT
                     RFGPSVACAFILQQYCNGGDLLQYIIGEKPKEATKEELKAQMRRRSRGRAERPQVQRR
                     LPPEEIYSLFKDITSGLSYLHSSNYIHRDLKPSNCLLHRDGNHLKCLISDFGEVQPEH
                     AVRKSTGSTGTISYCAPEVLKKDASGRYGNFTTKSDIFSLGMILYFMCFGRLPYVHAN
                     IVNEELEDADQLRAEISDWKGFQAERKERPDLPSKLYQLLTRLLAVNPADRPTASEVL
                     SAMGGEANFEGMMRGSRNTNPFLGLGGQRIQDLDSPLQSSTPVADPTKHARVNNAANE
                     DSPEPSQRPVSDAFTKPPTSNLLSRRINQQPTTSSAGDARHAASHAMTLSRGNRSRSQ
                     SNDSRTHTPHHPHPPSPHRSSNPNPAPASPQPATITTPLLMPPPTTRLQRARLTALLA
                     WYRAARWVSSNAMLLRLALFAAKVLSLSWVCWPYSAGWAVTAVVVGLAAGDLHFGLRD
                     EEGTGTTGSETGVEGTSERARLGSWDGAVPRERAGEEGVGLLEQSQDGGRRAEGPGGA
                     RWLDGGWQRSLVLLLLHCFILASMNSFGMMCAGGQVTRGWEDW"
     gene            complement(1872820..1873333)
                     /locus_tag="MYCTH_2308419"
                     /db_xref="GeneID:11507191"
     mRNA            complement(join(1872820..1873035,1873098..1873333))
                     /locus_tag="MYCTH_2308419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665037.1"
                     /db_xref="GeneID:11507191"
     CDS             complement(join(1872915..1873035,1873098..1873210))
                     /locus_tag="MYCTH_2308419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665085.1"
                     /db_xref="GeneID:11507191"
                     /db_xref="JGIDB:Spoth2_2308419"
                     /translation="MHTGRLKSEDVIQPDLYFSPPASNLAVGAGPIWESVSLNIVRVR
                     VVRSPKLVPSSIQWYVEGHQQEASGSGIGQFTW"
     gene            1873702..1874265
                     /locus_tag="MYCTH_2308420"
                     /db_xref="GeneID:11507192"
     mRNA            1873702..1874265
                     /locus_tag="MYCTH_2308420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665038.1"
                     /db_xref="GeneID:11507192"
     CDS             1873794..1874150
                     /locus_tag="MYCTH_2308420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665086.1"
                     /db_xref="GeneID:11507192"
                     /db_xref="JGIDB:Spoth2_2308420"
                     /translation="MKVLCLLLTLPAGILWGALAQEQCPGSWYLQGDDCICIRSTDGF
                     LLKAQTLQCCMALGYKTYDNMRTSSPDHRSDSLTWVFSDLCRGPQQTTDFQRLLQRPQ
                     TGKRHRSLPLSRGVTG"
     gene            1877183..1881520
                     /locus_tag="MYCTH_2308423"
                     /db_xref="GeneID:11507193"
     mRNA            join(1877183..1877781,1877835..1878739,1878793..1881520)
                     /locus_tag="MYCTH_2308423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665039.1"
                     /db_xref="GeneID:11507193"
     CDS             join(1877854..1878739,1878793..1881179)
                     /locus_tag="MYCTH_2308423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665087.1"
                     /db_xref="GeneID:11507193"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2308423"
                     /translation="MSSLSNRISLLEAMLKERGVIPPPAVHPPKTRQEAQARQQQEQR
                     QGQTNGERSKSSEAGKTAPPPLNQPPTPPGSGDEDVILAETPQPKTFPSGGHASHSRM
                     IDPRLLQEPESKKESGTRHLLRTRGSYVLDQSVGRTRFFGPTANSHVYAKQTSSLIPL
                     ERSDHLGRAEQLILGLRSATYDYLMRCFWEYYNSWQRVVDESAFETGRTTGDSRFYSL
                     FLHLAMLAVGFRFADWDREDVKMIMVGNRESTIHREAKAMLGAELERPGGVPSVQALL
                     LLADLECGVGRDATGWMYSGMANRLAFDIGLHVNTTAAGMSELERQTRRQVMTSCVMF
                     DRKWALLLGRPTAIKTQDIGADVLPRATGKPLVDSSIGSVASHAAIHRQMFELLELAG
                     KVADFQNSTYGPAHLFPAKTVEDRAYLHFVGLERLFHNWYRRLPESLAWKPVNIKSAP
                     MGFFMLHLQFHMCMILLHRPWAKYGPLSLDGTAAARYPSPESPTQEDGTGLPSWMAPL
                     PHHDNRASMSRSMCTQHAIRIARIFWHQRQRFDGRRVLLTSVQYAGTAALALMAALAH
                     KSAELDHQSNLRYLQVLSTAIYDMSHLYQPAARMYQLLKTMLVEIRSEMVKSGGFDVS
                     SLVGRYQGSNNMAFGSNQWAGGAENTRLHTDRLETIHEDDRASKRRRLSSLSSVDFSR
                     TTPSFLTNSHQGCPPSPGSAQSHSVNSAVLDQTPSEPGNFDLDLFHASFVDFINAGGD
                     SSNSQEWPAADADSSAPVLVPSMSGDLFALSGSLTKAPAQIKEPPSSTPPPIPASASD
                     KTPAAPEDDDDTAVDRTIEEWLAEPSKALAPSPTDDTPRSTTTETHRQAGEALPAPTE
                     PRNSLSHATADGTPICRDPYVLSLETELGIGFDLGPDPTTATGTTPTAAGSSLSSGNN
                     DTTEDSITVDAMDWLNTTSPPAAFNVTTPSPAPAPAASASTGLTASLNETTAVTTTTT
                     TTTTTTTTTMAVASTNTAPPLAPPPPPMTPVTLDELVQSVEEAVGSARARARARAAAA
                     AAAAAAVASASGSGSEGAGAGSNMGNGGTCDGAVAGAGSPTASIPGSAGERNRELDFL
                     VL"
     gene            <1883157..>1883585
                     /locus_tag="MYCTH_2047945"
                     /db_xref="GeneID:11507194"
     mRNA            <1883157..>1883585
                     /locus_tag="MYCTH_2047945"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665040.1"
                     /db_xref="GeneID:11507194"
     CDS             <1883157..>1883585
                     /locus_tag="MYCTH_2047945"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665088.1"
                     /db_xref="GeneID:11507194"
                     /db_xref="JGIDB:Spoth2_2047945"
                     /translation="KSCLKSSGRQDRSVRFADAARCLESGAVVEPHPTTRDEWMDELL
                     DARIDEADSSGRSTPERIEAIEAVVHPRVRELVRWQSRKRVHRLLLPADFDRESLEAY
                     AWRLLFQRAHKHMLRNRADCPIRSRLERHKHPALSTRPDPE"
     gene            1884560..1886146
                     /locus_tag="MYCTH_2308426"
                     /db_xref="GeneID:11507195"
     mRNA            join(1884560..1885061,1885191..1885219,1885333..1886146)
                     /locus_tag="MYCTH_2308426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665041.1"
                     /db_xref="GeneID:11507195"
     CDS             join(1884785..1885061,1885191..1885219,1885333..1885830)
                     /locus_tag="MYCTH_2308426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665089.1"
                     /db_xref="GeneID:11507195"
                     /db_xref="JGIDB:Spoth2_2308426"
                     /translation="MPPTPHHVLLLGGHGKVAQLLTPLLLRRGWDVTSVIRTEEQAPT
                     IQGLAPKDGGEGTGRLKVLVRSLEEVKSESDAEKVISEWGGDYVVWSAGAGGKGGPER
                     TYAIDRDAAIHFIRAAAAAPHVTRFLMVSYLASRRGRPAWWSEEAWAAARHLNEQVLP
                     HYYRAKLAADEALYAVSKERGDAFVGINLRPGTLTLEPAGRVELGKTGDVRGNVSRAT
                     VARVADLLLASEGIKNTWLDLLDGDEEAEAAVERVVRDGVNAAEGEDIF"
     gene            complement(<1886619..>1894041)
                     /locus_tag="MYCTH_2066697"
                     /db_xref="GeneID:11507196"
     mRNA            complement(join(<1886619..1887440,1887912..1888740,
                     1892410..1892416,1892690..1892753,1892816..1893295,
                     1893349..1893701,1893783..>1894041))
                     /locus_tag="MYCTH_2066697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665042.1"
                     /db_xref="GeneID:11507196"
     CDS             complement(join(1886619..1887440,1887912..1888740,
                     1892410..1892416,1892690..1892753,1892816..1893295,
                     1893349..1893701,1893783..>1894041))
                     /locus_tag="MYCTH_2066697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665090.1"
                     /db_xref="GeneID:11507196"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="JGIDB:Spoth2_2066697"
                     /translation="YIDYKNITKVIEPGRIIYVDDGVLAFEVLEVVDDKNIKARARNN
                     GFISSRKGVNLPNTDVDLPALSEKDKADLRFGVKNNVDMIFASFIRRAQDIRDIREVL
                     GEEGRHIQIIAKIENRQGLNNFPEILAETDGVMVARGDLGIEIPAAEVFAAQKKIIAM
                     CNIAGKPVICATQMLESMIKNPRPTRAEISDVGNAVTDGADCVMLSGETAKGNYPYEA
                     VREMSLACLKAENSIPYVSHFEELCTLVKRPVSIVESCAMAAVRASLDLNASAIFVLS
                     TSGESARLISKYRPVCPIIMITRNPSSSRYAHLYRGVYPFLFPESKPDFSKVNWQEDV
                     DRRIKWGLHHAIDLGILTEGETVVVVQGWKGGMGNTNTLRIVKANVEHLGIVDDMSSK
                     SSYLPRLGFSRGDGPILPLHNRTSPPIRKKHSEYSLSELSPRPDDGLLSSSPENDRDA
                     AVSSQRGSSPSARYHDWATDKASSKTRAEPPPLFTGPPPPIATSQMLYRDEEERDASS
                     TSSRHFGATSLARNIGSVLFDRNTPSPNRTRNRDYDPKPDAIWRNLQRRERALQKELQ
                     HLLDAQSAGLAANLGSDDGAPGVSNASSDSGARSIAPTTSPTPITAHTAGSSQRSQPR
                     HVTFEDRRHRRHHHHDAATSTSSVTSSGTLVPVRQPRPKSGGRGIRESPGGVEFLQLR
                     PERRTAEMAREWWENEVAILEKKKKEVDKERTALEQGVEVWRGAVMLVSEFEAELRNQ
                     LRESGNAEGGSGNGKGKNREGDQATPPSPEQTMLAQLDRMQGVMAGLEERLRVAEQNG
                     WNLLICAIGAELEAFRQADSMLREALRSAGVNVGDDDGTHGDSTPRLGKSTGLENSGQ
                     GVDRAEMSGEGKLVDLHDGDSKQDRDPESDNEVPPDLLVSALEDAEPESPGLSRKNSN
                     EIPAEFLREHHDDEGFPGFGAMT"
     gene            complement(<1894087..>1894663)
                     /locus_tag="MYCTH_2067689"
                     /db_xref="GeneID:11507197"
     mRNA            complement(join(<1894087..1894286,1894447..>1894663))
                     /locus_tag="MYCTH_2067689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665043.1"
                     /db_xref="GeneID:11507197"
     CDS             complement(join(1894087..1894286,1894447..1894663))
                     /locus_tag="MYCTH_2067689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665091.1"
                     /db_xref="GeneID:11507197"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="JGIDB:Spoth2_2067689"
                     /translation="MATALDHLQLGGKIEWLSQLDTAYQPERNLRRTSIICTIGPKTN
                     SVEAINKLREAGLNVVRMNFSHGSYEYHQSVIDNARQAEKVQNGRPIAIALDTKGPEI
                     RTGNTVDDADLPISAGHIINITTDEKYATACTTENM"
     gene            1895639..1896514
                     /locus_tag="MYCTH_2315875"
                     /db_xref="GeneID:11507198"
     mRNA            join(1895639..1895758,1895880..1895919,1895981..1896023,
                     1896141..1896514)
                     /locus_tag="MYCTH_2315875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665044.1"
                     /db_xref="GeneID:11507198"
     CDS             join(1895753..1895758,1895880..1895919,1895981..1896023,
                     1896141..1896279)
                     /locus_tag="MYCTH_2315875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665092.1"
                     /db_xref="GeneID:11507198"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="JGIDB:Spoth2_2315875"
                     /translation="MVLGRLTHYAFDAVLFSAFLAGMKRSTGLTFKTEKVAGDNKEMS
                     KWVDKYLGVGEWVMDQSVAIAGSSGWFERTR"
     gene            1899181..1900820
                     /locus_tag="MYCTH_2308437"
                     /db_xref="GeneID:11507199"
     mRNA            join(1899181..1899707,1899758..1900820)
                     /locus_tag="MYCTH_2308437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665045.1"
                     /db_xref="GeneID:11507199"
     CDS             join(1899525..1899707,1899758..1900702)
                     /locus_tag="MYCTH_2308437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665093.1"
                     /db_xref="GeneID:11507199"
                     /db_xref="JGIDB:Spoth2_2308437"
                     /translation="MYSKLSVIAALVALVEARFGQEGLVQSKISALSNFGNPGQAATL
                     AGASPGVLLAGANACAKLELADQIVSELGNDPEVIAAAAALVAAEKNFNPFVTSIPTI
                     CSDPNLPATPELRGIVPLVDPAVVGSDIENANSATSLTNPFNADGLSQADVAIANGFS
                     NFTAQASDGSTTGGNAGGNNGNNNGNNNGNNNGNNNGNNDGNNGNNGNNGNNNGNGNA
                     NNGNNNGNGGTTRCGRNRNNKNRNGNNGNNNGNNGNGNANNGNNNGNNGGNGGNGGNN
                     NSTATDFGSCDPTMKFEGGLGGRPADEFTFQSNDPQIAANQQEALNPNIITNRICDEL
                     TNICGANDAAKAVCRDAQAQIQALGTRDATTAETWNRLLGF"
     gene            1901490..1903055
                     /locus_tag="MYCTH_83864"
                     /db_xref="GeneID:11507200"
     mRNA            join(1901490..1901789,1901873..1902181,1902304..1903055)
                     /locus_tag="MYCTH_83864"
                     /product="alcohol dehydrogenase-like protein"
                     /transcript_id="XM_003665046.1"
                     /db_xref="GeneID:11507200"
     CDS             join(1901753..1901789,1901873..1902181,1902304..1903010)
                     /locus_tag="MYCTH_83864"
                     /note="Alcohol dehydrogenase-like protein"
                     /codon_start=1
                     /product="alcohol dehydrogenase-like protein"
                     /protein_id="XP_003665094.1"
                     /db_xref="GeneID:11507200"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_83864"
                     /translation="MSPTMKEALVSKGTQVEIVDSPIPNPNENQVLIKVVVSGSNPKD
                     WKLPEWFGGSTNQGDDIAGIVEKVGANVFEFKPGDRVAAFHEMRTSGGSYAEYAIAWQ
                     HTTFHIPESVSFEEAAAVPLAAMTAAVGLYLRLGLPQPWSPATTQTPLIIYGAASAVG
                     IYAVQLARRSNIHPILCVAGRATDYVAGFLDPSKGDAVVDYRQGDEAVVSGLVRALDG
                     RPPVAHVLDAVSEKSSVPNVVEVLKRAGARDAQGKLGAKVTFVLGVEQDLPEGVDKTL
                     TMVGTVHKEAKDFGYVYFRYFAKGLQEGWFKPQRTEVVPGGLGGIQTALLNLRDGKAS
                     AVKYVFRIAETEGVQR"
     gene            complement(1903063..1905180)
                     /locus_tag="MYCTH_2308439"
                     /db_xref="GeneID:11507201"
     mRNA            complement(join(1903063..1903658,1903744..1905180))
                     /locus_tag="MYCTH_2308439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665047.1"
                     /db_xref="GeneID:11507201"
     CDS             complement(join(1903280..1903658,1903744..1904990))
                     /locus_tag="MYCTH_2308439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665095.1"
                     /db_xref="GeneID:11507201"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2308439"
                     /translation="MADSFGDYPPNLTVKDALIVRETEGPSHAVTPYTGTDLARPRLG
                     PANPFRDDGPSASRKRKNVLTGHAEETFISEHTFRAKHRAVEGDQRHGTLTNREQKEV
                     NKRLRREREDKGDATIADGDGAYVGPWARYKRERYEEVEVGEGEEVELASGEEYEIVE
                     EGEEEEDDVVPSGTVVQAPAPSLARRKEAEEMGVETTTFHGSSEYDYLGRTYMHVPQD
                     LDFSLTKEVGSITNYIPKKMVYSWKHHGKPITALQLFPRSSHLGLSGAADGSVHIWDV
                     YRDRELLRSFSGHNKAISDLSFNNDGTKFLSGGFDRKIRLWDTETGQCVNRFNCGKTP
                     HVIKFNPSAENGHEFLAGLSDNRILQYDSRAGNETVQEYDHHLGAINTIEFIDESRRF
                     MSTSDDRSLRVWEYGIPVEIKTISEPDMFALTKSAQHPSGKYVLYQCSDNSIVAYSSG
                     PEKFRQHRRKAWRGHNTAGSAIGLTCSPDGQFVASGDTGGSVCFWDFKTCRMYSKLTA
                     DSAGGAINCVAWSEQETSKVFTAGTKGEIRLWD"
     gene            complement(1905420..1906886)
                     /locus_tag="MYCTH_2315877"
                     /db_xref="GeneID:11507202"
     mRNA            complement(join(1905420..1906030,1906086..1906152,
                     1906207..1906362,1906523..1906886))
                     /locus_tag="MYCTH_2315877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665048.1"
                     /db_xref="GeneID:11507202"
     CDS             complement(join(1905938..1906030,1906086..1906152,
                     1906207..1906362,1906523..1906623))
                     /locus_tag="MYCTH_2315877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665096.1"
                     /db_xref="GeneID:11507202"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="JGIDB:Spoth2_2315877"
                     /translation="MSGEAWLYLFAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCN
                     RLNTYIIPEVAVHGFLTFLFLINGYWLPLILNLPLVAYNAKKIIDNTHLLDATEIFRK
                     LNVHKKESFTKLGFHLVLFFFYLYSMIVALIKDEAH"
     gene            complement(1907062..1908942)
                     /locus_tag="MYCTH_2308446"
                     /db_xref="GeneID:11507203"
     mRNA            complement(join(1907062..1907431,1907482..1908028,
                     1908084..1908400,1908452..1908485,1908561..1908942))
                     /locus_tag="MYCTH_2308446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665049.1"
                     /db_xref="GeneID:11507203"
     CDS             complement(join(1907319..1907431,1907482..1908028,
                     1908084..1908400,1908452..1908485,1908561..1908701))
                     /locus_tag="MYCTH_2308446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665097.1"
                     /db_xref="GeneID:11507203"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="JGIDB:Spoth2_2308446"
                     /translation="MAKEPPTKKCLGADCENEASSLQCPKCLSLGIKDSYFCSQECFK
                     KNWATHKNIHKQENKTGYYNPFPTFNFTGPLRPVYPLSPRREVPKSIPRPDYAEDGIP
                     KHGRSLVRTNKIEQLDAKGQEAMRKVCRLAREVLDIAAAAIRPGITTDEIDEIVHNAC
                     IERNSYPSPLNYNHFPKSVCTSVNEVICHGIPDKRVLLDGDIINLDVTLYHEGYHGDL
                     NETYYVGDRAKADPDTVRVTETARECLEEAIKLVKPGTLFREFGNVIEAHAKSRGCSV
                     IRTYVGHGINSVFHCPPNIPHYAKNKAVGECKPGMTFTIEPMIALGKYRDVTWPDNWT
                     STTIDGKRTAQFEHTLLVTETGVEVLTARKADSPGGPVPMPPAAANGTS"
     gene            1909072..1910976
                     /locus_tag="MYCTH_2308449"
                     /db_xref="GeneID:11507204"
     mRNA            join(1909072..1909275,1909403..1909623,1909675..1910103,
                     1910157..1910976)
                     /locus_tag="MYCTH_2308449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665050.1"
                     /db_xref="GeneID:11507204"
     CDS             join(1909164..1909275,1909403..1909623,1909675..1910103,
                     1910157..1910930)
                     /locus_tag="MYCTH_2308449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665098.1"
                     /db_xref="GeneID:11507204"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2308449"
                     /translation="MEKKQKIVVIGAGPVGSLAALYAANRGDDVEIYELRSDLRDPTT
                     TPLNFTKSINLALSERGINAMRHSGQPKLLENVLEATIPMRGRMIHGRRANGDLYEEP
                     QDYDGVHGRSILAVDRSRLNERLLDILEGMPNVTFFFNHKLTGANFRQNKAWFEVREN
                     GSAPAPGQRAREVEVDFDFMIGADGAHSAVRYHMMKYTRVDYQQVYVDTLWCEFQIRP
                     KTTAPDASLNSKFAISPNHLHIWPGKDFMFIAIPSGDGSFTCTLFAPAALYEHLESDS
                     TGSLIPPFFDRHFPGVTALIPPAELIESFRRNPHLPLISIKCQPHHYGSSVVLVGDAA
                     HAMVPFYGQGMNAGLEDVRILFDVIDKHARMDELSAGADRASSRGRALAEYTAVRVPD
                     AHAINDLALQNYVEMRASVLSPGYRLRKFLEEALAKYVPSLGWQTKYSRVSFGNERYS
                     EVVAKSEHQGRMLVRGLVGLVGLPLLAGGMVLLLRYRRAMNVGLKAAFGSVDSIVELM
                     TMN"
     gene            1912387..1913025
                     /locus_tag="MYCTH_2308450"
                     /db_xref="GeneID:11507205"
     mRNA            1912387..1913025
                     /locus_tag="MYCTH_2308450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665051.1"
                     /db_xref="GeneID:11507205"
     CDS             1912522..1912770
                     /locus_tag="MYCTH_2308450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665099.1"
                     /db_xref="GeneID:11507205"
                     /db_xref="JGIDB:Spoth2_2308450"
                     /translation="MGITCDECHQLWSQSVAEPKACTNTKCNYGMVKCCGNRSGCGRT
                     GCFKGEKYCPTCKGAGQVVYCRYWKSHGPGGTRPPTRR"
     gene            <1919452..>1920069
                     /locus_tag="MYCTH_96005"
                     /db_xref="GeneID:11507206"
     mRNA            join(<1919452..1919472,1919526..1919553,1919765..1920005,
                     1920057..>1920069)
                     /locus_tag="MYCTH_96005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665052.1"
                     /db_xref="GeneID:11507206"
     CDS             join(1919452..1919472,1919526..1919553,1919765..1920005,
                     1920057..1920069)
                     /locus_tag="MYCTH_96005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665100.1"
                     /db_xref="GeneID:11507206"
                     /db_xref="JGIDB:Spoth2_96005"
                     /translation="MPKFSILIGYLYPYLGLNTNATLITYVLGTLLPASYTCLSASIC
                     PIPMPIDFGRSRAYRSSLPVDRAAYLVYNRNDLTLTTITIILKEEDKEEKVVKLSL"
     gene            complement(1974271..1976352)
                     /locus_tag="MYCTH_2308456"
                     /db_xref="GeneID:11507207"
     mRNA            complement(join(1974271..1975394,1975469..1975537,
                     1975631..1975733,1975789..1975847,1976101..1976352))
                     /locus_tag="MYCTH_2308456"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665053.1"
                     /db_xref="GeneID:11507207"
     CDS             complement(join(1974573..1975394,1975469..1975537,
                     1975631..1975733,1975789..1975823))
                     /locus_tag="MYCTH_2308456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665101.1"
                     /db_xref="GeneID:11507207"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="JGIDB:Spoth2_2308456"
                     /translation="MSTDKITFLTNWHATPYHAPLYLAQAKGYFKDEGIKVALLEPND
                     PSDVTEIIGTGKVDLGFKAMIHTLAAKARNFPVLSIGSLLDEPFTGVVYLKSSGITSD
                     FRTLKGKRIGYVGEFGKIQIDELTSHYGMSPADYTAVRCGMNVSKAIIEGTIDAGIGL
                     ENVQMVELEEWLASQGRPKTDVQMLRIDELAELGCCCFCTILYIGNERFVAENPDKVR
                     AFLRAVKRATDFVLAQPEQAWKEYVDFKPVMGTPLNRKIFERSFAYFSRDLKNVKRDW
                     DKVTRYGKRLGVLDESFEPNYTNEFLEWPLTPDSTDPTGDQRRMAEIQKDVACCGGFR
                     RLEGRVEA"
     gene            1977558..1978708
                     /locus_tag="MYCTH_2308457"
                     /db_xref="GeneID:11507208"
     mRNA            1977558..1978708
                     /locus_tag="MYCTH_2308457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665054.1"
                     /db_xref="GeneID:11507208"
     CDS             1977977..1978642
                     /locus_tag="MYCTH_2308457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665102.1"
                     /db_xref="GeneID:11507208"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="JGIDB:Spoth2_2308457"
                     /translation="MAQKDITNYLRVTHDRVFEHNRSWAENKKASDPDFFVKLSAGQE
                     PEYLWIGCSDSRIPAEQITGLEPGEAFVHRNIANLVCNTDLNVMSVITYAVEHLKVKH
                     IVVCGHYGCGGVKAAMTARDLGLLNPWLRNIRDVYRLHEKELDTIADEGARYDRLVEL
                     NVYEQVRNVIKTASVQQSYAKNRFPVVHGWVFDFKDGLLKDLKINFETILADIQKIYD
                     LTK"
     gene            1978710..1979775
                     /locus_tag="MYCTH_2308459"
                     /db_xref="GeneID:11507209"
     mRNA            1978710..1979775
                     /locus_tag="MYCTH_2308459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665055.1"
                     /db_xref="GeneID:11507209"
     CDS             1979194..1979730
                     /locus_tag="MYCTH_2308459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665103.1"
                     /db_xref="GeneID:11507209"
                     /db_xref="JGIDB:Spoth2_2308459"
                     /translation="MTRRSTAELQRNSIVAVFLRMIEYYEGMLFLTTNRVTDLDPAFY
                     NRIHVAIQYANLGPEERRNIWRQHLARAAKGNRNPRLWNEGVYRLLGEIATNGRDIRN
                     ATRTAASIARSMDRDLDITHVVAVMRNNFSGDRDFTDSGAHDGPKDLKVSAKDLEQVF
                     GELMKVHKQLEGSDNTTA"
     gene            complement(1979784..1980708)
                     /locus_tag="MYCTH_2308461"
                     /db_xref="GeneID:11507210"
     mRNA            complement(1979784..1980708)
                     /locus_tag="MYCTH_2308461"
                     /product="glycosyltransferase family 25 protein"
                     /transcript_id="XM_003665056.1"
                     /db_xref="GeneID:11507210"
     CDS             complement(1980387..1980683)
                     /locus_tag="MYCTH_2308461"
                     /note="CAZy_ID 270030"
                     /codon_start=1
                     /product="glycosyltransferase family 25 protein"
                     /protein_id="XP_003665104.1"
                     /db_xref="GeneID:11507210"
                     /db_xref="JGIDB:Spoth2_2308461"
                     /translation="MGHLHTLKTIIDKRWMTALILENDADWDIEIKKQLALVAPHIRA
                     VTNSTSHGQPQPYGSTWDLLWLGHCGDGVPPTGVVSIFDSTLPEEAAYRENTGE"
     gene            1982096..1987117
                     /locus_tag="MYCTH_2308466"
                     /db_xref="GeneID:11507211"
     mRNA            join(1982096..1982349,1982414..1982505,1982583..1982815,
                     1982881..1983160,1983220..1983453,1983516..1984189,
                     1984259..1984421,1984488..1984736,1984805..1985003,
                     1985068..1985139,1985229..1985344,1985395..1985579,
                     1985637..1986070,1986154..1986905,1986970..1987117)
                     /locus_tag="MYCTH_2308466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665057.1"
                     /db_xref="GeneID:11507211"
     CDS             join(1982195..1982349,1982414..1982505,1982583..1982815,
                     1982881..1983160,1983220..1983453,1983516..1984189,
                     1984259..1984421,1984488..1984736,1984805..1985003,
                     1985068..1985139,1985229..1985344,1985395..1985579,
                     1985637..1986070,1986154..1986886)
                     /locus_tag="MYCTH_2308466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665105.1"
                     /db_xref="GeneID:11507211"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2308466"
                     /translation="MRLGSSDSALCSPPAPTCSVFAAHLATGPRVLPTAGQPAGYSPG
                     EPGAGGQCLLLSYDSPPLPRDLSAKLFRQAMVESWNRRARPETKAALPLALLRCIRRP
                     FVAPIIPRLFLILFRYSQPALIRRSIQFVTDDVPSAAGVETRGYWLVFSAVTIYVGLA
                     VSTAAYQHRLNKLRVVTKSALVGIIHHKTISLPSATHDNSEAVTLMSTDADGLDGAAE
                     MFHETWAQSLEVVIGIFLLSREVGSIWPLPLILIFLCSRMSRYVAKHLGPRQNAWNTV
                     TQQRVAATSSMLSSMKVIKMLGLQHCMASFTRRLREEELKTASRVRWIMVYYNASANL
                     LGIFSPAITLTLSALAAARRGLALNAETAFTSMAILSMVTHPANMVMTIVPRAVAAFA
                     GLERIQAYLLKPRLLDGRQTRPSAGETAGLAIKVHDVVVGEHHSILNGVSIGVNYGSL
                     VILSGPVGSGKSTLLRAILGEIRPVHGSIQVASRRMAYCSQQPWLPNGSIKQAICGMD
                     DNQDDIQWYQRVLEACCLSHDLELLPDGDETEIGSGGLNLSGGQRQRVALARALFARC
                     DIALLDDVFSALDGDTEMRIFRNLFGPTGLFRQLNTAVVLVTNSAQFFPPADLIRVLE
                     GGSIKIQGSWEEIRHKAHSSISKFSLQHQNDRVVAPAPLSNFTKLNAQPQIRQEAKAD
                     LVRKTGDLGLYWYYFRFVGLFNLALLAGCTASYSFFITLPQQWLKLWTESSGQNQVFY
                     VLGFILLSLLSWTSTNGTMWSAVIRIAPHSGLIIHQHLLTIVSNAPLSFFSNNDNGSI
                     LARFTQDMQLIDKQLPSALANLGNQIFKLLAQVLLLCIAQRRLALSLPVCGSLVWIIQ
                     KVYLRTSRQLRFLELESRAAVLSSFLESVEGLETIRSFGWLSEITDQNNKRLEDSQRP
                     EYLLMCLQRWLNLVLDMIAATVAIGIIAAAVALRGQIQAGQVGVALNIMLVANTTLLR
                     LIESWTSLEVSLGAIARLQALETTTPSEFDKNAIFEPPRGWPTRGQVEFKGVTAVYNA
                     EAVALRGVTLTINAGQKITICGRTGSGKSSFLLALLRMLDVQSGSIELDGVNIAKIPR
                     DFLRQRCFVTVSQDGFLLPSETLRSNLDPERLLGDDYIIIDTLKRVGLWSHFSPAGQS
                     SKEYYRGDGHPILDQKLSSFSAFSAGQAQIFTLCRGILKAEALRADGGRPVVLLDEVT
                     SALDSSTEWAVQRIFEAEFAAKGHTIIMVSHRLGQLSEFMRPRTDLVVRMRDGRLESA
                     VSDLKGAAGD"
     gene            2007489..2008964
                     /locus_tag="MYCTH_2308471"
                     /db_xref="GeneID:11507212"
     mRNA            join(2007489..2007989,2008054..2008964)
                     /locus_tag="MYCTH_2308471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665058.1"
                     /db_xref="GeneID:11507212"
     CDS             join(2007589..2007989,2008054..2008654)
                     /locus_tag="MYCTH_2308471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665106.1"
                     /db_xref="GeneID:11507212"
                     /db_xref="JGIDB:Spoth2_2308471"
                     /translation="MERVIAALTASQISRFFSANGRPTQQECDKLAERITGQPAMPAP
                     VQGGSSYTVIAGDYVIQFRAPNAVLNLEFLGHVEKAYHGFMPCHSDSGTFGELFVYKM
                     RNVGGVSLYLARGSLYENDCFLLRETIMDFARFFASAWHKTPMAIPLPDRRLLHCKYT
                     SQLSQLSAGLPERFRSVLNRLIPRLRYITAVEWPLVPNHIDLLENNIHVDPSTGKLTG
                     ICDWAGTEISPFGMSLGAVENMLGIPKLDRESGRTDHVYHANHRELRGLFYDELYSAI
                     GSVSDRDKERIEDARLVGLFLTNAWRYDEAGNQLPAGEEEHGLQHLDAVLRATCDEY"
     gene            complement(<2009336..2010301)
                     /locus_tag="MYCTH_2144720"
                     /db_xref="GeneID:11507213"
     mRNA            complement(join(<2009336..2009761,2009808..2010084,
                     2010152..2010301))
                     /locus_tag="MYCTH_2144720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665059.1"
                     /db_xref="GeneID:11507213"
     CDS             complement(join(2009336..2009761,2009808..2010084,
                     2010152..2010165))
                     /locus_tag="MYCTH_2144720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665107.1"
                     /db_xref="GeneID:11507213"
                     /db_xref="JGIDB:Spoth2_2144720"
                     /translation="MSRRMYNALAYITNRTELQTNIPGNISDLLRIIDRHSMGDKFRN
                     HSLHRHTMLPDTTIRLETDAGETGYKWANATPIEDVDLNRVHPTFFKLHDGRLAIPEA
                     FFVEFSAHVAQNKLADMVALELGDFADLRRRKDSVTAEIEVQWGEGGVPFTLSVSVKD
                     LVDADGKERRLVPTAWTVPISRGGPRDSSPDKPAPGTHWNEATKPHGSKTHKVHVDSS
                     EDVTPNLLVQKLVGMAILRG"
     gene            complement(<2013355..>2014374)
                     /locus_tag="MYCTH_95997"
                     /db_xref="GeneID:11507214"
     mRNA            complement(join(<2013355..2013450,2013644..2013654,
                     2013990..>2014374))
                     /locus_tag="MYCTH_95997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665060.1"
                     /db_xref="GeneID:11507214"
     CDS             complement(join(2013355..2013450,2013644..2013654,
                     2013990..2014374))
                     /locus_tag="MYCTH_95997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665108.1"
                     /db_xref="GeneID:11507214"
                     /db_xref="JGIDB:Spoth2_95997"
                     /translation="MPKHEMTKSDSSRIQSLITGGGYQYLSSNVVFEKLSDRSPKDAP
                     LHLWRTNTTMQQSNVKDSSNSSAFYDHLHENGASRLPYSLASYQKATEGTGGQFDRLA
                     FGGSAFGGSAPVLYRLHQPGDQLSSKQTIDKVAKGRYYHVQFVPKVRSRGFGIEPGMD
                     GLK"
     gene            <2014882..>2015415
                     /locus_tag="MYCTH_2020741"
                     /db_xref="GeneID:11507215"
     mRNA            join(<2014882..2014992,2015095..>2015415)
                     /locus_tag="MYCTH_2020741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665061.1"
                     /db_xref="GeneID:11507215"
     CDS             join(<2014882..2014992,2015095..>2015415)
                     /locus_tag="MYCTH_2020741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665109.1"
                     /db_xref="GeneID:11507215"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Spoth2_2020741"
                     /translation="SVHNDRAREREEFTDFVLVCGPERFPVHKVIICSQSKYEIAEQS
                     PAMVRRMVEYFYTGNYKDCGEPTQDPSKETPECSDEEGLTALCIHARVFALAEMYQVD
                     GLQSLAVTKYGKALARSTNIQDLLDSIPDVYQLTPCTVRALR"
     gene            <2016464..>2017740
                     /locus_tag="MYCTH_2067458"
                     /db_xref="GeneID:11507216"
     mRNA            join(<2016464..2016601,2016784..>2017740)
                     /locus_tag="MYCTH_2067458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665062.1"
                     /db_xref="GeneID:11507216"
     CDS             join(2016464..2016601,2016784..2017740)
                     /locus_tag="MYCTH_2067458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665110.1"
                     /db_xref="GeneID:11507216"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="JGIDB:Spoth2_2067458"
                     /translation="MVLLRHPTAVLALISSLLLSPAVQAASLESVLADQANLTMFRGL
                     VKNTVQETLKYHILKGTIDMPSIVKGDSIWAATTLTDRNYSTVTGGQHLILTKQPGGE
                     VVFTSGFATRGTVVVEDLQFDSGLVQITDSVMHVPETLESTARNAYKDLAAFVGALYA
                     TDLYDEVAGWEDVTIFAPRNAAFQQLAGTFAAMDRDDLRRVLRYHVVPGRLSHVWELR
                     NASALASADGGTEVAITRQANSIFVNSAEIIQPDILLANGVAHLIDNVLDPGQPDARP
                     DFSLTTQQPPVFTPLGTATATGANVPTPFASNLPCTPSCVGGTRATAAPTGSGGADSS
                     NAGGALPRCTGLAGAGLGIGLAVGAIMAGF"
     gene            complement(2043824..2045730)
                     /locus_tag="MYCTH_2308475"
                     /db_xref="GeneID:11507217"
     mRNA            complement(2043824..2045730)
                     /locus_tag="MYCTH_2308475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665063.1"
                     /db_xref="GeneID:11507217"
     CDS             complement(2043925..2045634)
                     /locus_tag="MYCTH_2308475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665111.1"
                     /db_xref="GeneID:11507217"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="JGIDB:Spoth2_2308475"
                     /translation="MTAELSAAPVLSTPAEHVFEYAVTSPEADAQAPPKSDDELRAVY
                     EIARTAREVRQGGWKRIALQFPDHMLRDGPRVVQALNAELESLGRSGDPSERPEKIYI
                     LADTSYSACCVDEIAAEHVNADVVVHYGRSCLSPTSRLPVVYVFTHHDLDHGETLAAF
                     EKQYPDKDAEVVLMADVTYQDHVPALASELHKRGYANLLSTAIVHDPTGAIPNRKLVL
                     PGGEATDADPSAVDLKSHSIFHISTPPTALLLALSSRVRDLHIHPTTDPTSGATSSAA
                     AFSTARLLGRRYARLLTLASAGIIGILVNTLSVANYLSSVEAIRARIAAAGKKSYTVV
                     VGKLNPAKLANFAEVEGWVVVGCWESSLVEDGDADGYYRPIVTPFELDLALVGDDRRV
                     WTGEWWGGIEVLGRASGMEKEEKVSGEEAGVRGKMEMGGENERVNGSRDEDRNDEEEE
                     EEDEEESAPPEFDLRTGKLVSHSRPMRSGTTRANGKAKQEGGTRPEEGQARSSSALAL
                     RPKAELATVNGVVSPGAEYLRSQRTWQGLGSDYVMEESAAIEEGRSGVARGYTVGEAA
                     ERR"
     gene            complement(2045995..2048274)
                     /locus_tag="MYCTH_2308476"
                     /db_xref="GeneID:11507218"
     mRNA            complement(join(2045995..2047134,2047253..2048274))
                     /locus_tag="MYCTH_2308476"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665064.1"
                     /db_xref="GeneID:11507218"
     CDS             complement(join(2046200..2047134,2047253..2047958))
                     /locus_tag="MYCTH_2308476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665112.1"
                     /db_xref="GeneID:11507218"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308476"
                     /translation="MGEKNDGVRPAVACLSDASYTASDSSALSLSLPDPKKAGLIPDS
                     TSSDTVSADKPGTFQKDNTTTSAITEGKQASSDSPSDEDGDYNKHKHRNNNTNNHKND
                     DDNNNNDNNDGCGVDDDLPTGAALTLHPSAATTVDFPEGGLTAWLVVLGSFCAMLSLF
                     GLINSAAVFESYFTTHQLAHKTSSEIGWIFSLYLFIVFFVGIQVGPVFDRFGARVLVA
                     AGSGLIFLSLLLLSWCEEYYQIILTYSVLGGLGGALLNSPAYGAIAHFFNVRRGLATG
                     IATTAGGVGGVVFPVLLRALLPGVGFAWSCRVLAFIMLGLAVPSNLFIKTRLTPAKGQ
                     DGRRKVQSVWPDFSVFTDARFAFASIGIFFMEWGLFVPLTYIVSYAVAHGQDATESYL
                     LLSYLNAGSVLGRVLPGFLADRLGRFNVIIVTIALCVITVLALWLPAGSSQAMLIAYA
                     VLFGIASGSNLGLVPVCLGQLCDHRRYGRLFSTAMMVASFGTLSSVPIGGAILDLGSS
                     ESAWRNLVIFAGVSYFVALGCYTTARILGAGWDPREIF"
     gene            2050331..2052623
                     /locus_tag="MYCTH_2308477"
                     /db_xref="GeneID:11507219"
     mRNA            join(2050331..2050615,2050691..2051071,2051201..2051590,
                     2051775..2052130,2052365..2052623)
                     /locus_tag="MYCTH_2308477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665065.1"
                     /db_xref="GeneID:11507219"
     CDS             join(2050778..2051071,2051201..2051590,2051775..2052130,
                     2052365..2052596)
                     /locus_tag="MYCTH_2308477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665113.1"
                     /db_xref="GeneID:11507219"
                     /db_xref="InterPro:IPR001258"
                     /db_xref="JGIDB:Spoth2_2308477"
                     /translation="MGPHSTLAGVIALAALLVTDVSAQSCPGVTGRFQPKMGSGYRYS
                     VLATGLRNPRHIAVDAAGNLLVAEAGSQAVRRLVLQDQGDIVCVQSNTQIISGSTNHG
                     IALSADGKTLFTSNLASVTAYSYDAATGQVGQARPIVTGMSFQGSHPTRAIATSKWSP
                     DTILVARGSQSNIDTLAVDRAAARSMIKTFSISQGLQAAHDYATGGEVLAWGLRNIVG
                     MTEDPVFGGIWSVENQMDDLRLNGRDIHNDNPAERLSYHGILNDTENRYKGLNYGYPS
                     CVPAWDPQNVGIDGLLVGSLFKPDNVPNVDANECANNRMTGRLHFHAHTAPLDIKFNK
                     NSTAAYIAFHGSWNRNPADGYRVTRVDFADGQPVHHVTSRTAQVPVMENSNIGACPMN
                     CFRPVGLAFDEKGRLFVSSDSSGEIYVIYGA"
     gene            complement(<2054400..>2055452)
                     /locus_tag="MYCTH_2119965"
                     /db_xref="GeneID:11507220"
     mRNA            complement(join(<2054400..2054672,2054770..2055025,
                     2055085..>2055452))
                     /locus_tag="MYCTH_2119965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665066.1"
                     /db_xref="GeneID:11507220"
     CDS             complement(join(2054400..2054672,2054770..2055025,
                     2055085..2055452))
                     /locus_tag="MYCTH_2119965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665114.1"
                     /db_xref="GeneID:11507220"
                     /db_xref="JGIDB:Spoth2_2119965"
                     /translation="MEEIRRAALEQEQLFRVLQISEKLELINTPFLDQEHLDYLGVAV
                     RQPLDVDDDGTRDFDPRFFESWLPDELVAEVACDELWMDRLGPDMSPAEWRFEDYKFR
                     WFQHCLEQLYEMDNEIWDPWFTDALEIRQCTGLALPFRQRLMPEEYYLPVAAFFPVDK
                     TKPHVACVMADSNVAPGDQVLYSEVHSAVRLVRFRLEQGQHTGHHTKPGMLYTLHRDL
                     FARITQVHFDGKSSKLVLRRSRRLDLRGPEPPKDAYLLVRWVANRPVGQTEYVDEPEP
                     DEWTTTKDSSNTAPRILLGYAS"
     gene            complement(<2056238..>2058428)
                     /locus_tag="MYCTH_2068188"
                     /db_xref="GeneID:11507221"
     mRNA            complement(join(<2056238..2056475,2056983..2057258,
                     2057374..>2058428))
                     /locus_tag="MYCTH_2068188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665067.1"
                     /db_xref="GeneID:11507221"
     CDS             complement(join(2056238..2056475,2056983..2057258,
                     2057374..2058428))
                     /locus_tag="MYCTH_2068188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665115.1"
                     /db_xref="GeneID:11507221"
                     /db_xref="JGIDB:Spoth2_2068188"
                     /translation="MATAKRHDVAKTINEWASAVREDEDIRDEVKRHGRLTQLAVSDC
                     LFDKSGSDITHTEYLHLRTIWYRYNGTHIESFTRLFRDDKETGYKGFISHTADEWASR
                     LMSQKLAPLDQYLHEFQRRQGDPEYLHPSPASGYFAMVRYWQVMAITHTKGDNEGRSK
                     IFKPRIGSGPLVGTSSARPVTPPQQQEPQGADLPSQPSTSGIPPISATPAARSYPAAR
                     GTAENRPSADEAYVNTALLLLLQAVTQLFHKNFEPLHWVPPRMALHLKVPTANQETRK
                     YDESVLLEARVDGYLCNGALEGGLSRPLAICEAKSAVRSSIQVPTERQEAAEMAAWIC
                     NSQSHVGLLQASASGRKRRLMISQTRDEIWIIIGEYGQAYEEYIRNAPLKAGMTTTRP
                     PPLKHTRPDLLASNFEETLGSPAFLDQIEKMGVEGDIKGWKDPAVQAALSERAKARAT
                     QQASVGDNPKKPVQTPDLPKIDGFLVMHRFGPWKTFDKENMQVFVRRLLGLMIELHIN
                     ESSHSHSASSGSSK"
     gene            complement(2059850..2064124)
                     /locus_tag="MYCTH_2308482"
                     /db_xref="GeneID:11507222"
     mRNA            complement(join(2059850..2060824,2060900..2063307,
                     2063363..2063531,2063585..2063632,2063684..2064124))
                     /locus_tag="MYCTH_2308482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665068.1"
                     /db_xref="GeneID:11507222"
     CDS             complement(join(2060144..2060824,2060900..2063307,
                     2063363..2063531,2063585..2063632,2063684..2064010))
                     /locus_tag="MYCTH_2308482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665116.1"
                     /db_xref="GeneID:11507222"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="JGIDB:Spoth2_2308482"
                     /translation="MGEKSAAGVRTPAKIPTTAKKAPSTGKQQSILGFFSRTGGAGST
                     NGASSSPSTKPASTSKRDTSPRCLKETTRVNSMLARRTTTVTPLPSSDAIEPSSSQEN
                     RDTTTVKSVADEEATLHSSPSRKAKKTVNYAESSDEDDDEIFATLKARRSRQRRPRAT
                     VADEDDGDTYEADENDYEEDDDDLADFVVSDDSDAPSRTKKRKRGAVKPTGPRKKANL
                     SSSPSPDMRSPSAVDDEEMLDIPPSTSTAQKWKYDPDSIGPSEPASRAVPPTQKPSGP
                     KPKPKAHTKEPEERYPWLANILDGNKNPPGHPDFDPTSIYIPPMAERGFSPFEKQYWD
                     IKKNLWDTIVFFKKGKFYELYENDATIGHQLFDLKLTDRVNMRMVGVPESSLDMWVNQ
                     FVAKGYKVARVDQMESALGKEMRERESNAKKADKVIRRELSCILTAGTLVDGSMLQDD
                     MATYCAAIKESVVNDKPAFGIAFVDAATGQFFLSEFEDDVDLTKFETFVAQTSPRELL
                     LEKSRLSTRALRILKNNTGPTTIWNYLKPGTEFWDAELTRRELECGGYFSTEEGKEGV
                     WPEKLNEAKDKDLAMSALGGLTHYLRLLKLDQSLLSQGNFTWYSPIHRNGTLILDGQS
                     LINLEIFANTVNGGPEGTLFNLLNRCITPFGKRLLRQWVCHPLCSIEKINERLDAVDM
                     LNADRSILQQFSSQMAKMPDLERLISRIHAGACRPEDFVRVLEGFEQIDYVMGLLGAF
                     GGGNGLVDKLIASMPNLKEPLGYWETAFDRRKARDEKLLIPEKGIEEDFDNSLNELDR
                     IRDELHALLERQKTALKCKTLKFTDVGKEIYQIEVPKAVKVPASWRQMSATSTVKRYY
                     FRELEDLVRELQEAEETHSQIVKEVASRFFKRFDVDYDIWLQAIRIIAQLDCLISLAK
                     SSSALGTPSCRPVFVDDDRSVIEFKELRHPCMVNTVADFIPNDIKLGGDEAKINLLTG
                     ANAAGKSTILRMSCIAVIMAQIGCYVPASSARLTPIDRIMSRLGANDNIFAAQSTFFV
                     ELSETKKILSEATPRSLVILDELGRGTSSYDGVAVAQAVLHHVASHIGCVGFFATHYH
                     SLAAEFAHHPEVRARRMQIDVDEERKRVTFLYRLEDGVAEGSFGMHCAAMCGIPGRVI
                     ERAEVAARAWEHTSRLKESLEQAKLGCYIPLGVQSDVASLLREDGEEEVGERGLEVLL
                     RAIEAL"
     gene            2065915..2068367
                     /locus_tag="MYCTH_2308484"
                     /db_xref="GeneID:11507223"
     mRNA            join(2065915..2067059,2067119..2067257,2067314..2068367)
                     /locus_tag="MYCTH_2308484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665069.1"
                     /db_xref="GeneID:11507223"
     CDS             join(2065930..2067059,2067119..2067257,2067314..2068216)
                     /locus_tag="MYCTH_2308484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665117.1"
                     /db_xref="GeneID:11507223"
                     /db_xref="JGIDB:Spoth2_2308484"
                     /translation="MHSKRTGLEKALHQVEQALRRTSSGAEATKIVSELKVLLGPGPH
                     GPISLLNHDQSGTRSAEPRRESKQGDILLPDASSDAGDSSTSDQDAMSVPQGSTPSQG
                     HVAEESLAVDDAENPLQLLARASDLHVSPKSGADHVAAEHMSHQRTRQNKQSEKISEV
                     EKFFKLSQFSLDTGPDLDPINLGLVTAEEAETLFNFFHQNLAHTRWGLDPALYTASFT
                     RSRSAFLFTSIAAAAALFMPSASALSRRLSNHCKTLVNRIILDRYRSVEIVLAFMVNV
                     PWMFPGKHSTDDETCWYVSMATTMALDLSLHKILVPVASLRDGACGRAGSYGGIARAD
                     CIDPKVALALDGFADVDPNSEFGMRLLRRRERCWIALFVLERGMCLARGRCYTLPITP
                     ILRGCDQWHLSNIADAMDGHLVSMAVLRRDLDELFSSIRTLCDESRDGRVDGAMVARS
                     IQMMVEKFFDEWHAKWGISIGSGPQHRLPPYVQILVTHTRLSIYSTVINHPTAPTEVR
                     HFFHAAGLSSALNVMRAAIQGEGQLSSMPNNTAIMISFAACFALRLSGQFAGNSNLAP
                     SVRTLIGETAEVLERIGSTTEHRNGMSTLYGKYLKYIVKKAAAAAPAPSENGTRPRAG
                     TQPEMLSRHHPAAAYARGNNARASFSVADTIHRSPPVSNFMEPPLWSEPVQFSSMSDD
                     QIVEALSRVNNEFDPGLSMYPWDDAAALDWLNWSNLPDFGT"
     gene            complement(<2068388..>2069778)
                     /locus_tag="MYCTH_2128965"
                     /db_xref="GeneID:11507224"
     mRNA            complement(join(<2068388..2068477,2068542..2068704,
                     2068778..2068796,2068889..2069048,2069105..2069304,
                     2069372..2069439,2069511..2069535,2069606..2069637,
                     2069738..>2069778))
                     /locus_tag="MYCTH_2128965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665070.1"
                     /db_xref="GeneID:11507224"
     CDS             complement(join(2068388..2068477,2068542..2068704,
                     2068778..2068796,2068889..2069048,2069105..2069304,
                     2069372..2069439,2069511..2069535,2069606..2069637,
                     2069738..2069778))
                     /locus_tag="MYCTH_2128965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665118.1"
                     /db_xref="GeneID:11507224"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2128965"
                     /translation="MAGQKGTKQPFWLGGAAASMAVCFTHPLDLTKYRMQVLQTRAPM
                     LSTLYKFALRDGLLSLWSGLSASILRQSTYSTARFGLYNLLSRQMQQKSETSKLSTAS
                     TIACAGVAGGLAGMIGNPTEVILVRMCADAAKPIPERFGYSDAVTGLYRIGKEEGIRV
                     FGRGLSANVVRSVLMNVSQIAPYAAAKRTILSRTNLRDDIRTHALASLFAGTVATTAC
                     APADVLKSRIQNAAKGSTVMQVVKEGLSREGPMFLMKGWTPAWLRLT"
     gene            2070584..2072190
                     /locus_tag="MYCTH_2308489"
                     /db_xref="GeneID:11507225"
     mRNA            join(2070584..2071035,2071220..2072190)
                     /locus_tag="MYCTH_2308489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665071.1"
                     /db_xref="GeneID:11507225"
     CDS             join(2070796..2071035,2071220..2072095)
                     /locus_tag="MYCTH_2308489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665119.1"
                     /db_xref="GeneID:11507225"
                     /db_xref="JGIDB:Spoth2_2308489"
                     /translation="MPDPAARNRKSLKKRVDKRAAAAASRDMSKLSPSLKALINAPFA
                     RPGQAPAPRHIRDVYTRIAHEARERRYGERPWVTLSAAATFTLNSPASLLVLHELAPG
                     LSGGVLSPLAAAELIREVGLKCISFNGIPRTINCLGAFRAGVAHHPWAADLAARAPSR
                     EVTPAALPAVDARGRALWHSVYTPFDDKLVAKLADSHPDLPVHILGSHYGPLLSDPPR
                     PRSGTAPASSPSSPSSPSSPSSLPPPAEATVGRNLTSVVAVACLRAQTGVGPQVLSHV
                     FGLRKGVEQGAHRDEAAAALGPERGPAEADGLERLASDEGCEWLLRSVDAIAEAVGPS
                     FARWDGEGQGEGKSQGQGKSENGSESEGEGGKEKAKL"
     gene            complement(2072351..2074712)
                     /locus_tag="MYCTH_2308492"
                     /db_xref="GeneID:11507226"
     mRNA            complement(join(2072351..2072560,2072669..2073008,
                     2073122..2073233,2073320..2073808,2073930..2074214,
                     2074303..2074712))
                     /locus_tag="MYCTH_2308492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665072.1"
                     /db_xref="GeneID:11507226"
     CDS             complement(join(2072426..2072560,2072669..2073008,
                     2073122..2073233,2073320..2073808,2073930..2074214,
                     2074303..2074582))
                     /locus_tag="MYCTH_2308492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665120.1"
                     /db_xref="GeneID:11507226"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="JGIDB:Spoth2_2308492"
                     /translation="MLARQACSCSRQLAAVAVSGVSRGLRAPLLPGGTRLAIGCTRSF
                     SQSRHRRSVAAPDVDRAASKVWKSADEAVSDINSGSVILSSGFGLCGVASTLITALRN
                     RGPESLHSLTVVSNNAGAEGRGGLALLTENGQVDRMIMSFLGSNKKLERQYLTGKIAV
                     ELCPQGTLAERIRAAGSGIPAFFTPTGGNTLVQQGAIPVRFDADGNVVEYGRPRETRI
                     FNGRTYLMETALPGDVAILRAWKVDKAGNCVFRYTTKSFAPLMAKAAKLAIVEAENVV
                     EVGEIDPNDVDLPGIFVDRIVPATEPSQIEVLKTRSAGDDGKAVKSKGDAQVRRDRIA
                     RRAAKELKQGYYVNLGVGIPTLAPSFLPPGQQVWIQSENGILGMGDYPLPDQVDPDII
                     NAGKETTTLVPGAATFDSSESFGMIRGGHVDVSILGALQVSAAGDLANYMIPGKVFKG
                     MGGAMDLVSNPDNTKIVVATEHVAKDGTSKIVQTCTLPLTGARVVSTIITDLCVFQVD
                     RKHGTLTLTEIAPGVEAEEVKNKTDAAFTVAEDLKLME"
     gene            <2075878..>2078506
                     /locus_tag="MYCTH_2128968"
                     /db_xref="GeneID:11507227"
     mRNA            join(<2075878..2076026,2076156..2076311,2076526..2076794,
                     2076986..2077071,2077158..2077297,2077371..2077500,
                     2077582..2077678,2077767..2078036,2078232..2078316,
                     2078389..>2078506)
                     /locus_tag="MYCTH_2128968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665073.1"
                     /db_xref="GeneID:11507227"
     CDS             join(2075878..2076026,2076156..2076311,2076526..2076794,
                     2076986..2077071,2077158..2077297,2077371..2077500,
                     2077582..2077678,2077767..2078036,2078232..2078316,
                     2078389..2078506)
                     /locus_tag="MYCTH_2128968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665121.1"
                     /db_xref="GeneID:11507227"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2128968"
                     /translation="MSATHSAEHDKEKGESEHAPSAQVGFVSNAETFANEARLTRRIL
                     FKTDTRIIPILSLLFLCSFLDRTNVGNARILGLEDDLGITNLQYNQGLAVFYATYIVS
                     EIPSNLILKAMTPTVWLPVLTALWGIITMCLGFVRNFASFFAVRAVLGLAEGGLLPGI
                     VLYLSGMYTRREMALRIGVFYTAASLSGAFGGLLARGLSAIGPRGGLEGWRWILMIEG
                     LITVVAAAMAYLLLPTSIATASYLNEEEKSFALRRLQGLTPSARDDRFDPVREREEEF
                     KWSEVRRGIFNIQVWLSATAYFAILSGLYSFGLFLPTIVEDLNITEGPNETQLWTVIP
                     YAVATPITVFVAMLSDRLNRRGTLMLTTLPISIVGYAVIANVISARVRFAMTCLMAIG
                     MYASVPCVLVWNSNNSAGHYKRATTSALQLAVANCGGFVATFIYPSKDKPLYHKGHTI
                     VLGLLVYAWFAILANVLWCAKINKDKRDGKYAQYEGSGDDRDPKFKMVL"
     gene            complement(2078713..2078794)
                     /locus_tag="MYCTH_t156"
                     /db_xref="GeneID:11507228"
     tRNA            complement(2078713..2078794)
                     /locus_tag="MYCTH_t156"
                     /product="tRNA-Ser"
                     /note="Anticodon: CGA"
                     /anticodon=(pos:complement(2078758..2078760),aa:Ser,
                     seq:cga)
                     /db_xref="GeneID:11507228"
     gene            complement(2078906..2078979)
                     /locus_tag="MYCTH_t155"
                     /db_xref="GeneID:11511497"
     tRNA            complement(2078906..2078979)
                     /locus_tag="MYCTH_t155"
                     /product="tRNA-Val"
                     /note="Anticodon: AAC"
                     /anticodon=(pos:complement(2078943..2078945),aa:Val,
                     seq:aac)
                     /db_xref="GeneID:11511497"
     gene            complement(<2079159..>2079626)
                     /locus_tag="MYCTH_2128969"
                     /db_xref="GeneID:11511496"
     mRNA            complement(<2079159..>2079626)
                     /locus_tag="MYCTH_2128969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665074.1"
                     /db_xref="GeneID:11511496"
     CDS             complement(2079159..2079626)
                     /locus_tag="MYCTH_2128969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665122.1"
                     /db_xref="GeneID:11511496"
                     /db_xref="JGIDB:Spoth2_2128969"
                     /translation="MAVCGVWKRPVARMRRAIMTASKMSAQTLCFRGCVWAGGNLAAE
                     LPSRSATPQLCQREPQNKGPQGRRPGRATARPRSATVPSCDAVRSPAAAAAHARRKKA
                     VPVRVGSKPDLAQLPAIGGSAPGSPFAATGMRGTCLGPDARTGSETGLLQVHP"
     gene            complement(2081023..2083496)
                     /locus_tag="MYCTH_2308494"
                     /db_xref="GeneID:11507229"
     mRNA            complement(join(2081023..2081560,2081638..2081749,
                     2081869..2083496))
                     /locus_tag="MYCTH_2308494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665075.1"
                     /db_xref="GeneID:11507229"
     CDS             complement(join(2081380..2081560,2081638..2081749,
                     2081869..2083354))
                     /locus_tag="MYCTH_2308494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665123.1"
                     /db_xref="GeneID:11507229"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2308494"
                     /translation="MAPSQGSGAPATDPDADPEAAGAFAPSPTSSTHLKTGAVLNYTT
                     INPTTPSANHGAGGPHDESPTIPGIENNADTAPTAVEAARLRRGLAQRHLSMLGIAGS
                     IGTGLFLGLGGAVQRGGPLGALLGYAVIGLVVCAVQFALGEVAALMPVTGSFVRHAEA
                     LVDPAWGFAIGWNLVYGNLLSIPSEATAVVVLVRYWWEDVSAAWIIIVFVVLTAGVGL
                     AFVRVFGEVEFVFALVKILLVIFLIILGLVINLGGVPGTERIGFRYWKDPGPFVEYIA
                     TGGWGKFLGFWAVMTGAVFSFAGVESLAMAAAETTNPREAIPRACKRVFIRIVLFYML
                     AVLVVGMLVPSNDDRLDGSGSTVAQSPFVIAASQAGISAIPSVVNAVVITSAWSASNQ
                     ALLAGTRVLYGLAVKRQAPGIFLRTTPWGTPYVCVLLFTAFMFLSFMSLSEAAITVFW
                     WLVSLTAAGVLFSWSSILFNHIRLLQALNRQGIDPSRLPWHNWWTKYSSPAGLFMCVI
                     ILLTSGFSVFTRGNWDSAQFVSSYLDIPIMLTAFLFWKVFKKTKIVSLDEIPLRDALA
                     RADDYYPEQTLSKKSGWIRAISWIWD"
     gene            complement(2084078..2085726)
                     /locus_tag="MYCTH_2308497"
                     /db_xref="GeneID:11507230"
     mRNA            complement(2084078..2085726)
                     /locus_tag="MYCTH_2308497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665076.1"
                     /db_xref="GeneID:11507230"
     CDS             complement(2084379..2085443)
                     /locus_tag="MYCTH_2308497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665124.1"
                     /db_xref="GeneID:11507230"
                     /db_xref="JGIDB:Spoth2_2308497"
                     /translation="MLAQLVPPLAALATLASAHGVILAAQGEAGSPPSVGFQVNDAIA
                     RNCTTINPCQMDTTIIRDAEIAAGTVNSCGRTKLTGNIDVGEATENALAAKAVTQVKA
                     GTQLQITIHQVNADGAGPYFCDLDESSNTGVFTHNLTVTNNVPGSNGLSQVQAKDFNI
                     TVALPDNLNCFGASTGNVCTVRCRNNAQAGPFGGCFAVQQTDNTPLPAANQPSDIKTE
                     DTLDKINFEVASNQAALPAAVEANRIAGGTEAEQNRAAVEAILKLSTTLANFPTLTPT
                     VIDAGTATPTPTPTGGAAGGNNNGTGNGTGTGTGNGTGRSRGRTGRNRGGNAANDNSN
                     RSSSSSSSESENGDEAETGN"
     gene            2100800..2102062
                     /locus_tag="MYCTH_2308500"
                     /db_xref="GeneID:11507231"
     mRNA            2100800..2102062
                     /locus_tag="MYCTH_2308500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665077.1"
                     /db_xref="GeneID:11507231"
     CDS             2100887..2101834
                     /locus_tag="MYCTH_2308500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665125.1"
                     /db_xref="GeneID:11507231"
                     /db_xref="JGIDB:Spoth2_2308500"
                     /translation="MSNLPTLVLVHGAWHRASCFNPITSLLQEKHGLKCILVSLPSTS
                     GSPEATFKDDIDVVQEAIASETSAGRDVVVIAHSYGGMVGSSAIKGFAKKTGSAPDVA
                     GHVIGLILIASGCNLPGLSFMDPFFGHPPPSWRVNKETGYAELVVSPRELFYHDVPAD
                     EAEYWVSQLTTQSLKALFEGGEHSYAGWKDVPVWYIGTIEDRGLPVVAQRLGIGMARA
                     MGGVIEHREMQTSHSPFLSQPKETVGIILEAVEAFTGRPVEATPTSRSPPKGVTVPAV
                     RLWQPLTWYRFGLPLSFGRLMGGAFLFFGWCRKVFGGSK"
     gene            2102063..2102690
                     /locus_tag="MYCTH_2308501"
                     /db_xref="GeneID:11507232"
     mRNA            2102063..2102690
                     /locus_tag="MYCTH_2308501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665078.1"
                     /db_xref="GeneID:11507232"
     CDS             2102073..2102240
                     /locus_tag="MYCTH_2308501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665126.1"
                     /db_xref="GeneID:11507232"
                     /db_xref="JGIDB:Spoth2_2308501"
                     /translation="MLEDPNLGHTFLVIDALDECVTDLPLFLDYIVAKSPVFSCVKWI
                     VSSRNWPDIEN"
     gene            complement(<2118068..>2118919)
                     /locus_tag="MYCTH_2112012"
                     /db_xref="GeneID:11507233"
     mRNA            complement(<2118068..>2118919)
                     /locus_tag="MYCTH_2112012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665079.1"
                     /db_xref="GeneID:11507233"
     CDS             complement(2118068..2118919)
                     /locus_tag="MYCTH_2112012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665127.1"
                     /db_xref="GeneID:11507233"
                     /db_xref="JGIDB:Spoth2_2112012"
                     /translation="MPETFKVIKKSYNHYTAAFIFYGNSHTKSSPATGVEYHALQSLS
                     LPTILTTMGSICSRPEEPKVRVLAHPIRDSVALRQRISLNRQTLARILEQIGHPAAHH
                     ARRQPGPSGRLGGPQKNRAQTSSSLPCESKTGRNRRTMRSSFGHTIMRKRRTAKPINV
                     NKPLPPLPALPPPPPPPSSLSTTTPTPTPIPTSTPIPTAVSAGRAEPAPEHKHQKAHA
                     QHEREHIARHRAEALRCLESRGRARGRAASHSPTRVPSIILRRIVGRRRAGAILLGGE
                     GGMRVVC"
     gene            complement(2119695..2121240)
                     /locus_tag="MYCTH_2308502"
                     /db_xref="GeneID:11507234"
     mRNA            complement(join(2119695..2120346,2120510..2121240))
                     /locus_tag="MYCTH_2308502"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665080.1"
                     /db_xref="GeneID:11507234"
     CDS             complement(join(2119780..2120346,2120510..2120563))
                     /locus_tag="MYCTH_2308502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665128.1"
                     /db_xref="GeneID:11507234"
                     /db_xref="JGIDB:Spoth2_2308502"
                     /translation="MLFAIMFAFWRFAEIVTLIPITGMLAWFVDGYLDANVMTPAHIL
                     ILFIVSVLALAWSIFTLFSYHRSSANAHFVALVDLAFVGALIAGVYYLRFVARTDCAS
                     VRPGSPTDISLGIFGNARINYGLPEISVSKTCAMLKASFGLGIMNTIFFFITAVLAWI
                     HGDNAARSERRRTYSRHASRSRHRSHSGHRHGGSRRSSHSHHRAYV"
     gene            <2121793..>2122248
                     /locus_tag="MYCTH_2128976"
                     /db_xref="GeneID:11507235"
     mRNA            <2121793..>2122248
                     /locus_tag="MYCTH_2128976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665081.1"
                     /db_xref="GeneID:11507235"
     CDS             2121793..2122248
                     /locus_tag="MYCTH_2128976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665129.1"
                     /db_xref="GeneID:11507235"
                     /db_xref="JGIDB:Spoth2_2128976"
                     /translation="MSGIETVLNVSNIKSMPPPPSGINPKAGGVRLAGLTVHSLRELG
                     FPNRLDSLLGVPRLFPGSSEPTASPWEESNPMIPSAAPAEGLDAAEREMLRNALLKRE
                     HVPHQPHHRQVGHRSAAPGSEGVVLYRAMRMAARCAAGSGRVWGVELGR"
     gene            2123479..2125821
                     /locus_tag="MYCTH_2308506"
                     /db_xref="GeneID:11507236"
     mRNA            join(2123479..2124471,2124566..2125031,2125106..2125821)
                     /locus_tag="MYCTH_2308506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665082.1"
                     /db_xref="GeneID:11507236"
     CDS             join(2123643..2124471,2124566..2125031,2125106..2125583)
                     /locus_tag="MYCTH_2308506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665130.1"
                     /db_xref="GeneID:11507236"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="JGIDB:Spoth2_2308506"
                     /translation="MDEDQAPSQIVPEPAPRRTLADRLRGVKKTFLTKEGLIGNYDYA
                     FLFRPTLPFMKKADQPPPFFGLNDRMPVLLALILGFQHALAMLAGIITPPIIMAGSGG
                     ANLSSEQTQYLVSTSLIVSGLLSAIQITRFRILKTPYYIGTGLISVVGISFAIIPVAS
                     GAFSQMYANGFCPTAEDGTPLPCPDAYGALLGTSAVCSLLEILISFMPPKVILRVFPP
                     IVTGPTVMLIGINLIGSGFKDWAGGSGLCSEANPSEFFARCPDITAPHALPWGSAEYL
                     GLGFSVFVTIILCERFGSPIMKSVSVVIGLLTGCIIAAACGYFDRSGIDEAPAVSFIW
                     VHTFKLSVYGPLVLPLMAVFIICACEAIGDITATCDVSRIEVEGKIYESRIQGGVLAD
                     GINGLLAALGTITPMTTFAQNNGVIALTRCANRSAGYCCCLFLVIAGIFTKFAASLVA
                     IPSAVLGGMTTFLFSAVAVSGIAIIARGVPFNRRNRFILTAGLALGYGATLVPDYFSH
                     VFTYDGGNKALRGFLDAIELIMETGFAVTAVVTVALNLGLPVELEDTVAADQPAGAGS
                     SVVRDERGSGSGEEGAELKAVKVA"
     gene            <2126935..>2127728
                     /locus_tag="MYCTH_2066239"
                     /db_xref="GeneID:11507237"
     mRNA            join(<2126935..2127254,2127382..2127427,2127522..>2127728)
                     /locus_tag="MYCTH_2066239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665083.1"
                     /db_xref="GeneID:11507237"
     CDS             join(2126935..2127254,2127382..2127427,2127522..2127728)
                     /locus_tag="MYCTH_2066239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665131.1"
                     /db_xref="GeneID:11507237"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="JGIDB:Spoth2_2066239"
                     /translation="MFRSTFRPLTSAAAAAAATASRRAAVLGSAAPRVSQFHSTARVL
                     IKPGDPLPDTDALMEGSPGQRVNLAEEARKYNSMLLIGVPAAFSPACSATHVPGYASH
                     PRTKEMKAWGETLDPAGQLGIRFFADPTGKFTKMLDMAFDGSAIFGGDRSKRYAIIVE
                     QGKVKSVAVEPDNTGTSVSLAEKVLGPVSP"
     gene            2127921..2128617
                     /locus_tag="MYCTH_2308510"
                     /db_xref="GeneID:11507238"
     mRNA            join(2127921..2128264,2128341..2128617)
                     /locus_tag="MYCTH_2308510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665084.1"
                     /db_xref="GeneID:11507238"
     CDS             join(2128061..2128264,2128341..2128496)
                     /locus_tag="MYCTH_2308510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665132.1"
                     /db_xref="GeneID:11507238"
                     /db_xref="InterPro:IPR003746"
                     /db_xref="JGIDB:Spoth2_2308510"
                     /translation="MSARALWYVAATKKSAKNILYMHCNVKPGASKNREGITSVNDEA
                     VEICVAAQAREGEANKAVIRVLSEVLDLPKSDLQITQGLKSRNKTVAAVGSWVNSGEE
                     ECLKRARECLDKAMENS"
     gene            complement(2128829..2129721)
                     /locus_tag="MYCTH_2308513"
                     /db_xref="GeneID:11507239"
     mRNA            complement(join(2128829..2129075,2129132..2129189,
                     2129267..2129721))
                     /locus_tag="MYCTH_2308513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665085.1"
                     /db_xref="GeneID:11507239"
     CDS             complement(join(2129014..2129075,2129132..2129189,
                     2129267..2129578))
                     /locus_tag="MYCTH_2308513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665133.1"
                     /db_xref="GeneID:11507239"
                     /db_xref="InterPro:IPR013962"
                     /db_xref="JGIDB:Spoth2_2308513"
                     /translation="MAHDGSSHRRARSTSRSRPTTPLRPSSRSSFRDSARNSVQGDSA
                     SFPLNAFEPAFAELSDSIADLEANMMHFQLMHESLARFSESFASFLYGLNMNAFCVDF
                     PEGPITESFKRMKLKEEEQQQNPTRPPERTAGEVDTETTFM"
     gene            2169159..2171410
                     /locus_tag="MYCTH_2308517"
                     /db_xref="GeneID:11507240"
     mRNA            join(2169159..2170464,2170529..2170570,2170625..2170724,
                     2170825..2171410)
                     /locus_tag="MYCTH_2308517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665086.1"
                     /db_xref="GeneID:11507240"
     CDS             join(2169691..2170464,2170529..2170570,2170625..2170724,
                     2170825..2171342)
                     /locus_tag="MYCTH_2308517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665134.1"
                     /db_xref="GeneID:11507240"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008273"
                     /db_xref="JGIDB:Spoth2_2308517"
                     /translation="MTADVAPGRPGNLTPEQEEKLRRLWQLILQVCAVGQENDENNST
                     AANEKAQDEDGKKEKKGRMSFFSRKSKKDSGADSTPGTPANAPVLNLGKDGEADKYGQ
                     TKAFYETLASQSPQSIRNTIWSMVKHDHPDALVLRFLRARKWDVERALIMFVSTMRWR
                     AQEMKVDDDIMRNGEAAALATAETSSDPAEKKLAHDFMAQIRKGISYVHGQDKQGRPL
                     CFVNVRLHRQGEEAEEALERYTVYLIETCRMLLQPPVDTATIVFNMTDFSMANMDYAP
                     VKFMIKCFEANYPECLGAVLVHKAPWIFQGIWKVIRSWLDPVVANKVHFTNSAKEMEE
                     FIPIKHIPKDLEGEEDWTYQYVEPTEGENAKLADSETRDRLLAAREKLYREYEEATLE
                     WIRSGESGDGNAAEIKARRNAIAEKLRVDYWNVDPYLRARSYYDRTGVLLPGGKLNWY
                     PDAKADEVKDAAAAPAPAVETTSDDVD"
     gene            complement(2171493..2172496)
                     /locus_tag="MYCTH_2095112"
                     /db_xref="GeneID:11507241"
     mRNA            complement(join(2171493..2171752,2171812..2171826,
                     2171886..2171978,2172062..2172130,2172204..2172286,
                     2172359..2172496))
                     /locus_tag="MYCTH_2095112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665087.1"
                     /db_xref="GeneID:11507241"
     CDS             complement(join(2171645..2171752,2171812..2171826,
                     2171886..2171978,2172062..2172130,2172204..2172286,
                     2172359..2172404))
                     /locus_tag="MYCTH_2095112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665135.1"
                     /db_xref="GeneID:11507241"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="JGIDB:Spoth2_2095112"
                     /translation="MASKMASCIFCKIIKGEIPCFKLVETEKSLAFLDINPLSRGHAL
                     VIPKFHGEKLTDIPDDHLTDILPIAKKLVKATGAEEYNILQNNGPGAHQVVGHVHFHM
                     IPKPNPQEGLGIGWPQQKTDMDQLKALFEEIKSKV"
     gene            2173013..2174017
                     /locus_tag="MYCTH_2315892"
                     /db_xref="GeneID:11507242"
     mRNA            join(2173013..2173148,2173249..2173464,2173573..2174017)
                     /locus_tag="MYCTH_2315892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665088.1"
                     /db_xref="GeneID:11507242"
     CDS             join(2173069..2173148,2173249..2173464,2173573..2173882)
                     /locus_tag="MYCTH_2315892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665136.1"
                     /db_xref="GeneID:11507242"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="JGIDB:Spoth2_2315892"
                     /translation="MPHSFKRVPLFGGALECELPDNFADVSKIRQVPDNQEVYIDKDG
                     FTSIIFDITQRVEAPGTGLERDGRALTIHLEDLVGEDVDTVKVWNTTETQFTHLDEGT
                     PAYTLIATQTPKAPSNPDESRRAAAPDFTALILTLLRFEKQDSDILITINVPHIKGEY
                     DEEEVDLALGKQGELIGDAVEYAARIWATFKVNDWRLFNEV"
     gene            complement(2174048..2176746)
                     /locus_tag="MYCTH_2308522"
                     /db_xref="GeneID:11507243"
     mRNA            complement(join(2174048..2175350,2175416..2176746))
                     /locus_tag="MYCTH_2308522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665089.1"
                     /db_xref="GeneID:11507243"
     CDS             complement(join(2174213..2175350,2175416..2176203))
                     /locus_tag="MYCTH_2308522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665137.1"
                     /db_xref="GeneID:11507243"
                     /db_xref="JGIDB:Spoth2_2308522"
                     /translation="MARLTRPRTIWSDDEDEEFPDLDALVSRKKYQPQENDLTIQENL
                     KATPKTGLVAKTASTIRRRKLGPITDNLLLKAWAPDSAEADRERNGAGQGKGSSRPKR
                     AGVELRTRNTRPAVAPPPSSPHDEDQEYVSAQEEITIIEDVSMFDDTFHSCNSEDSDF
                     VNGEASEDEDEDVFADSPPRRPRSRPRLGLMDKKPRARAGENAAGSTCSNPKTKPGTS
                     RGPAAKGGISLQQDHTSKLRGTLRMGETSTEGDRDLADSMSKLRLNQTEGETGKSRTS
                     ATSDREITPPSTPPRSRPGLVSPKKLPRIPITPHRPSSDLFWSQEFVDDWNDEHSPRK
                     QLFPDAVAARRNSPAKTSAEKPSQKTAGAKKPSDREAKRAFEATKRELAEKFLQELDT
                     VITQGRLAELAESTGGIRVIWTNKLNTTAGRANWKRETIRTCQPDGTTTTRHKHHASI
                     ELAEKVIDDAHRLLNVLAHEFCHLANFMVSGVTTNPHGREFKAWAAQCSRAFADRGVQ
                     VTTKHSYDIDFKYVWACVECCTEFKRHSRSIDPARHRCGRCRGELRQIKPAPRGSGKK
                     AGGDGEASKGKVVSEYQAFVKEQMRLVKEENPKSPQKEIMKIVASRWAAKKGAASAMT
                     PDQQVKKLEEGLEELTV"
     gene            2179335..2186550
                     /locus_tag="MYCTH_140260"
                     /db_xref="GeneID:11507244"
     mRNA            join(2179335..2180030,2180148..2180340,2180394..2185676,
                     2185740..2186550)
                     /locus_tag="MYCTH_140260"
                     /product="glycosyltransferase family 48 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003665090.1"
                     /db_xref="GeneID:11507244"
     CDS             join(2180162..2180340,2180394..2185676,2185740..2186079)
                     /locus_tag="MYCTH_140260"
                     /note="CAZy_ID 270143"
                     /codon_start=1
                     /product="glycosyltransferase family 48 protein"
                     /protein_id="XP_003665138.1"
                     /db_xref="GeneID:11507244"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="JGIDB:Spoth2_140260"
                     /translation="MSGYQSGQGHGQGQGHHGYDDGYGHHGNTDSYYQDDQHYYDNNG
                     HNRGGYQQGDGYYDESGYYNADPNNPYHQDGGYYDNHDQYNDDYYGHNDGYYDQGYDR
                     GGYGNGHGHRNGSEEDSETFSDFTMRSDMARAAEMDYYGRGDERHNSYNDGPGGARGY
                     RPPSSQISYGGNRSSGASTPNYGMDYGNVLPAGQRSREPYPAWTSDAQIPLSKEEIED
                     IFLDLTAKFGFQRDSMRNMYDHLMTLLDSRASRMTPNQALLSLHADYIGGENANYRKW
                     YFAAHLDLDDAVGFANIKGRSGKRKNKKKKATPENEAEALEDLEGDDSLEAAEYRWKT
                     RMNRMSQHDRVRQLALYLLCWGEANQVRFMPECLCFIFKCADDYLNSPACQNMVEPVE
                     EFTFLNNVITPLYQYIRDQGYEIVNGVYVRRERDHNQIIGYDDCNQLFWYPEGIERIV
                     LKDKSKLVDVPPAERYLKLKDVEWKKVFFKTYKETRSWFHMLVNFNRIWIIHLTMFWY
                     FTSFNAPTLITPNYEQEVDNPPPRAAQWSLVGFGGTIAAAIQVFATLAEWLYVPRKWA
                     GAQHLTKRLLFLLVVLVINVGPGVYVFMPAANLDAYLEKQNSKPALILGIFQFFFGLV
                     TFLFFSVMPLGGLFGSYLTKNSRRYVASQTFTASYPRLKGNDVALSFGMWAVIFGLKL
                     GESYAFLTLSIRDPIRYLNIMNVDSCIGDTILQRYLCPYQPEITLALMLFCDLLFFFL
                     DTYLMYVVVNTCISVARSFYLGSSILTPWRNVFSRLPKRMYSKILATTDMAIKYKPKV
                     LISQIWNAIVISMYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDHSFKT
                     EYFPSHSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVMIPHYSEKILLSLREIIRED
                     EPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQFNGDEEEKEKDTAKSKIDDLPF
                     YCIGFKSSAPEYTLRTRIWASLRFQTLYRTISGFMNYSRAIKLLYRVENPEVVQMFGG
                     NSDKLERELERMARRKFKLVVSMQRFSKFKKEEMENAEFLLRAYPDLQIAYLDEEPPL
                     AEGEEPRLYSALIDGHSEFMENGMRRPKFRIQLSGNPILGDGKSDNQNHSIIFYRGEY
                     IQLIDANQDNYLEECLKIRSVLAEFEEMHTDEVSPYTPGVKTNAPAPVAILGAREYIF
                     SENIGILGDVAAGKEQTFGTLFARTLAQVGGKLHYGHPDFLNGIFMTTRGGVSKAQKG
                     LHLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSRE
                     YYYLGTQLPIDRFLSFYYAHPGFHVNNMFIMLSVQMFMICLLQIGALRKETIPCDYNR
                     DVPITDPLYPTGCANTDALMDWVYRSVLSIVFVFFISFVPLFVQEVSERGLWRAATRF
                     AKQFCSLSPFFEVFVCQIYANSVQQDITFGGARYIGTGRGFATARIPFGVLYSRFAGP
                     SMYFGARMLMMLLFATVTIWQAALVYFWISLLALVISPFLYNPHQFAWNDFFIDYRDY
                     LRWLSRGNSRSHASSWIAFCRLSRTRITGYKRKVVGDPSAKLSGDVPRAAITNIFWAE
                     IITPLCLVIVTLIPYLFINAQTGVKKSETKPTAALLRVAIVAFAPIAINAGALAIFFA
                     MACFMGPLLSMCCKKFGSVLAAIAHAIAVIVLLVFFEVMFVLQGFDFSRTLLGMITVV
                     AIQRFVFKLIITLGLTREFKTDQSNIAFWTGKWYSMGWHSVSQPAREYLCKITELCLF
                     AGDFILGHIVLFLMVPIILIPQIDKLHSMMLFWLRPSRQIRPPIYSMKQTKLRRRRVI
                     RYSILYFVLLVVFLALIVGPAVAGKYIPTESMLSMLKDQNLLQPTGLNHDDTRGKTPT
                     GTGAPNYSGVGTSTRTTARATATSGSDKRALFI"
     gene            2186882..2189227
                     /locus_tag="MYCTH_2095122"
                     /db_xref="GeneID:11507245"
     mRNA            join(2186882..2187356,2187442..2187542,2187602..2188112,
                     2188207..2188698,2188777..2189227)
                     /locus_tag="MYCTH_2095122"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665091.1"
                     /db_xref="GeneID:11507245"
     CDS             join(2187126..2187356,2187442..2187542,2187602..2188112,
                     2188207..2188698,2188777..2189001)
                     /locus_tag="MYCTH_2095122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665139.1"
                     /db_xref="GeneID:11507245"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2095122"
                     /translation="MDLHEVQTHLNEWLQEASAAFQKVPGSAVLIRYVRSSYQNDPVR
                     SAIELVLVIFFIRYLLSPSYSTSKQNYVKLTEDEIDELVEEWTPEPLVAPVTPQQEAE
                     LEKLPVIVGPTGPKSKLTNGKTVMNLASYNFYNFNANDQIKEKAIQTLRTYGVGPCGP
                     PQFYATQDVHMKLEADIASYLGTEGCIVYAHAFSTITSVIPAFCKRGDIIVADRGANY
                     SIRRGLEISRSNVKWYNHGDLDDLEEVMRKVVKEQAGKKLTRRFIVTEALFETTGDMN
                     DLPKLIELKEKYKFRLILDETWSFGVLGRTGRGLTEAQNVDPSQVDMIIGSLAGPLCA
                     GGGFCAGTKDVVEHQRITSTAYTFSAALPAMLAVTASESINLLQSNPEILLQCRENIR
                     LMRAQLDPRSDWVVCTSAPENPIMILIIKPEVVKARRLSIDDQERLLQECVDEALANG
                     VLITRLKTMPISQHTSFKTNIYTVTPALKVCLTSGLSKKDIEKAGVTIRHAITKVMTR
                     KTNNKLGVPAA"
     gene            complement(2189500..2191723)
                     /locus_tag="MYCTH_2308533"
                     /db_xref="GeneID:11507246"
     mRNA            complement(join(2189500..2189864,2189992..2191723))
                     /locus_tag="MYCTH_2308533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665092.1"
                     /db_xref="GeneID:11507246"
     CDS             complement(join(2189733..2189864,2189992..2191275))
                     /locus_tag="MYCTH_2308533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665140.1"
                     /db_xref="GeneID:11507246"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="JGIDB:Spoth2_2308533"
                     /translation="MKPNSTLLCGGFGLCGVPDTLIDEVLKRPDLTGLTAVSNNAGTD
                     NSGLGKLLRTKQIKKMIASYIGENKTFESMYLTGEVELELTPQGTLAERCAAGGKGIP
                     AFYTPAAFGTVVQTGELPLRNKPDGTPDQFSYPKDVKVFNGKSYLLEHAIEGDYAFVK
                     AYKADRLGNCQFRLAANNFNGAMGRNAKMTIVEAEHIVEPGEIPPEAVHLPGIYVKRV
                     IQSTAPKNIEKYTWSKDPSEAEDPKAAAALGTGDTKAKRERIVRRAAKEFQNGMYANL
                     GIGMPMLAPGFVGDDVEVMLQSENGILGLGPYPRKGEEDADLINAGKETVTLKPGASV
                     FGSEESFGMIRSGRINLTILGAMQVSANGDLANWMLPGKVKGFGGAMDLVSNPSETKV
                     VVTMEHTDKKGNPKIVKQCAFPLTGKACVSRIITELGVFDVDFAKGLTLVEIADGVTV
                     EEIKAKTEAPFRVADDLKPML"
     gene            complement(2192627..2195227)
                     /locus_tag="MYCTH_2308537"
                     /db_xref="GeneID:11507247"
     mRNA            complement(join(2192627..2192864,2192922..2194349,
                     2194536..2195227))
                     /locus_tag="MYCTH_2308537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665093.1"
                     /db_xref="GeneID:11507247"
     CDS             complement(join(2192797..2192864,2192922..2194349,
                     2194536..2194626))
                     /locus_tag="MYCTH_2308537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665141.1"
                     /db_xref="GeneID:11507247"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="JGIDB:Spoth2_2308537"
                     /translation="MDTDDDFMSNVSSEDDILPDESDNDMSGDEDFGFDDEPDTHLDS
                     QKENGFKKKAAYDISFKVYQPSDIQKQQDELIDEVNMILNISKEEAAILLRHFRWNKE
                     RLIEDYMDRPNQVLDAAGLAPTSAGPPRMQVVPGFVCDICCEDEPGLQTFALKCGHRY
                     CVDCYRHYLSQKIRGEGEAARIQCPSEGCNVIIDARSLDILVTPDLMARYHELLHRTY
                     VEDKETLKWCPAPDCENAIECAVKKKDLDKVVPTVSCLCGHRFCFGCILNDHQPAPCE
                     LVKKWLKKCADDSETANWISANTKECPKCNSTIEKNGGCNHMTCRKCKHEFCWMCMGL
                     WSEHGTSWYNCNRYEEKSGTEARDAQARSRVSLERYLHYYNRYANHEQSARLDKDIYH
                     KTEKKMVQLQKESGMSWIEVQYLNSASQALQTCRQTLMWTYAFAFYLARNNLTEIFED
                     NQKDLEMAVEALSEMFEKPIAELADSKLKVEIMDKTSYCNKRRVILLEDTAQNLAEGR
                     WTFNTELLGSGANSGLILRR"
     gene            2195420..2196768
                     /locus_tag="MYCTH_2308539"
                     /db_xref="GeneID:11507248"
     mRNA            2195420..2196768
                     /locus_tag="MYCTH_2308539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665094.1"
                     /db_xref="GeneID:11507248"
     CDS             2195578..2196558
                     /locus_tag="MYCTH_2308539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665142.1"
                     /db_xref="GeneID:11507248"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="JGIDB:Spoth2_2308539"
                     /translation="MDDGFAERGGRRSSRWEELDEHEGSRNEQRRRYRDDESGKRVDR
                     SRSRERDHRRRSRTPESRDRRSRSRDRERRRERDRDRHRDSRRQRSEERRDRRNREHD
                     DDWKERRSGRSPDNRSRRLPAPHDADERSRSEHGRSLIRRAGPLPSQSDSFAISKGEE
                     PEKPKEKPNFANSGLLAAASNTITQADGTAVTLKYHEPPEARKPPPRDLWKLFIFKGQ
                     DIIDTIELSTRSCWLIGRDLAVVDLPAEHPSISKQHAVIQFRYTEKRNEYGDKIGRVK
                     PYLIDLESANGTMLNGEKVPESRYLELRNKDMLQFGSSTREYVLMLAPRD"
     gene            2198114..2203957
                     /locus_tag="MYCTH_2308541"
                     /db_xref="GeneID:11507249"
     mRNA            join(2198114..2198361,2198526..2199226,2199312..2199561,
                     2199625..2199667,2199861..2200925,2201027..2203957)
                     /locus_tag="MYCTH_2308541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665095.1"
                     /db_xref="GeneID:11507249"
     CDS             join(2198359..2198361,2198526..2199226,2199312..2199561,
                     2199625..2199667,2199861..2200925,2201027..2203698)
                     /locus_tag="MYCTH_2308541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665143.1"
                     /db_xref="GeneID:11507249"
                     /db_xref="JGIDB:Spoth2_2308541"
                     /translation="MASINKHPSRFELTAVYQHPQAKADIVLVHGLNGAPDKTWTAPN
                     GVYWPTDLLPASLKDQHANVLVYGYNADVYGAFWERHAKNPSDNFIHHHAQTLVATLT
                     HYRKSVGTERNPIIWVAHSLGGIVTKRALLYSNDVRDPNQEDLRSIYVSTFGIIFLGT
                     PHNGSDAATWGGIIQRMADAVVPRKIFDTESVLLKSLKKDNETLQEISNHFLDIYQKF
                     KIHMAHENQKTDVKGSKMLVVDASSASPQLVGVTYYGIEATHSRMCKFDSENAPGYRT
                     VSTAIREWVADAPNVIPIRWEVEEDQRRVRANLENFERSRQYHSPALVPVDRPQIIAH
                     GGSETVSSHLQQPPPLDEGRSVSAPLLTEATKEAPSSLRPSSHSPKLLPAIPDAPGGL
                     PDPDHEPLFIHPETFRPNSYFVGREDELRGLHEMLMDRKRRSEGTSAVLIQCLPGGGK
                     THLARQYVFQHRSDYPGGVYWVRADSRQELEYWFWRIARNEALRGLVDRKDVDELRDP
                     KKIVQIVRRWLNSQSDWLMVLDGVQFDTPGLHEFIPDARNTSLIYTSTERAVTGDPRF
                     DNPQVMELGLLTAQQAQDLLLLELERKRPWSAEDQAMALELVGLMGRLPLMIHVAAQH
                     LKATREPLARYLRSYRSRPKAGDLPAYKAVREQLENRGEYAALNLMSLLVFFDQHIPV
                     EMLALGLSALDKVTPVKTLDAMHRKASLNNTLKVLIAFALIERSESDDISPTSSRSSK
                     RSFDRHADYLDLLRIHSVVQAFFIDSLYEQRQIPFWLERAVAVWARSYDEADRRIQED
                     PRVGLPDDYRRFCIHGEKLLKNLNRFEKRYPKLSVVRSPLEERLKKIQGQIDDLSHAI
                     QKNIVDGSAEEYPASVFDRISASSQSDVATMQSHGSQLSGMASGESSLVQSPVSELLE
                     QEAQLVAPYPTTPRMPMVPEMYEDDDHDTVVLSVAGTQVHVGATDEVAPLPPDPHDAH
                     HPGSSFDDWRDAIPHDRVITRQEARRYRDRAGSWRDETISDPRVGLSWEVALGSISGT
                     RDASSPPSRARLTNRSEAEMKLNEIKKGAPPSPKQRGSFSSQTMFRPNTLLGRNSWSL
                     PQAQKASDSEVAQVPPKDFSGGSKQTSSSSSSSPRSWTEATLKLLKKTVLPSNKRTEK
                     GPQAQQQQQPQHPEVPPEEEDMIPPTAIFRGSRSANSSPAGIASPFPPPSFSGIPTAD
                     LLARPEPGVPLVVRRWDTVVYPPDGTPVTSAGVEWSSSADPMSLSYPSILPSRHQQLN
                     ARPQVLLRGNGGGPPTGYSSQPMSRDGSQQSNLGIGVHIPAAAAAIQSPVSRSSRFAY
                     TGQQRPPSFTETEPSPRMDTAFSDIDTSYHRWEQHHYQFQNRAGTSPAMSTVSSPAAA
                     SSSAASSRTGKESRGSRWRPSSRRTRFLPIRGARPGRGSGKAKGGSSSRRAHSHSPPG
                     SPSAELLEACFDDQALSSRPIPRTAAAAAAAAAAAAPPPPLASSPTPSSSSSLPSSST
                     GRARSHSRGHSQARAPAARGFGTPPPQQYLSRQHQHQHQHQHHPLAEWAVPPAGADTS
                     AAGGIRMDDGTVVEFGSPVLGSDQP"
     gene            complement(2204260..2206698)
                     /locus_tag="MYCTH_2308546"
                     /db_xref="GeneID:11507250"
     mRNA            complement(join(2204260..2204530,2204595..2205082,
                     2205149..2205815,2205869..2206698))
                     /locus_tag="MYCTH_2308546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665096.1"
                     /db_xref="GeneID:11507250"
     CDS             complement(join(2204324..2204530,2204595..2205082,
                     2205149..2205815,2205869..2206417))
                     /locus_tag="MYCTH_2308546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665144.1"
                     /db_xref="GeneID:11507250"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="JGIDB:Spoth2_2308546"
                     /translation="MEAASARYAARDRWGDMGGAPAQSQLQRFIQAACSPENYEPNLA
                     LNLEIADLINAKKGSAPREAAVAIVNYINHRNPNVSLLALNLLDICVKNCGYPFHLQI
                     STKEFLNELVRRFPERPPVRPSRVQLKILEAIEEWRRTICETSRYKEDLGFIRDMHRL
                     LSYKGYTFPEIRREDAAVLNPSDNLKSAEEMEEEEREAQSAKLQELIRRGTPEDLRQA
                     NQLMKVMAGYDTRSKVDYRAKAAEEVAKIQQKARLLEERLEAFKPGDKIVDGDVFSEL
                     ASALASAQPKIQKMCEEESDDHEAVAKLLEINDSIHRTVERYKLLKKGDIQGAQQLAK
                     GAPTSTSSGKSAANELSLIDFDEGDANGGAAASQATQKPTGVEDDLLGLSINDTSSYG
                     QAGGIALGFGANTNVPGPALLSSVTQGNSARGQLPTSSPSPVPFSNYSSFTSAPGSQS
                     GTPHPPQRSAFSPPSQSTATTDPFAALSSLSPQPPSAPAPTAAAANDDDEWNFSSALP
                     PETPQAPKEHTAVVSNTSLKLDMIANRTVDTDPSISLLFAFTNNTAQQVTELHFQLAV
                     TKGYELLLDPQSGRTLAPKQSRGITQSIKVRHAGNPFQKVESIKLRWRVSYKVGGELK
                     QEMGEIPEFTVA"
     gene            2206876..2208541
                     /locus_tag="MYCTH_2308548"
                     /db_xref="GeneID:11507251"
     mRNA            2206876..2208541
                     /locus_tag="MYCTH_2308548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665097.1"
                     /db_xref="GeneID:11507251"
     CDS             2207073..2208356
                     /locus_tag="MYCTH_2308548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665145.1"
                     /db_xref="GeneID:11507251"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="JGIDB:Spoth2_2308548"
                     /translation="MVRHKKDNFSSRGKHHGRGGGGGCPRSARQIIESEKQGDGSASA
                     NNNGSSSSSSTTSSRPVFKAACWDLGHCDPKRCSGKRLMKLGLMRELHLGQRHSGVVI
                     TPNGKRTLSPADRPLLDQYGAAVVECSWARTKEVQWGKVGGRCERLLPYLVAANTVNY
                     GKPWRLNCVEALAAAFAICGHPDWAEQVLAPFSYGSAFLEINSSLLKKYAACEDEAGV
                     KQVEQEWMDRLDREYIESREEGGPDDLWAGGNVNRRMPVDSDDEDEDEEGSGDEDEDD
                     EGGDGGKGDGADDESVDGIYLGTKPPPKTQSAQTGEKDRFALPSESEEEDDDAEMEAI
                     RRKILASKPFANPEPDEKKSLQTVPRPPQQYKPDSDAEPDSDNGSDNDEFDNIINATP
                     VTDRIGLVKLEKERARITTTTRNFSSGGVSAPSRW"
     gene            complement(2208485..2212666)
                     /locus_tag="MYCTH_2308549"
                     /db_xref="GeneID:11507252"
     mRNA            complement(join(2208485..2208765,2208834..2212512,
                     2212574..2212666))
                     /locus_tag="MYCTH_2308549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665098.1"
                     /db_xref="GeneID:11507252"
     CDS             complement(join(2208614..2208765,2208834..2212512,
                     2212574..2212600))
                     /locus_tag="MYCTH_2308549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665146.1"
                     /db_xref="GeneID:11507252"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="JGIDB:Spoth2_2308549"
                     /translation="MMRRGLWQQKQRQPSACLLCRFSYSHGPYARTAPLPPSNYNDRV
                     IDDKPISAAPSPALARLTRCYSVAADTRKTGGLANAASPRRPVGLKPLSALSDGNDGN
                     ISQRFFTTSGLPSWATLPVQPATSNDGLLPHERAARERAMSRVKPAPAPPAETTNPIP
                     NNDGLLPHERVAREKALGRTRPPPPQPSAAEDARPATGNNKLLPHERAARQRVTGRAR
                     PPPSQRASKDDARSAASSSSPLPQNRAAREKAVGRTQSPRTQPTGDVPLASVSKDSPR
                     ETSIGEGGQQHQEKPLPSQTRSAPAPRNSGISWASAAPSWSAPALQPAAGDSGAGQST
                     RPADSMAYLLPHERAARDRATSARKQGESPNSPPQPEHPTPPSSPIPEDKMSQEYLAL
                     QSRRRRPFGGTGAPKDARESEDSDPFVPTTQEPRSRMPRYDLPRPSSLTQTPADQDDW
                     KKLTRRERNLPPGLNMALPSSALNPASNGLGKDSQRSASNSAADPFSSLQQTAPSQST
                     QPKTSLDSGFDQFNVLETKSEELSKSQKKRKATENSDTWAWAEEYTEEARQAKAQRIA
                     RELRQETEQVSEETSPNTATPTARVERDDRHGRADKQGREDGSERREKPKKPKNRRRQ
                     EEEEDDDWDEDYYEQRRRKKAEKAERERQRKAALEAAGPTPIFLPEFISVSNLAIALG
                     QKVDVFVRQLEELGFEEVSKDNILTGETAALVAQEYGFEPTVDSGEDEDLKPAPAPED
                     PSSLPLRPPVVTIMGHVDHGKTTLLDYLRKSSIVSQEHGGITQHIGAFSVTLSSGKQI
                     TFLDTPGHAAFLSMRQRGANVTDMVVLVVAADDSVMPQTLEALKHARAAKVPIIVAIN
                     KIDKPEANIDRVKSDLAANGVEIEDYGGDVQVVCVSGKTGQGMEDLEENIILLSEMLD
                     IRADPGGMAEGWVLESTIKPIGRVATVLIKRGTLRPGDFIVAGRVHAKVRSLRNEAGV
                     EVREAPPGTAVEVLGWKEPPDAGDQVLQAPDEAKAKAAVRYRQELKERSEVIAQMAQQ
                     EADRREREREREREKALAEAADPRKNKRQQATPAEALDKDEQDPADKTQYVTFIVKGD
                     VHGSVEAVTAALLEQGNNEIRAKVLVSGPGQITESDVEHAAISKSTIVNFNNTIPNHI
                     KRMAHDAGVKILDHNVIYHLIEEVKQRLADALPPLIIKKVVGEADVLQVFPINIKRRI
                     YKNIAGCRIGNGYVKKGSKARVIRNGEQIFEGVIETLKHVKKDVTEMRKGSECGMSFA
                     DWDELKEGDRIQIIEETTEKRKL"
     gene            2213064..2214739
                     /locus_tag="MYCTH_2308551"
                     /db_xref="GeneID:11507253"
     mRNA            2213064..2214739
                     /locus_tag="MYCTH_2308551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665099.1"
                     /db_xref="GeneID:11507253"
     CDS             2213334..2214434
                     /locus_tag="MYCTH_2308551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665147.1"
                     /db_xref="GeneID:11507253"
                     /db_xref="JGIDB:Spoth2_2308551"
                     /translation="MPPSKTSRGKALLSSSVKSSNSKNSNGTPSAPPHPFKPAPAALQ
                     PFAATLPPGHVYIAHVDPRPASFKRNLFLVPIAINLAVIALFAWRVASVGPWYLALLL
                     STLGQANETTVRAADLAYGELVRVVVRRAATFLLDFVLAVFVWPWPYEFFVGSTGRGS
                     PIAWRWAVGFRGREVYVRRSRDGWDGVLREKGVDLFDPDSKEAREGREAIMARVRAAT
                     APMFMQQKTGYLTMDGAWDLDWKGMVDATRLADKGEISLEAFGTVVLLHHAKFGWVTV
                     DLGNGASAEQEERRRQVMAFRDALAKLGKEDLFFRWVEMIQFETTQPGGFTPEKQVAA
                     AQKIRDMFKSNGVDFDGLWKEAVGTDGLAGMP"
     gene            complement(2216382..2218623)
                     /locus_tag="MYCTH_2308554"
                     /db_xref="GeneID:11507254"
     mRNA            complement(join(2216382..2217938,2218042..2218360,
                     2218447..2218623))
                     /locus_tag="MYCTH_2308554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665100.1"
                     /db_xref="GeneID:11507254"
     CDS             complement(join(2216489..2217938,2218042..2218304))
                     /locus_tag="MYCTH_2308554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665148.1"
                     /db_xref="GeneID:11507254"
                     /db_xref="JGIDB:Spoth2_2308554"
                     /translation="MMGDSVGFRKSLASLSAPYQSGSDWARVREDAIALPLAAGRKGV
                     KGPRSLVAMCCRVLADNLGAVSKSSIEHLPDHLLWKLWKTLGPRNRSLHAWKILSCVL
                     LEGSQQRCVSEGGMKRDQSPMPMALFRYRQEIIDPPCDLAVYVSPLARLEKGSLAYLC
                     LDNVARFQTHELIPLATLQPLAVLEIIERDDADSKISDALIRGWSEAGKDPFSRLRVL
                     KIASKTHRISESGLQYLLELPCLEIIDITALPTTKLRLSRRMKDSLDTSGWRVARPRG
                     SLFVSYADAFLDGRMAVHPAGVEALKMVFEDDRHPVIWVDNARAAVYKQWERGAGRGT
                     GEWKGQPVRTSYGDESYDGPDPASDCGQPRPADFSDVQYLDDGWRAVLQGFRSSTTKD
                     TQEHSSTRDEERLDDQIFWFLALMDQSRYDGSNAVRGCASGVTLPLERLVCLRLRNPC
                     NTAEQTRLLLNSERLIFSRRRMHAVLGSRSEVARCQLELEDGQSCDLSPSGASRTDDR
                     RQGGLEPRKRQNSEAERLSNPLPTWAPGPDGRREKGLQPRKRLKKPLFEILNPFMEPQ
                     VRPG"
     gene            complement(2219318..2221651)
                     /locus_tag="MYCTH_2308558"
                     /db_xref="GeneID:11507255"
     mRNA            complement(join(2219318..2220888,2220956..2221651))
                     /locus_tag="MYCTH_2308558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665101.1"
                     /db_xref="GeneID:11507255"
     CDS             complement(join(2219386..2220888,2220956..2221540))
                     /locus_tag="MYCTH_2308558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665149.1"
                     /db_xref="GeneID:11507255"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="JGIDB:Spoth2_2308558"
                     /translation="MASPLQFAYRTQKAIGVFDAAPVYEALPGFAKPEGNLRCCVYSP
                     CGRYFAYASNEGVVVVDASVGHVLTSLPIANVYELGFSPRGTYLSTWERPSKDENGDA
                     TKNLKIWRTIEDVAEGAERQPLGKFVQKSQSGWNLQYTADEKYCARMVTNEVQFYSSS
                     DLSTVWNKLRVEGVADFAIAPGLNHNVAVFIPERKGQPAAVRVYNVPLFNSPISQKTF
                     FKGDKVQLKWNALGTSLIVLAQTDVDKSNKSYYGETTMYLLSANGAFDARITLDKDGP
                     IHDVAWSPNSTEFGVIYGFMPAKTTIFNHRGVAIHSFPIGPRNTIIFSPTGRFVLVAG
                     FGNLAGQIDVYDLEKDYRKICTIESGNPSVCAWSPDSRYIMTATTSPRLRVDNGIKLW
                     HVSGAIMYNEDMVELYNVMWRPLPASSLPGGDPLHPVPTPHASAVAYLGTVKTPSKPV
                     GAYRPPGARGAMTPLHFKREDEGGAAHTVSNGTPSIGPNGFGRPRHLVPGAEPASRPP
                     VPGAVPADEGNASKTGSKKKKRNKKAKEGDAANAAAAGGTATEGGLAPSPREYGNASG
                     NEGRSPDRRGHHSRSRSRQNNGNRNSSRPASRPAPAAAQGGSPVPPAVGGDANGADAA
                     GAAASAAPAAAAAAAANPNAKKIRALQKKIRAIEDLEMRLAGGEKLEDTQIKKINTKK
                     QVLAELAALGEHP"
     gene            2226128..>2227365
                     /locus_tag="MYCTH_2308559"
                     /db_xref="GeneID:11507256"
     mRNA            2226128..>2227365
                     /locus_tag="MYCTH_2308559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665102.1"
                     /db_xref="GeneID:11507256"
     CDS             2226155..2227363
                     /locus_tag="MYCTH_2308559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665150.1"
                     /db_xref="GeneID:11507256"
                     /db_xref="JGIDB:Spoth2_2308559"
                     /translation="MVVPPPAPRNPIPARALPIPGQVAGQPRPKVEHREYAAPVTPSS
                     LQSPTSSADKGKGKATAVAPQAQASGIHHPAAPVIVSSDSAQSPKKRTPLPNIGSLAL
                     GQQATADASPASAAGPSTPRTTGIPRSQPLPASGRLESGDPPPPEPTDPTDPIDETYE
                     DEGPIYLAEGVDPFDALIPAHATPAVSAADLHRHRQEYDRVAYAKREELGRTFAFMKE
                     PAFAKRRKESFIYAVRVVAIPDSGRVVNEFTGPRVEDRYGTHVAQGGWVVPPLEERVR
                     WREERKRAYRNKGAKPGRYEGLPYPQVQRAMPVRFDWSGGTEPRYYGPAAPIWRETCD
                     PCLEDVYWMVWQLLAGKQFLGFQPGTGFGKARPHATGDVALLNQNPFKSPSTEALYHS
                     ASYPRGKEHK"
     gene            complement(2249592..2253153)
                     /locus_tag="MYCTH_2082522"
                     /db_xref="GeneID:11507257"
     mRNA            complement(join(2249592..2252377,2252546..2252704,
                     2252807..2253153))
                     /locus_tag="MYCTH_2082522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665103.1"
                     /db_xref="GeneID:11507257"
     CDS             complement(join(2250061..2252377,2252546..2252704,
                     2252807..2252820))
                     /locus_tag="MYCTH_2082522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665151.1"
                     /db_xref="GeneID:11507257"
                     /db_xref="InterPro:IPR007604"
                     /db_xref="JGIDB:Spoth2_2082522"
                     /translation="MFRQRTSSQKPGDDLLANFRQQFPEVAAVGSTASTAGPARTATA
                     GHAHADVPGPAPERSHSISHEAFRDQDPTPRGSNDPWRFTPSLLDPASFSFANFANQA
                     PGYYTPTSGGTNTIYHPQAGDLHTPTLGLGMGLGTPLSMPNSEGAAHAGAGPMDMTGF
                     HQGFHPQQFQQFTTPFIQAPPPQSSFAPSSFMHHDTGYETMDQGSPIDSDHAEERIGS
                     IDGNLQSQSPMVSFQARQFGMPMSVPLPASAEKFRFHAALNAPTAMIKHADEIPVTYL
                     NKGQAYSLSIVDTTPTLPIAPGTRFRTFVRVSFEDEQQRQKPGVCWSLWKEGRGTNEA
                     HQRGGKLQAVEYVEAGQPAEGDDKKTRIELETSSFDGFSVIWTPGVNGAVECNIAVRF
                     NFLSTDFSHSKGVKGIPVRLCAKTQQLPADTSSPGDSTNAPEICYCKVKLFRDHGAER
                     KLSNDVAHVRKTIDKIKQQIAQAESGMKDFGKRKRAGGSQLKGQNGQRPGKAHKHKRT
                     WSMSSASSGGGGPRVTLEEDLHFKLQTLQDMFTSTRPVSVLYLRGEELDDPDLHPVSL
                     PGESLELGKVESRDSVAWRSERGSITGSSLVSPSPSSLSLHSQNSAGNKPQWQDYQIG
                     GGSGSGATSSEPSSRDLHNGRPTKVRQVDEAGNLTGWIEALGVDANYHPPADRRPKPV
                     ACFYVALRRSSPDQAGGQPYQELHRAVYLMQRTARDLVARLAAKWRFDASRVVRTVHV
                     VEPRGLEVEVDDDVVRELPEGLDMTLEIVEVPTAAAGGEVVKKEWDAMAVDDAPGEAD
                     LPSPDSSGALGYVQHQQLQGKTGAIELKLRY"
     gene            2260021..2262252
                     /locus_tag="MYCTH_2308567"
                     /db_xref="GeneID:11507258"
     mRNA            join(2260021..2260342,2260490..2260736,2260829..2261527,
                     2261592..2262252)
                     /locus_tag="MYCTH_2308567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665104.1"
                     /db_xref="GeneID:11507258"
     CDS             join(2260221..2260342,2260490..2260736,2260829..2261527,
                     2261592..2261948)
                     /locus_tag="MYCTH_2308567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665152.1"
                     /db_xref="GeneID:11507258"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="JGIDB:Spoth2_2308567"
                     /translation="MWAFSSSTSTAPAAPSPDGPATDEPQNEGSKLKTFISILRKFVG
                     VSDLASVRFSLPSQLLEPTPNLEYWNYLDSPNAFVAIGTADDPVDRMLEVLRFWFTKD
                     LKYAKGKPCKPYNSCLGEFFRCNWETEDDAPRIDTSAFRRNNGSAPGSSASSTKSAKL
                     SVPAGLGSGDSRGASSVSVPQSAKNPTKPVRVSYLTEQTSHHPPVSAFYISCPEKGLH
                     AKGFDQITAKFTGTSIKVMPGEHNLGIFITVERRDHETYQLTHPAAHLGGILRGALSV
                     SVGDMAYITCPETKLKAILRYYDDGWLGRTTNKVEGIIFRYDPENDDKRQIQDVPEEE
                     VLVRLGGPWKEKIVFTLGPKPLNSHPPEDQITIVDIAPLNVAPKVLPPPEKQLPHESL
                     QLWGEVTKAILAKQFSRATTLKQELEEAQREKARERERKGETWKPVFFEQATDKAGKP
                     SLTDKGREVLNRAQRGDWSMDGIL"
     gene            2263099..2264910
                     /locus_tag="MYCTH_2308569"
                     /db_xref="GeneID:11507259"
     mRNA            join(2263099..2263563,2263724..2263970,2264041..2264492,
                     2264557..2264910)
                     /locus_tag="MYCTH_2308569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665105.1"
                     /db_xref="GeneID:11507259"
     CDS             join(2263282..2263563,2263724..2263970,2264041..2264492,
                     2264557..2264646)
                     /locus_tag="MYCTH_2308569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665153.1"
                     /db_xref="GeneID:11507259"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="JGIDB:Spoth2_2308569"
                     /translation="MATTTSGLTRRRGGGGGGGGFGDGETTGGIGSRTNSSANVRDTS
                     GGPETSYENGENGHRIAFDPRDISESAERSKQPKLTLMEEVLLLGLKDKQGYLSFWND
                     NISYALRGCIVLELAFRGRIAMQKTPSRRSFPLPDRIIEVIDDTLTGEVLLDEALKMM
                     KTSEKMSVSSWIDLMSGETWNLMKIGYQLKQVRERLAKGLVDKGILRTEKRNFLLFDM
                     ATHPVVDSGAKEEIRRRVRNVLTQRTVVLNSSQWLPEGLEFRYLRTVAMVCAAYAANV
                     LENALSTLGHEAREKAFNQTDELLADYSQWPFGRKATGNDIGENLPQVIGEEVSKAHD
                     KELQLEVVAACLCVFTQLDSLL"
     gene            complement(2265674..2267929)
                     /locus_tag="MYCTH_2135152"
                     /db_xref="GeneID:11507260"
     mRNA            complement(join(2265674..2267513,2267644..2267727,
                     2267799..2267929))
                     /locus_tag="MYCTH_2135152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665106.1"
                     /db_xref="GeneID:11507260"
     CDS             complement(join(2265930..2267513,2267644..2267727,
                     2267799..2267819))
                     /locus_tag="MYCTH_2135152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665154.1"
                     /db_xref="GeneID:11507260"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="JGIDB:Spoth2_2135152"
                     /translation="MADTALQERLRDHAKAFDGLLSLIPAKMYYGEDTSDQWRKKKQT
                     KDQARAAKRGKLDPDSELNRNAKEVLDERARNKRKLREMESEDESGSGSDQDDDDDSD
                     IPGIEKEKPGEGLKKKKLKLDEEEKDDESVKKANGEVPNREKAVEEPEQQAGESTLSK
                     RQKAKEEKKVAKKQKQEEAKRVKEEEAKKMKEENSKKGAKPEKAEKTRKAETEPAEEV
                     EHSEKPAGDQDEEPAQDSAEAASDDVDMAPIDISGLGNENEDTSADSAPDSPVFDTPK
                     NASAEPASTTTSISSAVPPSEKPKYLKIPADTTALRARLEAKLIALRAARKAADSEGK
                     PIRTRQDLIEARRQKQAQRKAHKQEMRRLAKEEEERKREQALNSARNSPGLSPLFEQE
                     DDRNANHFAFGRLAFSDGTQLSHDLSYEKTPGSAKKKGPSDPKTALLKLEAQKKRIAN
                     MDENKRKEVLEKETWLAARRRAEGEKVHDNESLLKKALKRKEKAKKKSEREWKERTES
                     VKAAIQERQRKREENIRKRREEKLARKAGKKNKGVQTRKKNRPGFEGGFGGGRK"
     gene            complement(2268508..2271108)
                     /locus_tag="MYCTH_2308577"
                     /db_xref="GeneID:11507261"
     mRNA            complement(join(2268508..2270652,2270705..2270852,
                     2270913..2271108))
                     /locus_tag="MYCTH_2308577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665107.1"
                     /db_xref="GeneID:11507261"
     CDS             complement(join(2268531..2270652,2270705..2270852,
                     2270913..2270925))
                     /locus_tag="MYCTH_2308577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665155.1"
                     /db_xref="GeneID:11507261"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="JGIDB:Spoth2_2308577"
                     /translation="MGISGLLPLLKSIHRPTELKKYAGETLGVDGYGWLHRGAVACAI
                     ELAQGKPTRKYVDFAMHRVRMFKYFGVTPYVVFDGDFLPSKAKTEAARSKRREESKRI
                     GLELLRAGKPSQAYSELQKAIDVTPEMARHLIEELKKADVPYVVAPYEADAQLVYLER
                     QGLISGIVSEDSDLLVFGAKRLLTKLDQHGQCVEINRRDFCAVREISLTGWTDREFRH
                     MAILSGCDYLDGVSNIGLKTAYRLVRKHKTPERIIKMLRFDGKHQIPDSYLEDFKQAE
                     LTFLHQRVFCPKKQDIVFLTELDPSSNPDEMRFIGAPVETELARSIAIGDVNPITKER
                     IVVPRSPGKRRISQALAPASGPPRTLGKPISEYFKDRSDRRIPLGEMDPNCFAVDPNH
                     NSSTTAEERPRPIVFPLPRPYVEGAEEALESTPRPYTSNARPLRRKTEPISKLLGLDV
                     FESSENRRRTTGPVIQVYQDPTASSRPPKKARLCDEQTFDESADGTPEKSKFFSSTKP
                     NKSAKKKADKLLMSDDSIEEAFRSLPDHSWRSEKPPKPTDDIVIFHEPSPKKQTDEVP
                     AAESPIEGCEDHAEHEVEVPASSPTQQGPAKECNDDSRSASMTPLGELLKEFSYGTGH
                     ARTRVIHGLPTPASSIQQTATPKCTGPRNTQTPMPTPLQRIGARALQRDRFQSTPPTP
                     GIVSSGDRSNKFDSLPVNPAFVPLPRVDVEEVEALNKPLGSEDQIIPDSDGEDDDDVG
                     DEPMSSSAVRRLNLTKFLYS"
     gene            2271777..2273359
                     /locus_tag="MYCTH_2095162"
                     /db_xref="GeneID:11507262"
     mRNA            join(2271777..2271978,2272029..2272116,2272193..2272326,
                     2272383..2273359)
                     /locus_tag="MYCTH_2095162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665108.1"
                     /db_xref="GeneID:11507262"
     CDS             join(2271807..2271978,2272029..2272116,2272193..2272326,
                     2272383..2272528)
                     /locus_tag="MYCTH_2095162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665156.1"
                     /db_xref="GeneID:11507262"
                     /db_xref="JGIDB:Spoth2_2095162"
                     /translation="MARTLEKTRKQIAKKRHGKIEALHEKSRDSKRLHRAQVRDDRLE
                     KLAEARRKKDQPILARAAFFQEAVRQNGNKPLELEAIQAKINEFVHQHDEEYEEVKKV
                     RRPGRPPSTKEDLLKMKITALQKEQRDGFYLPDLTSESNVQLLSKFEGSWSYLTSIAW
                     VKISAAGSIKPSKFPPQSL"
     gene            2273919..2274595
                     /locus_tag="MYCTH_2308580"
                     /db_xref="GeneID:11510917"
     mRNA            2273919..2274595
                     /locus_tag="MYCTH_2308580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665109.1"
                     /db_xref="GeneID:11510917"
     CDS             2274017..2274367
                     /locus_tag="MYCTH_2308580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665157.1"
                     /db_xref="GeneID:11510917"
                     /db_xref="JGIDB:Spoth2_2308580"
                     /translation="MCTYTTHIRVCARCAREDTVLISEQLCQTAKASGIFGSCLEGVL
                     CQRDTAGYRCWQCRDTATVAVAAAVVRSGVTVAGGRVAGERKRRATGRIGRMVGGAVA
                     EGVHAGQARSGWLQ"
     gene            2274795..2276313
                     /locus_tag="MYCTH_2308582"
                     /db_xref="GeneID:11510918"
     mRNA            join(2274795..2275350,2275408..2276313)
                     /locus_tag="MYCTH_2308582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665110.1"
                     /db_xref="GeneID:11510918"
     CDS             join(2274998..2275350,2275408..2275939)
                     /locus_tag="MYCTH_2308582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665158.1"
                     /db_xref="GeneID:11510918"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="JGIDB:Spoth2_2308582"
                     /translation="MMSLRTIARSAPRALARASSTYSSRTASSLFRARPASFIRPQQV
                     SAFSTSLFRRAMAGEVDEEVSAKLASEIEFEQDVKQNEPLPASIKDFLDNSPFKVEDV
                     PGKEDVILTRTFGDEKITVSFSIADLHNYEPDMMEDPAMEDELDDIEAGRSPQERGGA
                     ADLDQEANEDLEAGSDEAAVPCRLNIVIEKPNKGALNVEALAQDGAIIVENLYYYSDP
                     KLAHSTDPAAVHAAQDTYPGPPFGSLDEDLQILMERYLEERGITQSLALFAPDYMDYK
                     EQREYVAWLKNVKNFIDA"
     gene            2279071..2281161
                     /locus_tag="MYCTH_2315910"
                     /db_xref="GeneID:11510919"
     mRNA            join(2279071..2279178,2279251..2279268,2279594..2279840,
                     2279984..2280499,2280629..2281161)
                     /locus_tag="MYCTH_2315910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665111.1"
                     /db_xref="GeneID:11510919"
     CDS             join(2279639..2279840,2279984..2280499,2280629..2280909)
                     /locus_tag="MYCTH_2315910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665159.1"
                     /db_xref="GeneID:11510919"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="JGIDB:Spoth2_2315910"
                     /translation="MAPSAISPAQQHAQLAFAPKKVKDAAAEVEDRAAGLTKPLAEMM
                     GNWDDFSFAPIRESTVSRAMTRRYFADLDKYAESDIVIIGAGSCGLSAAYTLGKLRPD
                     LRITVIEAGVSPGGGAWLGGQLFSAMVMRKPADVFLREVGVPYEDEGDYVVVKHAALF
                     TSTVLSKVLAMDNVKLFNATTVEDLITRPDPDSEDIGPGVRIAGVVTNWTLVSMHHDD
                     QSCMDPNTINAPVVISTTGHDGPFGAFSVKRLVSMKQLEQLEGMRGLDMQRAEDAIVK
                     NTREIVPGLIVGGMELSEIDGANRMGPTFGAMALSGVKAAEEAIRVFDLRKKQNEI"
     gene            complement(2281205..2283407)
                     /locus_tag="MYCTH_2308594"
                     /db_xref="GeneID:11510920"
     mRNA            complement(join(2281205..2282582,2282664..2282708,
                     2282785..2283075,2283139..2283407))
                     /locus_tag="MYCTH_2308594"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665112.1"
                     /db_xref="GeneID:11510920"
     CDS             complement(join(2281317..2282582,2282664..2282708,
                     2282785..2283075,2283139..2283192))
                     /locus_tag="MYCTH_2308594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665160.1"
                     /db_xref="GeneID:11510920"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="JGIDB:Spoth2_2308594"
                     /translation="MAGTQGDKPLNRADELDHLIDAVKALIVPFVREADEAVPSRAAG
                     ELLPDSQGVVQNALVKTRRPEDLVKELALNLPKGEGLGEEGLLQTMRDVLKYSVNTWD
                     QGFMDKLYASTNPVGVASELLLGALNTNVHVYQVSPALTVIEKHTARSLANLFGFTGP
                     RAGGVTCQGGSASNLTSVVIARNTLYPECKTRGNSGGPSPFVLFTSVHGHYSVEKAAV
                     TCGLGSSAVWTVPVDGEGRMDPSALRTLVERAKAEGKTPLYVNATAGTTVLGSYDPFP
                     EIAAVCAEFNLWLHIDASWGGPAIFSPTHRHKLAGSHLANSLTVNPHKMMNVPVTCSF
                     LLGPDMAVFHRANTLPAAYLFHGPGQEEEDTSRSSPAAAAGGPTTNGVNGTAAPNGTT
                     TPSEQEREQKEEEEEVWDLADLTLQCGRRADSLKLALSWVYHGAAGFARQVDGAFAVA
                     AHLADLVARHPDFVLLSANPPPCLQVCFYHAPGGRLAEDPAVNTARTRRMARALVARG
                     YMVDYAPGEKGSFFRVVVNAQTLTGTVEGLMKALEHVAREVVG"
     gene            2284748..2286125
                     /locus_tag="MYCTH_2308595"
                     /db_xref="GeneID:11510921"
     mRNA            2284748..2286125
                     /locus_tag="MYCTH_2308595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665113.1"
                     /db_xref="GeneID:11510921"
     CDS             2285006..2285875
                     /locus_tag="MYCTH_2308595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665161.1"
                     /db_xref="GeneID:11510921"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2308595"
                     /translation="MKSTTHTPSASDASQTPIPISITICGDGGCGKSSITLRLVRSQW
                     TSEYDPTIEDSYSVTRRLDGVVYHLSLTDTAGQEEYRGMWASSNLGADAFLLVYDITS
                     RDSLDALDYFNELIDMEAETRLDNAARARRAGLTTLDLSSSSSSAAIGVGGGSSASGK
                     TVPPVKIVAGNKCDLQESRQVPAATGLEWARKRGCGFMETSARLEVNIEETFALIIRR
                     VVEARRLAQTAAGAQPAATSRGMTKPLTPLPPPGDDEADEEKRGPGVRGPNIRGDRVG
                     KGDGGFWRKLRCW"
     gene            complement(2286807..2288097)
                     /locus_tag="MYCTH_2308596"
                     /db_xref="GeneID:11510922"
     mRNA            complement(2286807..2288097)
                     /locus_tag="MYCTH_2308596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665114.1"
                     /db_xref="GeneID:11510922"
     CDS             complement(2286884..2287789)
                     /locus_tag="MYCTH_2308596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665162.1"
                     /db_xref="GeneID:11510922"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="JGIDB:Spoth2_2308596"
                     /translation="MASVEHCLYCFETLAAHLEGRKPMTLSEVQKSWAEYVRSTAAAD
                     AADSSKLSKRLPALRRVTEDSSSSSSSSSSASSASTSTLSLGPSTPETPVSSDSALAE
                     DGQAAEAEAEAEAGQDVAAAAAAAAASQITESPLFVTWNTVSSRAGGGHSLRGCIGTF
                     EPQELDEGLSSYALISALQDTRFRPVAARELPSLEVAVTLLTDFEDAADPMDWELGTH
                     GLRISFHHHGRRYGATYLPDVAVEQGWTKEETLVSLMRKAGWVGKKDRWTEIQLNVVR
                     YQGKKESLGYAEFKRWRDWVEAKGK"
     gene            2289989..2290839
                     /locus_tag="MYCTH_2315913"
                     /db_xref="GeneID:11510923"
     mRNA            join(2289989..2290371,2290458..2290839)
                     /locus_tag="MYCTH_2315913"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665115.1"
                     /db_xref="GeneID:11510923"
     CDS             join(2290299..2290371,2290458..2290588)
                     /locus_tag="MYCTH_2315913"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665163.1"
                     /db_xref="GeneID:11510923"
                     /db_xref="JGIDB:Spoth2_2315913"
                     /translation="MKLTVATVLTLAAVALAYPAVDKSAPAKRQNAGDQIDVSVPSMT
                     DASGNVVPFNAQNVHKDATAKGI"
     gene            <2291555..>2292102
                     /locus_tag="MYCTH_2065741"
                     /db_xref="GeneID:11510924"
     mRNA            join(<2291555..2291748,2291874..>2292102)
                     /locus_tag="MYCTH_2065741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665116.1"
                     /db_xref="GeneID:11510924"
     CDS             join(2291555..2291748,2291874..2292102)
                     /locus_tag="MYCTH_2065741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665164.1"
                     /db_xref="GeneID:11510924"
                     /db_xref="JGIDB:Spoth2_2065741"
                     /translation="MSSLDLDQVMHARARWRKAILIPLWIFQIAVLLCLMGVFAYRLA
                     ETFEDYGERDKQGEVPIVEVVWEATNVGFNLIALILNIVEIARMATERLTPFVMVFTQ
                     SIKLTLAFAVLALDIVAYLEHMDGHYSTVGLSLDCGLL"
     gene            complement(<2293121..>2293905)
                     /locus_tag="MYCTH_2129017"
                     /db_xref="GeneID:11510925"
     mRNA            complement(join(<2293121..2293237,2293281..2293428,
                     2293517..2293645,2293814..>2293905))
                     /locus_tag="MYCTH_2129017"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665117.1"
                     /db_xref="GeneID:11510925"
     CDS             complement(join(2293121..2293237,2293281..2293428,
                     2293517..2293645,2293814..2293905))
                     /locus_tag="MYCTH_2129017"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665165.1"
                     /db_xref="GeneID:11510925"
                     /db_xref="JGIDB:Spoth2_2129017"
                     /translation="MGTPSGAESGESRRRTEAFGECRGGASPTYINYALAISDDIPEE
                     YRANYEQFRDALSSLFIERIAAPFSKPKRRPSTRPCPGRGLRDLWARLGPPDVHHHLI
                     PRMVYDKAVKRGWHRRDELQDFRGHEELAREYYTVERLLATDEVRRFGEWVGRVRWKA
                     R"
     gene            2293995..>2295016
                     /locus_tag="MYCTH_70861"
                     /db_xref="GeneID:11510926"
     mRNA            join(2293995..2294237,2294433..>2295016)
                     /locus_tag="MYCTH_70861"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665118.1"
                     /db_xref="GeneID:11510926"
     CDS             join(2294069..2294237,2294433..>2295016)
                     /locus_tag="MYCTH_70861"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665166.1"
                     /db_xref="GeneID:11510926"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Spoth2_70861"
                     /translation="MATITTIIAFDLYGTILSTDSIAAELAEVAGHDRAGELASLWRR
                     YQLEYTWRINSMGHYRPFTTLTLASLRHAVADLDPALVSVLTPDREDRVMRAYDALRV
                     FPEVPAAFRSIRDQAEPAPAPATAAAAKTRVEAYVFSNGTADMISSSLSNAPDLAPHA
                     GVLRGLVSVDEVRVYKPDRRAYEHLLRRVGKEGRPEEVWLVSSNPFDVVGAVSAGLRA
                     AWVDRAGRGWTDRLLFEPTIVARGVDEAVREII"
     gene            complement(2295106..2297646)
                     /locus_tag="MYCTH_2308601"
                     /db_xref="GeneID:11510927"
     mRNA            complement(join(2295106..2296605,2296661..2296738,
                     2296838..2297646))
                     /locus_tag="MYCTH_2308601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665119.1"
                     /db_xref="GeneID:11510927"
     CDS             complement(join(2295363..2296605,2296661..2296738,
                     2296838..2297349))
                     /locus_tag="MYCTH_2308601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665167.1"
                     /db_xref="GeneID:11510927"
                     /db_xref="JGIDB:Spoth2_2308601"
                     /translation="MAQPSPPTTRPTTRPTRAAPANNTRFFGSQIGGRSVINYGYTDM
                     PWKLMAWDVYYFFKYSWAIPYILWPLSPADSGELSELSPTKENIRAIAIHLVLCILQL
                     GGLVALPALAVLPIWTATIIVGVFLLVNKLLCMLLNGKEVEYHSDPKYAPALPEHAHE
                     QWIFINGVAVGSHWMQTNLNRLAASFKRPILGIHNRTSGILFDVVECLIQRNWGYATK
                     DVRVCYRIIKKKLYNPQYSKVIFILHSQGAIEGSLILDWLLQELPQDLLSKLEVYTFG
                     NAANHFNNPHRHIRTQNLAKLNPSAACVDSVQLTHNREEAARVPRRRCPQPGSRPNSS
                     SSSNSSSGSSSSSRSSSRSGARSSSSSTSFDLDDAADSSNRHSTPTTTETESGAGTAT
                     ALFTAAAGSSPHPSHHPDRAIGYIEHYAHTTDFVAAWGVLHFATSSPSSQFVPRFIGR
                     VFARTSPRGGHQMVQHYLDGMFPLRRDPATGELARNADGVPLGVEEEGNEFMESEVLV
                     GGGGDGTGREEGEGEELSDGEAADGEEQEQVEVVDVSPEPARAESGDGAVSPRKTRRK
                     RQEGVRVKVKDVSRLWQYRNGRSPEETPPLLVRGKDGVVRNATM"
     gene            2298307..2301339
                     /locus_tag="MYCTH_2308603"
                     /db_xref="GeneID:11510928"
     mRNA            2298307..2301339
                     /locus_tag="MYCTH_2308603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665120.1"
                     /db_xref="GeneID:11510928"
     CDS             2298357..2300939
                     /locus_tag="MYCTH_2308603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665168.1"
                     /db_xref="GeneID:11510928"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="JGIDB:Spoth2_2308603"
                     /translation="MGKNRKSKRQLIRDEKRAKKRGRELAEEEERSAKRQRQHDADGQ
                     QELSNDDLFTYDPNADYIPFDEEEDGNDAAGYNASAAHPRARGGNFEREFFGMLGEQE
                     QEYFRHADELLELNDFPSAEERHIFLQNVYREARGKELKLASSQSCSRLMERLILLST
                     PRQKKRLFGAFAGHFMTLVTHRFASHCCEKLFLMSAPVVTAELSGEADKDVEMGDADD
                     DEPMAPEIAEAVKTSMEDLFMLTLDELEEHLSFLLSDRYGSHALRVLLVVLSGRPLAQ
                     AGTKSLLQGKSKEYVTVEGASAVTSALNTQTRAVPSSFTMAIEKIISDSTASMDSTAL
                     RVLAKHPTGNPTLQLLLDLELSLSKSKKSKKEEGSGNAAEGEGSVVSLLERLVPGAPA
                     SFSDEKSQACEFVNSMLYDPIGSRLLETLISHCPGKVFKGLQANIFAPRIQSLLRNDI
                     ASYPAIKVLNRLNKEDLANAVQKALPEIPSFVEKGRFNVIKTLFERCNVRGATAELGS
                     LLQALTAACGGNWKHIVPKLCLLSEPEQEPETKEKKFQTPEAKSKAALISHGSQVATA
                     LLDIPGQPSKAIQNSLLALSPDQLLRMATTSPSTAAILTKALATPAQIPHFHKLLVAA
                     LLPNIFTLATSQHGNGIVTEIISTPSKGGGGTSSEGAVVVPFHLKENIMAQLERQERA
                     LRETWLGRNVWRAWRGDLWSHRRHDWVRWAKETDPEGERVAGMPKVSKPGDGEEEGKG
                     KGKAGKAAAKGPVSGGKKSTSVNGVAAGKGVGQELGTKRKTEPKAEGKVDKKGNEKKG
                     GKEEEGKEKRGKKEGEGKEKRDKKEGKATNGENADEDVKKEKKKKKKKGLGKEGVEGE
                     VKAA"
     gene            complement(2302519..2304818)
                     /locus_tag="MYCTH_2135162"
                     /db_xref="GeneID:11510929"
     mRNA            complement(join(2302519..2304427,2304515..2304818))
                     /locus_tag="MYCTH_2135162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665121.1"
                     /db_xref="GeneID:11510929"
     CDS             complement(join(2303003..2304427,2304515..2304580))
                     /locus_tag="MYCTH_2135162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665169.1"
                     /db_xref="GeneID:11510929"
                     /db_xref="JGIDB:Spoth2_2135162"
                     /translation="MPTKRLSPSSDANDVVNLPLKKTQRTHEENQERAYIAASRRADR
                     DIEHRIRSALKASECRRKRTGRGLKITREAVIGDEQYESEDDDHASRRFSMPATTSTT
                     ASSLSNPYVQSPSRAADRYAEIDALFAKHFPHVQLSSQWSRQHQTTHRYSYSQPSLGP
                     QAQAHPGRYVPRFQQQQQQHQHHQNSSVQIPVPVPATFSNTAMTTTTTTTTTPPTAAP
                     TSSPSCSYSPALLTPPVSYPLPPAACGNGEAAGSPTAKSGSMSPLLLENQHSSLLSSS
                     SSRPGSAFSAAAQQATVGLGLASGYLQQVATTGAGGDLDSHDGAAAALSCCFGTLGYS
                     AETVPAGLGADDPLWYSSGDHGPGATAAGGRGGLTATTTTTTTATTPTAAAAAAAAAA
                     TTTTTTASAPAQAGWQSQSRSLSLPSALEQFQFFPAFEQASIGEEEPSDALIDPGILA
                     SGSGVAAGSGSGSVPVDGFDAGAPGEPWADWINLDGDAPAPLGVEV"
     gene            complement(2308353..2311662)
                     /locus_tag="MYCTH_112227"
                     /db_xref="GeneID:11510930"
     mRNA            complement(join(2308353..2309869,2309971..2311662))
                     /locus_tag="MYCTH_112227"
                     /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
                     phosphoketolase-like protein"
                     /transcript_id="XM_003665122.1"
                     /db_xref="GeneID:11510930"
     gene            complement(2308605..2308688)
                     /locus_tag="MYCTH_t154"
                     /db_xref="GeneID:11510931"
     tRNA            complement(2308605..2308688)
                     /locus_tag="MYCTH_t154"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:complement(2308653..2308655),aa:Lys,
                     seq:ctt)
                     /db_xref="GeneID:11510931"
     CDS             complement(join(2308946..2309869,2309971..2311518))
                     /locus_tag="MYCTH_112227"
                     /codon_start=1
                     /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
                     phosphoketolase-like protein"
                     /protein_id="XP_003665170.1"
                     /db_xref="GeneID:11510930"
                     /db_xref="InterPro:IPR005593"
                     /db_xref="JGIDB:Spoth2_112227"
                     /translation="MGDANELESISTFGSARSTIKGAPLSEEEVKKYNDFFKASLYLS
                     LGMIYLRHNPLLKEPLKKEHLKARLLGHFGSAPGQIFTYMHFNRLINKYDLDALFISG
                     PGHGAPAVLSQAYLEGTYSEVYPDKSEDEEGLQKFFKHFSFPGGIGSHATPETPGSLH
                     EGGELGYSISHAFGAVFDNPNLIALTMVGDGEAETGPLATAWHSNKFLNPITDGAVLP
                     VLHLNGYKINNPTILARISHKELENLFLGYGYQPYFVEGDEVDSMHQAMAATLEHCVL
                     EIRKYQKQARDSGEPFRPRWPVIILRTPKGWTGPRKIGDKYMEGYWRAHQVPITDVHE
                     NPGHLKLLERWMRSYEPERLFVDGRINPELRALCPTGNRRMSANPVANGGLLRKPLRM
                     PDFRNYALEVEKPAVTMAASMQNMAKFLRDVVALNPTNFRLFGPDETESNKLAGVYQA
                     GKKVWMGEYFEEDENGGNLAPNGRVMEILSEHTCEGWLEGYILSGRHGLLNSYEPFIH
                     VIDSMVNQHCKWIEKCLEVEWRSKVASLNILLTAVVWRQDHNGFTHQDPGFLDVVANK
                     SPEVVRIYLPPDGNCLLSCMDHCLRSSNYVNVIVADKQEHLQYLSMEDAIVHCTKGAG
                     IWPQFSTDHGAEPDIVMASCGDIATHETLAAIDLLLQHFPELKIRYVNVVDLFRLISH
                     IDHPHGMTDAEWEALFTADKPIIFNFHSYPWLVHRLSYKRPGAWRNLHVRGYKEKGNI
                     DTPLELAIRNQTDRFSLAMDAIDRMAGSGVLGNRGAAAREALKNAQIRARTEAFENGV
                     DPDFLKSWTWPYERTVQEAVPKLMG"
     gene            complement(<2314864..2317958)
                     /locus_tag="MYCTH_2308614"
                     /db_xref="GeneID:11511495"
     mRNA            complement(join(<2314864..2316896,2316968..2317216,
                     2317273..2317406,2317471..2317958))
                     /locus_tag="MYCTH_2308614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665123.1"
                     /db_xref="GeneID:11511495"
     CDS             complement(join(<2314895..2316896,2316968..2317216,
                     2317273..2317406,2317471..2317591))
                     /locus_tag="MYCTH_2308614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665171.1"
                     /db_xref="GeneID:11511495"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="JGIDB:Spoth2_2308614"
                     /translation="MSSYDGSRSARQSKRYSMSALYMSMSANESDLVIEDDLAKAQKV
                     LRDLKAKISSQSKKNFVLEKDVRYLDSRIALLIQNRMALEEQNEVASHLEDATEVQEG
                     TFPNDEKTQKYGNLMFLLQSEPRHIAHLCRLVSMSEIDSLLQTVMFTIYGNQYESREE
                     HLLLTMFQFDNTPEYSSLLRANTPVSRMMTTYTRRGPGQSFLKSVLADRINSLIELKD
                     LDLEINPLKVYERMCEQIEQDTGSLPASLPKGITQEQAAENPQVQAIIEPRLTMLTEI
                     ANGFLTTIIEGLEEAPYGIRWICKQIRSLTKRKYPDANDQVICTLIGGFFFLRFINPA
                     IVTPKSYMLIDGTPAERPRRTLTLVAKMLQNLANKPSYSKEPYMAKLQPFIHQNKDRV
                     NKFMLDLCEVQDFYESLEMDNYVALSKKDLELSITLNEIYAMHALIEKHSAELCKDEN
                     SHLSIIMSELGAAPPQVPRKENRVINLPLYSKWETAIDDLTAALDIAQEEVYFMEAKS
                     IFVQILRTIPPNSSVAKRPLRLERIADAAATSKNDAVMVRKGIRAMELLSQLQELRVV
                     DKSDGFSLLRDEVEQELQHLGSLKEVVLAETQKLEEVYKTIRDHNAYLVGQLETYKNY
                     LHNVRSQSEGTRRKQQKHQVLGPYKFTHQQLEKEGVIQKSNVPDNRRANIYFNFTSPL
                     PGTFVISLHYKGNPHSFIFRFSSFFFSTPSSSISVQQARQNTDKPICRTEPRPARARS
                     EAGRPPRNAKRQPGRPRPRVRPVQRAQGVGAPQQAVRAEERVVGRPSFSLAAAQFLLP
                     PLLPLLLPSLRSRFLRLSFSASRPALARGRGGGFAHL"
     gene            2323426..2325374
                     /locus_tag="MYCTH_2308617"
                     /db_xref="GeneID:11510932"
     mRNA            join(2323426..2323511,2323694..2324213,2324369..2324686,
                     2324821..2325374)
                     /locus_tag="MYCTH_2308617"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665124.1"
                     /db_xref="GeneID:11510932"
     CDS             join(2323780..2324213,2324369..2324686,2324821..2325253)
                     /locus_tag="MYCTH_2308617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665172.1"
                     /db_xref="GeneID:11510932"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2308617"
                     /translation="MAGLVEDVEKQAAVTPHPGTLAPEKMSLSTKGTGPSLTCSDTQS
                     SIDTDPLSPLQHALALPLAAAEVEQIPSDDLDDDDEEEEEEEDNDGNPNHISRSNSNN
                     VNEDNKDPLHLTRTRTSVTSAASRPLDFEVTIEADDPENPRNWPLWYRAYTVLSVSYA
                     TWVVVLYSTSYTATIPGIMAEFGVSSRPVATLGLTTYLLGLAAGSVVVAPMSELYGRR
                     VVYLVCLGLFVVLIIPCGLATGLAELVVVRFIGAVFGAAMISNSPGTVVDIAGHESLA
                     LCMSWYSIAPLNGPVTGPLIGGFVYENLGWRWGNWLAMILAGVAFVMLSLVKETYMPA
                     LLKKKAARLRKETGDDRWWCRHDQRISTLDLLKTNLGRPFVLAATEPILWFFNIWSVN
                     FP"
     gene            2325364..2326548
                     /locus_tag="MYCTH_2308621"
                     /db_xref="GeneID:11510933"
     mRNA            2325364..2326548
                     /locus_tag="MYCTH_2308621"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665125.1"
                     /db_xref="GeneID:11510933"
     CDS             2325496..2326284
                     /locus_tag="MYCTH_2308621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665173.1"
                     /db_xref="GeneID:11510933"
                     /db_xref="JGIDB:Spoth2_2308621"
                     /translation="MTGLAFVGIGIGTLIAIGMEPVWRRLINGSGKREADTGRAAPEA
                     TALVMCIGALLTPLGQLVFSWTCLPASIHPAVPIAFGIPFGMGNTLSFIYGSNYLAAA
                     YGIYAASAMAGNAVARSVFGAALPLAGPAMYEAMTPQWAGTFLGLLEVLLIPIPFAFY
                     RYGHKIRDRSRVIRQMREDRAKAERRAARFAARKERAEKMTGLAATTTVTAATAAAAA
                     AATTIITTVPTSPAAAAAAAAVAITRENGEEEKEHAAAQGARMA"
     gene            complement(2327009..2329576)
                     /locus_tag="MYCTH_2308622"
                     /db_xref="GeneID:11510934"
     mRNA            complement(2327009..2329576)
                     /locus_tag="MYCTH_2308622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665126.1"
                     /db_xref="GeneID:11510934"
     CDS             complement(2327220..2329283)
                     /locus_tag="MYCTH_2308622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665174.1"
                     /db_xref="GeneID:11510934"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="JGIDB:Spoth2_2308622"
                     /translation="MQQQEHYSSSPSLSSPPSALSEPGSPTRVLNAGRANIEMDEIIV
                     DPSSAARFTIMQQHQPAEQAPNVPLTAAGLPRKKPGRKPGSTVKPKPPADGSSNTTNG
                     DAPKQRRPRKPKDPNAPPVQRKRKAAATEAGDANSEMDARSASGPPRQTKITELTPMR
                     MALDARSAPTDIGFAPTAPKRESASGSMNMMNLLNEEPQPKPQPAPPARQMFDPIRGN
                     YDPIRESVATRDPYGTGPHGSPRAPTQVVNRASASPSIASLVDPQPAPSAISPRPAYT
                     NPTSQPRYQDSTSMPPSPSDVARNASQSAAKPTTLTEARRPPPPPPAPPTASKPESKV
                     TTSFTSMASAPSATSSGPTAAPTAAAAAAPAAAPPAAAPSKKIAAVVQQERESQKKTR
                     SSSSSSPKLNSLKDALPPLPGGERSILDFGKARPGEEAEAPNISLHIPLNPGECNRYV
                     NFMRMAEERYGWDALHPRLAASRERKARIAAATAALEKTGSGRDSSAEEMDEDILQGS
                     DAGESNAEMQGNGNGTGTGAPAKPAKKKRNFKEDEYDKDDDFVDDSELLWEEQAAASK
                     DGFFVYSGPLIPEVEKPAASEERPRRGRGGRGRGSRGGGGTVRGEGSGRGRGGGGPGS
                     RGGTVRKPRITKLEKEQRDREKAEREKLAQITTSKTGTDSPASSLLSLGAPSSTQGAT
                     PSMAM"
     gene            2331713..2333527
                     /locus_tag="MYCTH_2308623"
                     /db_xref="GeneID:11510935"
     mRNA            2331713..2333527
                     /locus_tag="MYCTH_2308623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665127.1"
                     /db_xref="GeneID:11510935"
     CDS             2331889..2333253
                     /locus_tag="MYCTH_2308623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665175.1"
                     /db_xref="GeneID:11510935"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="JGIDB:Spoth2_2308623"
                     /translation="MEVTLDVLDVKERETSDATPPSFPTAPAPSATGFPAHKKRVSAF
                     KQQRQKKPAGASPASTSADRSSKPSGHDEAPARHATTTTDERRAIDEENKAVLASMSP
                     EEIAEAQKELYNGLDPKLIQMLLRRANLDEPSGPSPFDAQPPERSQDPGSPPPPPPAK
                     PRQATVEDAPEEPPAAGPKSPPREERDDKPKKTVTFDEDAPPPMPPPDLFPVTSAARP
                     KPAPAHKPTPAHKPTPAHKLSADVPHNTHFPRPPAVPDLDPADPNFLETMHKKFFPDL
                     PADPSKLAWMAPVPTPDSPADRESPYYPGQDSLPVSALRFDFRGALLPPRVSRRIPVT
                     KGLHHHGEAPEAAGYTIPELARLARSAVPAQRCLAYQTLGRILYRLGKGEFGSGAGGR
                     DGEEDDLAFALWRCFKEGRVIESLEQEAGLPEGKGHMSSKAYATEALWLFEKGGWKEK
                     WRGL"
     gene            2338900..2340439
                     /locus_tag="MYCTH_2308628"
                     /db_xref="GeneID:11510936"
     mRNA            join(2338900..2339203,2339305..2340439)
                     /locus_tag="MYCTH_2308628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665128.1"
                     /db_xref="GeneID:11510936"
     CDS             join(2339050..2339203,2339305..2340122)
                     /locus_tag="MYCTH_2308628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665176.1"
                     /db_xref="GeneID:11510936"
                     /db_xref="JGIDB:Spoth2_2308628"
                     /translation="MLDFTQFSAAFPTDGPKPYDQNGIREIETFRKSFGGVLFIDRVL
                     KALGLGDTGKVYPPKGDSGLRALHQQICATKVSPHAKLSVFYYLLLDYDELRGARSNL
                     AEALAEESGLPTNYQLLMRGLWHMDRKEFKFALENLAHPSLPAEFADDIVTVLVRHAK
                     AAAAAPQSDGDGDDDDNNNNNDDDYSLALAYYHAAQPVLQTSEALELLFGALARTSVS
                     EALYFSRRFPDHARQQLFEKLVASVLDQAADAAGARGRELASLPLTGAEEKWFHDYIA
                     VGDGRKSKNAKTVAQMRQLVTGRHRGPIPAGGLGGLGGQGAAVRAAR"
     gene            complement(2340857..2343095)
                     /locus_tag="MYCTH_2308630"
                     /db_xref="GeneID:11510937"
     mRNA            complement(2340857..2343095)
                     /locus_tag="MYCTH_2308630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665129.1"
                     /db_xref="GeneID:11510937"
     CDS             complement(2340969..2343011)
                     /locus_tag="MYCTH_2308630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665177.1"
                     /db_xref="GeneID:11510937"
                     /db_xref="JGIDB:Spoth2_2308630"
                     /translation="MAQQQSLSSNNPFRRKAASSAPAAPPAAVPRFADLDESPGPTPG
                     VEPDLPPADLFRHQLQSLSASTEPPPETSFRKPKVVKKVRVQSPPSSPDSSGVPEQFP
                     SASSDEDDSSIGPSDETGNHEDPFDRASSTDSADVSDKGEDDPQPLPTYRTPPNPFEK
                     TLRDLNVGPAGSEKKGPERASGTRGVLDVDAFGRLLLTGQAGGAASSQAASPFITEHD
                     TKHPPAPNSNGATTRDATSAPRSPSSGTLQVAQDTPQLSREALEHAGQSDGSGSVSSV
                     QPSTLPNVQTTPPHPKKKPPPPSSRHGKLINPGPAGAAAESKPTAGGAQGPVTSPGRR
                     ATTSLTPASPSSPHSANRSLSSASQEPPAEEASNSVPDREAAGKLLGPEIQPGLNIVI
                     PPRPPTPPNASHATVVTGTQSSRKPAPPPRRQPHVRSGSKTASGAVSAVQHDDPELPV
                     RRSSVDSTKSRSSAAARVGVHAPAPPPPRRPSHASRGSISHAVPPPSPTAPSEDSEPI
                     FLSGGAPIVSSPATVSDDTPDGSGSSTPAPAQPPATAAPGTKPVPPPPPPARNASVRG
                     KRPAASRTVPASPSSSSPDASGLTRRSSGSGNRGKEPPPPPTRHRDRGNSRGSSVEGA
                     AAASGWAESQQPVPDAERSVDSGPAGMESHAGEILADLNALQREVDALRGQVEKAG"
     gene            complement(2344476..2346046)
                     /locus_tag="MYCTH_88687"
                     /db_xref="GeneID:11510938"
     mRNA            complement(join(2344476..2345218,2345273..2345400,
                     2345550..2345572,2345742..2345768,2345825..2346046))
                     /locus_tag="MYCTH_88687"
                     /product="histone 1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665130.1"
                     /db_xref="GeneID:11510938"
     CDS             complement(join(2344920..2345218,2345273..2345400,
                     2345550..2345572,2345742..2345768,2345825..2345917))
                     /locus_tag="MYCTH_88687"
                     /codon_start=1
                     /product="histone 1-like protein"
                     /protein_id="XP_003665178.1"
                     /db_xref="GeneID:11510938"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="JGIDB:Spoth2_88687"
                     /translation="MPPKKTETKTETKAEGAAAPKPKSGSQHTYQDMIIDAIIALKDR
                     NGSSRQSLKKYVRANNKINATDAMFDSLFNNALKKGVEKGIFEQPKGPSGGTKLAKKA
                     LKPAAPKKAAAPKKAAAKKETKDAKEPKEKKAATKKAAPKKETAAKETKETKEKKAAA
                     PKKAAPKKASAAKKVSRSFHLRFYHCCSG"
     gene            complement(2351213..2353138)
                     /locus_tag="MYCTH_2308643"
                     /db_xref="GeneID:11510939"
     mRNA            complement(2351213..2353138)
                     /locus_tag="MYCTH_2308643"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665131.1"
                     /db_xref="GeneID:11510939"
     CDS             complement(2351363..2353003)
                     /locus_tag="MYCTH_2308643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665179.1"
                     /db_xref="GeneID:11510939"
                     /db_xref="JGIDB:Spoth2_2308643"
                     /translation="METYYGVVRSPADAIKLFEACRLGLLPRVQRRLSEKERQAIRSG
                     SVFVWDEREAGMRRWTDGKSWSASRVAGSFLTYREMEGKRGNAFGGRRGAGKTPDSGR
                     GSDEDHDDGEPDGYRYKPDGLTKQSFSITNAAGQHLHLIAYYARGPLDLPLPTTDPSL
                     RHIVPAKGMYPESSLTETTPPTTGRAPLPQPAYMPPPHQPQPPHGYPSHYPYPGHAWP
                     PSPDGTPPYGHGQYSYPPALPPPQGHHPPPALPPYLPAPPSHHHPHHHYPPAESNSSQ
                     ERTPLPLPPPPSYSSQHAPAHPSTPSYSHAQPHSQPQLPAPRAAIQAPPPYPQNQHQS
                     PQPPPRVTLLDSPRSQHLQAKAREAVQIEPRLAPIDAARNRHSPLPAPGQLTHPQQNG
                     GSPTTTTTTATATTMTTTTTTTSITLPPPTTTASPTINAPSGSPIPNGSSRPDSSGRA
                     HAPTTTTPTTASTRPTLSALLHPSTIPPPAPPHGSSEPSSAQPISSAGTVGGGGVGIN
                     SAGSSPGAGLPPSATVRQDSRSSDEDARAIGVLNKNFF"
     gene            complement(<2358734..>2359905)
                     /locus_tag="MYCTH_2112063"
                     /db_xref="GeneID:11510940"
     mRNA            complement(join(<2358734..2358919,2358982..2359069,
                     2359107..2359168,2359248..2359293,2359402..2359475,
                     2359716..2359756,2359815..2359835,2359878..>2359905))
                     /locus_tag="MYCTH_2112063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665132.1"
                     /db_xref="GeneID:11510940"
     CDS             complement(join(2358734..2358919,2358982..2359069,
                     2359107..2359168,2359248..2359293,2359402..2359475,
                     2359716..2359756,2359815..2359835,2359878..2359905))
                     /locus_tag="MYCTH_2112063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665180.1"
                     /db_xref="GeneID:11510940"
                     /db_xref="JGIDB:Spoth2_2112063"
                     /translation="MPGIVACRLGRPNPRASERLIVTQSWNIQRYSIHTTANYTTCAR
                     RTSSVLDDVLNLAVLPLLGMVNEEFRICRAQESPGNTLYVRDAVWTCPCNTTPSLGQV
                     PLRLMICIQKVQYESASTMMYATTQGQPPDRTVLRDTLSTGALTIKSIGQDVVRTPKL
                     LSSPTLTDRELARWLAGRLVE"
     gene            complement(2365899..2367814)
                     /locus_tag="MYCTH_2308647"
                     /db_xref="GeneID:11510941"
     mRNA            complement(join(2365899..2367148,2367223..2367340,
                     2367403..2367814))
                     /locus_tag="MYCTH_2308647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665133.1"
                     /db_xref="GeneID:11510941"
     CDS             complement(join(2365991..2367148,2367223..2367340,
                     2367403..2367674))
                     /locus_tag="MYCTH_2308647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665181.1"
                     /db_xref="GeneID:11510941"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="JGIDB:Spoth2_2308647"
                     /translation="MRPALALRPSSVSRSLGPRRVASFHQCASQWSSRSVAELLQWRP
                     TEKVDDVTVNGFVRSVRSMKTHRFVSLGDGSSLAPLQALVQADDAKDLAVGAAVRLTG
                     SWVSSPGVAQSHELHVSRVEVLGPSDAKTFPIQKKYHTPEYLRTVPHLRPRTPVNSVL
                     LRLRSEVIASLTQFFAARSFTQTHPPIITSSDCEGAGEVFTVMPASDAPATGSNKDNS
                     QAFFFRSKKYLTVSTQLHLEALAQAVGNVWTLSPVFRAEKSDTSRHLSEFYMLEAEMS
                     FVDDLGPVMDLAEDMLRSLSSSLIESSTVRDLLFRSRNSGSDLAPADEVRRRWEGLTR
                     QDWPRITYSDAVALLQQKSDLFEHKPTWGAGLQSEHEKFLAEYVGGGEKPVFVTNYPR
                     DIKAFYMRETQPASPQVPGPTVDCFDLLVPEFCEIAGGSMREHRLDPLLDAMKRHGIL
                     KPPLEGASDGSSSSGLDWYVDLRRWGSPPHGGFGVGFDRLLSYLSGVQTIRDIVAFPR
                     WHGRCDC"
     gene            2369202..2370912
                     /locus_tag="MYCTH_2308648"
                     /db_xref="GeneID:11510942"
     mRNA            join(2369202..2369587,2369639..2370912)
                     /locus_tag="MYCTH_2308648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665134.1"
                     /db_xref="GeneID:11510942"
     CDS             join(2369395..2369587,2369639..2370522)
                     /locus_tag="MYCTH_2308648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665182.1"
                     /db_xref="GeneID:11510942"
                     /db_xref="JGIDB:Spoth2_2308648"
                     /translation="MPSSGTKSTKPKPSEVASEAKRIYIPMIRDRYAVTWTTCSYIYH
                     QPLLQINFTDRPLDLSPPVFYVSVGDPVDTALNWVESARCAIAFICAANDKRPGGDWE
                     TGVVGYEERLCRRSTLAACLATPADGSPANSHYPLPTCAGVLSQHVGESACSGNFSAR
                     LVNLPHTVVFRGPHDRYEKLPTDQWRALPVVSVPPPRWPKLTQNGTKYSFADEREMVK
                     EKMRGALRICAYNNYSTVVIGNFGLGNGYRNPPQELAELWREVCLYDPDLRGRIRCVA
                     FVFEDPSQSTTQLILDDIAKKAKGGGSSSSGRSKTNGSSSSSSSPGGSPADVEIFSRV
                     FDNAEIQRFLAQPDARYGLSNLLA"
     gene            complement(2373824..2377961)
                     /locus_tag="MYCTH_2308649"
                     /db_xref="GeneID:11510943"
     mRNA            complement(join(2373824..2374231,2374413..2375605,
                     2375720..2377961))
                     /locus_tag="MYCTH_2308649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665135.1"
                     /db_xref="GeneID:11510943"
     CDS             complement(join(2374148..2374231,2374413..2375605,
                     2375720..2377547))
                     /locus_tag="MYCTH_2308649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665183.1"
                     /db_xref="GeneID:11510943"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="JGIDB:Spoth2_2308649"
                     /translation="MADYSMYHALGQGEVLDPNDPTRTSQPAPPQFQPPVAPNPYQQA
                     AGQQPYYGAPPPAGSLVPPQAPGYGPPQPGGYPQQGQQPPAGDGGLVAQMGGMTLGAD
                     AGTGAGTGTVRKKKKDRHAYHTVEAPAGSSQPFNGMPPAGTPATPYLNADPSAAASRY
                     GPGAPTPQMSQFPAPVSPAFVPFPASPAEFAARSGYADPAPSPSMVPAAAGQTRVSPD
                     EMPSVPLSRDSVQQYFLSNVYPTFERLVPPPATVSFVAFDQGNASPKFARLTLNNIPA
                     TADGLKSTGLPLGLVLQPLAPLQAGELDIPVLDFGDAGPPRCHRCRAYINPFMMFRSG
                     GNKFVCNLCGYANDTPPEYFCATSPQGVRVDRDQRPELVRGTVEFVVPKEYWTREPVG
                     MRYLFLIDVTQESYNKGFLEAFCDGILRALYGGGDDERDENENGEVRRRIPAGAKVGF
                     VTYDKEVHFYNVSPALEQAQMMIMPDIEDPFVPLGEGLFVDPYESKAVISSLLTRLPQ
                     MFSTIKNPEPALLSTLNAAVAALEATGGKIFCSLSALPTWGPGRLFLRDDGKHPSGEP
                     DKKLFSTEHPGWRKTAEKMVSVGVGVDFFMAAPSGGYLDIATVGYVSATTGGETFYYP
                     NFIAPRDNTKLALEIKHAVTRETGYQALMKVRCSNGLQVSGYHGNFVQHTFGADLEIG
                     VIDADKALGVTFTYDGKLDPKLDTHFQAALLYTSASGQRRVRCINVIAGVSENARDSI
                     KFIDQDAVYTLLAKEASTKLATTSNTIKDIRLSLAERAIDVLANYRKNFLSQAHPPGQ
                     LVMPERLKEFSMYMLGLLKCRAFKAGSESTDRRVHEMRMIRSMGALELGLYLYPRIIP
                     LHNLQPDEGFPDPQTGHLRMPPAMRASFSRVEPGGVYLVDNGQQTLLWMHAQTSPNLI
                     ADLFGDDKTSLQSLDAYTSSIPVLQTHLNAQVRNIIEFLRTMRGSKGLTIQLARQGID
                     GAEYEFARLLVEDRNNEAQSYVDWLVHLHKGVQLELAGQRKREDTSESSALSSFTGLR
                     PSYW"
     gene            2378405..2381855
                     /locus_tag="MYCTH_2308652"
                     /db_xref="GeneID:11510944"
     mRNA            join(2378405..2378672,2378772..2381855)
                     /locus_tag="MYCTH_2308652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665136.1"
                     /db_xref="GeneID:11510944"
     CDS             join(2378527..2378672,2378772..2381733)
                     /locus_tag="MYCTH_2308652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665184.1"
                     /db_xref="GeneID:11510944"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="JGIDB:Spoth2_2308652"
                     /translation="MFTFSPLQGALTESAASQSLLELDGGVKVLVDVGWDETFDVEKL
                     RELEKQVPTLSLILLTHATINHLGAYAHCCKNFPLFTRIPVYATRPVIDLGRTLTQDL
                     YASTPMAATTIPQTSLAESSYSYAQASSADHKLLLQPPTPDEIARYFSLIQPLKYSQP
                     HQPLPSPFSPPLNGLTITAYNSGHTLGGTIWHIQHGLESIVYAVDWSQARENVFSGAA
                     WLGGGHGAAGGAEVIEQLRKPTALVCSSRTPETALPRGRRDEQLLESIKLCIARGGTV
                     LIPVDSSARVLELSYLLEHAWRSEVAKDNEVFKSTKVYLAGRSVGSTMRNARSMLEWM
                     DDSIVREFEAVAGGTRTGNSGGGAGSGAKGKEAGPFDFKHLRLLERKAQVERVLQQAT
                     ATDDAEPRGRVILATDSSLEWGFSKDVMRAIAEDPRNLVILTEKPSLNPGKPSIARML
                     WEWWRERKDGVAVEQTSGGDTFEQVYGGGRELELTDATRQALEGTELDVYQQWLATQR
                     QLQATLQTGGAATLESAADVVDDASETTTESEESETEQQGKALNVSTTIGQASRKKVL
                     LKDEDLGITILFKKKGVYDFDVRGKKGRERMFPIVVRRKRNDEFGELIRPEDYLRAEE
                     REDAEAQDERQDGQREEQGQGLGKKRKFDDVGAAKGGASGANKRPQPKRAVSDEPEAG
                     ALLDGHAGDELDELEDEEEEAVVGPAKLVVKSQTVSVKLRIAFVDFSGLHDKRSLNML
                     IPLIQPRKLILVAGGEEETHALAADCRKLLSAQLTSESSSQAAIDVFTPAVGATVDAS
                     VDTNAWVVKLADPFVKRLKWQNVRGLGIVTVTGLLLPGGEMAVQDGAAAEAGSSNNNK
                     HGNEQEEQEQDGSNKRQKLDGTPTPGPAEPDGTVTTTNTTTNKNNNNNTSTSASTLAT
                     TDKPATLPTLDVLPPALASAVRSAAQPLHVGDLRLADLRRGMLASGHKAEFRGEGTLL
                     IDGIVAVRKTATGRIEIESVGLPLAADAGSGSGSGAAAALAGLGTFYEVRRKIYEGLA
                     VVAGA"
     gene            complement(2382310..2383106)
                     /locus_tag="MYCTH_2308654"
                     /db_xref="GeneID:11510945"
     mRNA            complement(join(2382310..2382634,2382939..2383106))
                     /locus_tag="MYCTH_2308654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665137.1"
                     /db_xref="GeneID:11510945"
     CDS             complement(join(2382393..2382634,2382939..2383032))
                     /locus_tag="MYCTH_2308654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665185.1"
                     /db_xref="GeneID:11510945"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="JGIDB:Spoth2_2308654"
                     /translation="MAAETPITEESLRAALTERLKVTHVEIQDMSGGCGQAFTSLIVS
                     PEFAGKTSLKRHRLVNAALRDEIARIHAWSAKCQTPDEYASEMAATGGDDNPPLDGTE
                     DGKVAGVNG"
     gene            2383265..2384719
                     /locus_tag="MYCTH_2308655"
                     /db_xref="GeneID:11510946"
     mRNA            join(2383265..2383456,2383516..2383685,2383825..2384719)
                     /locus_tag="MYCTH_2308655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665138.1"
                     /db_xref="GeneID:11510946"
     CDS             join(2383395..2383456,2383516..2383685,2383825..2384480)
                     /locus_tag="MYCTH_2308655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665186.1"
                     /db_xref="GeneID:11510946"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="JGIDB:Spoth2_2308655"
                     /translation="MEPALQSPPFTQLVVKAMRSLYPEELADRAWDNVGLLQENIALP
                     SGAVPSRVLLTNDLTLRVAEEAIKKQVSVIVSYHPFIFRGLKSITLGDPHQRIVLRLA
                     QHNIAVYSPHTAVDAVLGGVNDWLASILDKVPGGTSDVTVVQPARGATAPSIPPGFDG
                     AGYGRLVRLREPTDLESILRAYAVALRMRHVMVSRVAPAAPIRSVAVCAGSGFDVLKD
                     ADADLIVTGEMTHHNALRLKMLGKSVLTVFHSNSERGFVREVLQPKLERALREEDAVA
                     EVLVSEEDEDPFEIWEAKE"
     gene            complement(<2385270..>2386370)
                     /locus_tag="MYCTH_2112071"
                     /db_xref="GeneID:11510947"
     mRNA            complement(join(<2385270..2385709,2385776..>2386370))
                     /locus_tag="MYCTH_2112071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665139.1"
                     /db_xref="GeneID:11510947"
     CDS             complement(join(2385270..2385709,2385776..2386370))
                     /locus_tag="MYCTH_2112071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665187.1"
                     /db_xref="GeneID:11510947"
                     /db_xref="JGIDB:Spoth2_2112071"
                     /translation="MSTIASPRDPSGPFPRRTNSVITPTSSSRPSLDVPASVSNSPNP
                     NQSAVSISQSNKRANRAALREYYNLRSNNNNNNNNNNKPLPSTPTVEITDHLGGASSP
                     SFSSTTPAATPPSELDSPDFDAQAYVANLLASSSLADLLRTYTTVLGEMRALDAERKA
                     LVYDNYSKLIAATETIRRMRGAQGSSDSASGSGPGSGPGVGAASLEAVVEGIYRRAAD
                     LREELRASVAAQARADTLGGGSGRGGGDGDGDGDGDGEADEKAARRERTRELAREVVK
                     VPGRLRRLVEDGKAEEAKREWKMPRRLLVRWKELGVGGDDVAALIEEGDAALRKAVEA
                     DGNKGGDPTA"
     gene            2386823..>2387967
                     /locus_tag="MYCTH_116885"
                     /db_xref="GeneID:11510948"
     mRNA            2386823..>2387967
                     /locus_tag="MYCTH_116885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665140.1"
                     /db_xref="GeneID:11510948"
     CDS             2387113..2387967
                     /locus_tag="MYCTH_116885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665188.1"
                     /db_xref="GeneID:11510948"
                     /db_xref="InterPro:IPR013894"
                     /db_xref="JGIDB:Spoth2_116885"
                     /translation="MDIPHQLQASLSTTSIPVPSLAWLEALAGARSPAPPLASLLATA
                     RARLLASDLTAPGLLDARYAAAHSLPARLAQTHAGTREAALPHDVVVQVLDVEDVARS
                     RWEQVEALEALERGEGTRGREIIRLNTASSSSSSSSGADGTAEGAEEEEEEEGGNAAA
                     GAGGGGGGGGRGGATSTSNNNNNNNSSSSSSSSKNGTHKLVVQDCKGQKVHAIELKRV
                     ERLGVGRTFIGEKILLRAGTVLARGVVLLDPAHCVVLGGKVESWHRAWLDGRLARLKE
                     AVGADRRT"
     gene            complement(2388019..2392797)
                     /locus_tag="MYCTH_2308658"
                     /db_xref="GeneID:11510949"
     mRNA            complement(join(2388019..2392483,2392545..2392797))
                     /locus_tag="MYCTH_2308658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665141.1"
                     /db_xref="GeneID:11510949"
     CDS             complement(join(2388331..2392483,2392545..2392663))
                     /locus_tag="MYCTH_2308658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665189.1"
                     /db_xref="GeneID:11510949"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Spoth2_2308658"
                     /translation="MSGTKALLKGINEAIKQQKWTEAIEAAEDVLQKDPKNYQAHIFL
                     AFALDKANQFDRSESTYLTATRLKPNDPQAWQGLIKLYQRQRGKKLKQYQHAALKLAE
                     IFRDANEMYKCQDVVDKFIDFARTQGERAQYVDALDLILPESPIYPALEGRVPHPAKT
                     YEIQAQIVEADEKKRINTLIGERRTRIGARVSEVTLEVKREVYSQSKLGYIYGQLINW
                     ATDDDVRRTYEEKLIQYCYDRLLAWPPGEQKEREAAIVQKLANDMVIIRHPFKFAWDI
                     TINWQDHKDIRDWDVTVLRQYCTFFPDSDLNRVIMGFLTSDISPFPKEPAQQPKSSTN
                     AESEDESEDDEGGGAPTTYVPLTDDDRLLMIMEGVSSADSLFAFRLAGEYYQHIEDHE
                     SNVELMRRALDHLKAERSRTGLPFRNTEDALSLYLGTALIFYQSPRHHQEAKSLFDKV
                     LAHDPSSTGAMIGVGLIYEEEEEYTEAIDFLERALQRDPGNLRVRTEAAWVKALKGDF
                     ETSRNELESCLPLLTKRGQTNKELLAQTQYRIGYCIWNLDTSRAARKSRSGAYAYFLD
                     CLKNNLNYAPAYTILGKYYADYAKDKKRARRCFQKALELSASEVESAERLARSFADDG
                     DWDRVELVAQRVVDSGKVKPPPGSKRKGISWPFAALGVAELNKQDYRKAIVSFQAALR
                     ISPDDYHSWVGLGESYHGSGRYIAATKAILNAQKLEEAAGGNIPGETWFSKLILADVN
                     RELGDFDEAITLYRGIIADRPGEAGVAISLMQATVDNALDSLHKGFFGKSIDLAVETI
                     EFAVQAPQEIKETFNYWKAVGDACSLFSSVQGRLSEFPADTVQQLLGVDESDILSGDG
                     VGAVVNGTTPDENKIGKELTKVLHATILAHKRAIQVSANDTHAQAVAYYNLGWAEHRA
                     HMCLPMRLRKKATKYLKAAIACFKRAIELEAGNSEFWNALGVVTSVVNPSVSQHSFVR
                     SLHLNESGAHTWTNLGTLALLQGDVQFANDAFTKAQSADPDYAHAWLGQGLVALLLGD
                     RKEARSLFTHAMDISESSSTASRRHFAISMFDHVMESPSGLPVTSLVQPILALSQLQG
                     LDPQEVVYGHLSALFQERNHEHDRTVATLEKICAAVESDYEVTESPESLKRFAIAKAD
                     LARAYLAIGSNEEAIEAAELAVQLSNTDDGDDSSELTAEERKRVRLSAHVTMGLAKYY
                     QQQGDGVDDAVACFDLAIEESDGNPDVACVLAQVLWATGKEEARERAREVLFEVIERS
                     PHHVQSVLLLGVIALLDEDEESLEAVMAELQSLRASDEGVTPADQRQLGEVLRAIAAF
                     GKGEGQEEEEAKADQARVDVMLHPHLPHGWAELGGAGGEEGKSAAEMAVRVALKGVPP
                     RGDVAAEDLARAYAGTGRAMDAQRAIVVAPWEKAGWQALGEVVKG"
     gene            2393128..2396798
                     /locus_tag="MYCTH_2308660"
                     /db_xref="GeneID:11510950"
     mRNA            join(2393128..2393490,2393543..2396798)
                     /locus_tag="MYCTH_2308660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665142.1"
                     /db_xref="GeneID:11510950"
     CDS             join(2393254..2393490,2393543..2396674)
                     /locus_tag="MYCTH_2308660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665190.1"
                     /db_xref="GeneID:11510950"
                     /db_xref="InterPro:IPR005554"
                     /db_xref="JGIDB:Spoth2_2308660"
                     /translation="MDSTPAKRRKLDHSQDDAEILLQSAASTGISRSRAFILETEELL
                     DSVRLDYETALDGADNLLHRIKGTIEGIKPHEALPIAQAASKLEKTTKIKVPFPDPQP
                     QENSNYKVAFAKPAQFNVVGSYVSKTMIKTQKDHGVDMVIVIPKEILQEKDYLHLRYF
                     YKRAYYLAVVASSLREEFGSEAQLSYEYLNGNPLCPVLAIQPNVSKEAELETSGKGRV
                     LDFRIRILPCAPDGFFPTAKLHLGATLVRKNRDGESNTSEPTSFYNSTLVAESCFLPY
                     LKVLRQAEKKCAAFKNACILGRIWLQQRGFGGDISQGGFGHFEWAVLLALLLQGGEAK
                     ALSPSLSATQLFKALVQFLSVTNFAEKPCVFGPGKPDLESYCEVTPILYDSARQLNIA
                     FKMGPWSAALLHQHAKWTRSLLANSSVDQFNPTFILKADIPLHSFDLVARLKIDEAPA
                     DTGADSRGPAWQVSNKAYQILKRALVDKEMGQRARLIHMQVPACHRSWPLTEGLGSQA
                     TSPVEIRILFDPINMARTVDRGPSAGPSAEEKKACENFRKFWGDKSELRRFERDSIRE
                     TLIWTSTTPFGICEEIIRYILGRHLRIGHLHEEISVYGDGLPALLSLKPADTASFNVA
                     KKAFGAFERDIRDLDELPLRVRQVAPICPELRQASVKTPTFGSSKSGPRPLECVISFE
                     ASGKWPDSLVAIQRTKIAFLLMIGSLLERSKPGELKTHVGLENAKYETENLAFLDVIY
                     ESGPSFRLRIHSDLEESLLERQVKDKTSEQYLRQRATTLLATFRRLYTNLPLHNQYIS
                     TCATRFPALSPTIRLVKHWFNVHKLSCHFTEEFIELAVLHVFLSPYPWDAPSSINTGF
                     MRTLLFLSHWDWRSEPLVVDTSGEMTASERASISTRLEAWRKIDPNMNHTVLLVATSQ
                     EPSGVAWTTADGQAKPSKVVAARMTSLAKSASRLIREQGVELDHRRLFVPSLKEYDVL
                     IHLNSKAFKSTLKTYANIDPEEEEEVARPKFKNLDERTGQEPLPLAQHPADLFLEHLN
                     ATYGGPLVFFRGSVEDNTIGAIWNPQMQRRSFRINLPTSYKPVAAGKKQSKSDEHEDD
                     EEADLVDVNKEAILSEIARIGADLVEKIEVKSAS"
     gene            complement(2396736..2398132)
                     /locus_tag="MYCTH_70818"
                     /db_xref="GeneID:11510951"
     mRNA            complement(join(2396736..2397300,2397383..2397731,
                     2397801..2398132))
                     /locus_tag="MYCTH_70818"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665143.1"
                     /db_xref="GeneID:11510951"
     CDS             complement(join(2396919..2397300,2397383..2397731,
                     2397801..2397909))
                     /locus_tag="MYCTH_70818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665191.1"
                     /db_xref="GeneID:11510951"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="JGIDB:Spoth2_70818"
                     /translation="MSVVSLLGVNVINNPAKFTDKYEFEITFECLEPLQKDLEWKLTY
                     VGSAQSDHYDQELDSLLVGPIPVGINKFVFEADPPDTKRIPIDELLGVTVILLTCAYD
                     GREFVRVGYYVNNEYESEELRDNPPAKPEIDKIRRNVLANKPRVTRFAIKWDSEASAP
                     PEFPPEQPEADLVADEEEYGADELAEEEEAEALDGSGDAQMDGVEGPDGVVDEEDLSD
                     EGSVDIEGESEEEILEEDDGIDQEGGEGAEGAEGVEGDEGDEMDVDRPEPAVHKQPEA
                     MVH"
     gene            2399740..2402556
                     /locus_tag="MYCTH_2308663"
                     /db_xref="GeneID:11510952"
     mRNA            join(2399740..2401258,2401309..2402556)
                     /locus_tag="MYCTH_2308663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665144.1"
                     /db_xref="GeneID:11510952"
     CDS             join(2399806..2401258,2401309..2402423)
                     /locus_tag="MYCTH_2308663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665192.1"
                     /db_xref="GeneID:11510952"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="JGIDB:Spoth2_2308663"
                     /translation="MELDMNYFPEAELIFNRSLMSTPNVNLWTKYLDYIRRRNDLNDS
                     TGNARQTVSRAYEFVIDNIGLDKDSGKIWAEYIQFLKFGPGTVGGSQWQDQQKMDQLR
                     KAYQRAICVPISNVNTLWKEYDQFEMGLNKLTGRKYLAEKSASYMSAKSAYTALENIT
                     RGLQRTTLPRLPPAPGFDGDQEYMEQVEIWKKWIAWEKSDPLDLKDDKEQPGLYQKRI
                     LYVYNQALMALRFWPEMWVDAAQWCFDNNITSKDGSPTGLDFLTRGIEANPESVLLAL
                     KHADYIESTYPIEETDESKIARGKAVRAPYDKVLDTLYGIIKRLKEREAAEIARIEEA
                     AKSAGENTTNNKSDDDDEDEDDAGSSDKAPKNSKVSDQLRAIKQGFAAQTQLLSRTIS
                     FVWIALIRAMRRIQGKGKPNTELGGMRQAFQDARHRGRLTSDVYAAVAQLEWTIYKDP
                     AGGKIFDRGAKLFPEDENFALENIKYLHSRDDTTNARVLFETVVNRLTQKPELVHKAK
                     PLYAYFHKYESQFGELSQIAKLEKRMAELFPEDPKLAHFSARYSTDKFDPIAARIIVS
                     PMTQLRPKQLIPSIEKGASAQDSPRPPPLASRASPASHTLPATNSPKRPLPADDFEEP
                     PRKIQRNDFSEFQRGASPLKGAAGRRLDQQRRLQGQGAASYAAAPAPIARDITFLLSQ
                     IPRADLYDFQRFNPAKMTNLLRDTPVPEYTAWKSMRQSSEHTGQYGGYQSRDSPAPVG
                     RPHSPYVGGDGGRGRMPPASAVPYRQGSNRPGSSGSYEPPPAVYAPGHPPLPPQAGYA
                     PPPPVQYDGAAGAAWPPYPPPPAAQQGYGGPPPPHLYGQAPPPPAQGGYPRYPPHPY"
     gene            2405369..2405683
                     /locus_tag="MYCTH_2308664"
                     /db_xref="GeneID:11510953"
     mRNA            join(2405369..2405473,2405526..2405683)
                     /locus_tag="MYCTH_2308664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665145.1"
                     /db_xref="GeneID:11510953"
     CDS             join(2405390..2405473,2405526..2405675)
                     /locus_tag="MYCTH_2308664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665193.1"
                     /db_xref="GeneID:11510953"
                     /db_xref="JGIDB:Spoth2_2308664"
                     /translation="MASNKQRHVLAIPEGINKRCDLPPEAYLNPDKVNTPFAARRGYN
                     TSGQNINVCANQFRIQNVTGRDVYQYDVCISER"
     gene            2407014..2408919
                     /locus_tag="MYCTH_2308665"
                     /db_xref="GeneID:11510954"
     mRNA            2407014..2408919
                     /locus_tag="MYCTH_2308665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665146.1"
                     /db_xref="GeneID:11510954"
     CDS             2407028..2408599
                     /locus_tag="MYCTH_2308665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665194.1"
                     /db_xref="GeneID:11510954"
                     /db_xref="InterPro:IPR003165"
                     /db_xref="JGIDB:Spoth2_2308665"
                     /translation="MIKFAVQRPPQRQAQIMKMVQNLEWDKDRYLSHFGIKINPTMTK
                     IPAKLLPNPVIQYGNKPVDPKMTGRWDLRGIRFAVPNPQPLVSWALVIIDNCVDKPCA
                     ENFAKTFRNVYASHGGRIANDPIILAPPRGTPLEGVVGAAYEKCGTNFKADPQLMFYI
                     LRDKAAIIYDRLKAANDCQVACLSQMVQAQHVRKAAPQYCSNVCMKVNAKLGGQTSRL
                     AVKANQKPLINIPTMMIGVDISHGSTAAGNVSTAAMCVSMDRDIAIYDAAVQTNGRGV
                     EILQPHNMHSMLGPLVTKWRKKFNTAPQHVFYLRDGVSEGQFAHVMEFEIEELKKVFK
                     ESIGVIPKVTVIIATKRHHIRFFPERGDKNGNCLPGTLVEREVTHPFHYDFYLCSHVA
                     IQGTARPVHYNVIHDECGLKPDDLQRILYHQCYQYCRSTTPVSIHPAVYYAHLAGTRA
                     RHHENKSANAEPMVVDSRHLVLTRPGPMSKSDSRTVTSRSEDDVVPPPLLKVGCGSKA
                     RPSAIRTFENTMWWV"
     gene            2409548..2413045
                     /locus_tag="MYCTH_2308666"
                     /db_xref="GeneID:11510955"
     mRNA            join(2409548..2409700,2409872..2412072,2412148..2413045)
                     /locus_tag="MYCTH_2308666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665147.1"
                     /db_xref="GeneID:11510955"
     CDS             join(2409582..2409700,2409872..2412072,2412148..2412893)
                     /locus_tag="MYCTH_2308666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665195.1"
                     /db_xref="GeneID:11510955"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="JGIDB:Spoth2_2308666"
                     /translation="MAGFLRAKQAGVQKDLSAGIAPGAFKPDEQARYGISSQISCLTY
                     DPTQSLLAVGTTASKYGPAQIYVFGGRRVARTITLNQTSGLSALASSIGTSGAAALQP
                     PLSVRYLAFVANRLVSLDSHNELAVWDPDTGQKVCRTTYGRASCVTTDPGLDWAFVGS
                     ENGGDVWAFDLDRGTPAAGWRLGNLWNSPERPGARTGRPVSAFAVGVVSLQLHPRDIG
                     KLLIGYTTGAVIYSFKQNVATKFFEYVVPARARGGNGIGTEKERRPRLVQAVWHPSGT
                     FVLTAHEDGSLVFWDPKDGRLVAARSIYHTRVNEPGVNVEKKPTPLVPFGKITWCCKQ
                     NPDDTALLIAGGQAVDEEEKGLTFLELGPTPIYATSSWEALANHFEGKRRLTLPIPPG
                     AAVASYCLVPRSSPFFDGAQDPIAIFTMLTSGEIITLTFPSGYPISPTNMLHPSMLFV
                     HPFVQKIAVSTVPRQKWLALVETRNQGGPFLLGGAPAPKRRRVGWDYRNIIQVAHADS
                     TIRIWDVGHDDDIENQAQLQVDVARALGRFEDVSVTALSMADATGEFAAGTRTGEVVI
                     YRWGGNRYYGRDATKPLDPNPGGLTDISSRAEPSLKEGLQPFVLYEMMQGPVSVVTVS
                     DVGFVAAGSEGGFFSLIDLRGPRVIFQGSLTQFIKEDKRSSFLKGHSSRASATLEFPT
                     VIEFGVLTLEGDGYSSIACFVGTNLGHVVTFKILPSGQTYTAQCAGVTKCGGDKVVGI
                     NPLNVDTAQPASATGLAVAGLREGRQVNGVLVAVTQTEIRVFKPATAKGASKSFDDQL
                     CDAARVTEIPHVGVALVAVFSDRTARAYTLPGLKEIGRATLSMLDPSRTISAVISRTG
                     EVFGWTGPSEIAILSVWGTGQPLPPSRDTLINPELVLPPRPTISNLQWISGTQYVSPT
                     DLDLLIGGDDRPPSKRMMAAAAAERGMAGGADSAGTGAGGARAGASQEGWGEYLSRQL
                     NERAEKLTIVDDAVNRLQESSQGWAEGVNNFVKKQKRDLLIGGVKKSLF"
     gene            2413603..2414025
                     /locus_tag="MYCTH_2308667"
                     /db_xref="GeneID:11510956"
     mRNA            2413603..2414025
                     /locus_tag="MYCTH_2308667"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003665148.1"
                     /db_xref="GeneID:11510956"
     CDS             2413652..2413963
                     /locus_tag="MYCTH_2308667"
                     /note="CAZy_ID 270029"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003665196.1"
                     /db_xref="GeneID:11510956"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="JGIDB:Spoth2_2308667"
                     /translation="MPNKPDPSWAAAYAKAIDFLSSLTLTEKVSLTTGTTGWQADRCI
                     GNMGGVPRLGFSRLRGEAIGAEFRGKGIDVMLGPVSGPLGRSPQGGRYWEGFGFVSLR
                     P"
     gene            <2414101..>2414414
                     /locus_tag="MYCTH_2129052"
                     /db_xref="GeneID:11510957"
     mRNA            join(<2414101..2414282,2414345..>2414414)
                     /locus_tag="MYCTH_2129052"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003665149.1"
                     /db_xref="GeneID:11510957"
     CDS             join(2414101..2414282,2414345..2414414)
                     /locus_tag="MYCTH_2129052"
                     /note="CAZy_ID 270028"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003665197.1"
                     /db_xref="GeneID:11510957"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="JGIDB:Spoth2_2129052"
                     /translation="MYILNEQETYRGSVDVHADRRPECACENEWTSNYLLKNELGSPG
                     FIMSDWGPGHPFAVPTSNWNATMQQLGDHGSGKDCLCGL"
     gene            complement(2414496..>2416836)
                     /locus_tag="MYCTH_116881"
                     /db_xref="GeneID:11510958"
     mRNA            complement(join(2414496..2414802,2414903..2415584,
                     2415671..2415837,2415903..2415982,2416052..2416099,
                     2416211..2416409,2416549..>2416836))
                     /locus_tag="MYCTH_116881"
                     /product="general substrate transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003665150.1"
                     /db_xref="GeneID:11510958"
     CDS             complement(join(2414764..2414802,2414903..2415584,
                     2415671..2415837,2415903..2415982,2416052..2416099,
                     2416211..2416409,2416549..2416836))
                     /locus_tag="MYCTH_116881"
                     /codon_start=1
                     /product="general substrate transporter"
                     /protein_id="XP_003665198.1"
                     /db_xref="GeneID:11510958"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_116881"
                     /translation="MASSSQEKVSFENVEAADSDHIGNATKGAVVGSGALAADDFGFS
                     PAEQRKIIRQVDRRLVLTVGAMYCISLMDRTNLGAANIAGMGVDLVLIENRYSIVSLV
                     FFITYVLFQPPSTVIVRKIGPRIHLAAITILWGSCMIGMGFVNHWGQLAGLRVLLGFL
                     EAGFFPSCVYLLSTWYTRYEVGKRNSVFYLVGCVASAFAGILAYGLMQMAGLAGLNGW
                     RWIFIIEGIITVLLGIAGYWLLVDFPDATRKNWSFLGAREREWVCARVNADRGDVKPQ
                     PFSLAKYLRAGMDIKVWAYAMIFFNTTTVTYALAYFLPLILTENMGFSIGASQCLVAP
                     PYAFAGIVMFATAWAGDRYRIRGPIVAFNCLLCIIGLPLMGFHSKAAVRYFGVFLVTA
                     GANANVPAAMSYQANNIRGQWKRAFCSATFVSFGGIGGIAGSLVFRNQDKPGYKPGLY
                     ACIATTLLTLVIVGLLSLEFRRLNKKADRGEVPLECDSDDTYEPGFRYTY"
     gene            complement(<2419016..>2419841)
                     /locus_tag="MYCTH_2112081"
                     /db_xref="GeneID:11510959"
     mRNA            complement(join(<2419016..2419276,2419365..>2419841))
                     /locus_tag="MYCTH_2112081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665151.1"
                     /db_xref="GeneID:11510959"
     CDS             complement(join(2419016..2419276,2419365..2419841))
                     /locus_tag="MYCTH_2112081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665199.1"
                     /db_xref="GeneID:11510959"
                     /db_xref="JGIDB:Spoth2_2112081"
                     /translation="MQTVQSWSETQIITVSVLGAIAFAAVVASVVEILKSRKRARDFA
                     GKLDNAVAEVGVEQSRTISLQQELSRREVFIDRNILKGPGAVSAAPYEECPKQCQEYR
                     PEFALDGASALGSDDKNSDRDDDDHDDGVGEGGLSAETTPDVAVDAVQSCTAMLAVRD
                     CQVSRDDLCHRASMKEARENRYVWTRPQQGEPQAQIDRSWESNTIENTQEESPRAAEN
                     KVPTEVGTAATEVDRNGAGRDDVGAMR"
     gene            <2422053..>2422899
                     /locus_tag="MYCTH_55803"
                     /db_xref="GeneID:11510960"
     mRNA            join(<2422053..2422492,2422555..2422651,2422729..>2422899)
                     /locus_tag="MYCTH_55803"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003665152.1"
                     /db_xref="GeneID:11510960"
     CDS             join(2422053..2422492,2422555..2422651,2422729..2422899)
                     /locus_tag="MYCTH_55803"
                     /note="CAZy_ID 267873"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003665200.1"
                     /db_xref="GeneID:11510960"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_55803"
                     /translation="MKALSLLAAAGAVSAHTIFVQLEADGTRYPVSYGIRDPTYDGPI
                     TDVTSNDVACNGGPNPTTPSSDVITVTAGTTVKAIWRHTLQSGPDDVMDASHKGPTLA
                     YIKKVGDATKDSGVGGGWFKIQEDGYNNGQWGTSTVISNGGEHYIDIPACIPEGQYLL
                     RAEMIALHAAGSPGGAQLYMECAQINIVGGSGSVPSSTVSFPGAYSPNDPGLLINIYS
                     MSPSSSYTIPGPPVFKC"
     gene            complement(<2423372..>2425867)
                     /locus_tag="MYCTH_2120042"
                     /db_xref="GeneID:11510961"
     mRNA            complement(join(<2423372..2423737,2423771..2424196,
                     2424273..2425040,2425092..2425382,2425447..2425503,
                     2425775..>2425867))
                     /locus_tag="MYCTH_2120042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665153.1"
                     /db_xref="GeneID:11510961"
     CDS             complement(join(2423372..2423737,2423771..2424196,
                     2424273..2425040,2425092..2425382,2425447..2425503,
                     2425775..2425867))
                     /locus_tag="MYCTH_2120042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665201.1"
                     /db_xref="GeneID:11510961"
                     /db_xref="JGIDB:Spoth2_2120042"
                     /translation="MSAFAARQQLWELAAAKHKGGSVSEPATEDETNFQRKSGGRSIL
                     TTRDGERLVILGSYGVKVCEGEATIAGAILTPSDPIQWVHAPHCHAVPVLRTTDDTVL
                     ELRSHPAAKELRQLATLNPVFAKLWNESAREKSTPRPKPSATFQIIYTSQDVPKRAVL
                     QELTSPPEWNKKLSGLVTAKRKGTPVIFLCGPKSSGKSTFGRLLTNRFITDRGGVKNR
                     PWTNVAVLDIDPGQPEYSPPGVISLVRIATPNLSPAFCHPTLTPSGGQLRAHAIASVT
                     PALDPGHFIECVLDLFAQYQRGPDANSPLLINTPGWIQGTGLDILTELITSIRPTEVI
                     YMSQDGPEETVSSLRAACATTTPSTPFTTLPSQSSELSSRTPLHFRTMQTMSYFHLKR
                     QPSIQEQQSPQNRGILGILCYDHQPAPSLLAEAINGTVLALVGLESRDALRDLHYPRP
                     RPATLASGDEPAPPSRAGRRRQQEEEEAEEEEEEEDDNDDDDQLPLIPNPHSRTLSPR
                     HSRLLGLVLLRGVDTARKELQLLTPLDVEDVLAGSGRDLVLVAGRFDTPTWAYSEWLC
                     RSRAKGAAGASEAAGSGSETESESESEGEGESEGEGDGEGGGEGQGQRAGEDQAQVVV
                     VVGKGDGRQGGEEVPWVEALHGSQKRAVGSKVWRVRRDLGRN"
     gene            2426434..2428998
                     /locus_tag="MYCTH_2308677"
                     /db_xref="GeneID:11510962"
     mRNA            join(2426434..2427738,2427789..2428102,2428161..2428998)
                     /locus_tag="MYCTH_2308677"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665154.1"
                     /db_xref="GeneID:11510962"
     CDS             join(2426567..2427738,2427789..2428102,2428161..2428765)
                     /locus_tag="MYCTH_2308677"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665202.1"
                     /db_xref="GeneID:11510962"
                     /db_xref="JGIDB:Spoth2_2308677"
                     /translation="MAGPRAPIGTLSQHAAAAAGLVRGMVPKMFGRTDPKQARKTEEI
                     TESDSTSDSDSDSSTHSDSETDEAVREDTKNWADKLKAKKAGSTPTPASKPVKAAPVS
                     AASPNAKSSSRATKSDIKKSSSSDSSASESDSDSDSESGSDEGDDKMAVDPKSDSEVV
                     SKKTKNGGPKVKEEVQSGSDSESSDEEMGDSAPTEKAAPSPSSSETSASEDESDDETP
                     APATSLTHKKDAAARAVSSSDESASESESESESESESESESEVESESESEVEPKSTTK
                     AEKKTQDESESAGESDGGSDSDSDSGSDEGTKHPQKSLAKRPQSPRPTAKQAASAKQP
                     VPTKSAKSSAAINGAAKSKEFVSESDSSSDAESGDDSDSEGTAQSTTVEKQSGKNSVQ
                     APPREIISQGFHLRKAEEDVDAAEVARAFKKAKAEGKQIWYFTTPKSVPIEVIQKHVI
                     PLDKVHAGKAIFAHDGAEYTGHFEEPVNHAIKVLIPGKTGAKYETLNHSVDRVLHITR
                     VTRLGEEGADESVPATTSVSSPAPVSQGPRPQPKGLKARYQPFGVTKVSSSALGMDAS
                     DNEDVEMAQAPPLTAKSDTPKAAKKRKHGDVDKGANKEESTSTPANKPKKARVDNSDT
                     KASKDTPVVHPSVASASTKTTEQTSPSKKKSKGKDKAKKDGPASSETLTGESKKPTKV
                     TPILPPAIPGVTSP"
     gene            complement(2431124..2433042)
                     /locus_tag="MYCTH_2308679"
                     /db_xref="GeneID:11510963"
     mRNA            complement(join(2431124..2432277,2432374..2433042))
                     /locus_tag="MYCTH_2308679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665155.1"
                     /db_xref="GeneID:11510963"
     CDS             complement(join(2431308..2432277,2432374..2432816))
                     /locus_tag="MYCTH_2308679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665203.1"
                     /db_xref="GeneID:11510963"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="JGIDB:Spoth2_2308679"
                     /translation="MEAVQEFPAMLAQAPAMKPKLLPLRWPSTLAQLNPIPHKYRSAR
                     KLRLHLRVSRGQEHAGDITRLQTSFDIKRSLRALRTRKWTLWDLQHLVTLGYILFSLA
                     ILPPAPLIKIGVLLVLGLLLLMPITQQFFLPSLPIWTYLLYFFASRFIAPEYRPHIWV
                     KVLPALENILYGANLSNILSAHTHAVLDVLAWLPYGIGHFALPAICSAFMFLFAAPGT
                     TPVFARAFGYMSMLGVTIQLIFPCTPPWYEKLHGLEPAHYGMQGSPAGLRRVDELFGV
                     DMYTTSFTTAPLPFGAFPSLHAADAILEALFMQYCFPRFRPFFIFYAVWISWSTMYLN
                     HHYAIDLVGGGIFAASAYYIARTKFLPRPQLDKTTRWEYEYVEFGDRPRVIDEEYGLG
                     RGLLSTRRPGSSDSDEWTLGSSSSLDSMSRGDTLCGSSNSTPGILSPTTPTDDHYDVW
                     SKVRLAQPQEGDACEIFVAR"
     gene            complement(2437133..2439098)
                     /locus_tag="MYCTH_2308681"
                     /db_xref="GeneID:11510964"
     mRNA            complement(join(2437133..2438424,2438501..2439098))
                     /locus_tag="MYCTH_2308681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665156.1"
                     /db_xref="GeneID:11510964"
     CDS             complement(join(2437162..2438424,2438501..2438692))
                     /locus_tag="MYCTH_2308681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665204.1"
                     /db_xref="GeneID:11510964"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308681"
                     /translation="MSTVAAQAAGERQQPQIQPCRYKVGKVLGAGSYSVVKECIHIDT
                     GRYYAAKVINKRLMAGREHMVRNEIAVLKKVSMGHQNILTLVDYFETMNNLYLVTDLA
                     LGGELFDRICRKGSYYEADAADLIRAVLSAVAYLHDHGIVHRDLKPENLLFRTPEDNA
                     DLLIADFGLSRIMDEEQFHVLTTTCGTPGYMAPEIFKKIGHGKPVDLWALGVITYFLL
                     CGYTPFDRDSDFEEMQAILNADYSFTPLEYWRGVSDSAKDFIRRCLTIDPAKRMTAHE
                     ALQHPFVAGWARVGEGDDKGTNLLPTVKKNFNARRTLHAAIDTVRAINKLREGQAAGF
                     MNGVRSREPARAAPPSSGNGNTTNNNNSNQNNRDQKSSQNENAPQPRNHDSGIEIGQA
                     QEGQSKDGGYDTQTAQASQGSATGADASTADGDVRMDDWPAPHSQQAGQQAPEGRGHL
                     PPAHAVPASLRPGNEANRVVETSKGLWNGSGSRR"
     gene            complement(2439099..2443074)
                     /locus_tag="MYCTH_2308682"
                     /db_xref="GeneID:11510965"
     mRNA            complement(join(2439099..2439710,2439769..2440520,
                     2440578..2442452,2442517..2442862,2442932..2443074))
                     /locus_tag="MYCTH_2308682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665157.1"
                     /db_xref="GeneID:11510965"
     CDS             complement(join(2439506..2439710,2439769..2440520,
                     2440578..2442452,2442517..2442862,2442932..2442951))
                     /locus_tag="MYCTH_2308682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665205.1"
                     /db_xref="GeneID:11510965"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="JGIDB:Spoth2_2308682"
                     /translation="MPAQKTVDSRIPTLIRNGLQEKKRSFFVVVGDRSKDAIVHLYYI
                     MSSMDVRQNKSVLWAYKNKLLGFTSHRKKRENKIKKEIKRGIREPNSEDPFELFISLH
                     DIRYVYYKETDKILGNTYGMCILQDFEAITPNILARTIETVEGGGLVVLLLKGMSSLK
                     QLYTLSMDVHSRYRTEAHDDVVARFNERFILSLGSCESCLVIDDELNVLPISGGKGVK
                     PLPPPDEDEPKSAAAQELEKMKEALQDTQPIGSLVKLARTTDQAKALLTFVDAIAEKT
                     LRNTVTLTAARGRGKSAAMGVAIAAAVAYGYSNIFITSPSPENLKTLFEFVFKGFDAL
                     DYKDHADYSIIQSTNPDFNKAIVRVNIHRNHRQTIQYIRPQDSHVLGQAELVVIDEAA
                     AIPLPLVKKLMGPYLVFMASTISGYEGTGRSLSLKLIKQLREQSRAGANSNGSGSVEI
                     DRSSGRATKETTSVGGRSLKEITLSEPIRYAQGDKVEKWLNMLLCLDATLPKSKLSTQ
                     GCPDPSQCELLHVNRDTLFSFHPVSEKFLQQMVALYVASHYKNSPNDLQLMSDAPAHE
                     LFVLTGPIVEGRLPEPLCVIQVSLEGKISKESILKSLSRGQQPAGDLIPWLVSQQFQD
                     DEFASLSGARVVRIATNPDYMSMGYGSKALQLLIDYYEGKFADLSEEGSSTVPQSIPR
                     VTDAELAQASLFDEIKVRDMNELPPLFAKLAERRPEKLDYVGVSYGLTQPLHKFWKRA
                     SFAPVYLRQTANELTGEHTCVMIRPLQDGNDPSWLGAFANDFHRRFLSLLSYKFREFP
                     SILALTIEESASSGAQLDPSATPTEITKSDLDALFTPFDLKRLESYANGLLDYHVVLD
                     LMPTIAQLYFSGRLKSSAKLSGLQQAILLAIGMQRKEVETVAEELSLPASQVLAIFIK
                     IMRKITSHLNSLVAGAVEAEMPDANKVGVSRENATGIHDDEVIDTKYTPLETRLEDEL
                     EEGGDEALSELRAKQRELIDSLPLDQYEIEGDDAAWEEAERRVQRAAKSGKGAPMVSV
                     KTKAKRKVEETDGHEEKGGDKGHSKSKKAKREKKK"
     gene            complement(<2443199..>2443897)
                     /locus_tag="MYCTH_2065824"
                     /db_xref="GeneID:11510966"
     mRNA            complement(join(<2443199..2443283,2443340..2443600,
                     2443659..>2443897))
                     /locus_tag="MYCTH_2065824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665158.1"
                     /db_xref="GeneID:11510966"
     CDS             complement(join(2443199..2443283,2443340..2443600,
                     2443659..2443897))
                     /locus_tag="MYCTH_2065824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665206.1"
                     /db_xref="GeneID:11510966"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="JGIDB:Spoth2_2065824"
                     /translation="MLAHHVLQSPANLVSRWPWNAWTIIPGSRRFVHRALDATFDQEQ
                     LAEARKWHQSFQLSSLPEGNTSFSRSSGPGGQHVNKTETKATTTWPVPQLLGFLPKLL
                     HAGVRESKYYSRRSDCLTIQAQTHRSRSANADENRRKLFEELQELYRKTVPGESSPET
                     AKKYEALKKSANEARVKAKKMQKSKKAFRRGFDD"
     gene            2444497..2447483
                     /locus_tag="MYCTH_2308686"
                     /db_xref="GeneID:11510967"
     mRNA            join(2444497..2446111,2446168..2447483)
                     /locus_tag="MYCTH_2308686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665159.1"
                     /db_xref="GeneID:11510967"
     CDS             join(2444800..2446111,2446168..2447315)
                     /locus_tag="MYCTH_2308686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665207.1"
                     /db_xref="GeneID:11510967"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2308686"
                     /translation="MEPNPGPSEISDTIVVGGDYSDESHDESDESIDYGEGEEGQEQE
                     KVEPEAANDDYAKTFDSPTAQEDLNEAEEVQPDVSLASESMTSPPAPDPAAVPSDHPP
                     THSPAVSRINGEVQSSGDPSPSEQANRSEVPSDPSPTAPNTIPSSAAPTSATAAEEPG
                     KESPAAPAPDAAPPTAASAAPASTDEDDAAAVDIQKLVDDITARAAATASPPNAPAQA
                     TPVSTQAPTASLPVSHPPSLPPKPSLPNPPANLPAIPPAHYSFQSRGHNAPPAPAMPM
                     TLASSGASHGAHAANEGVSSLPAPPPGSFGAPPAHHLPHSGDASGNYHGSSIKQLWEQ
                     FLADEKRYTSEAKWERFPEGSRIFIGESTIAAPCHGPLAHHGSGNLSSERVSKREVFD
                     VFHRFGRLAQISLKSAYGFVQYHTVAEGQAAMQGAQGIELGGRRIHLEVSRTQKKKDD
                     RDRSPDRRGPRGSYGSERFDAGDRGWKRDDYRPGRSPSPRRGDPRSSRDGHYSRDREF
                     GSYQRRRSRSPARFGRYGDDSYRRRSPSPHRRAPSDGDRFDFPRRFGADVPDVQILLL
                     QEVSRDFVGWVQRAFHNKGLKTDVMYLNPRFPRETVVQRQVVEGVHAIVDLDYGAQTK
                     GKIPIQVFIRSGGSSVRFELYQDVDPPIAAELVMREKSQSAAHLGQPPAPYAPNGYGH
                     PPPAQAPPAGYPYPYPQHAVPPAQPPAAPAPDLASVVGNLDNSALQALLASLQTPQAG
                     APQTTYPGVAPAAPQAPQIDVNALLNNLRSAAAAQPAPPPASYGAAPAYGAPTAPGSY
                     GGVDPAQQVQTIMEQLKRAAH"
     gene            complement(2448066..2450838)
                     /locus_tag="MYCTH_2308690"
                     /db_xref="GeneID:11510968"
     mRNA            complement(join(2448066..2449374,2449579..2450239,
                     2450357..2450460,2450543..2450838))
                     /locus_tag="MYCTH_2308690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665160.1"
                     /db_xref="GeneID:11510968"
     CDS             complement(join(2448349..2449374,2449579..2450239,
                     2450357..2450460,2450543..2450677))
                     /locus_tag="MYCTH_2308690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665208.1"
                     /db_xref="GeneID:11510968"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="JGIDB:Spoth2_2308690"
                     /translation="MTMKGSTLLALALGFGAHAQFPPKREGITVIESKFYKNVSISFK
                     EPGICETTPGVKSYSGYVHLPPNLIEGADQDYPINTFFWFFEARKDPANAPLAIWLNG
                     GPGGSSMMGLLEENGPCFVGPDSKTTYLNRWSWNNEANMLYIDQPVQTGFSYDVLTNV
                     TVQLDVDDPSEPIITPTNFTDGHIPRTNNTFRIGTVGSQKASQVTNSTELSAHAMWHF
                     LQTWLFEFPHYRSDDGRISLWAESYGGTYGPAFFRFFQQQNERIADGQLEGRYLHLDT
                     LGIINGAVDWPILAESLIDYPYNNSYGIQFYNDTFHAALKHNWTRPSGWREQMQACTE
                     SLASSSSSSSPPAAGCEAVRSVLDDVLAAAFPRQSGRAPFDLAHPRADPFPPPHPHGF
                     LARADVQAALGVPVNHTAVSLPVNRAFDATFDPLRGGQLDALAGLLDRRAGGGVKVHL
                     VYGDRDPSCNWAGGEKVSLAVPWSRRDVFAAAGYAPLVVVSGKGGGDGGNTGGGNTGG
                     GEEEVVVVRGLTRQVGRFSFTRVFQAGHEVPSYQPQAGYEIFRRAMAGLDLPTGRVRA
                     GDDFVTAGLRDAWAVKNAAPDMVEPRCYVLKPESCEPEVWKTVVDGTAIVKDWFVVGS
                     TGGEGRGVEGGIDGDEL"
     gene            complement(2450850..2452893)
                     /locus_tag="MYCTH_2308691"
                     /db_xref="GeneID:11510969"
     mRNA            complement(2450850..2452893)
                     /locus_tag="MYCTH_2308691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665161.1"
                     /db_xref="GeneID:11510969"
     CDS             complement(2451346..2452671)
                     /locus_tag="MYCTH_2308691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665209.1"
                     /db_xref="GeneID:11510969"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="JGIDB:Spoth2_2308691"
                     /translation="MRRGALLSNALRANASPPSKPRAPSRALVPTCCYPKDLVVATPR
                     QCQRRRNHTSTSPEQHRRQHDPGAATVVAAQATSTTTAAATTATTTATTTIPTAGITA
                     GITAAAPHHDVLAPSAAAANPPPTTRPPPLHLPSKPDPAPPLFSRPGLSYLYATGVAY
                     LKFYRTALRHVVFTNTRLLYPSSSSSSSSSSHSPPSPASPDDPQSATPGEVPGADRRP
                     PPPLPGTRAHLHLRLRWRHDIRRLPLFALILLVCGELTPLAVLALPRAVPLACRIPRQ
                     VEGLLRTAESRRAEGRAEAARWMVAVAESSSSKSGRGEEEEEDAEVPVEVMAKVLGLT
                     VRPWTPAFVLRPRVLRRLRFLAVDDALLIRAGGAAALVGDEVRLACADRGIDVLGRGE
                     AELREALARWLRLTDATRLGGEGRERAVRRLLLVRDSEWQEAKREEDVA"
     gene            complement(2453180..2455659)
                     /locus_tag="MYCTH_2308692"
                     /db_xref="GeneID:11510970"
     mRNA            complement(2453180..2455659)
                     /locus_tag="MYCTH_2308692"
                     /product="glycosyltransferase family 71 protein"
                     /transcript_id="XM_003665162.1"
                     /db_xref="GeneID:11510970"
     CDS             complement(2453276..2455267)
                     /locus_tag="MYCTH_2308692"
                     /note="CAZy_ID 268070"
                     /codon_start=1
                     /product="glycosyltransferase family 71 protein"
                     /protein_id="XP_003665210.1"
                     /db_xref="GeneID:11510970"
                     /db_xref="JGIDB:Spoth2_2308692"
                     /translation="MLMMRAPSSQGSLAFLRHLALRILFLRGSKAKFAVAGLLLVLLV
                     SASLAYRFFCLEDDFYAPTRIFGRHPYANYNHHHHQHRHQQHHQHHQHHNNDDEDDDD
                     NGDGRHDDVGGWWAEFFGRLESTRVTAGPVRVGEPGPSINWAPGINATRPDLIELSED
                     DVARFRASHAGFVDQLAEFASHLPYEADTTGIVTTTGVATFGQAVSLVLMARRAGSRL
                     PIQIFLDSSSPWVDRLCAETMPRFDARCVSLEDTWGGVRGPVPELVRFQWKVVSIVGS
                     SFQNVLFLDADCLPVRSPDAIFDRRSEPFASAGLVTWPDFWVTNTSPLFYRIAGDLDV
                     PPVTARTSPESGMMAYDKARHADTLLLAAYYNYNGPDHYYPIFSQRGAGEGDRESFLQ
                     AALVLQALRKKGAYRPPTAWMRPGVGVRKGYYDVKELPFVHGRSAKQAWRGMFMMQQD
                     PMADYRAFTAVLEGEEEEEARRRKNGTATGTDGRQQELSPDSGTGTGSGSAVMTVIRE
                     KKVEGKKKKKEKKKKNGEEEEEEELDEDAFLTDTTALDRFGDLTPALERQKEKGGGGS
                     ERRRREHVMFFHHNGVNPDFTRVLDPESGLVETDEEGRYVRLWGDPGWIADCLGRDAE
                     KLLWEDTMAVYCQPGLVARFERLRRVCAHMRDIHQQLYV"
     gene            complement(2456932..2459647)
                     /locus_tag="MYCTH_2308694"
                     /db_xref="GeneID:11510971"
     mRNA            complement(join(2456932..2458163,2458238..2458312,
                     2458376..2459014,2459118..2459647))
                     /locus_tag="MYCTH_2308694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665163.1"
                     /db_xref="GeneID:11510971"
     CDS             complement(join(2457013..2458163,2458238..2458312,
                     2458376..2459014,2459118..2459151))
                     /locus_tag="MYCTH_2308694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665211.1"
                     /db_xref="GeneID:11510971"
                     /db_xref="JGIDB:Spoth2_2308694"
                     /translation="METFDCVVVGAGWYGLGAAKQYRFTNPGSSLVVFDGQSTLGGTW
                     AAERLYPGLRSNNLLGTYEYPDFPMSTARFKVPVGSHIPGEAIHEYLKAYAAEFGIAD
                     HIRLRTRVLSAEHVDEAGGGWILTVASTGTGTGTGDDQGQQQTRVKARRLIVATGLTS
                     EAFLPHFDGQETFGGRVFHGKHFQQNRDTLKTAKSAVVFGGTKSAWDAAYAYATAGVE
                     THMVIRSSGHGPCWMSPPYVTPLKRWIEKLANIRALTWFSPCVWGSADGYVRIRNFLH
                     GTTLGRKIVDIFWSILGGDVKSLNRFDSHPETAKLKPWLDAMFAGTSFSILNYETDFF
                     QLVRDGKIRVHISEITRLSPGKVHLSDGVQLAADALLVNTGWKQVPPIRFLPEGIDKE
                     LGLPHIPDGYDNSNSNGNSAPGVTDDLAGEQGAIQQADSQILERFPRLRKQPVWNRAY
                     TPLTERAGVGTAEAVTPSTPLAPFVLHRFMVPPSARFLRTRDVAFVGMVSNFSNVITA
                     HLQGLWVGAYFRGLLPLAGPAAGLNGDGGDGDGGDGGGDDLEALRREALLHNRFGRWR
                     YPVDWGSSRAPSFIFDAVPYFDLLLRDLGLETYRKGGVLAEVLSPYGPEDYQTVNEEW
                     AAKVQAAL"
     gene            2459858..2460781
                     /locus_tag="MYCTH_2308696"
                     /db_xref="GeneID:11510972"
     mRNA            join(2459858..2460047,2460124..2460276,2460356..2460781)
                     /locus_tag="MYCTH_2308696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665164.1"
                     /db_xref="GeneID:11510972"
     CDS             join(2459889..2460047,2460124..2460276,2460356..2460448)
                     /locus_tag="MYCTH_2308696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665212.1"
                     /db_xref="GeneID:11510972"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="JGIDB:Spoth2_2308696"
                     /translation="MAPPVAVLTDKAPKPIPQLSQAVKYNGMVYCSGSLGVDPKTSKF
                     VEGSVKDRTRQALKNLSAVLEAAGSSLKNVVKVNVFLTDMSNFTAMNEVYDEFFVWEP
                     KPCRTCVAVHQLPFNSDVEIECTAFESVKARL"
     gene            2461332..2463301
                     /locus_tag="MYCTH_2308697"
                     /db_xref="GeneID:11510973"
     mRNA            2461332..2463301
                     /locus_tag="MYCTH_2308697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665165.1"
                     /db_xref="GeneID:11510973"
     CDS             2461855..2463105
                     /locus_tag="MYCTH_2308697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665213.1"
                     /db_xref="GeneID:11510973"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Spoth2_2308697"
                     /translation="MARVTTTLLCLHAALYLNFFVQTGRLHRLGDPVVLSGVMAFGGL
                     LLLVSAALRPVRRFSYRLFFIIHVIAGIIVPLQLLIHAAPARMFLFEALAVFFLDLAS
                     RKLDTVTGYATVESISDTNLVRISTTVPRSKVSRYRTRPGSHIYLSIPAAACKAMGAA
                     SASRLLYGFLFNPFTVASVDEKNGEVTLVARHCGGPMTTALRRLARATKPRNPDRSTD
                     EDKVLLSIEGPYGAAGRLSQLCADFDRVLLVAGGIGATFTLPLYRAILENNPGAKVEM
                     VWAIRSAGDATWAATGKEAQTLIKDDNIHLFITGETSAAGGAEARRQTSAISRTNGEA
                     DGEVELIAMYSDGRRGRYASQNNRKRPDLQKIVDNLFKHGQDERVAVLVCGPDDMARE
                     LRAHLGVWVKKGRSIWYHKEGFGF"
     gene            complement(2463303..2464240)
                     /locus_tag="MYCTH_2308699"
                     /db_xref="GeneID:11510974"
     mRNA            complement(join(2463303..2464075,2464212..2464240))
                     /locus_tag="MYCTH_2308699"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665166.1"
                     /db_xref="GeneID:11510974"
     CDS             complement(join(2463420..2464075,2464212..2464236))
                     /locus_tag="MYCTH_2308699"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665214.1"
                     /db_xref="GeneID:11510974"
                     /db_xref="InterPro:IPR006976"
                     /db_xref="JGIDB:Spoth2_2308699"
                     /translation="MRIRLPFAGVFVLLILLAGYAGLSSLQLDETTLPINDKVLHLLT
                     FFVLTIVFYWVIDTTRRRTAHLTLVVCTAGLGIGSEFIQAVLPNGRSFDLFDIVANLV
                     GSLAGLGLCSWYHKRMLERKRRRKYAAVPSGEAGGAEDLELGEGPGIGAASGEHEEGV
                     ITMSGAAGAGGGQRATTLEEEVDNWDENAVDAWDEDDAGDVGVSAPASGKNAETGGDN
                     AGAKKRSD"
     gene            <2465390..>2469010
                     /locus_tag="MYCTH_55909"
                     /db_xref="GeneID:11510975"
     mRNA            join(<2465390..2466464,2466522..2467690,2467748..>2469010)
                     /locus_tag="MYCTH_55909"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665167.1"
                     /db_xref="GeneID:11510975"
     CDS             join(2465390..2466464,2466522..2467690,2467748..2469010)
                     /locus_tag="MYCTH_55909"
                     /note="Contains conserved domains: cd05511, Bromo_TFIID,
                     Bromodomain, TFIID-like subfamily; pfam07524, Bromo_TP,
                     Bromodomain associated and COG5076, COG5076, Transcription
                     factor involved in chromatin remodeling, contains
                     bromodomain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665215.1"
                     /db_xref="GeneID:11510975"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="JGIDB:Spoth2_55909"
                     /translation="MSMTNGQPAWHTPNSSQANGSRMPNGVVDDGPTQTPSDNPLALM
                     PEASDPDDDHRRAHFANLFRRAEERLALLFGDNGEYNTAGLEALKRPPTPPAALLPPP
                     ATDHTPAQEPPRKKAKRVIDEDDYGDDDEDEDESRESGPKPETVQSKHANDDGAKTLL
                     SPAKSGTPVPSSPWPGKQGDKSRQDGSRTQAKSSEDARKELEEARNATELAAKQSFHT
                     LIYTLENDRTAMLEQQQLEESEKQLQAEMDKSNNNNTSQPGQNHGSLSNTNLGASSLT
                     LKHLIARIDMKRDQVRASDAELRSLMNEVRKNRSKWASEENVGQEELYEALEKVLSEL
                     KAHTEYSTPFLNRVNKRDAPDYYNFIKQPMDLGTMTKKLKGLQYKSKAEFVYDLNLIW
                     DNCLKYNQDMGHPLRRMANGMRKEAEKLIPLIPDIVIRPRAEVEAEERRKQNGGEDDA
                     GDDSDDEPIMSSRGRKAGTKGANKSRKAPSDQKEGKEGTPNVEQKPLLQVNGILAKAQ
                     REGSEVDSSTGLGTPPIGGSLTPSGANGQSGVSNADAMDIDGPSLDGMALGQALGEAA
                     EQVYEDEAYKIWKQVTKKDRALIAKERYQLFAGNKLNPDEPALLRSKAGMRRFLKSRR
                     EAEVLGIIHGSHLDASATGSSDGAKAPETLAEGMEEEGERTVPSYYEPQTIIPDIDPK
                     LQWVEDGEGQVINHFEDMLRLIPPGHFTAPESRLTNKIDANIRQMQETRKLCSKIGVI
                     KQMQIQTHVYTNQFPKYNPEPFVEADIEPSFIAGEGPVMAPETCRSAMQRSVAKIFYH
                     AGFEELQPSALDTITDIAGDYFQKLVRTFNVYREVEKKPATGVFAERGARTQPRFTPE
                     EVILHTLNENGHDLDSLESYARDEVDRLGNKLGQIHERMKAHLADLLRPALTDAGPDG
                     SGAFNDGSEQFIGGDFAEELGEDFFGFKALGLDKDLGLETLSVPLHLLQSRVRSQYQM
                     QTQTVGGTTAADLFDALPPLEPVTRESIENEIGLVRNFFLAKLHANNNAPLVEDEDLP
                     PKQRRARPRLGATGKIVSPQKRSPKEQLALAKKKKKLESGSAQVTDGANAAGANAAGN
                     KAGSVSPEKKKTTTLNDAKTGPAPPLPLPPSSSQSSAPGGLAVPMQRQDTNTTDGGAS
                     QATDKDEAGATGMMSPESLEQR"
     gene            complement(<2470332..>2471974)
                     /locus_tag="MYCTH_2067613"
                     /db_xref="GeneID:11510976"
     mRNA            complement(join(<2470332..2471322,2471385..2471749,
                     2471822..2471857,2471918..>2471974))
                     /locus_tag="MYCTH_2067613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665168.1"
                     /db_xref="GeneID:11510976"
     CDS             complement(join(2470332..2471322,2471385..2471749,
                     2471822..2471857,2471918..2471974))
                     /locus_tag="MYCTH_2067613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665216.1"
                     /db_xref="GeneID:11510976"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="JGIDB:Spoth2_2067613"
                     /translation="MAASNAKSATYALSESHKQMLEKSLLESDPEKNEIQRQRESIIL
                     IASENVTSRAVFDALGSPMSNKYSEGYPGARYYGGNQHIDQIELLCQKRALEAFNLDG
                     AKWGVNVQCLSGSPANLQVYQALMPPHGRLMGLDLPHGGHLSHGYQTPQRKISAVSTY
                     FETMPYRVDLETGIIDYDTLEKNAQLFRPKILVAGTSAYCRLIDYARMRKIADSVGAY
                     LVVDIAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVRSVDPKTGK
                     ETLYDLEDKINFSVFPGHQGGPHNHTITALAVALKQAASPEFKEYQRKVVSNAKALEN
                     KFKELGHKLVSDGTDSHMVLLDLRPFQLDGARVEAVLEQINIACNKNSVPGDKSALTP
                     GGLRIGTPAMTSRGFGEADFERVAQYIDESIKICKEVQASLPKEANKLKDFKLKVASG
                     EVARINELKKEISEWSLTFPLPVEGWRMDAGI"
     gene            <2473353..>2476348
                     /locus_tag="MYCTH_54923"
                     /db_xref="GeneID:11510977"
     mRNA            join(<2473353..2473579,2473699..2475684,2475760..>2476348)
                     /locus_tag="MYCTH_54923"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665169.1"
                     /db_xref="GeneID:11510977"
     CDS             join(2473353..2473579,2473699..2475684,2475760..2476348)
                     /locus_tag="MYCTH_54923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665217.1"
                     /db_xref="GeneID:11510977"
                     /db_xref="JGIDB:Spoth2_54923"
                     /translation="MASPAVAMAQVNGVSPLSRPDSPASINSSTKRKRESTDDNEADL
                     NRGDPPKQPVNGVHASEGRKSLVRDFYRVLESNPSLLKRPLPDSLPDGEPSSKRAKSE
                     DGTPISISDKVTQDVYEVLDDLVADVVHTADAQVKELETAGTPGDADVLAKTIALKTK
                     ALELYRQELAYPNVPRPIPGKQTFGRQAPATSGLVLTAVGAAPTPRPLFTSLQRDAAK
                     PLAEAALPPGVTATKVLSEANLSGDKNGRVPTLGELFPSPRNLPPLQPPKAPKTATKS
                     NVLTFYHPELAEKSKYRSGSYFSSSISVGHWLDYSNATPTTHAKTKQRERAQSLAGIK
                     PSTTELEVSELETLFRGAFSSFAPCKDDTGAIVPSGQLSRIWWQRVGRRNFAKIADAE
                     EPEEESENGTAADSAVAVEIDEERVKEAIENWDETAIDPSLDHVLGKKSEQEKEVDDL
                     LEEVSDLIETLASYQRNRNLTLPTSQDRYSADPVNGDMLRNGNLSHQPSEEEMATYEA
                     LKAQLALIIQNLPPYAVARLNSDKLGELAVSTKLEIRSDEYRGVMEEDEPTRLARLAA
                     QAATSNQRQAHRTPSVSGPYANHQYQTQFTPSVRPVGTTQHFPQTPSRPQGNVYQRAP
                     SSVPISQPHQQVQPRAAPGTQFRPMYAPQLAKAQGPYGHSNMPHQFAGTPSQPRMQQH
                     ANYNMGQPGTPSHRFPQGYPAGYQQQQIQPHPQHAQHSPHPQHSPHPPPMAHPQQPQS
                     PTPPQQHQQIVRPPYGSPGPGIPPNAVPRQYAAGSPGPGMMPAGGGGNGAGAGRSNLT
                     GFATVMPEVQQRQLMEQARARADAEQRASGHMGKVTQGEVVGLAGIGLAGHMDVHKVA
                     AAKMQMGNSANNNGHSVSPSPKVAMGATMQGHGQGGINGAAAVGTGPASGTGGPMPAQ
                     AAPVPGTAGLPPQQGKPVA"
     gene            complement(2477247..2478791)
                     /locus_tag="MYCTH_2308710"
                     /db_xref="GeneID:11510978"
     mRNA            complement(2477247..2478791)
                     /locus_tag="MYCTH_2308710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665170.1"
                     /db_xref="GeneID:11510978"
     CDS             complement(2477331..2478677)
                     /locus_tag="MYCTH_2308710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665218.1"
                     /db_xref="GeneID:11510978"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="JGIDB:Spoth2_2308710"
                     /translation="MRPLLPNWGSAARSASFSVSSTTSRPRPSQRHFHPTPAAWIPRR
                     RNFFTSNVFLQQDGSEPATRSVAPRIADDTITASQASQKRRKLPLKNSLHRVAIVAQK
                     GVPAKQPPPATDTKKSGAEGSSTISAVCVAESFDMDKVEDILKNHGFSLDPDGSGFDA
                     HEVVHARGFNTGDIFVFPSGTVVTWGLPPDVVTTLATKHLLPAAEMPFVEDREEEDLE
                     FVIDPEQEQSRVSGDVVVLGTRREVEAGDRLETTLAKIAFSSGLARSTKLAVLESSLT
                     RYLESTRHIPERLSQGLDAPLSRGMILQKAGELLNLRSQLNHYNDLTDALPDIFWDTE
                     EKLETYYAKIGKALDVGVRIKTLNDKMTYAQEVVGVAQGVLDISEKMSSEAHSTRLEW
                     IIIILIAIEVVFELRRLYMERYDVFHDELLAELRALRADLQKQETTTEQRTQADSN"
     gene            2479073..2481307
                     /locus_tag="MYCTH_2308711"
                     /db_xref="GeneID:11510979"
     mRNA            join(2479073..2480867,2480920..2481307)
                     /locus_tag="MYCTH_2308711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665171.1"
                     /db_xref="GeneID:11510979"
     CDS             join(2479296..2480867,2480920..2481297)
                     /locus_tag="MYCTH_2308711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665219.1"
                     /db_xref="GeneID:11510979"
                     /db_xref="JGIDB:Spoth2_2308711"
                     /translation="MEPDIRVEDYLDDKLQSTTDFEHLDTLISSVEYQRSQLQSQLDD
                     ATRELDEARRSSADRSAALVARIDEFQKLQKSIDVRLRIIAESDAPDEAIRRLEPPME
                     QLRNVDLAYRYLLLLQDVEALCQSARSHLPQDPKAALEPYTRLKQLAMRLKELQRQAD
                     GAAVHLVTHVAAAADKLWDEMKQTMWDELEAVLAKRGWPSVDPDSDADEEWLRCFEKL
                     LDLQVPEVLYSPTTVSLLPIDVMAQIFVKEFRFHFLSDKPTSNPQLITAHCFPWFLAL
                     VEKWEDFLRDNFGSILASKFGETEAARQMVYMDPVCAFITSMLPVMREKIALTIAETS
                     GDTVFLSSLLSQLMTFDERLRSGFAYDGGDTEEGWAGLTSEVLSQHFRTWLEAEKKFA
                     LERYQTIMSTPDARNIDYDFAAAGKTKPTFAAVRVTDLLRSVTAQYERVRRFSHKLRF
                     LVDIQLTILDEYHDQLRGTLEAYLSITSTVGRAFGVTKEQLAALEGTGALETLCKVYG
                     SADHIVNALRDWSNEEFFVTLWEELQSRARAAEDQSNLAGGMSYDHVRDKTSAAVGKE
                     EDGGVLFDETIAAYSQRRKRAEEFLSEALVESQRKAFKAYLHRPQWSTIADDASGDLT
                     VTPELDEPLRVSCLPGFSLTSSQRR"
     gene            complement(2481676..>2483123)
                     /locus_tag="MYCTH_2315933"
                     /db_xref="GeneID:11510980"
     mRNA            complement(join(2481676..2482869,2483006..>2483123))
                     /locus_tag="MYCTH_2315933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665172.1"
                     /db_xref="GeneID:11510980"
     CDS             complement(join(2482040..2482869,2483006..2483120))
                     /locus_tag="MYCTH_2315933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665220.1"
                     /db_xref="GeneID:11510980"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2315933"
                     /translation="MADSAADMEGHSSSSSSAVQTAKDLFSGAAGGVAQVLIGQPFDI
                     VKVRLQTSQAYPSALAAATSIYRNEGPLAFYKGTLTPLLGIGACVSIQFGAFHAARRW
                     LEQRKAGTAGTGAAAPQLGYGEYYAAGAFAGVANTVLSSPIEHVRIRLQTQPHGAARL
                     YSGPWDCVRQLSARRGGGGVARGLYRGSAVTVLREAQAYGVWFLTFEWLMNSDAARNG
                     IERKDIANWKVALYGGLAGEALWLGSYPFDVVKSKMQTDGFGPDQRYKTMRDCFAQTW
                     RAEGMRGFWKGIGPTLLRAMPVSAGTFAVVEMTMRAIN"
     gene            complement(2483611..2486684)
                     /locus_tag="MYCTH_2308715"
                     /db_xref="GeneID:11510981"
     mRNA            complement(join(2483611..2484679,2484739..2486436,
                     2486525..2486684))
                     /locus_tag="MYCTH_2308715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665173.1"
                     /db_xref="GeneID:11510981"
     CDS             complement(join(2483915..2484679,2484739..2486436,
                     2486525..2486638))
                     /locus_tag="MYCTH_2308715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665221.1"
                     /db_xref="GeneID:11510981"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="JGIDB:Spoth2_2308715"
                     /translation="MYEDSWYSFVPELSQHQPAFVVQTAGHRRKQSLSQQPNNTADDA
                     GAVEPLPTLFEDQKDAASPPEPTLSRRAKSYSDFYDIVRAQLAVHAPKKKRKRRRSDR
                     SWEALAVPDSAAASLPEEEEDYNGTLGKELIRASQQEYWFVGQPGARCRPRGPLLTSL
                     SRLYHDELAMTERHLGTLVADADKALKVLESLCHSFRAVDDQTSSFQAQCDGLLAEKK
                     RLEALAEAVGTDLQYYTYLDSATRRLNAPGAGRLVEGGSFAEILSTLDSCIEFMTRNV
                     SQSHPSGITHERADMAQSSYRDAESYLARYQALLTKALHLLEVGFVNHLNKVSTEISR
                     QVGATQSESARHALAYGRFEEMVLESYSLIPNVQAVVRKAYDQDGQPSSTPNADIYAN
                     TANNLFHSYWAARERDFKPIIQHDLDVFRAEANDSIETASRNFVKQSFERSDSEATLF
                     RNIFSIDPHYSTDAQSAFAVLKSQRTVLTGANVAPIAASLQAVLQGSDLQTICNLVGW
                     ITSEYLLPEYDEDETPFVGRCRELAARLLAEHLWAFTDAAFEAEIAKSITRAVVPPEA
                     LKIGPVTNGDMASNAFPPVKRALELLVLFDQSMPKERCQRNSPVVFRIIKESIASLQR
                     AEGRLKSAAAAAAAAAKPSPGSTDPDLFMIKNLLIFKNELMTLEIGDVRGNQATSSSA
                     FLGAGSGNMQHFTQIWDTLRPHNLLGGLLSSFGSLSTYIPGSSLWSSSPASAAGAAGG
                     GRVGAPAVGGTPRVGTTAPVAVDDAHEQLDGLLRQSIVAFTRRWAGVLNDARGVGGGS
                     SSSKLGGKNVGKVERELEETLERAFSGQPEVIAKLKEAVQIEAEGQARVLGEKKSYVT
                     RV"
     gene            2486946..2489353
                     /locus_tag="MYCTH_2308717"
                     /db_xref="GeneID:11510982"
     mRNA            join(2486946..2488138,2488299..2489353)
                     /locus_tag="MYCTH_2308717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665174.1"
                     /db_xref="GeneID:11510982"
     CDS             join(2487143..2488138,2488299..2489078)
                     /locus_tag="MYCTH_2308717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665222.1"
                     /db_xref="GeneID:11510982"
                     /db_xref="JGIDB:Spoth2_2308717"
                     /translation="MFKTASPFLTRTAFRQPSSLRTLAATSAQCARYSSSTGPTQRVS
                     ARAVGLLTVAVASGAGTLWAYPRLFGEPQPAGPAQPEAAEIVYEKPRKKAADKEESRE
                     LVSPQHVQVKRSWEHPGVYAWGSNAGKVVAPDSDETVIKTPRRIPYFDGKLLRDLKLD
                     RDFGVAVTEEGDLVQWGTAFSKDAVTPTVTLKGKDLSKIAVSRDRIIALSSNGSVYSI
                     PVAKSDQESGEKPTSKSWLPFWSSEASMSYRLLTPPSLGWGEKVIDVKSGQEHCLLLT
                     SKGRVFSAASSSEEFPSKGQLGVPGLTWHTRPAGPYDQPHEVKALSNIKAIAAGAFHS
                     LALDDRGRAFSFGDNSSGQLGFETDIAAIVDKPSLLPVHKLYSGTGLVPKVTSIGAGG
                     HNSYFTVDATKTQGQDAQEVGRTVADTWACGAGIYGGLGTGKWTHVSAVPTKIKALSN
                     LYEYDEATNRVTPIRLARLAVGSTHACAVLDNLTRLTAPRSSTSGSDTDTNFGADVLW
                     WGGNEHYQLGTGKRNNVSVPVYIAPLDGGRAGDADKSGVGEPPRFQLTPRTTVRLGEG
                     GKGRKASVEQRIECGRFVTAVYSGA"
     gene            2490467..2492875
                     /locus_tag="MYCTH_2308718"
                     /db_xref="GeneID:11510983"
     mRNA            join(2490467..2490554,2490615..2491063,2491134..2492875)
                     /locus_tag="MYCTH_2308718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665175.1"
                     /db_xref="GeneID:11510983"
     CDS             join(2490700..2491063,2491134..2492584)
                     /locus_tag="MYCTH_2308718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665223.1"
                     /db_xref="GeneID:11510983"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="JGIDB:Spoth2_2308718"
                     /translation="MTNLPRFHRRKKDVAPPTLITSNLPGKSTPSSADLPPSSPKRSF
                     QKLSRFRVFHRSSGKRARDSPPASLPHSPAGAPVPPADYTDGRPVSPLSLKMEAASDE
                     VQKPAKQYKMPAFLDLSDEEIENRFSELVWRERNRLMLSVTNPSPDFRWARVTGPHLK
                     TLDRYLNIQPWHNNRIKLRVPEGHVDYVNASPIVLEPLPCPTPDGRPGPVREPDRYIA
                     MQGPKQASMDHVWRMLVEQLESPGVVVMLTETHEGHLEKCFPYFPRSKDDPPVEVNER
                     DEFGDGFRATVRCEGMEETPAGDAIELRKLVIRVHPRPRTPAQSEPSQGNSSSPTESS
                     SQQTAATTETNEVSPTDQQQERDQQPNASGEEGSYEEKIIYHFLYKNWPDFGVPSLDD
                     LDSFFTLMRLSREKNASPRNPRVVHCSAGVGRSGTFIALEYLMRELEAGVLEDWDERA
                     AGAGAGAGSKTTPSPGKKVDEKEEEEEEEEAVEEELDGGEEGRERSSESGSGETEGPE
                     LQPQGQGPDLIFETVNSLREQRRAMVQAELQYLFIYRVLRQLWIEKYGPPQADGQEEG
                     EEGEGGGGKEVMPGADGKGDGDGERAAKRLEVDPSTEQ"
     gene            2497024..2499603
                     /locus_tag="MYCTH_2308721"
                     /db_xref="GeneID:11510984"
     mRNA            join(2497024..2497304,2497848..2499603)
                     /locus_tag="MYCTH_2308721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665176.1"
                     /db_xref="GeneID:11510984"
     CDS             2497893..2499311
                     /locus_tag="MYCTH_2308721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665224.1"
                     /db_xref="GeneID:11510984"
                     /db_xref="JGIDB:Spoth2_2308721"
                     /translation="MVTEGLPVPCSICDEAPPGPASSRDKSDPKAPSSGESSHVAAIT
                     EALRRINFSEAQRSSSEPVTEQEAQSRRASIRQAARAAAASTTGSAIETPPQSPCLAP
                     GPGAQQQKPRQDSGFRRTYDEYVTRRAGPCDNCALTLPKRQENGKDVSTGSRPDRGPT
                     LRTRAPYARVFTGVDNHMSPPTSRSSSSAPSEDESGNQQRPPSHRRTGTGLSVTSRSS
                     GTSDSASANSHMHFLDYTSTHEPLAPESFSLVRASCLRTLSLETLPRAPATSPAAAGA
                     TMPTPSGSPKSPAYVTTHSIGSAASGGSIFFGDRKVGYTTAYIFRVPDVHARGHKRVY
                     AFLALSTHPEPTAVKTFTFLSSAFRDMASWIQELAEAEAERALAESTGSSGNSPVAPG
                     PGYGSFHSEPVAPPVSGGNSSFLTGGIGGLSRRMGGGFGGSGVALKQRGLAELVGLPD
                     FFIELHAKFVRLLLEIGVMVGS"
     gene            complement(2500358..2502053)
                     /locus_tag="MYCTH_2095260"
                     /db_xref="GeneID:11510985"
     mRNA            complement(join(2500358..2501524,2501595..2502053))
                     /locus_tag="MYCTH_2095260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665177.1"
                     /db_xref="GeneID:11510985"
     CDS             complement(join(2500555..2501524,2501595..2501890))
                     /locus_tag="MYCTH_2095260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665225.1"
                     /db_xref="GeneID:11510985"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2095260"
                     /translation="MGDVLVENATNSTQPLKKNTTSTIPSIENFEGVPTEGGDEYATL
                     KRLQRQLEYIQLQEEYIKDEQRSLKRELVRAQEEIKRIQSVPLVIGQFMEAIDQNTGI
                     VQSSTGSNYVVRILSTLDRELLKPSSSVALHRHSNALVDILPPEADSSIAMLNADEKP
                     DVTYADVGGLDMQKQEIREAVELPLTHFDLYKQIGIDPPRGVLLYGPPGTGKTMLVKA
                     VANSTTANFIRVVGSEFVQKYLGEGPRMVRDVFRMARENAPAIIFIDEIDAIATKRFD
                     AQTGADREVQRILLELLNQMDGFDQTANVKVIMATNRADTLDPALLRPGRLDRKIEFP
                     SLRDRRERRLIFTTIASKMSLAPEVDLDSLIVRNDPLSGAVIAAIMQEAGLRAVRKNR
                     YNIIQSDLEDAYSSQVKGSSDENKFDFYK"
     gene            2503447..2504507
                     /locus_tag="MYCTH_2144787"
                     /db_xref="GeneID:11510986"
     mRNA            join(2503447..2503633,2503688..2503758,2503841..2504507)
                     /locus_tag="MYCTH_2144787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665178.1"
                     /db_xref="GeneID:11510986"
     CDS             join(2503459..2503633,2503688..2503758,2503841..2503999)
                     /locus_tag="MYCTH_2144787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665226.1"
                     /db_xref="GeneID:11510986"
                     /db_xref="JGIDB:Spoth2_2144787"
                     /translation="MENNSTSITIPEQRHRAVHAEAGSSPSSYSSSPSSSPEPSTKAA
                     QKRKLLHTRRPSLLSSAFTQQECTTIKIGDDPEGPMRLITYLSSDQGFVWNPEIFVPS
                     FCDYDYVPLEQRRDPVHEIYLSDEEIKKILPQ"
     gene            complement(2505629..2508238)
                     /locus_tag="MYCTH_2315937"
                     /db_xref="GeneID:11510987"
     mRNA            complement(join(2505629..2505702,2505855..2507472,
                     2507548..2507671,2507729..2507778,2507842..2508238))
                     /locus_tag="MYCTH_2315937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665179.1"
                     /db_xref="GeneID:11510987"
     CDS             complement(join(2506795..2507472,2507548..2507671,
                     2507729..2507778,2507842..2508033))
                     /locus_tag="MYCTH_2315937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665227.1"
                     /db_xref="GeneID:11510987"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008273"
                     /db_xref="JGIDB:Spoth2_2315937"
                     /translation="MAEPAPAPLELDPKYDDYDYPTTAPTPQSGHPGYLTPQQQAQVH
                     QLRLLLESEGYKERLDTLTLLRFLRARKFDVELAKTMFIECEKWRQETKLDELLPTWE
                     YPEKEEVFKYYPQYYHKTDKDGRPVYIEQLGGIDLTAMYKITTAERMLTNLAVEYERV
                     ADPRLPACSRKAGTLLETCCTIMDFKGVGLAKAPQVYGYVKQASALSQNYYPERLGHL
                     YLINTPWGFSTVWSVVKGWLDPVTVKKIHVLGSNYQKELLAQIPAENLPKQFGGTCEC
                     EGGCHLSDMGPWREEQWARPAKWEKKKKEAEAAAKNEPAAAKEGTEADAGAPAAAEAA
                     DAAKEDAAVPAAA"
     gene            complement(2508514..2510231)
                     /locus_tag="MYCTH_2308733"
                     /db_xref="GeneID:11510988"
     mRNA            complement(join(2508514..2509143,2509202..2509327,
                     2509384..2509482,2509548..2509659,2509733..2509855,
                     2509942..2510009,2510060..2510231))
                     /locus_tag="MYCTH_2308733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665180.1"
                     /db_xref="GeneID:11510988"
     CDS             complement(join(2509030..2509143,2509202..2509327,
                     2509384..2509482,2509548..2509659,2509733..2509855,
                     2509942..2509973))
                     /locus_tag="MYCTH_2308733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665228.1"
                     /db_xref="GeneID:11510988"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="JGIDB:Spoth2_2308733"
                     /translation="MASTDKEAAARDATPSNPRGIPYAPFVDKVEDYVTSRADVEPTL
                     RRFQEMIAKYQFMEQNLQRRVAGLKDKMPDIRKTLEAVRFLKLRTGESDPIETTFELN
                     DTLYAKAEIPPTDEVYLWLGANVMLSYPIDEAEALLESKLQAAKQSLSNCEEDLDFLR
                     EQITTMEVAVARVYNWDVVQKRKEKEEEEKGKGKNSQNSGS"
     gene            2511097..2512943
                     /locus_tag="MYCTH_2308737"
                     /db_xref="GeneID:11510989"
     mRNA            join(2511097..2511503,2511560..2511716,2511787..2512943)
                     /locus_tag="MYCTH_2308737"
                     /product="aspartic protease"
                     /transcript_id="XM_003665181.1"
                     /db_xref="GeneID:11510989"
     CDS             join(2511402..2511503,2511560..2511716,2511787..2512721)
                     /locus_tag="MYCTH_2308737"
                     /codon_start=1
                     /product="aspartic protease"
                     /protein_id="XP_003665229.1"
                     /db_xref="GeneID:11510989"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2308737"
                     /translation="MKDAFLLTAAVLLGSAQGAVHKMKLQKIPLSEQLEAVPINTQLE
                     HLGQKYMGLRPRESQADAIFKGMVADVKGNHPIPISNFMNAQYFSEITIGTPPQSFKV
                     VLDTGSSNLWVPSVECGSIACYLHSKYDSSASSTYKKNGTSFEIRYGSGSLSGFVSQD
                     TVSIGDITIQGQDFAEATSEPGLAFAFGRFDGILGLGYDRISVNGIVPPFYKMVEQKL
                     IDEPVFAFYLADTNGQSEVVFGGVDHDKYKGKITTIPLRRKAYWEVDFDAISYGDDTA
                     ELENTGIILDTGTSLIALPSQLAEMLNAQIGAKKSYTGQYTIDCNKRDSLKDVTFNLA
                     GYNFTLGPYDYVLEVQGSCISTFMGMDFPAPTGPLAILGDAFLRRYYSIYDLGADTVG
                     LAEAK"
     gene            complement(2512944..2516116)
                     /locus_tag="MYCTH_2308740"
                     /db_xref="GeneID:11510990"
     mRNA            complement(join(2512944..2514648,2514708..2514898,
                     2514949..2515282,2515348..2515559,2515613..2516116))
                     /locus_tag="MYCTH_2308740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665182.1"
                     /db_xref="GeneID:11510990"
     CDS             complement(join(2513166..2514648,2514708..2514898,
                     2514949..2515282,2515348..2515559,2515613..2515975))
                     /locus_tag="MYCTH_2308740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665230.1"
                     /db_xref="GeneID:11510990"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="JGIDB:Spoth2_2308740"
                     /translation="MESSQDLKSLRDTVHSALVTVTRSVNALANEDLQFQRTVHPSVA
                     TRLDQNTERILRLARGVLKSASNFTSQREPQLEDVDDVEIQWKGVVDVIDSLLEKSDT
                     CLDEYTGLVKRKDAPTAELGRELKRSRSTTSRLDWSMKRANILKPQNAFERKIDNFDS
                     GPWKPLMTSKPHARVPLETSLDTFVDEEGRTQYKHPYEQEITNMQYPEQVYRSCEPIK
                     YLPMETTKAIWVDTYEGVLEMLQELKQATEIAVDLEHHDFRTYAGLLSLMQISTREKD
                     WIVDTLVPWRHKLEVLNEVFADPKIVKVLHGAFMDVIWLQRDLGLYIVGLFDTFYASD
                     TLGYAGKSLAFLLKKFADFDADKKYQLADWRIRPLPEEMFYYARSDTHFLLYIYDMLR
                     NELAELASQNNPDGNPIDRVIQKSKEVSLQRYEHPVCDPETGAGNRGWYNTLIKSPTL
                     YNGEQFAVYKAVHKWRDDVARQEDESPFFIMTQQVLSDIARIIPTDMKALWSLLESNA
                     RGLKGRLEELFQVIQEARARGVNGPTMLQFFRELSSGASQTSLGVRKVAAAAAEDSEP
                     LSIEELKCDRSQLWGDVALNSSLDGTSKARPIREEDMIPLYTFDFGAIKEELPETNQP
                     SPRRVAEQDTKGLPVLEEEGFTLKAGRKRKSRDVDVESASEAEAVSDIEMGGDSSAGK
                     DHPKSPSVEQEVEGGDDKAAKQAKKQAKKAAREEFKRAQLLAEQLAQNGDIKGAKELK
                     AQARKALRAAKKAQKQQQQQQQQTSASAATSAADEQTSGEQEEGHDDDAEQEPFDYSK
                     ASSVLHAAQATNGDDGDDDGGRKEVRGKFAPFDPYGMKSGDAPQGARKMNHVKGGRTA
                     TFKK"
     gene            2518804..2521968
                     /locus_tag="MYCTH_2308744"
                     /db_xref="GeneID:11510991"
     mRNA            join(2518804..2519107,2519170..2520301,2520352..2520813,
                     2520871..2520974,2521027..2521968)
                     /locus_tag="MYCTH_2308744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665183.1"
                     /db_xref="GeneID:11510991"
     CDS             join(2518973..2519107,2519170..2520301,2520352..2520813,
                     2520871..2520974,2521027..2521347)
                     /locus_tag="MYCTH_2308744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665231.1"
                     /db_xref="GeneID:11510991"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="JGIDB:Spoth2_2308744"
                     /translation="MPDNDGLMRVFWPADLPRSDLKGVVVGWRNSALDVFVLAILEEV
                     ELRNVEFALKIGTLLRNAPHPVSRIYELCGQTSICVLGLSNTPDSVEIDPSWIRVTVG
                     PKRRVPAITCPRASSIQLILFERPNPTRMQYISLNPIELALDDKHDSFRQDVSDGIED
                     DDEKEERRKKEQQRQLVEKLKQHSIFKRVPSEKEKALAKIVNQINWSWELEKLLQKNV
                     SRIGTRPKRSLSVSERVVESATTARDMMVVWMWDLFTVYVWPVIKRVFVMGLLAHRIA
                     AEMLLRILEWRAQPRYAALKDISATAQQVEIRLQQFCYWPMQYVTLRLRKNDWESVTT
                     SHPDYIRFYNSLWLVANDVIIGIALGSYIIDNAGWVAEEVNQLLSQYTVDALQSSISW
                     LMGWPAGLKLNNELGAFLGDLFLWVIDYWSSFIEALRPYLPRIIWFIGFSSFAGASMP
                     IALFSDLLSILTVHIYSFYLASARIYHWQLNILISLFHLFRGKKHNVLRNRIDSCDYD
                     LDQLLVGTILFTLLFFLLPTVVVFYLNFAIARMVIISLKAVFDTMLSCLNHFPLFALM
                     LRIKDPGRLPGGIRFELRDTQDFRSPITINSPTQKLPSTSVIYLKSVPLKFKAMFHQY
                     FQMGQRIRKHYLSPRVLLCLLTGKFVPPLNRKNLYSLQYSMLPARRAGVMEMWNAVNS
                     LPESKKRGAPVHVPILANGKTFPSNYGGGRSRGYG"
     gene            2522215..2523841
                     /locus_tag="MYCTH_2308748"
                     /db_xref="GeneID:11510992"
     mRNA            join(2522215..2522389,2522447..2523312,2523398..2523841)
                     /locus_tag="MYCTH_2308748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665184.1"
                     /db_xref="GeneID:11510992"
     CDS             join(2522332..2522389,2522447..2523312,2523398..2523622)
                     /locus_tag="MYCTH_2308748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665232.1"
                     /db_xref="GeneID:11510992"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="JGIDB:Spoth2_2308748"
                     /translation="MSSQDPKERFYRQFQTSVTTIHEQINQLSSFASVGPERQDAVDH
                     ILGGLSHLSKEVADATEFIPAHDLRIYSDTVKSLKDQLNEAQAKLMPKNRFQFRKRPE
                     NSDAATAKPDTRRLDLTANTRSSTDVASAQTEAKDTIGALPASSSLPTSSKNYNAEIS
                     RDDATAKGVGVRKPSFSAARDVHLSDHIRVHITLPASASRATSSGTLTDLHQCVVDMT
                     LPTSSSTTGSGPGTPFASLTLKDIRSSAIVAGHVNGPVHVTGVRDSVVMVIARQVRIH
                     ECRNVVFYLHCVSRPIVEDCTGVQFAKAPEIFLTEKEKKEANLYDQVDDFKWLKTFSS
                     PNWSLLPDDQVVPEDVWKKALDGKPGTLIDDTLRMLGVEKGLGAGKET"
     gene            complement(<2524113..2524857)
                     /locus_tag="MYCTH_2144795"
                     /db_xref="GeneID:11510993"
     mRNA            complement(<2524113..2524857)
                     /locus_tag="MYCTH_2144795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665185.1"
                     /db_xref="GeneID:11510993"
     CDS             complement(2524113..2524829)
                     /locus_tag="MYCTH_2144795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665233.1"
                     /db_xref="GeneID:11510993"
                     /db_xref="JGIDB:Spoth2_2144795"
                     /translation="MATHLPAGLSPDAVDVVTELSSIITRLRAAQQSSSPSGANATGA
                     TAASAGGGGNKPQGGVTGTTPLPTSVPTPNPSSSNNIITNSNTANAANAAAAASSSTA
                     GAANPNPNPNQQSTTTGSGPGSGDKELLSVKDLPFATDNLKHKLQRARAAVRMLGGVR
                     RALAQQEAEARALEERRANQAARLARTQEDGLLFVKAKREESEGVVVMGDVDVDDGGR
                     GAGKEGDGNGQAGAGERMVE"
     gene            2525153..2527340
                     /locus_tag="MYCTH_2315941"
                     /db_xref="GeneID:11510994"
     mRNA            join(2525153..2525259,2525357..2525709,2525769..2526141,
                     2526198..2527340)
                     /locus_tag="MYCTH_2315941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665186.1"
                     /db_xref="GeneID:11510994"
     CDS             join(2525232..2525259,2525357..2525709,2525769..2526141,
                     2526198..2527003)
                     /locus_tag="MYCTH_2315941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665234.1"
                     /db_xref="GeneID:11510994"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /db_xref="JGIDB:Spoth2_2315941"
                     /translation="MAPEHKACLIVIDGWGIPSEDSPKDGDAIAAAETPVMDEFSKSA
                     TGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSVKKGEFSSNDVV
                     KKVLEASKNTNGRLHLCGLVSHGGVHSKQTHLYALLRAAKEVGVPKVFIHFFGDGRDT
                     DPKSGAGYMEELLSTINEIGTGQIATVVGRYYAMDRDKRWERNEVALQGMVLGEGEQS
                     DDPVKTVRERYEKGETDEFLKPIIVGGDEARIKDGDNVFFFNYRSDRVRQITQLLGDV
                     DRSPLPDFPYPKVNLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQGVEQVHVAETE
                     KYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVPTYDKAPEMSADGVAEQVCKRLS
                     EGRFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYESCKKNGYILFITADHG
                     NAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLTAMGLPVPE
                     EMTGTNLLVKA"
     gene            complement(2527828..2529315)
                     /locus_tag="MYCTH_112204"
                     /db_xref="GeneID:11510995"
     mRNA            complement(join(2527828..2528615,2528683..2529023,
                     2529114..2529315))
                     /locus_tag="MYCTH_112204"
                     /product="mitochondrial ATP synthase protein 9"
                     /note="Has EST support"
                     /transcript_id="XM_003665187.1"
                     /db_xref="GeneID:11510995"
     CDS             complement(join(2528610..2528615,2528683..2529023,
                     2529114..2529225))
                     /locus_tag="MYCTH_112204"
                     /codon_start=1
                     /product="mitochondrial ATP synthase protein 9"
                     /protein_id="XP_003665235.1"
                     /db_xref="GeneID:11510995"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Spoth2_112204"
                     /translation="MASTRVLASRLASQMATKAARPAARVSLANTSKRTLTVASKSSP
                     LQAVKRQQMSSIINATTRQAFAVQRRAYSSEIAQAMVEVSKNIGMGSAAIGLTGAGIG
                     IGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFT"
     gene            complement(<2531075..>2532481)
                     /locus_tag="MYCTH_10609"
                     /db_xref="GeneID:11510996"
     mRNA            complement(join(<2531075..2531424,2531503..2532275,
                     2532321..>2532481))
                     /locus_tag="MYCTH_10609"
                     /product="histone acetyltransferase SAS2-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665188.1"
                     /db_xref="GeneID:11510996"
     CDS             complement(join(<2531075..2531424,2531503..2532275,
                     2532321..>2532481))
                     /locus_tag="MYCTH_10609"
                     /codon_start=1
                     /product="histone acetyltransferase SAS2-like protein"
                     /protein_id="XP_003665236.1"
                     /db_xref="GeneID:11510996"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="JGIDB:Spoth2_10609"
                     /translation="RPDRNIDKVVLGDICFRAWYPSYYGKDVLGDSSGNSTKGGKETK
                     SHGGGGGGGGAKTHGRRDRDHHPPMLDRLYVCPRCFKYSKELVTWWKHVRWCERRGYL
                     PGRLIYTHPKGKRTVLVAAGPAPKQGRGSKRGSVGQRLVEQVVQDEGEWSIREVDGEQ
                     DVLFCQNLSLFAKLFLDNKSVFFDVTGFNYFLLVYTPPPSAPSPAATSPTTANPEMRS
                     VRPAPVRNRSQIVGFFSKEKMSWDNNNLACILVFPPWQRKGLGSLLMGVSYEISRREG
                     VLGGPEKPISDLGKKGYKRFWAGEICRWILGLSGAEEKGNKEIVVDIEACSRATWIAP
                     EDCLSVLREMGLAEDAGAGPPLGSKVQAPKRADESANPNGSGAFTTETASSSPDQVVQ
                     RVRISQAAVREWVATNKISLERTCDPDGFVEGYALK"
     gene            <2533934..>2542101
                     /locus_tag="MYCTH_2095291"
                     /db_xref="GeneID:11510997"
     mRNA            join(<2533934..2536081,2536148..2537035,2538313..2539023,
                     2539408..>2542101)
                     /locus_tag="MYCTH_2095291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665189.1"
                     /db_xref="GeneID:11510997"
     CDS             join(2533934..2536081,2536148..2537035,2538313..2539023,
                     2539408..2542101)
                     /locus_tag="MYCTH_2095291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665237.1"
                     /db_xref="GeneID:11510997"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="JGIDB:Spoth2_2095291"
                     /translation="MVKAVGAPQRQSSEEDAFDEILGETKEDAITSRNVLDDPLPCVN
                     GTGEGGRPFEHPRTTPDRVFGTTAGRITSDAAPEKSRPLENTDHELPFLQLPTDPVKL
                     KALPTGFSDMTEQEQQEELWIVHAEERLGKEWELEDPGKHAPYNHDYPPYSPSKVIGL
                     LHRWRDRAWTAQQWRLARAIAGNRSLRLPVLTAQAFLRRHTLLARRRGVELKIERYLG
                     GTKEWKARLAELESQTGVSEADIKQWLWILSPESGDAKIQRFLKSKCRKPLFLLQLLL
                     AKDKKIHEPATFLGLLKFMRENYVLADRPQDELNHPAYKGQGRAVTWWHYLVFLYRLV
                     WHCREGWPAAMPLLARLTADYIGTMRLDSKARALTGYQARSLVLNKSLRYFSWPARVR
                     PIDHMEHNWAAQRHLLRLAATAEPPLVMDQNGYRAVRAVLIALRKTKGEARNADRSAQ
                     TWPPYRRTLDGIDERRDPEDDLSRSAKAGILVRAAGYSDDVVDRALSALGGSTFGQAP
                     TIQTRSLPPAFYSGRLASHNIFAEWAAQLRATRNAREAWIVFENPPEPGLRPTAQIYG
                     EMFEKLYARPASESPAIRPGDVREAFPVYDGNLSEFEIARLTPPSPEELYDLMLLQDK
                     LRPTGFCLAVLIRNSPSRATALRYLGDSPYKPCIQALRVPASRADAESLKALSELPLN
                     IFNAWIAMLCRLHTRAPQEKSARPDSQPNAEGAHGGSIPEAITLATAFQAHNAKAAHH
                     DRQPWHTIMQALAGRKILYSQRGAEFNVLETLMTFLRIYERTTASKGIDPVAFEALCL
                     MIRKALKLMTFEKVEGGKMVPRPYMADTAVMEKLLWRAHRHAVKTFEMLTSPVPDERL
                     EGADAPSGHAVGTINEEEEEDDDDDEMEEADDWATPGMLRFNVVGRPLHKYMLALACC
                     GDHKGMVRLMDWLLDGWDQEYIREEAKTSHNLDYHYTIRTIAYFAEMGRELVEPAELD
                     RLRQRLEDMRWEKGCTWFWPQEGWQGPTEEQALPELETDLTLADQGSVSSGSAAYEVC
                     RSKHIRVDLPPSTLVHPKSQYQGYVPPLPPTPESDAVLSLLELAGSRKKKGFAEIELE
                     SFSFYINSAVYPYEMRPLQHMATRIGHDQFYFDGVLRVGGTRHYVQNVEVSELPIGNY
                     GTEHATVRGQIWARSRLNSKADVYYLLTQPSKEYDRFYAPFLWVADLAKHVVDFSAAM
                     IDRGRPVQINSFKAHFMRWLRRTHGNSPEFRRWRAQHPSGDYRTSRIRVGDTISTPRD
                     GETTDTKWRNMASKGAAKDDRWFGLVQRVHVANDGSRSFDVTWFYRPVETPCCMMKYP
                     WPNELFLSDHCTCQEGHRSRVKEHEVLGVHNIDWFGSPEKGGGGEFFVRQTYLVEDRR
                     WVTLQKAHMVCSHGREKLGCKTGDTVLAVLSKSPEANAEPYEVVKVFRQGDHQFVRLR
                     RLLRRCQVDPQADTAPNELVYTDQLVVAKPDKVIGKCAIRFFRPTEQVPTPYDRGGTG
                     NLFYITHRLVSGDDGGEKCVPFDGDFPTSLRQGFDPAQPVPRRLRGMDLFCGSGNFGR
                     GLEEGGAVEMLWANDIWDRAIHTYMANSPEPKSIKPFLGSVDDLLRRALQGKYAENVP
                     RPGEVEFISAGSPCPGFSLLTPDKTTLAQVKNQSLVASFASFVDFYRPKYGILENVVT
                     IVQARHNRSQDVLSQLFCAIVGMGYQAQLVLGDAWSHGAPQGRSRVFLYFAAPGLHLP
                     DAPLLSHSHYAGVNSRGLGEMCNGEPFVSRSFQPTPFKYVSAAEGTSDLPLIGDGKAE
                     PAVAFPDHRVCAGLTPKLRHQIAAIPTHPYGMSFARAWHGGDGVMTLADRALFPADGA
                     RVSPISQGWRRVRPGDVFQTVTTRSQPTDARAGTGLHWIDNRPLTVQEIRRAQGFPDQ
                     EVLLGTLADQWKLVGNSVARQMALALGLRFREAWARSSATLEGREGSSKASASVGVSL
                     EGTPVVDAGMVKRTGRRPSTPREIVDLTAAVEDEPRAVETDNEQTQCDFREIIDLTLA
                     PDTTERASRRRGGSQELSANINTIRKRRLSQRQQAAPEARSSKVGRLESRESTPAPPR
                     LTAPEPRPMPGGGNDVRARLADPRPVVPPSPAVEGEKPARAGPTIVRLWSPEELGSNE
                     PGPNGDDLHQFTDY"
     gene            2543174..2545478
                     /locus_tag="MYCTH_2308758"
                     /db_xref="GeneID:11510998"
     mRNA            2543174..2545478
                     /locus_tag="MYCTH_2308758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665190.1"
                     /db_xref="GeneID:11510998"
     CDS             2543285..2545162
                     /locus_tag="MYCTH_2308758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665238.1"
                     /db_xref="GeneID:11510998"
                     /db_xref="JGIDB:Spoth2_2308758"
                     /translation="MRTTTLILHALSLVASADAGPLRNQSWRRAQALRIPRQAESGSE
                     RVASNSTESASPSLPATITTTTDAECSDIPTLSATSSLSSLLTSIVFSESSTFVTPMI
                     TVNPTSSSSERPLSGGLGSSTSSGTLLHSAVELSLTSTTTGRPVVTSFRQDPDASSTL
                     SSLTAPESSDLLSSISATTGTLILGTGSGQVSSTSGFFLNSTATATTLGSATITGLPS
                     SAALSSSSSSTAPVVTGSPNPDIPTVLEPPPPATTTVSPDVYQRNIEEARGYNKIFAT
                     LTEQTACSQGQVACIAGGVATCAEGGTWDIAPCPELGTACLAMPMNTTDGAVLGCTDV
                     TLAKQVLESIPDALLPGSSSTVSATASTTLSTSTGSSADALPTASSTGRRTRTSIVTV
                     TSGIETVTVTVDPSTTAESSVPSTLSLSQSPSSETSTTSSSDTAVIQPITRTAVIVVG
                     TETATITFTIDPNIHPTALPPSPDESTTSQGPPFHKSPPGSNFTVPSIVFTTVPHSTT
                     TSSTTTSLSSSTSTRESLVVIPIESTTATTTTSATSVETPTETPTETEMEPPVSTTTT
                     TMTSTPGSANGAVDGPVSVTVTQLVTVTEKERVTTTDTATVTTTVRLGSVVVVDSIMT
                     R"
     gene            complement(2545506..2548044)
                     /locus_tag="MYCTH_2308759"
                     /db_xref="GeneID:11510999"
     mRNA            complement(2545506..2548044)
                     /locus_tag="MYCTH_2308759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665191.1"
                     /db_xref="GeneID:11510999"
     CDS             complement(2545983..2547227)
                     /locus_tag="MYCTH_2308759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665239.1"
                     /db_xref="GeneID:11510999"
                     /db_xref="JGIDB:Spoth2_2308759"
                     /translation="MTPTSARFATTPQSRRTTARAAAALHSRKDNGNAPFRTPTINRN
                     SEEKPNGNATPSNATPSFLRRRTVSIGMSAAAAAASRTGLARIDEKKEEGAANDGGRT
                     DEEKEEEEAWRKIGPLRLPRKLGFGRSLSSVVADLRKMEEEAFGDDEEALREMEMAGS
                     SGGGGIDRPLTVDKTMRKRGAGTKDSQGAAVQLGRDPPGKADARGTTEPAVGLLSGFD
                     EEGLYDSPDEEEQKGAQQQPLRQFKKRGQKRTTRLVKMRPTRTKRPTQANVEDESDEA
                     EVDDMVPETQLDASSEPAAAAGDDGLRLSEVDSASDADFDAAAAAAADDDDEDEERGG
                     KSKTKNSRSATAKNKDKDNKTNNGRSGSGDGDGKDKGEGVVRRAVRKVKATAHANFKR
                     LKLRNSGAKGGPAHNSRFRRRR"
     gene            2548273..2549824
                     /locus_tag="MYCTH_2308760"
                     /db_xref="GeneID:11511000"
     mRNA            join(2548273..2548874,2548945..2549824)
                     /locus_tag="MYCTH_2308760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665192.1"
                     /db_xref="GeneID:11511000"
     CDS             join(2548343..2548874,2548945..2549624)
                     /locus_tag="MYCTH_2308760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665240.1"
                     /db_xref="GeneID:11511000"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2308760"
                     /translation="MDAGAAVDAPEDIQAQVLNATLAEIKTRRLGSADSDESRDRDRD
                     CCVICLDAISDPCAALPCGHAHFDFLCLVSWLQEHPNCPLCKANVYKVRYADDQKAEA
                     FYRVPNAPRTRNDGGGAQNNSTNSLDATIRRRRFASQSGLLLLRERERRPPRPPPTVD
                     EAIQRRRYVYRHQLYSLHIGSNRISRYRPHPTPAQFASTPHLVSRARLWIRRELQVFS
                     FLSSSSSSTNDEPDPASTATSTNREDRRRRNNAEFLLEYIIAILKTVDIQGSAGQAEA
                     MLADFLGRDHARLLLHELRNWLRSPAVGLAAWDREVQYPEPGPDAPRDVVSRGDSEDG
                     ENDNGDEGGSAAGEDEAGRWWRDRGGDHWVARRGAHASPVGKRKRRASGKPREGRVSR
                     ARARGDTQGGG"
     gene            complement(2550740..2553099)
                     /locus_tag="MYCTH_2144800"
                     /db_xref="GeneID:11511001"
     mRNA            complement(join(2550740..2551071,2551165..2552492,
                     2552555..2553099))
                     /locus_tag="MYCTH_2144800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665193.1"
                     /db_xref="GeneID:11511001"
     CDS             complement(join(2550928..2551071,2551165..2552492,
                     2552555..2552813))
                     /locus_tag="MYCTH_2144800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665241.1"
                     /db_xref="GeneID:11511001"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="JGIDB:Spoth2_2144800"
                     /translation="MPGKTPDKEPVENGGYRGGKDLKPKGKKASKKEGDDEMTVVVPP
                     SKSSKQSSVPPPNDAEGDVAMDDAEKTAEGEAKVDPVAQTINDIKSNFALLDRAVALF
                     DARFSLRALRSISSIRKRLTPDILAQAISETYASSSASANVARQMLLAIGRSDVPLGQ
                     QLGPDMEVDSEPKPSSKNGAKKEAKEVIPEVDVFLGILTQVLLHDSKQHQQGFEFSQF
                     LVDQIRSLNRRTLDSLAAKVYFYYSLFAEQIAPLPPSLQSPIVSIRPTLLAALRTAVL
                     RKDVDTQATVIVLLLRNYLLTSHISQADLLVSHTQFPENAANNQVARFLYYLGRTRAI
                     QLRYTEAHEHLTAATRKAPSSACALGFSITATKLLLVVELLMGDIPDRATFRQPNMET
                     ALRPYFLLVQAVRVGNLGDFETIIAEHADAFRRDGTYTLILRLRQNVIKTGIRMMSLS
                     YSRISLRDICIRLHLGSEESAEYIVAKAIRDGVIEATLDRERGFMKSKEVGDVYATRE
                     PGEAFHDRIRACLALHDESVKAMRFPMNQHRLELKNAQEAREREREMAKEIQEGDLDE
                     DDLGGEFEGM"
     gene            complement(2554550..2556980)
                     /locus_tag="MYCTH_2308761"
                     /db_xref="GeneID:11511002"
     mRNA            complement(join(2554550..2554929,2555008..2556980))
                     /locus_tag="MYCTH_2308761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665194.1"
                     /db_xref="GeneID:11511002"
     CDS             complement(join(2554672..2554929,2555008..2556741))
                     /locus_tag="MYCTH_2308761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665242.1"
                     /db_xref="GeneID:11511002"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="JGIDB:Spoth2_2308761"
                     /translation="MMRGIAYLGEEEKIKYEKGLASLWKMHDTAPPGSPQQEDAKKKI
                     AEFGRMLSQKLQQRRQAQQQQNQQQQQQQQQQQQQQQQQSLQQPGQAQSAQHGQQASA
                     AQGGSGPSGSMANPPSQPPATAPQAAAAQARTLPPHIVSHLNEIQFQAPPNVQDKAKW
                     LEEIKTKYARALWQMDNARSATKSIEQTLQENQALPPEERKKLEDRKAQLQKQYTDAI
                     SFANLVRKQYGIGGNQRTAQNGASVAANQQRPQTAGAQGAVQPGPGVNNGAPGAAPAN
                     SMQNSTAAVNAAIEAAKKQQLAAGRVPGAVNALPAQQGPHPQHQSQGPATPAQAQQSP
                     VTQAPPAQPISSQPQSQQPHQIQHPAAPVKVEPGTQAALPTPLNTAIAAAASVGGIPS
                     AGTPTQNSARLQTPQSATPTTANANIRPLTHAAAVNLASQRPGVIPAPPTTGPGSNQA
                     PGLGVIGAAQQQGHSHAHPPQPQPTPQANLQSKLPIPKVLHEKAAQMPTPVPNIGGIG
                     SAGRPTYSGGGGIGGGVMNQPALPKTPAYQLEGEGERILNKKKLDELVRQVCGGTAEG
                     QEGNLLTPEVEESVLSMADSFVDNVLHQACRNAKERGSKVLEIRDIQLVLERTYNIRI
                     PGYSSEELRTVRKIQPNSSWIKKMSAVQAAKVVPGKSDI"
     gene            complement(2557902..2559070)
                     /locus_tag="MYCTH_2308764"
                     /db_xref="GeneID:11511003"
     mRNA            complement(2557902..2559070)
                     /locus_tag="MYCTH_2308764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665195.1"
                     /db_xref="GeneID:11511003"
     CDS             complement(2557987..2558937)
                     /locus_tag="MYCTH_2308764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665243.1"
                     /db_xref="GeneID:11511003"
                     /db_xref="JGIDB:Spoth2_2308764"
                     /translation="MWPAATNSKISQNVGPSSPPETPRTASPVFGRKSSPRPEERSRK
                     VPLRPMAPPPSTGRTAVNGLDFSHPPSIRPEQLSPRSTSSSSEPLSESEDSEVSEASN
                     AAAGLSPSAATERRPAAAPPTPPARTGRVVTQSNFDVEELSDFDDNDNDRVDMVRPWA
                     IEYAESDRSRSTSRTRPEIDQKMMYNLNNLNCSDDSDISLNEEEYHEFLMKRRAERRH
                     KRMTSGSIGKRTISESIGSDTDREDIRSFLNAEQAGSSARRLRRRVGDRRSLQFQDPP
                     PPRIDELDEPGSSEDEIFIGESLARELPYYEYVSMEVDSP"
     gene            <2559444..>2560179
                     /locus_tag="MYCTH_2112126"
                     /db_xref="GeneID:11511004"
     mRNA            join(<2559444..2559476,2559754..2559992,2560101..>2560179)
                     /locus_tag="MYCTH_2112126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665196.1"
                     /db_xref="GeneID:11511004"
     CDS             join(2559444..2559476,2559754..2559992,2560101..2560179)
                     /locus_tag="MYCTH_2112126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665244.1"
                     /db_xref="GeneID:11511004"
                     /db_xref="JGIDB:Spoth2_2112126"
                     /translation="MAAKQWLVRALFCQSLAQCLGAGLSSPTNAAGGPAGKGARTVGQ
                     SLQEISLEPKPRWPDAVRRHSGSLGSNAPVPLTCPWTTTAASESCMGQTMVAVELSIV
                     SATAQRSRRKLVVL"
     gene            2561167..>2561951
                     /locus_tag="MYCTH_2144803"
                     /db_xref="GeneID:11511005"
     mRNA            join(2561167..2561249,2561339..>2561951)
                     /locus_tag="MYCTH_2144803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665197.1"
                     /db_xref="GeneID:11511005"
     CDS             join(2561185..2561249,2561339..>2561951)
                     /locus_tag="MYCTH_2144803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665245.1"
                     /db_xref="GeneID:11511005"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="JGIDB:Spoth2_2144803"
                     /translation="MSLLSAHLEQISISCRGIDSLPFPPPKIFTNALLSKPDITSLIR
                     DTEAHERALFSVPAPPPPTQQTASASASATAGRQNKAEAPNPSSRRKTVFNVTGGEVT
                     TGPPSSSSRGAGLAARRNTAVAAVLGGDLHAQIVRRGGQQHQPGQPGADVDIEVLLHG
                     AEKLCAVYALPGALERIPALRQKYAQQKATLAYYEGKVAEQQEALERMNLERALDEDE
                     GEGQEEEK"
     gene            complement(2562197..2563311)
                     /locus_tag="MYCTH_2315946"
                     /db_xref="GeneID:11511006"
     mRNA            complement(join(2562197..2562879,2562945..2563050,
                     2563136..2563311))
                     /locus_tag="MYCTH_2315946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665198.1"
                     /db_xref="GeneID:11511006"
     CDS             complement(join(2562232..2562879,2562945..2562992))
                     /locus_tag="MYCTH_2315946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665246.1"
                     /db_xref="GeneID:11511006"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="JGIDB:Spoth2_2315946"
                     /translation="MTNFNIKIVSDAICPWCYVGKKRLERAIELYKRDVPGGANDSFN
                     ISWHPFYLDPTLPKSGVDFNDHLAGKYGPERAAMIKAHLRAVGEAEGIKFSLQGRVGN
                     TRDAHRLIQLAKTKSGDVQDRVISTLFQSHFEEDADITSQSVLVAVGEKAGLDKNEVR
                     DWLNQGKGGEEVDREVEDAYRKGIHGVPNFTINGRYELNGAQDPQKFLEVFARAKKSS
                     PDVSIESSKGPSC"
     gene            2564438..2565934
                     /locus_tag="MYCTH_2308768"
                     /db_xref="GeneID:11511007"
     mRNA            join(2564438..2564702,2564817..2564885,2564951..2565278,
                     2565373..2565934)
                     /locus_tag="MYCTH_2308768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665199.1"
                     /db_xref="GeneID:11511007"
     CDS             join(2564672..2564702,2564817..2564885,2564951..2565278,
                     2565373..2565745)
                     /locus_tag="MYCTH_2308768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665247.1"
                     /db_xref="GeneID:11511007"
                     /db_xref="JGIDB:Spoth2_2308768"
                     /translation="MATRFQLGWYRWVPFLGYHHVLMILIAVAIILLSLLLAGCSSSS
                     PLIPDIFLLSLYYMRYTATPDTAQVDYNVHNAIADIVGDARLQARVGFFGICVSPDGG
                     SWLCSNNATTLANEVSLDQDPLNLIWLASQFKDMIVFPYLLIIAIIFAFICLLLLATF
                     PGWHEEEDSEGSEREVKPFPSRPVSQVALAIIFISSIFVLVSVLWQHTASVAASIIAQ
                     DLANGSVRSGVGTSAMVMGWFSFTLLIIVTIGLLVMILSMQVLEHIMD"
     gene            complement(2566604..2570159)
                     /locus_tag="MYCTH_2308771"
                     /db_xref="GeneID:11511008"
     mRNA            complement(join(2566604..2567272,2567407..2570159))
                     /locus_tag="MYCTH_2308771"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003665200.1"
                     /db_xref="GeneID:11511008"
     CDS             complement(join(2566966..2567272,2567407..2569796))
                     /locus_tag="MYCTH_2308771"
                     /note="CAZy_ID 267963"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003665248.1"
                     /db_xref="GeneID:11511008"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Spoth2_2308771"
                     /translation="MFRPRRHRVVLICAFVITVLLYHVSKNSQWDQPRETWRGKTSPN
                     THPRPEPLPPPPPAPNPHQGPPPHVPPPHDPPPRASPLPDPEPIRIPQLKEADEEQGT
                     YGLPTEPAAVVPERKPPTHHDGYHDAQAEDVGVLDPATPTSAVVHWQKPYEWFPVPEE
                     SLIPLPTGNPKPIPSVQVSFAQESPAAKEKREQRLAKVRAEALHAWTGYKKYAWNHDE
                     LMPVSNRSRDPFCGWAATLVDSLDTLWIMGLKDEFDEAVDAVRGIDFTTTPYREEIPV
                     FETIIRYLGGLLGAYDVTGNDPRYRVLLDKAVELAEILMGVFDTPNRLPILFYNWKPD
                     YAERPKRASTSASVAELGSMSMEFTRLAQLTGQNKYYDAIARITDAFEDLQNRENGTA
                     IPGIFPERLDASGCNRTAPPPSSSSATPAGGAATVQHGTDDLKRALAGHHEAQSPEGS
                     ALGTGIGSITTEFYGGPQKRTDGPRGGDQTSLNAKELPPNWDCAAQPLTGTSWGTGSY
                     SMGGSQDSTYEYFPKQYLMLGGLEPKYRTMHEKTVDAVKEYLLFRPMAEGDPDILFSA
                     KAYSSDGTADKLTYEWEVTHLTCFLGGMFGLGGKIFDRPEDVEIAKKLADGCVWAYEV
                     MPAGVMPEYARVLPCKSRDDCHYDQAAWYTALDPRAEQREAEMEEYYTQLAEWKEQVE
                     KLKKEDALRKQAEEPAREVESQSKPAAETAQYGDSGDFPAEPTENDKNKSPDGFNFRS
                     DNQGISNNQQPMRSDKLVFPPAPMKPVTHKEYVAQRIENERIPPGFVTLTDKRYLLRP
                     EAIESVWYMYRITGDPSWQEKGWRMFEAVIGATRTEAGHSAIRDVTTKDPGNAKDMED
                     NMESFWLAETLKYFYLLFETPDVISLDNWVLNTEAHPFKRPT"
     gene            complement(2571561..2576822)
                     /locus_tag="MYCTH_2308773"
                     /db_xref="GeneID:11511009"
     mRNA            complement(join(2571561..2571691,2571793..2573674,
                     2573921..2576822))
                     /locus_tag="MYCTH_2308773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665201.1"
                     /db_xref="GeneID:11511009"
     CDS             complement(join(2571571..2571691,2571793..2573674,
                     2573921..2576651))
                     /locus_tag="MYCTH_2308773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665249.1"
                     /db_xref="GeneID:11511009"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308773"
                     /translation="MYQNGQRDTRPFQVPPPPPPMSPPPPVGISNMMAIPPPPPRYPS
                     APTTGGNVLLPPPPGPPPNTTFPSSAIGPPSALGNAPWHGQWGRAYDGRTAFNVPPPP
                     PVVGNTGLQAYNPMSHAQTHAQAIAAANSTTMSSGQTNLTVPPPPPPSEQMSATYIPT
                     KDTYGEGVGIPGLWIPDDGTHSGQTGMDSAAATPLEETSGRDGLYAAAMGAKARPNTS
                     GGTSSVPAELAAQWPLERVLAWLRANNFSKDWQETFELLDIHGAKFLELGSSHGGRGN
                     FGMMHQQVYPMLARVCPKNGGVWDQPREREEGKRMRRLIRSVVTGRPPDPSMVMASHA
                     RKASSSAVGVPSTANESAESPNTPIKAPGPGFSGRRFSQSRSATMPTSNNTMSSDSSN
                     HRSLMKNIDTAIARRHSPNPSESGEVGSLRESNLLGRDSPGGSPVPQSGLLPPSSTAG
                     NVSASPHRSSFGHRSRNSTDSISSNAAIYGSGVPPDAAALLKNGVSLGDLVNAPRGSD
                     EHGQRSGQDGNRHSPQDTGDRSAGTDPPGSAKGSSFFSSIFKGLKKPDDHDSPTSPSV
                     CKYCRHSNAGENSQERPASKRAGSGRVLILATADCWNYRMVDVTDVGTPSELRQLICI
                     NLGLPSSDGAQIYLTELGRFEHDEEPLDDAKLLSTKTHVGDSVGSLKFFVRPSMFQNG
                     SPATTSFGNGPVAVEEGDVNAKDGRQRSGSSAATSKQEPLEGRERDDKMLTAEAIQYR
                     AEQLRKQEEYLAKRRQMIDAKESSPSAETPYGIVGRTVNFDVPRVSPYEDRKVDTLFP
                     QRKAPAPPENPSATLLRAESRRKNHGTRLSQDSNTSGGRPKRASSDLREEVAFEKQRK
                     RPGMPNPEDGIHGLLVGMGERMAGIGRPTPSGHRGLSPHRVSSMPVTNTEANAQARVP
                     SPGDVSPSSREPSHALATTTSEKRKSHGPDTDFQGNDVRFSQASTLHENSNENRNAAG
                     DDSGDDSDDGLFAVPLSARNNATSRKTGASAEGGESDGSGKRPSLRVNTKRSRKAVSV
                     AFQSPQSSGDSKTPADGEEDGANGRSSQIDDPEVKLSRRKSFIEKDVWANRPPTDALI
                     NNLEDFFPNVDVDQPVLEDGEGPSPIDEADESEQQNAGASSSVPPIPPLPAGLASGAG
                     RAGSTYNESDTLGSDESTLKALDSRPTSMQTLAGRSVRRSGGLGRMKSIREVARGAHE
                     ASKRYTQASGPLNSRAGTGPGDRNTNLMRRKSTKMFNANIVQIQPERGSLNMALSQST
                     IPQDNLPTQQGNRDNIPKRQTTFRWFKGQLIGKGTFGRVYLGMNATTGEFLAVKEVEV
                     NPKAAQGDQKKMQELVAALNREIDTMQHLDHVNIVQYLGCERKERSISIFLEYISGGS
                     IGSCLRKHGKFEEPVVASLTRQTLSGLAYLHREGILHRDLKADNILLDLDGTCKISDF
                     GISKKTDNIYGNDKTNSMQGSVFWMAPEVVRSQGEGYSAKVDIWSTGCVVLEMFAGRR
                     PWSKDEAVGAIYKIANGETPPIPDDIREEISPIAIAFMLDCFTVDPTDRPTADVLLSQ
                     HPFCEHDPNYSFYDTELYAKIRHAL"
     gene            complement(<2578042..>2580416)
                     /locus_tag="MYCTH_55232"
                     /db_xref="GeneID:11511010"
     mRNA            complement(join(<2578042..2579952,2580033..>2580416))
                     /locus_tag="MYCTH_55232"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665202.1"
                     /db_xref="GeneID:11511010"
     CDS             complement(join(2578042..2579952,2580033..2580416))
                     /locus_tag="MYCTH_55232"
                     /note="CAZy_ID 267776"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003665250.1"
                     /db_xref="GeneID:11511010"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_55232"
                     /translation="MTNLRLTIEDGKFRDGYGRQVLLRGINVAGEAKYPSKPNQPSHV
                     PEDFFDGDNVSFVGRPFSKEEAHLHFSRLKRCGYNTIRYVFTWEAIEAAGPGIYDEAW
                     IDETIEVLRAAKSYGFYVFMDPHQDVWSRFSGGSGAPMWTLYAAGLNPQSFAATEAAI
                     VHNTYPEPDAFPKMIWSTNYYRLAAATMFTLFFAGRDFAPRCIIDGVNIQDYLQGHFL
                     RACAHLAQRIHEAGDIENDVVFGWESLNEPNKGMIGYQDISVIPKEQALKKGTCPTIW
                     QTMLTGSGRAVEVETWDMGGLGPYRVGRTLVDPHGEVAWLPEGYDESRYGYKRDPGWK
                     LGECIWAQHGVWDPSTDTLLRKDYFAKHPATGETIDYSYFTNTYFMDFFRKYRDTVRS
                     VHKNAIILLQGPTMELPPLIKDTPDGDDPFLVYSPHWYDGITLMTKKWNRNWNVDVIG
                     VLRGRYWHPALAVKLGETAIRNCFRDQHAAMRKEGLDRMGNHPCLMTEFGIPYDMDDK
                     YAYKTGDYSSQSAAMDANHFGVEAAGLEGYTLWLYMASNDHEKGDQWNGEDLSIVSVD
                     DKLLPLSAHPRIPSLEDSTSNLRTPAARKELDDDESVTPANLRRSITNPSISLEATSR
                     QPELTASPGYRAAEAYVRPAPVATAGVITDYGFDLRKCLFTLTIQAPRVADPEAPTVV
                     FLPEYHFPKDECSVEVSSGKWEISSDEEETVLIQRLRWWHGDGQQTLRVSGVIKKHNI
                     GESAEDTGYYEQCNQGAWSSCTAM"
     gene            2580940..2583794
                     /locus_tag="MYCTH_2315948"
                     /db_xref="GeneID:11511011"
     mRNA            join(2580940..2581451,2581503..2581694,2581748..2582191,
                     2582260..2583794)
                     /locus_tag="MYCTH_2315948"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665203.1"
                     /db_xref="GeneID:11511011"
     CDS             join(2581198..2581451,2581503..2581694,2581748..2582191,
                     2582260..2582923)
                     /locus_tag="MYCTH_2315948"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665251.1"
                     /db_xref="GeneID:11511011"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="JGIDB:Spoth2_2315948"
                     /translation="MTTAIEEDTVMVEAGEVQGVADPASMQAVEKSLAQPADDEDMGV
                     EIKQESKAEVKLEDLFDGIDSDDDEFPTSSNHLNSQEPGHAENNAQDTSIELLRIYYQ
                     RFFPWRYMFQWLNHSPVPTKDFKHREFSLWLHNDAVLRYQSFSTSDLFRKDVLRLMPR
                     RIEIGPVYTADPRDRKTFRTASAFQPIAKELCFDIDLTDYDDIRTCCDMANICHKCWK
                     FMIMAIKVIDTALREDFGYNHILWVYSGRRGVHAWVCDKQARTLEDKHRKAIAAYLEV
                     VTGKQGGKRVNLRRPLHPHLSRSIDILKDHFQKDVLETQDPWRSPERAENLLQQIPDH
                     QLREALRKKWESSPGRSSTARWADIDALAQTNASAALDPKELLDAKQDIVIEYTYPRL
                     DTAVSQKLNHLLKSPFVIHPGTGRVCVPIDMNNLDGFDPLNVPTLQRLVTEIDAWTEA
                     DGAAMGGSGGSSQEVKPVQDWEKTSLKPYIEYFRSFVTALMKDEREPGVKREREEDEV
                     QVKVESLDF"
     gene            2584935..2587932
                     /locus_tag="MYCTH_2308779"
                     /db_xref="GeneID:11511012"
     mRNA            join(2584935..2585116,2585174..2587932)
                     /locus_tag="MYCTH_2308779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665204.1"
                     /db_xref="GeneID:11511012"
     CDS             2585243..2587864
                     /locus_tag="MYCTH_2308779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665252.1"
                     /db_xref="GeneID:11511012"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="JGIDB:Spoth2_2308779"
                     /translation="MTVTVFRQFLREALYKLGKRVEIWASPNGRMNWKIVKQASPGNL
                     QDVEEDLGSLSEAAPIILAVKISTKASEARSVGVCFADASVRELGVSEFLDNDLYSNF
                     EALLIQLGVKECLIHMEKADKEKDPELAKLRQIIDNCGIAISERPAADFGTKDIEQDL
                     ARLLKDERSATLLPQTDLKLAMGAASALIKYLGVLHDPSNFGQYQLYQHDLAQFMKLD
                     AAALKALNLMPSARDGAKTMSLFGLLNHCRTPLGSRLLAQWLKQPLMDKSEIEKRQQL
                     VEAFVNDTELRQTMQEEHLRAIPDLYRLAKRFQRKKANLEDVVRVYQVAIRLPGFLGT
                     LEGVMDETYRDPLDEAYTNQLRGLSDSLAKLQEMVETTVDLDALDNHEFIIKPEFDDS
                     LRIIRKKLDKLRTDMNREFADVASDLGQERDKKIFLENHKVHGWCMRLTRTEAGCIRN
                     KSRYMECSTQKNGVYFTTKTLQGYRREFDQLSQTYNRTQSGLVNEVVGVAASYTPVLE
                     RLAGILAHLDVIVSFAHCSVHAPISYVRPKIHPRGEGQTILTEARHPCLEMQDDVQFI
                     TNDVELTRDKSSFLVITGPNMGGKSTYIRQIGVIALMAQIGCFVPCSTAELTIFDSIL
                     ARVGASDSQLKGVSTFMAEMLETANILKSATAESLIIIDELGRGTSTYDGFGLAWAIS
                     EHIVKEIGCFALFATHFHELTALADQYPQVRNLHVTAHISGTDSSSSKKKTGTEKREV
                     TLLYKVEPGVCDQSFGIHVAELVRFPDKVVRMAKRKADELEDFTSAKQDGDGKTAATP
                     TTTTTTTTAVLAGAEYSKRDVEEGSALLKDLLVRWKDEVRAGSMSKAEMVARLREMVG
                     KDEKLLANPFFQSVRAL"
     gene            complement(2588627..2592837)
                     /locus_tag="MYCTH_2308782"
                     /db_xref="GeneID:11511013"
     mRNA            complement(join(2588627..2590504,2590563..2591007,
                     2591063..2592567,2592631..2592837))
                     /locus_tag="MYCTH_2308782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665205.1"
                     /db_xref="GeneID:11511013"
     CDS             complement(join(2588700..2590504,2590563..2591007,
                     2591063..2592220))
                     /locus_tag="MYCTH_2308782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665253.1"
                     /db_xref="GeneID:11511013"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2308782"
                     /translation="MSRPSTQSSVLGRFRYVCTLCGIVVSLDISLPRLRPEWLKMISD
                     EDRIRKSLKAAREEDPQRYADVGTEKETHYRTTALHTLNQYIKNILEESGTGPRKRIS
                     FRNKTFQVQFGRDCDEIFRYLGFEEDHDANTNESYWIPPRLPPPEGKTPIGSSRAFYE
                     DVRSEVQSVFAGKPPAQGEPTVMPVSPAPRDELEKVLGCDKSRRCFSTLPVIENEARH
                     FATLGAPVDADDALLKFAYSRQAELDPENTSTYLEALGTLAGRRSEELQMFVFTHQEL
                     LARQQKEAAAGGPNASPVEKAYAHFGLTKSCPEDPAFFIGVYRTYRDQSPAQKSDHRL
                     ALLQIANDRQSDEIRNEVFGKPMDLQEACQFLRVEPGWPMDSIAVMAQSISSDSDMDQ
                     LDLLLLALDAISLSRGTDDPNRPEFESVLAELRSIRRSQLTSSGTEHVGAAVSASDHA
                     SDAVDLELPVGLANLRNTCYLNSILQYFYSVNAVRDLALNTDFPALEPTEANLSNLLR
                     TDSSSNTGHDQRRTDLETGRAFVGHEFARELSTLFRSLNASAENSITPRQRLANAALL
                     RPEKLRPQSADPTAVPGASNDDAPPLPPRIAKGAVTEAKDTPMAGVEQSDAASSGSSE
                     TLVDQSSGESPLIFALEEEDLKEKAAAAAVTSAAGGSNRPASEPQTISRTSEPEVKMS
                     KLTVEELAVELDKPNVGSDQMDVDEVMGNAIDHLRAAFKVSTVGNSAAPPDPIEQAFF
                     STFIDNRKKIGDSEWNRTTRSDRWVTAYPAQSGTLDLYDALANSFDIEPLPGNLLSFT
                     TIERPAPHFHVCIQRSDGVRKNSNPITIPETLYLDRFMHTAETQSSLFKRRKRKWDIK
                     TRLSEMVTPAKKRLETAKQQSQIGGRPSKAGAQDDGLTEEEIDGFLVLGGLDTRYQIP
                     SSSMVDGVGVSNDEPETQSFFALDPDLKRLANKYGVEEPDLSLTVAADPPPKSDATTT
                     FPPSDLDEFWERFAAEEAEEKERLITERDRLFSDAQNVAYRLHAVVCHAGSSASAGHY
                     WVWIHDFERDVWRKYNDTTVSVHPAEFVFGELNTKGEPYYLAYVKADEVQNLVSIPRR
                     QPQAPPPVPPRPRSSLGAVKADGEDNVMASIEHWEDVEMLPPPYSNP"
     gene            2593904..2595074
                     /locus_tag="MYCTH_2308783"
                     /db_xref="GeneID:11511014"
     mRNA            join(2593904..2594213,2594274..2594393,2594482..2594676,
                     2594748..2595074)
                     /locus_tag="MYCTH_2308783"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665206.1"
                     /db_xref="GeneID:11511014"
     CDS             join(2594033..2594213,2594274..2594393,2594482..2594676,
                     2594748..2594848)
                     /locus_tag="MYCTH_2308783"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665254.1"
                     /db_xref="GeneID:11511014"
                     /db_xref="JGIDB:Spoth2_2308783"
                     /translation="MAPTGDDGYHPKDAIHESINQGLMFGGAGLLFAAVKNSLAKNNI
                     GPWTTFTRNGGIIASFAAAGAAFEFTRCASANLREKDDYWNHAVGGFFAGAAVGVRTG
                     RMPRVLGYGALASVALAAFEYTGGTLKGYLNRHDEDEYERKEMIRKNRRRPIEETLAE
                     IGEGRGIKPPGYEERRRERIKEKYGIEIQTVSADPDAA"
     gene            complement(2596053..2598289)
                     /locus_tag="MYCTH_2308787"
                     /db_xref="GeneID:11511015"
     mRNA            complement(join(2596053..2597611,2597684..2597970,
                     2598039..2598289))
                     /locus_tag="MYCTH_2308787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665207.1"
                     /db_xref="GeneID:11511015"
     CDS             complement(join(2596376..2597611,2597684..2597970,
                     2598039..2598153))
                     /locus_tag="MYCTH_2308787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665255.1"
                     /db_xref="GeneID:11511015"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Spoth2_2308787"
                     /translation="MSKTFTQSDVASHNKADSLWIVIDGDVYDLTKFQDDHPGGKKIL
                     QRVAGKDASKQFWKYHNEGILKKYQKQLQIGSLDTKPKPAAPPAPAPTPKKAAPKPKA
                     AAAAAAAPAEEAEALEPFGLQIPFADPSWYQGHHSPYFNETHAALRAEVREWIETEIE
                     PHITEWDEKKEVPAEIYKEMGRRGYLAGLLGTHYQKDYVQNPIKSVPPEKWDLFHEML
                     LTDELSRTGSGGFVWNVIGGFGIGCPPLVKFGKKSLVDRILPGILNGDKRICLAITEP
                     DAGSDVANLTCEAKLSEDGKYYIVNGEKKWITNGIWADYFTTAVRTGGPGMNGVSLLL
                     IERDFGGVSTRRMDCQGVWSSGTTYITFEDVKVPVENLIGKENQGFRVIMTNFNHERI
                     GIIIQCLRFSRVCFEESVKYANKRKTFGKKLIDHPVIRLKLAHMARQIEASYNWLENI
                     IYQCQKMGETEAMLRLGGPIAGLKAQATVTFEFCAREASQIFGGLSYSRGGQGGKVER
                     LYRDVRAYAIPGGSEEIMLDLSIRQSMRVAKMLGMKL"
     gene            complement(2599425..2601127)
                     /locus_tag="MYCTH_2308790"
                     /db_xref="GeneID:11511016"
     mRNA            complement(join(2599425..2600080,2600214..2600775,
                     2600831..2600835,2600885..2601127))
                     /locus_tag="MYCTH_2308790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665208.1"
                     /db_xref="GeneID:11511016"
     CDS             complement(join(2599559..2600080,2600214..2600775,
                     2600831..2600835,2600885..2600983))
                     /locus_tag="MYCTH_2308790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665256.1"
                     /db_xref="GeneID:11511016"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="JGIDB:Spoth2_2308790"
                     /translation="MGIKQLFSIIKEEAPDAIKEGDIKNQFGRKVAIDASMSIYSFLI
                     AVRSDGQQLMNESGETTSHLMGMFYRTLRMVDNGIKPLYVFDGAPPKLKSGELARRFQ
                     RKQEATEGLEEAKETGTSEDVEKFSRRTVRVTKEHNAECQRLLKLMGVPYIVAPTEAE
                     AQCAVLARAGKVYAAASEDMDTLCFDAPILLRHLTFSEQRKEPIQEIHVSKVLEGLNM
                     DRKQFVDLCILLGCDYLDPIPKVGPSTALKLIREHGSLEKVVEFMKNDPKGRYTVPDD
                     WPFEDARELFFSPDVRQADDPLCDFKWEKPDIEGLVQFLVHEKGFSEDRVRAGGARLE
                     KNLKSSQQSRIEGFFKVLPKTEEEKAAHKRKLEEQNEAKKKKLKEEKKEKAKSKAKPR
                     GAV"
     gene            complement(<2602032..>2603904)
                     /locus_tag="MYCTH_2066622"
                     /db_xref="GeneID:11511017"
     mRNA            complement(join(<2602032..2602065,2602123..2603640,
                     2603705..>2603904))
                     /locus_tag="MYCTH_2066622"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665209.1"
                     /db_xref="GeneID:11511017"
     CDS             complement(join(2602032..2602065,2602123..2603640,
                     2603705..2603904))
                     /locus_tag="MYCTH_2066622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665257.1"
                     /db_xref="GeneID:11511017"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Spoth2_2066622"
                     /translation="MASYGGYGGSGGGNWGSGGSTKPSERSRWTPLTRMLLSGEMTQE
                     KQKELTPREKFDRWMVNEGYRRIFVFVFMLLHATVFAFGFVHYSLKDSLQVARDTFGP
                     TFMIARSSALVLHVDVALILFPVCRTLISLARQTPLNGIIQFDKNITFHITTAWSIFF
                     FSWVHTIAHWNNFAQIAAKNNLGFYGFLLANLVSGPGWTGYVMLIALTGMVITSVEKT
                     RRANYERFWYTHHMFIVFFFFWSIHGAFCMIQSDFAPFCVSTGASAIGVFWQYWMYGG
                     FAYLAERIAREIRGRHKTYIAKVIQHPSNVCEIQIKKENTKTRAGQYIFFCCPAVSLW
                     QYHPFTLTSAPEEDYISIHMRVVGDFTRAVAETLGCEFDKKKSDSSKVVGVDQDNNEV
                     DPALRRVLPRVYIDGPFGSASEDVFKYEISILCGAGIGVTPFASILKSIWYRMNYPQK
                     KTRLSKVYFFWICRDFGSFEWFRSLLLAIEAQDVDNRIEIHTYLTAKIKVDDATNIMI
                     NDANADKDTITGLRSPTNFGRPNWDMIFRGIRKLHSPSEAGVFFCGPKGLGSTLHILC
                     NKYSEPGFNFVWGKENF"
     gene            complement(2606757..2608532)
                     /locus_tag="MYCTH_2308798"
                     /db_xref="GeneID:11511018"
     mRNA            complement(join(2606757..2607543,2607613..2607796,
                     2607869..2607898,2608017..2608062,2608289..2608532))
                     /locus_tag="MYCTH_2308798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665210.1"
                     /db_xref="GeneID:11511018"
     CDS             complement(join(2607404..2607543,2607613..2607796,
                     2607869..2607898,2608017..2608062,2608289..2608332))
                     /locus_tag="MYCTH_2308798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665258.1"
                     /db_xref="GeneID:11511018"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2308798"
                     /translation="MALKRINKELTDLGRDPPSSCSAGPSGEDLFHWQATIMGPADSP
                     YAGGVFFLQIQFPTDYPFKPPKVQFNTRIYHPNINANGSICLDILRDQWSPALTISKV
                     LLSICSMLTDPNPDDPLVPEIAHVYKTDRAKYEQTAREWTRKYAV"
     gene            complement(2609477..2611084)
                     /locus_tag="MYCTH_2308801"
                     /db_xref="GeneID:11511019"
     mRNA            complement(join(2609477..2609534,2609591..2610616,
                     2610691..2611084))
                     /locus_tag="MYCTH_2308801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665211.1"
                     /db_xref="GeneID:11511019"
     CDS             complement(join(2609488..2609534,2609591..2610616,
                     2610691..2610904))
                     /locus_tag="MYCTH_2308801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665259.1"
                     /db_xref="GeneID:11511019"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Spoth2_2308801"
                     /translation="MSRLLLRRLPTRALVHRPSHAVRTYASSTPAVPQFNWEDPLGSR
                     NLLTEEELAISETAERYCQEHLLPRVLQAYRDEHYDPKILQEMGELGLLGATINGYGC
                     AGVSTVAGALITRAVERVDSGYRSSMSVQSSLVMGAINDFGSAEQKDKYLPAMAKGKI
                     IGAFGLTEPNHGSDPGSMEAVAREHPQKKGYYLLKGSKTWITNSPIADVLVVWAKLQE
                     TGKIRGFLVDRKQCPAGTLETPAIKNKTGLRASITGMIHLEDCPVPKENMFPDIEGLK
                     GPFTCLNSARYGIALGVIGALEDCIARARAYALERKQFKGNPLAKYQLIQKKLADATT
                     DAAYGTLAAIQVGRLKDEGKATPEMISMIKRQNCDRALHNARVLQEIFGGNAVSDEYM
                     IGRHVANLYVTQTYEGQSDIHSLILGRAITGVQAFV"
     gene            complement(<2611429..2612651)
                     /locus_tag="MYCTH_2135222"
                     /db_xref="GeneID:11511020"
     mRNA            complement(join(<2611429..2611439,2611495..2611883,
                     2612024..2612651))
                     /locus_tag="MYCTH_2135222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665212.1"
                     /db_xref="GeneID:11511020"
     CDS             complement(join(2611429..2611439,2611495..2611883,
                     2612024..2612274))
                     /locus_tag="MYCTH_2135222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665260.1"
                     /db_xref="GeneID:11511020"
                     /db_xref="JGIDB:Spoth2_2135222"
                     /translation="MARRRRPPRPGALSELPPLKILSQIAALQGLYYAVALILMLFTV
                     LIAGTKFSLDLVFGWDAVRGDTTQGWLMGFVWVLDGGLAMAVAIVILVGRSKLVLDFA
                     LSLHAIHLVVVTLYSGQLPRHKGWWLAMAVASAVSVTLATWGCRYRQLQPISFGGGGA
                     ASTAGGTGGNNGDGGESGADGHEEEAGFTRGRGRGRGRGGAGEYEMVNLPADTVFK"
     gene            2612818..2613760
                     /locus_tag="MYCTH_2308806"
                     /db_xref="GeneID:11511021"
     mRNA            join(2612818..2613363,2613536..2613760)
                     /locus_tag="MYCTH_2308806"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665213.1"
                     /db_xref="GeneID:11511021"
     CDS             join(2613127..2613363,2613536..2613655)
                     /locus_tag="MYCTH_2308806"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665261.1"
                     /db_xref="GeneID:11511021"
                     /db_xref="JGIDB:Spoth2_2308806"
                     /translation="MGLFNIFSPSEEEKRAAEVRTGAVAPTRAERQKCWAARDAYFAC
                     LDAHNIVDAIKDDKKAAAACGGEGAQFEKDCAAQWVTYFKKWRVQDIQKKARLKELEA
                     QGANKMDVQTEFAPRR"
     gene            complement(2614459..2617819)
                     /locus_tag="MYCTH_2308809"
                     /db_xref="GeneID:11511022"
     mRNA            complement(join(2614459..2615458,2615533..2617819))
                     /locus_tag="MYCTH_2308809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665214.1"
                     /db_xref="GeneID:11511022"
     CDS             complement(join(2614598..2615458,2615533..2617653))
                     /locus_tag="MYCTH_2308809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665262.1"
                     /db_xref="GeneID:11511022"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="JGIDB:Spoth2_2308809"
                     /translation="MPSFVSDANTAIDSQSSGVVHLDRAVEYGLTQPKAHGQMVRQPH
                     SHTSNESFGGSSANSTTSSSTSETSIEPDQRAAKDSSGPRSMSSSRNGPSGGEPNGVA
                     GVESASRRSLQSTHSATLVDRTVPNSGNRGAGDDLQGRKLSDGIPRATPENGNPQSLP
                     SVEVHLHPAGKGDVRTVDGGPSSPSVPAASPPAPGASAASSQRNQKSPHRYSSPPIYD
                     QPNSSGQLQSPPTPGIKHRHTLEVPKTSSARGSRDGFDTAYSSGRFSPTITPSGGRRA
                     SLSLARRNTRSLHSDGPRDEVIPDEDAMRWAEAYRQKRASKRRRRELEDDDRVLVGTK
                     VDETHANWVTAYNMLTGIRVAVSRTNAKLDRPLTDADFDVKQKSTFDIAGNELVPSAK
                     YDFKFKDYAPWVFRHLRALFRLDPADYLMSLTGKYILSELGSPGKSGSFFYFSRDYKY
                     IIKTIHHAEHKFLRRILKDYYQHVKENPNTLLSQFYGLHRVKMPYGRKIHFVVMNNLF
                     PPHRDIHQTFDLKGSTIGRDYKEEDLEHNPRATLKDLNWLRRKRNLELGLQKRQLFLE
                     QLYKDVRLLQRLQIMDYSLLIGIHDLQRGNEENLRDKTLRVFNPGGSNSASEDFDPHS
                     VLMRTPSKLENQRKARELRQMIQSEKPVPMGETSSRMPDELEEGQGRPGFIFNQDDGG
                     FRATHEDNAPADEIYYLGVIDCLTHYGIVKKIEHFWKGLSSDRSQISALPPQEYGERF
                     INFISSMTMSREEASRAAQERDAALAAESAAAVPPVPSRGPPLPPTSSPPGQTRAAQQ
                     TRAWEGAGTEEDVPERVLRTTITAPTSNNAGPGKSSQNGSPSATERRETTILPVVEEA
                     AEGTSTGDRSRNSHVSSLTTESEGRPLTPAKEGDELAPGFANPLLGSRSGSKGSSNMN
                     ARPPPTPPKTGHGYTGQAKPNSADSGYGIGSGNGSNGGPRSLGGSQKSLSIPQQLSRE
                     SLDKALPPLPKAGSARAQSTS"
     gene            complement(2619475..2621597)
                     /locus_tag="MYCTH_2308812"
                     /db_xref="GeneID:11511023"
     mRNA            complement(join(2619475..2620894,2620956..2621597))
                     /locus_tag="MYCTH_2308812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665215.1"
                     /db_xref="GeneID:11511023"
     CDS             complement(join(2619626..2620894,2620956..2621477))
                     /locus_tag="MYCTH_2308812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665263.1"
                     /db_xref="GeneID:11511023"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Spoth2_2308812"
                     /translation="MTVPTPSHDEPVVVLASTRTVITLPDDSLVLTPATIIISPATGK
                     ILSVVSQVLPQSSFPPETLYHDYSPKLLLPGLVDAHVHLNEPGRTEWEGFNTGTQAAA
                     SGGVTTVIDMPLNAIPPTTTLKGFQEKLAASQGQCWVDVGFYGGVIPGNAHELLPLVE
                     AGVRGFKGFLIDSGVEEFPAVSPSDIALAMKTLNGTPTTLMFHAEMVPPAAAPEGDAA
                     QQSEAPAQPAGEPGSYGTFLDSRPPVFETTAVEQILSLAHLAPQLHLHIVHLSAAECV
                     PVLRKARQDGINITAETCFHYLGLASDDIPDGDTRHKCCPPIRAQTNQDKLWDEITDA
                     DGCIKTIVSDHSPCTPELKLLPPHLQTAYQEGPRPAVRHADSGIEVPQLGGEQGIGGG
                     GAKKERRREKEAKAELRARGREKEKEDEDEDAVDLLPGAQTPGAATTAAAAEGSPAAC
                     AAEAKEQGDFLAAWGGISSVGLGLPILHTTAAERAARGDRAPSVVDIVRMCSQATARQ
                     VGLAHRKGGLRAGMDADVCVFDDADVWTLRAAEMRWKNRVSPWEGHTFTGRVRETWVR
                     GQRVFQLGGPNSGFVMGRPVGQPIVERRTE"
     gene            complement(<2623641..>2625084)
                     /locus_tag="MYCTH_103379"
                     /db_xref="GeneID:11511024"
     mRNA            complement(join(<2623641..2623690,2623771..2623940,
                     2624029..2624063,2624158..2624264,2624388..>2625084))
                     /locus_tag="MYCTH_103379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665216.1"
                     /db_xref="GeneID:11511024"
     CDS             complement(join(2623641..2623690,2623771..2623940,
                     2624029..2624063,2624158..2624264,2624388..2625084))
                     /locus_tag="MYCTH_103379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665264.1"
                     /db_xref="GeneID:11511024"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="JGIDB:Spoth2_103379"
                     /translation="MARQSLQLELAERPTGAIVPGRTFRQRRVPAPTEADLREGELLL
                     ECLYVSFDPAMRGWLDDRRSYVPPVRIGEVMRAATIARVLASRSARARPGDIVTALMG
                     IREVGIVSEDKVEPAPPGFARAGAGARVTDLLGVFGLTGMTAYFGMLRIGEPKPGETV
                     VVSAAAGATGSVAAQIAKIAGARVVGIAGSDEKCRWLTEELGLDVALNYKDPDFKAKF
                     KKATPNFIDVFFDNVGGEQLDMALGRANAFARFVMCGGISQYNAENKSGPKNFNSVIS
                     QRIKMQGFIVFDFAKEYPAAREQIGRWLAEGKLKRRETIIKGGVAASEEAFKQLFEGG
                     NIGKLLVEVKNPDEVARL"
     gene            complement(2626265..2628131)
                     /locus_tag="MYCTH_2308814"
                     /db_xref="GeneID:11511025"
     mRNA            complement(join(2626265..2626547,2626640..2628131))
                     /locus_tag="MYCTH_2308814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665217.1"
                     /db_xref="GeneID:11511025"
     CDS             complement(join(2626386..2626547,2626640..2627848))
                     /locus_tag="MYCTH_2308814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665265.1"
                     /db_xref="GeneID:11511025"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="JGIDB:Spoth2_2308814"
                     /translation="MQLGAGVSVVRGAGSATRVGRVARIRRPTCAECLGAVSLDGRSP
                     QSRVLFHSGRPRPSAWAAAVSVAGNIVSNAVTRATKGDLPTIDPLRIVAKEMKFLTGN
                     IRKLLGSGHPSLDRAAKYYTQSEGKHIRPLIVLLMSRATSLCPKAPHRQQATLQASAA
                     IDTSISPLSILADYNPSAGAESEPVLADADGILPSQRRLAEITELIHTASLLHDDVID
                     HSVSRRGAPSANLEFGNKMAVLAGDFLLGRASVALARLRHAEVIELLATVIANLVEGE
                     FMQLKNTARDETNPQWSEDTLTYYLQKTYLKTASLISKSCRAAALLGGADAQTVDAAY
                     NYGKNLGLAFQLVDDMLDYTRSEKELGKPAGADLELGLATAPLLFAWKTIPELGALVG
                     RKFSQEGDVERARNLVMQSDGIEQTRALAQDYADKAIASLSLFPESEAKDGLVEMAVK
                     TLQRKK"
     gene            2628148..2629221
                     /locus_tag="MYCTH_2308817"
                     /db_xref="GeneID:11511026"
     mRNA            join(2628148..2628569,2628629..2629221)
                     /locus_tag="MYCTH_2308817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665218.1"
                     /db_xref="GeneID:11511026"
     CDS             join(2628330..2628569,2628629..2629195)
                     /locus_tag="MYCTH_2308817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665266.1"
                     /db_xref="GeneID:11511026"
                     /db_xref="JGIDB:Spoth2_2308817"
                     /translation="MTPSIVAGLQALSKAATATLVQNEPEPSLGAPAVGNPVSHSQIV
                     NLWKALKEAGHGEYTLETLLKGSKIYVLPPPPKPEPSNEYKELMARLRREQDQREYER
                     MTNPLPPMGTFSQRYVNGASMAQSFAAVNRPSNQADMGDDDVTYGDVHRQLMLILNFV
                     ASILGVAATLWIAARWWSTPARLFLTMAGSLVVGIAEVAVYSGYIWHLSQAKKKDKTI
                     NEVKEVVQTWTVGAETKATVVGGESRDEDATLRRRHKDVRKRRSSCNTSD"
     gene            2629427..2630815
                     /locus_tag="MYCTH_2308818"
                     /db_xref="GeneID:11511027"
     mRNA            2629427..2630815
                     /locus_tag="MYCTH_2308818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665219.1"
                     /db_xref="GeneID:11511027"
     CDS             2629757..2630611
                     /locus_tag="MYCTH_2308818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665267.1"
                     /db_xref="GeneID:11511027"
                     /db_xref="JGIDB:Spoth2_2308818"
                     /translation="MSTCQLDHVMDSPWATPTAVSQGRKRPLRTYSRRTIQTRAQEQE
                     ATQSDRDPTTMMANSIPAEVPDQHPVLQSQSEAERPAEAKRPNRGSILAYFRPVLPST
                     DKALSKVAAFGTIEPPLTPRISPELRGANPRRRLTTRPQFGEVGEVSRDDVGRPINVG
                     NVNAVEGAETDGERDESADNPDCSLGSPHDPPTEALGELPTNTLGRHDWTVGVSTDGR
                     VKPKKRAYKQPVKDMMQTTLSLSVQKEPGFILCGVCDILYNPFNEKDRKEHNRRHAAS
                     SRKRRKTA"
     gene            2630762..2632783
                     /locus_tag="MYCTH_2308819"
                     /db_xref="GeneID:11511028"
     mRNA            join(2630762..2631050,2631112..2631396,2631458..2631614,
                     2631683..2631854,2631923..2632783)
                     /locus_tag="MYCTH_2308819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665220.1"
                     /db_xref="GeneID:11511028"
     CDS             join(2630911..2631050,2631112..2631396,2631458..2631614,
                     2631683..2631854,2631923..2632584)
                     /locus_tag="MYCTH_2308819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665268.1"
                     /db_xref="GeneID:11511028"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="JGIDB:Spoth2_2308819"
                     /translation="MGLQNDEMRLQNGQTGLENGKMELKNGEKGLKDGDHVNTPNGHR
                     SDRGRTCVPSDTRDYGAWLGQILDHIDKHGEQELLPVLQEFRELITSDPRFYMYFTGM
                     WEEIPVKEPDPKNPTVQPRIRDYEQMLQVMNHVLVAAPEWTQAAASAGLAGVPLVAMF
                     DEAMSTPSGHAAFLDPDVNLMFKKILNAWGKYLQTPESVEVLGDHENGWFCQAAFKEL
                     LEVANAPYNTSFRLEELYKCDPSKEHFGFKSWDDFFTRQFHESVRPVASPDDDNVIAS
                     PCESTILNIAYNSKLRDKFWIKGLRYSVADMLGHDPLAEHFAGATVCHAFLSAMSYHR
                     WHAPVSGKIKRCFVQEGTYFSISLSDLFADGGDAKGHLATQGYASAMATRGIVFVEAD
                     NPAIGLVAFIAIGLTEVSTCEITVTEGQRVQKGDEIGMFHFGGSACCLLLQNGVRVSG
                     FPEIRSPVNVPVRGRLAVVQP"
     gene            2633940..2634497
                     /locus_tag="MYCTH_2308822"
                     /db_xref="GeneID:11511029"
     mRNA            2633940..2634497
                     /locus_tag="MYCTH_2308822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665221.1"
                     /db_xref="GeneID:11511029"
     CDS             2634283..2634456
                     /locus_tag="MYCTH_2308822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665269.1"
                     /db_xref="GeneID:11511029"
                     /db_xref="JGIDB:Spoth2_2308822"
                     /translation="MLPDQKPKQAAQYRESLADPADQRGFRVFEVASAARKLPEPTMT
                     DFGELDSLKEDAE"
     gene            2637417..2640137
                     /locus_tag="MYCTH_2308823"
                     /db_xref="GeneID:11511030"
     mRNA            join(2637417..2638216,2638285..2638371,2638435..2640137)
                     /locus_tag="MYCTH_2308823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665222.1"
                     /db_xref="GeneID:11511030"
     CDS             join(2637595..2638216,2638285..2638371,2638435..2639963)
                     /locus_tag="MYCTH_2308823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665270.1"
                     /db_xref="GeneID:11511030"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2308823"
                     /translation="MPSPWLGSRSTGSSSVSASSSSLGFSHTGQLSPISNGVDLPCGA
                     VHGSASLASPSQSPSVTATSRPASSSVQTPAWPPPGCVGPENPSPLPGPEERYDAQHR
                     DAAASEGGDVAEVLVPKLEPMEDDDFCMNDFQEAPSPFATRALPGHPPQEEALEHSKQ
                     KRPRGRPRKHPFVPNVVTHNKITKGRSKTGCLTCRKRKKKCDEAKPRCMNCEKNAVVC
                     EGYPEKQIWKSGKERAEEERLRCRGFPSITMRPLFHCLETVEDRIFWKHYNEHLSAVL
                     TVESEHKNAFKDMMIPIAVKHRGLMHSILSLASKHIDYETPYGLNILRNNPNTTLEAL
                     KQRSFYHHQQARFNMYRDIDAARKAPHTIDRVSTEARYGQMLCFLLEALVEGDSRSEH
                     RPHLQAYCNLISSSPPEDSPFLSFIAEVFQYYIFAAELIPGLNGHAARRLEPLPPFPT
                     MDKPRLLGVADGLLNYLSQITEIRNTIRSKMMAQVDLAVDYQVLYQGSEIDGAIRDFT
                     TYWPPGDSRQQVTLLYKQMLWIYLNRTVHLPSSTPSSMASSSTSLLSNNSQPCHGRYP
                     ASVVNTPPQSASTSCASSPQLTASGHESNHSDGRPNSRLGPTSRPQGSIAADSGVTAA
                     GRDNRAESPAPTRQPPDLDPDLAQAVEESLNLLEWFKPSDPCQTLLLLPCFLVGTACF
                     RPSQQQRVRAAIRAVKGYTGLRNADCVLQLLEEVWRLMEAGDWVAAWDWPGVAENLGL
                     DFIPA"
     gene            complement(2640941..2643480)
                     /locus_tag="MYCTH_2308826"
                     /db_xref="GeneID:11511031"
     mRNA            complement(join(2640941..2641471,2641585..2642717,
                     2643084..2643480))
                     /locus_tag="MYCTH_2308826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665223.1"
                     /db_xref="GeneID:11511031"
     CDS             complement(join(2641031..2641471,2641585..2642598))
                     /locus_tag="MYCTH_2308826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665271.1"
                     /db_xref="GeneID:11511031"
                     /db_xref="JGIDB:Spoth2_2308826"
                     /translation="MLEAAATSLASIIVLGAGFGLAAYAYHKGYKYMVLHKMANAFEP
                     GDPVLELAAIGKDLPLSKTAAATHWVERPEQPIVDDIVAGRSVGHYHLFIGDKGTGKS
                     SMLLEAMRKIDGDGVAMFEAHADLEIFRIRLGKALDYEFHEDYIGGYFSERGPRDTTA
                     LLDIERALNKLEKVALRRRAKVGRPLVVIINQMHLIRDDEDGKDLIELLQQRAEQWAA
                     AHLVTMVFNSDDYWVYERLKQLATRMDVLTIMDLPKAQATAALRNYRQRYFHEDPPSE
                     ILEEVYNRVGGRLNFLNRVAKSNDMLDACDKIKETEKTWFLNQCWILGKDMDDDVMDQ
                     QKWAAAAVVLAAALVDKEKEMETTYDPVVGHVLPSFPLYKAQEIMTRVDFVRAFDRLN
                     LFSITSDAQVRASSVPMHLAFREIVSQPGFREHLQGTIDRIAAIESLGRTRELVAKDL
                     VLGGKYEIRKIPGGIDVSLREKEEEEATGDDDKN"
     gene            <2644806..>2646257
                     /locus_tag="MYCTH_2120116"
                     /db_xref="GeneID:11511032"
     mRNA            <2644806..>2646257
                     /locus_tag="MYCTH_2120116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665224.1"
                     /db_xref="GeneID:11511032"
     CDS             2644806..2646257
                     /locus_tag="MYCTH_2120116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665272.1"
                     /db_xref="GeneID:11511032"
                     /db_xref="JGIDB:Spoth2_2120116"
                     /translation="MGRGDRRLPRLTQEELANPCTRISLDGVEVQLWQVAHIYGLSYE
                     MPSPSLRGGASSQDFRSLPSRERDEGTEVPGVPGPLTSSGRSNVNERTPFTDLPIAPL
                     RISPRRGVQQRIRCPAESDSSRHGSGTQDILRLIDELVDECWSDGIDKEETQDKTAVP
                     LATLSDPAPRIKGATWADPSFPPPAHPPPARPLPRVPEQPAGNMNPGAGAHQARRLAV
                     VPRTTPGISSRHSGKLTENSDPNRDNNDDDDDDDDDADSERTITPRASRRQLVAAPRE
                     RNVSMPNPWPSAQQPAAVHSAGRAVSASILRNRDEVHYHPLPQRFGPAQAQSKQVRPP
                     LPLRHPLPDFLLNPPSFLQHPPDLSQQPHLPENQGNAGAVARRDPRSNKSGSTSSPAA
                     ACASAPRAAMPTSDDEVAVTSRWSSDSSDSEDEKESKMKRLKKVLSFSKLRPRKSSFF
                     QKQTATEAGKSAVSVGRSTSGSSGSRRGSKTEN"
     gene            2647072..2650749
                     /locus_tag="MYCTH_2308827"
                     /db_xref="GeneID:11511033"
     mRNA            2647072..2650749
                     /locus_tag="MYCTH_2308827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665225.1"
                     /db_xref="GeneID:11511033"
     CDS             2647318..2650713
                     /locus_tag="MYCTH_2308827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665273.1"
                     /db_xref="GeneID:11511033"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2308827"
                     /translation="MGNESSRPEQLEGRSRSLSPLPRDYQLSPDAADSLSALPSTMPA
                     SLQVANEGSGPPGAPGSLAWHRRRRRARALSPELPRASPPFELSDNEHPADDQEFPLT
                     AHAVSTAELSLPATQPTRVKSKRAKKKSSEKKRKAELKEAAKAAHDEAVRVEAAIQDH
                     KKRRHRSTAPSPFPPRDGEQATGDPEPYNELVEATSPRSQSLKHSRLSKKYKGLGTEV
                     TTGDGEEEATTVHGRSIFDLEGDDDAPSSARPQGKRPRRDSDSKPRKNRKSSRSSNLG
                     LDDGLEAGRSEEPIDRLALEGTNADFQLDRGGGTGREGETDMTEAARSSSPVLEERIS
                     ADGAARRASTTSNHGSQRSNSDSGYEEAEVQGMPQREHEGDALERRGSPQLRGDDHLA
                     AGDQANQNDDDEISVASDLHRSPVASPTPNSPADANVANGELNDDAVESAPSQHDSDT
                     AVAPFESVAKTSSSRSSAKRKTKVPFFSRGEEESARTAAEPTQDAATSQEQSRRRPGA
                     ESPVPGEADPSDTARKPKPKKQKRRPEAETAVAANEPDAQAQPEGSRYRTGPLSQTEE
                     NQITRAMERFRENEGLTQQELNQVIHDNPQKSERPIHRQLWATIQDACPTRPRRKLIE
                     WCRQRYNNWAGRGTWTPEQDDELVDLVAKHGKKWSYIAGLINRYQKDVRDRWRNYLVC
                     RDTVRTDAWSEGEEERFREVVEKAIEKIREGVGKDSKKPAEALINWLDISQAMGYTRS
                     RLQCMEKWKRMRAAEPLPDTVPTVLPQGNSWRLEKAREDLRKMTAEDKYRLMCAIRDS
                     GVETDAKINWKPIIKGTFQGVFERTALVVTWGRLRKAVPDWETKTTRDCAQYLCEMYE
                     NEGHFGSSEIAETAEDEENAAVSANKKRRKGKKVVRPTSTDDEIAPSLETATTGAQSK
                     EAEIVPSTINEDNDSASRGFLPKRGNKGRKTATDASTDAPSERTGDAADLDVQTEESA
                     PVESRTDPYSGKRPRQAEKEQSPELNSGQAELSPSIEAQAARFRRRERIGSTVERGSV
                     KGKGKGKEFRPLGSETKASKFSKRQRRASLSDVEDIESPKLKKRKTLSSSSKAEADGI
                     ASPRTREDKAPESYGKSWSVISSDMDDMEDIPATLPVSSQAAH"
     gene            complement(2651406..2652939)
                     /locus_tag="MYCTH_2308828"
                     /db_xref="GeneID:11511034"
     mRNA            complement(2651406..2652939)
                     /locus_tag="MYCTH_2308828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665226.1"
                     /db_xref="GeneID:11511034"
     CDS             complement(2651424..2652830)
                     /locus_tag="MYCTH_2308828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665274.1"
                     /db_xref="GeneID:11511034"
                     /db_xref="JGIDB:Spoth2_2308828"
                     /translation="MPLAAPFSGTPTSTTTSLSALSTTAIKDGHRGALHHRGHQHSPS
                     TNSLEAERADRISRLTGLSSVSTLRGTPPGFGHQQQQQQQQQQQQHSAHSPHAITTSS
                     GSPANAVAAAAAALSPAYFDAAGQPVAVTKVSTVGSASATDSVGGRTTATTADTGADT
                     STLGEEDHDEDMLTEMDSASASGYMGPDTDADAMDEDLDNLTSRSVGGFEDRMSDDGT
                     ASLVGFGEGAGSTVSGPIYHRRPLPSQGGGGGGGGGACGLERSSSGLSEGAIASPNPH
                     HGGGGGGRREAARRSWEPDREREDTPVSQSAVRERREARMMDGVALDAAAAAAAAADD
                     DDDNDNDDNDNDNDYDDSDDVFVDTTTSGPVPDDRPVPPAHATTAANTNNNNNKPLRE
                     RQHRPHHRHHRQHQHHPPHATAQTQQPSLTSTPPREPAECLVRERQDEGGQGRARSPA
                     LGSTKGGERLGKFFFEDR"
     gene            complement(2653822..2656454)
                     /locus_tag="MYCTH_2308831"
                     /db_xref="GeneID:11511035"
     mRNA            complement(join(2653822..2655772,2655830..2656054,
                     2656119..2656454))
                     /locus_tag="MYCTH_2308831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665227.1"
                     /db_xref="GeneID:11511035"
     CDS             complement(2653845..2655362)
                     /locus_tag="MYCTH_2308831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665275.1"
                     /db_xref="GeneID:11511035"
                     /db_xref="InterPro:IPR015798"
                     /db_xref="JGIDB:Spoth2_2308831"
                     /translation="MDPITLELVRIDYLPTGHDEKVKPPAPWQPAPPSEYIPEAQTLR
                     KDLKPLRVTQPEAASFSVEHFSELGRLIRWQKWDFKVGFNQREGMVLYDVHYDNKPLF
                     YRLSLSDMCIPYADPRNPFHRKAAFDLGDVGAGIMANNLQLGCDCLGSIYYIDGVLVN
                     GKGEPIRMPNVICVHEQDAGILWKHTNYRTNRAVVVRNRELVLQTILTVSNYEYILSF
                     VFNTAGDLAYEARATGILSTQPVDRDLTATPHPFGTVVHPGVLGGFHQHFFSLRIDPM
                     IAGHGNSIVYDEAVPIPRDPKLNPHGVGYTVQRTEVETSGGFDLDTTKNRTFKIINPA
                     VHNPVNGAAVGYKVVVPPMQPILADRDSFHYRRAEFTDHSIYVTRYADGELYAGGLYT
                     NQSRGGNGVRSWADRKDSLKGGDPVLWVQFGINHIPRVEDFPVMPAETLRVTLRPVNF
                     FDRNPAIDVPPSRQEVNRSVSLNEPGDDVQENMNGLSLGGEGGSLGSCCASHGSV"
     gene            complement(2656800..2657889)
                     /locus_tag="MYCTH_2308832"
                     /db_xref="GeneID:11511036"
     mRNA            complement(join(2656800..2657399,2657507..2657889))
                     /locus_tag="MYCTH_2308832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665228.1"
                     /db_xref="GeneID:11511036"
     CDS             complement(join(2656999..2657399,2657507..2657780))
                     /locus_tag="MYCTH_2308832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665276.1"
                     /db_xref="GeneID:11511036"
                     /db_xref="JGIDB:Spoth2_2308832"
                     /translation="MGIIKKVNLGTVGLGAGALGYLGLSTTIVSPLPADDPLWRSKSY
                     AQFNTHHNASTQDVCLKRIPLSKIKPELLQRDGDLALEFCRGVWSGIGYRFQRAYLAR
                     KYQGPATAGQLWTVEQLARSTYEPGTQLTDHFEVVEKTPSEITVRCGDSPRNPNPRDS
                     DGLFAIGAAVDRERGEAVLALKSCFFNSRIKVEGIQGPMPGWIELLHRWYSRLLIETG
                     SWRVTR"
     gene            complement(2658273..>2660162)
                     /locus_tag="MYCTH_108627"
                     /db_xref="GeneID:11511037"
     mRNA            complement(join(2658273..2658829,2658994..2659975,
                     2660130..>2660162))
                     /locus_tag="MYCTH_108627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665229.1"
                     /db_xref="GeneID:11511037"
     CDS             complement(join(2658675..2658829,2658994..2659975,
                     2660130..2660162))
                     /locus_tag="MYCTH_108627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665277.1"
                     /db_xref="GeneID:11511037"
                     /db_xref="JGIDB:Spoth2_108627"
                     /translation="MAPTVKRTGEMKAKAESGPRNSITVAAGTPAGPERSPGRETESA
                     RSSPGEVAGPDDEGVRPSIPIHTGKDGEKDVMEGSNINGHTVAPAASQEAAGTTASGR
                     DYYHEYEFSDLDEITVRQLNEDILAYRYDLEYCKSQLEEADLTPQEMRTLQLRTLDLG
                     HQLRHCKHRIEIIKAQSRKRPSRAAHGNAGAVSYSTGSTTGPSARQHRADSGMLPARR
                     VASTPSQAAGSSKRPAAGSADEESGGGVKRAKMASPDSDVAGPGTDDGSVNTSLQRLG
                     FWKCRLCSAPKYLLAGSGRSPAAPCKWPLKDISKMITHFTEMHGEHTPSERCVELGAA
                     LSHNRGPFEYWLRRTRAQNISDSGVIDDCLETLLDGEMPDLLRRHSRAAASMPVD"
     gene            <2661802..>2662792
                     /locus_tag="MYCTH_54570"
                     /db_xref="GeneID:11511038"
     mRNA            join(<2661802..2662437,2662561..2662586,2662696..>2662792)
                     /locus_tag="MYCTH_54570"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003665230.1"
                     /db_xref="GeneID:11511038"
     CDS             join(<2661802..2662437,2662561..2662586,2662696..2662792)
                     /locus_tag="MYCTH_54570"
                     /note="Contains conserved domain SET[pfam00856], SET
                     domains are protein lysine methyltransferase enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665278.1"
                     /db_xref="GeneID:11511038"
                     /db_xref="JGIDB:Spoth2_54570"
                     /translation="TVCLRDGHGSWSLVTQPQHENCPLASDWSPWSYQPFCLKPATEE
                     DEPAPADCVFTLTAFRGNQGISLITTPNLAASIATNLDDSRVPPGLRYQLADVGRGRG
                     QTAAYEIRDLPGRGKGMVAKRKFAEHETIMVGYPVLVVRLDFLNGDGLTDRGKRVMME
                     TSVKQLPPKQSWALKSLARSTGGEPILDIIRTNGFGIEIDGVQHLAVFLDGSRVNHNC
                     RPNSFWRYSGSSIAMEVVALRDVRPGEEIAHSCK"
     gene            complement(2664097..2666200)
                     /locus_tag="MYCTH_2308837"
                     /db_xref="GeneID:11511039"
     mRNA            complement(2664097..2666200)
                     /locus_tag="MYCTH_2308837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665231.1"
                     /db_xref="GeneID:11511039"
     CDS             complement(2664280..2666157)
                     /locus_tag="MYCTH_2308837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665279.1"
                     /db_xref="GeneID:11511039"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR006107"
                     /db_xref="JGIDB:Spoth2_2308837"
                     /translation="MSRISTAELSRYLLTGRFSRRGCLNSRLSRIAPVRQTSLSSQGR
                     SLGTSAETATAAPPSATAAPITPLRKQLKEQAKALKASGKKKKKNKADNQTVPGWELT
                     VGIEIHAQLNSARKLFSPAATSFNDKPNSHVALFDVAMPGSQPLFQPEVLIPAVRAAL
                     ALNCAIQPISRFDRKHYFHWDQPAGYQITQYYHPFARDGRVVLHARDGIAPEDGDRVE
                     IGIKQVQMEQDTAKTTAQPGDVHWLDFNRVGLPLIEIITLPQIHHPATAAALVRKVQM
                     LLASVDACVSGMEAGGLRADVNVSVRRTDDAAAGGKLGTRTEIKNLSSFKAVEDAIIA
                     ERDRQIAVLEAGGVVEAETRGWSLGSTETRRLRGKEGEVDYRYMPDPDLGPVVIGDDL
                     VAHLASSMGVLPDAEIDELVGRYGLSAKDALSLTTVDDGARVQYFYNVLDALEARLGL
                     DKTGAASDQRHALLAANWCLHELGKLTELSSDLGMTPEGECNVPSAALAAILAHLHRR
                     EITAKVAKELLWDAFRGEVTADSVTQKIDADKLWFKELSEDEYAQLADQVVQGEDKVL
                     GEFLRFKQGKAKAYPQGKLMFLVGKMMRAGTEQRMDPASAERVLRARIEDVYLPRLEG
                     R"
     gene            complement(<2666901..>2667775)
                     /locus_tag="MYCTH_2112160"
                     /db_xref="GeneID:11511040"
     mRNA            complement(join(<2666901..2667250,2667309..2667522,
                     2667569..>2667775))
                     /locus_tag="MYCTH_2112160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665232.1"
                     /db_xref="GeneID:11511040"
     CDS             complement(join(2666901..2667250,2667309..2667522,
                     2667569..2667775))
                     /locus_tag="MYCTH_2112160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665280.1"
                     /db_xref="GeneID:11511040"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="JGIDB:Spoth2_2112160"
                     /translation="MTFNGTVSRPTIIADWGDDVTIHVTNNMASNGTSIHWHVARLGA
                     APVMQNGLINGTNSYNCTGESDVRCYLFRLINVAVDGVFEFSIDGHGLQVVDHDLVPI
                     VPYKTDSVQLTIGQRYDVISEANAEPGSYWLRSGWNTDSPPTESESTVTLSDSCLDEP
                     PAKTVPHLSLDVTNMCGGVVYENMNSTLAIAFRLDSPGAWLVHCHIVWHASQALALEF
                     VESQSRIPPDDRSTWMYRKTCDSWVAWTPIWDQEESGI"
     gene            complement(2670031..2672153)
                     /locus_tag="MYCTH_83595"
                     /db_xref="GeneID:11511041"
     mRNA            complement(join(2670031..2671281,2671357..2671687,
                     2671803..2672153))
                     /locus_tag="MYCTH_83595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665233.1"
                     /db_xref="GeneID:11511041"
     CDS             complement(join(2670616..2671281,2671357..2671687,
                     2671803..2672062))
                     /locus_tag="MYCTH_83595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665281.1"
                     /db_xref="GeneID:11511041"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_83595"
                     /translation="MILKMLPLLPVWLALHVGVTLGAAHPRALEHSGPAPQHLSPFQL
                     SGDLSDRRGHGRPVNIDLSVWRKGQTELQWYGEITVGTPPQKFKLIFDTAASLMLIAH
                     KNCTTCGDHPLYDPDRSSTFSPLPGYRGEVTFGSPGGGTISSPEVQGANCTVVTDTVR
                     MAGRGAPSEFMMCDNYSSGLRDQPPDGIFGLSSTPYALPGPEFSFSFVPDRRRAGVLT
                     LGGVDRSQYVPGTLRKIPLNWPLSASRWRWVVDVRGARVVVAVGGGGGGGGGSAPLGN
                     STDAVALVDTGGATIVTPDRETTRELYGRMSGEIRPLDDRGAWGAPCAVLDRAARDVV
                     FRVGSADRHVDAAVRREFVNVGEFPGRPGICQGVFTDPERVAREPIRGRPAWIFGTPW
                     LRSYYTVWNGADRTLGFATPSHRNRD"
     gene            2672911..2674416
                     /locus_tag="MYCTH_2308841"
                     /db_xref="GeneID:11511042"
     mRNA            join(2672911..2673706,2673841..2674416)
                     /locus_tag="MYCTH_2308841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665234.1"
                     /db_xref="GeneID:11511042"
     CDS             join(2673102..2673706,2673841..2674288)
                     /locus_tag="MYCTH_2308841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665282.1"
                     /db_xref="GeneID:11511042"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="JGIDB:Spoth2_2308841"
                     /translation="MSAAEKEPENSTPAGSKAAPESAPAAEGTDATPSTAPAAKAPEA
                     SETPEAQTAPAAPATATEAAASAPTSEEKKESTPSETPIGQLWAAARASGHPEIWGVT
                     LADPSSHVPTRIVLQKYLNANDGDLAKAKDQLTKTLEWRAKTKPLELVKKVFSKAKFD
                     GLGYVTRYQEDGSGEPEGKEVFTWNIYGGVKSIEETFGKLDEFLEWRVALMELALQEL
                     DIASATKEITAEYDPYKIFQVHDYKSISFLRQSPQVKTASQETIKVFAQNYPELLKEK
                     FFVNVPAIMGFIYTFMKLFVAPKTIKKFHPMSNGQTLAAEFGDSKVSKLGERLPPNYG
                     GKGAKLEEQGRGPLLE"
     gene            complement(<2674560..>2675530)
                     /locus_tag="MYCTH_2120123"
                     /db_xref="GeneID:11511043"
     mRNA            complement(join(<2674560..2674847,2674906..2675238,
                     2675285..>2675530))
                     /locus_tag="MYCTH_2120123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665235.1"
                     /db_xref="GeneID:11511043"
     CDS             complement(join(2674560..2674847,2674906..2675238,
                     2675285..2675530))
                     /locus_tag="MYCTH_2120123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665283.1"
                     /db_xref="GeneID:11511043"
                     /db_xref="JGIDB:Spoth2_2120123"
                     /translation="MSGKRARSRDVFVWDLNDNEDRIPLGGLVLTAGITNTDFRQMLD
                     ILITSCDYVVQNEHGDEVLRDNQPLLPGDYFIIADEVEVNNEVVYTRACSIASGTRVQ
                     SFIEQVQARDGRCIVSKVENARAVDGFWWGFEAAHIFPLAYEQQWLENNYSRWITIDP
                     PQGGKINSVQNGILLRSDLHQLFDNYTFSINPDNGYKIIYFVKDCEQLAGKSLDSRLL
                     DDPRRPPDSLFRWHFRQAVLTNMRGIGEPAYEHDFPPGSDIMGEIQAGPKAAERMEFE
                     LFDRLAHHVEIL"
     gene            2676091..2676635
                     /locus_tag="MYCTH_2308842"
                     /db_xref="GeneID:11511044"
     mRNA            2676091..2676635
                     /locus_tag="MYCTH_2308842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665236.1"
                     /db_xref="GeneID:11511044"
     CDS             2676271..2676465
                     /locus_tag="MYCTH_2308842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665284.1"
                     /db_xref="GeneID:11511044"
                     /db_xref="JGIDB:Spoth2_2308842"
                     /translation="MYSWLNGHLGVEQAHSLWCSRRRGSLYVVKPLQFAGSSQVSVSL
                     ESATTPQPGQVRLSLRHMMI"
     gene            complement(<2677238..>2678371)
                     /locus_tag="MYCTH_2112164"
                     /db_xref="GeneID:11511045"
     mRNA            complement(join(<2677238..2677264,2677546..2678021,
                     2678101..>2678371))
                     /locus_tag="MYCTH_2112164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665237.1"
                     /db_xref="GeneID:11511045"
     CDS             complement(join(2677238..2677264,2677546..2678021,
                     2678101..2678371))
                     /locus_tag="MYCTH_2112164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665285.1"
                     /db_xref="GeneID:11511045"
                     /db_xref="JGIDB:Spoth2_2112164"
                     /translation="MCIRIVFLCPSCRAPSGQTTTLRLHGPSCWDRVLVERLMQSQHF
                     HPGWYCTTPDCGYSRDSQERDAKEIKQIRLNQARNDTSSDADDELYDTDDERDEAMED
                     CEADTDTKPANAESGGLVNLQPGPSIYYPSAKPCVKRRHNNSKGGSYPVKTEPADPTT
                     RPLGRGLGTLHHGAKGVRRDNLGTARPRHRGSRMPVGLDSPTRDRIGKLLSRIVLHAD
                     AHPEKSKWLEEEEELLEILRAHKVSYRQIAELRVVEYIK"
     gene            complement(<2679051..>2679724)
                     /locus_tag="MYCTH_95835"
                     /db_xref="GeneID:11511046"
     mRNA            complement(join(<2679051..2679083,2679135..2679547,
                     2679637..>2679724))
                     /locus_tag="MYCTH_95835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665238.1"
                     /db_xref="GeneID:11511046"
     CDS             complement(join(2679051..2679083,2679135..2679547,
                     2679637..2679724))
                     /locus_tag="MYCTH_95835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665286.1"
                     /db_xref="GeneID:11511046"
                     /db_xref="JGIDB:Spoth2_95835"
                     /translation="MAEAEENAILLANRAGRAPRAEGAIEDNNASAPLGHAAEEENQG
                     EVSEGEANATCDASLTCNTVRDNAAPLSRVPSPQPSPRSQPSLSHQLPTQELVAAIAD
                     EPALSAVDTDSTDSHFSPKTAARVRELRDVIASYEADDKTKKWYPEEEELLRILRESE
                     LSYHRVAKQQQLIHSFK"
     gene            complement(2681462..2682254)
                     /locus_tag="MYCTH_2308845"
                     /db_xref="GeneID:11511047"
     mRNA            complement(join(2681462..2681765,2681811..2681883,
                     2681939..2682254))
                     /locus_tag="MYCTH_2308845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665239.1"
                     /db_xref="GeneID:11511047"
     CDS             complement(join(2681641..2681765,2681811..2681883,
                     2681939..2681944))
                     /locus_tag="MYCTH_2308845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665287.1"
                     /db_xref="GeneID:11511047"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308845"
                     /translation="MKDILIGDRYRVDRRIGAGGFGLVYFGTDLELGEEVAIKLTHVR
                     DNPEVLRSEKETYEALSGVVGIL"
     gene            2682361..2684265
                     /locus_tag="MYCTH_2308847"
                     /db_xref="GeneID:11511048"
     mRNA            join(2682361..2682749,2682800..2684265)
                     /locus_tag="MYCTH_2308847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665240.1"
                     /db_xref="GeneID:11511048"
     CDS             join(2682465..2682749,2682800..2684095)
                     /locus_tag="MYCTH_2308847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665288.1"
                     /db_xref="GeneID:11511048"
                     /db_xref="JGIDB:Spoth2_2308847"
                     /translation="MARAQPRKRARADDLSQEHCPNKKIKSRDRLHGSSNFPPEFWDN
                     LSKIWLTPRALRELDRRNSTRAPEPAMPVVYTTDLARFARHGGPDLRHLWGYPEPKSA
                     VRTISCSRSIASSSQRTKSTKSTEATDVSSRTKPSSAYDKNFEQHLNDNNVYLHGRKS
                     KPNNKVDLYESRLSLSPSKFSDSAFERFQDEHDHLGSEGDVMRKIIPVISGSTNIHNS
                     GEMLFNNLESITDGTMGDVKPDFYDGAYFGDIDAAVRNDLNSLIIPSNTNAARRPIAP
                     NFFLEAKAPLGRADVAKRQAGLDGAIGARAMHALQNYGKEEPAFDGNAYTYSSTYHAG
                     TGTLKLYAHHVTAPTTPGGRPEYHMTQVDGWDLTGNIDCFRRGVTAFRNARDLAKEHR
                     DRFIQAANARARQTDTEALSEAEITVAVAEQYEDSTADESVDCEDYVESQAVGTENHA
                     TSQDVGEGLTLPEYLHEEEEEPSQQPTLLGAEPAMSFATSFTSSFTVQSQTSSKRNRA
                     SNSPPSNSRPRKKHDPAK"
     gene            complement(<2684896..>2685093)
                     /locus_tag="MYCTH_2066278"
                     /db_xref="GeneID:11511049"
     mRNA            complement(<2684896..>2685093)
                     /locus_tag="MYCTH_2066278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665241.1"
                     /db_xref="GeneID:11511049"
     CDS             complement(2684896..>2685093)
                     /locus_tag="MYCTH_2066278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665289.1"
                     /db_xref="GeneID:11511049"
                     /db_xref="JGIDB:Spoth2_2066278"
                     /translation="KQKKTYNTRDSLVVTDPTTNRALASLTKGERTGSRAFWRVWSYV
                     IVLYSQMHYVSGLRVRRPEKK"
     gene            complement(2686116..2687054)
                     /locus_tag="MYCTH_2308849"
                     /db_xref="GeneID:11511050"
     mRNA            complement(2686116..2687054)
                     /locus_tag="MYCTH_2308849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665242.1"
                     /db_xref="GeneID:11511050"
     CDS             complement(2686199..2686900)
                     /locus_tag="MYCTH_2308849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665290.1"
                     /db_xref="GeneID:11511050"
                     /db_xref="JGIDB:Spoth2_2308849"
                     /translation="MDSTGAAPPTPQWRGPTIPIENSRQVAMLVTSAFAMVIPTILVG
                     LRFWAGHIIHRRLDASDVCILAALLFTIGLHVDMYIMVLRGGFGFHGQDIVLRFGMDT
                     LVLFLKCILAFPIIWNFTICLSKLSVLFMYANVIPVPRMKIACRVVGLLIILWNTGGI
                     LGALLLCRPIAKNWDKTIPGTCGDNRLFYIWLGIINVIVEAVILLLPVPFILRLQMKT
                     FKKVVVVGMFSVGWM"
     gene            2692705..2694423
                     /locus_tag="MYCTH_2308851"
                     /db_xref="GeneID:11511051"
     mRNA            join(2692705..2692917,2693076..2693683,2693855..2694423)
                     /locus_tag="MYCTH_2308851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665243.1"
                     /db_xref="GeneID:11511051"
     CDS             join(2692864..2692917,2693076..2693683,2693855..2694143)
                     /locus_tag="MYCTH_2308851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665291.1"
                     /db_xref="GeneID:11511051"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2308851"
                     /translation="MGSVEPNAARVAIVTGGTSGIGLLLSRHLHAKGWRVALVGRRAD
                     VGAPKTALLDRSGERAVFEQCDVSSYSSQAAMFRSVWARWGRLDLLIANAGNVDHGSW
                     YNFGGRGAGVDDLPPEPDSSCTDTHLKGVMYGTRLATHFMRHNKPSPGGKIIATSSML
                     GLHPCPTFPEYGAAEAGVIQWVRVSAPLLKLKENITINAVMMGPVITPVMPGFAKAFL
                     PEELVLPSTILEAYDVFIDDAENQRTGETVETAHDRLFWHEMPELKAGKLNVRNMAVY
                     EPWFAAMHGEKSGLENALQGPPEGNAEDAGRAEELAVGMR"
     gene            2694728..2696163
                     /locus_tag="MYCTH_2308852"
                     /db_xref="GeneID:11511052"
     mRNA            join(2694728..2695531,2695612..2696163)
                     /locus_tag="MYCTH_2308852"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665244.1"
                     /db_xref="GeneID:11511052"
     CDS             join(2694980..2695531,2695612..2696037)
                     /locus_tag="MYCTH_2308852"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665292.1"
                     /db_xref="GeneID:11511052"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2308852"
                     /translation="MSDVKIIAVTGATGAQGGGVVNMLKKTAGWRVRAITRKPESEAA
                     KKLAADGLVEVVRADFDDEESLVRAFEGAAAVFAVTNWWEALFSGKSQWEAGEIEERH
                     GMNLARAAARTPTLEHYLWSTQPSAKRRLPGRLETPHMDYKANVDDRIKAELPDLARK
                     TTYLYFGYYPQNMAYFPLLKPFQLPGNGQYVQLLATDPEAKILLAGDMSINPGIWVRQ
                     ALATGAPAFGRYANVALERWSFRQMMDKWSEITGKRGVVVQVTEEAWTRLWGPAGTEL
                     AWQFKFGELCDPWAVRDDFISPEELGIGPDEVVGFEGTIKGLASLGLFD"
     gene            complement(2702500..>2703158)
                     /locus_tag="MYCTH_83591"
                     /db_xref="GeneID:11511053"
     mRNA            complement(join(2702500..2702920,2702988..>2703158))
                     /locus_tag="MYCTH_83591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665245.1"
                     /db_xref="GeneID:11511053"
     CDS             complement(join(2702874..2702920,2702988..>2703158))
                     /locus_tag="MYCTH_83591"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003665293.1"
                     /db_xref="GeneID:11511053"
                     /db_xref="JGIDB:Spoth2_83591"
                     /translation="KTEEHITLVAAINELGFEVIPCFYYFSCGLYCYIIESSSCYGEY
                     VYYRRLYDGSRVHCRQVKAPRPIRTRC"
     gene            complement(<2718376..>2718531)
                     /locus_tag="MYCTH_2031276"
                     /db_xref="GeneID:11511054"
     mRNA            complement(<2718376..>2718531)
                     /locus_tag="MYCTH_2031276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665246.1"
                     /db_xref="GeneID:11511054"
     CDS             complement(<2718376..>2718531)
                     /locus_tag="MYCTH_2031276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665294.1"
                     /db_xref="GeneID:11511054"
                     /db_xref="JGIDB:Spoth2_2031276"
                     /translation="QETTEKNETYNTRNSLVVTDPTTTRALASLTKGERTGSRVLWRV
                     WSYMLGWH"
     gene            complement(2720291..2721796)
                     /locus_tag="MYCTH_2308868"
                     /db_xref="GeneID:11511055"
     mRNA            complement(join(2720291..2720593,2720657..2721796))
                     /locus_tag="MYCTH_2308868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665247.1"
                     /db_xref="GeneID:11511055"
     CDS             complement(join(2720468..2720593,2720657..2721478))
                     /locus_tag="MYCTH_2308868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665295.1"
                     /db_xref="GeneID:11511055"
                     /db_xref="JGIDB:Spoth2_2308868"
                     /translation="MFRLNLTFVAVAWALLQAHLILISVTIPQAHAWPTPTKWLPHFK
                     SQRPQRDYARRNLKTISSIYNLTVYPNQLPIFQAGGAGVPNGLFNKNVVGRVDPVGNF
                     TDFEESVEYFFALSPLPQGNPAKAAITGYQITEFSSQCRDVAASVVYLYCSVVNPGCA
                     DHGKPLPPLKQVAFWRFDEHGAVLKYDAWIPNLNTWVESTTAANADDPQSRASAIAQI
                     CGATQTRCQGPNAQWSSVEECMTALSQKSYGSYDEAWGDNIVCRSIHVVLTQVRPDVH
                     CPHVGPTGGGKCVDEPYPANYFSDKALYGQPTGETFMCD"
     gene            2722974..2724901
                     /locus_tag="MYCTH_2140156"
                     /db_xref="GeneID:11511056"
     mRNA            join(2722974..2724234,2724356..2724612,2724700..2724901)
                     /locus_tag="MYCTH_2140156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665248.1"
                     /db_xref="GeneID:11511056"
     CDS             join(2723421..2724234,2724356..2724612,2724700..2724768)
                     /locus_tag="MYCTH_2140156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665296.1"
                     /db_xref="GeneID:11511056"
                     /db_xref="JGIDB:Spoth2_2140156"
                     /translation="MASAESGTTDDVLPRKSLLILIWVCFSAACLFVALRTIIRVRSP
                     ASTRRLGPLEDCWIFLALAALLALCVLETIQLPSLYYITSVLSGDLELMSAEGVMSHT
                     KNYLRYQFPIVILFWTVLWSVKGAFLALYWRLFRDLTWYRGAWFVLTVFTVLAYGGCV
                     TTLALSCGPDVRNFFGFNTCAGPKNVWSSNFSVYFSTAVDVFTDLCIMAMPLRLIYNI
                     KVSLKQKLGLVCVFSLGFVMIVFAIIRANQSLAQQGFVNLTLLLVWSTLAASISVLVG
                     TLPALKVLITTRARASESRSGGASRATQPKHSSFGTHKSVKSARSVALGSLKRDSSNV
                     KSVAGSGSDIAESQEEMLAQREMTTSYGQVPRPSPVSYHQRFQNR"
     gene            2725475..2727492
                     /locus_tag="MYCTH_2308872"
                     /db_xref="GeneID:11511057"
     mRNA            join(2725475..2725844,2725961..2726099,2726181..2726289,
                     2726404..2727492)
                     /locus_tag="MYCTH_2308872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665249.1"
                     /db_xref="GeneID:11511057"
     CDS             join(2725653..2725844,2725961..2726099,2726181..2726289,
                     2726404..2727259)
                     /locus_tag="MYCTH_2308872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665297.1"
                     /db_xref="GeneID:11511057"
                     /db_xref="JGIDB:Spoth2_2308872"
                     /translation="MPEFFRVVEHTVSCSHSREYVGATANGDADRPQLAVKQYIPLDN
                     PNPQPGDVTIIAAHANAFPKELYEPLWDEIHKRITKSGIRIRSIWIADMWNQGQSGVL
                     NEKILGNDPSWLDHTRDLANLINLKRDEMPHPLVGIGHSMGAAQLTHLALQNPRLLHS
                     LILIDPVIETGTTGLGPARASTWRRDLWDSRAAAAAKFAQSPFYQAWDRRVFDLWVRY
                     GLRDLPTELYPSSPPSSSGNAASGGGGGGGPPVTLTTTKHQELFTFLRPTYRAGSDLR
                     DWAGHDGNDSDSSSQKSRYPFYRAEPRQAFERLPELRPGVLYVFGARSDMSGPEARRA
                     KMARTGTGVGGSGGAARGRVREAVLDCGHLVAMEKVAECADAVAEFLPGELALWRREH
                     EAAEAERRRRREAAAAAGGGRREEMMIDERWVREMKAKM"
     gene            complement(2727641..2728189)
                     /locus_tag="MYCTH_2308874"
                     /db_xref="GeneID:11511058"
     mRNA            complement(2727641..2728189)
                     /locus_tag="MYCTH_2308874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665250.1"
                     /db_xref="GeneID:11511058"
     CDS             complement(2727726..2727896)
                     /locus_tag="MYCTH_2308874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665298.1"
                     /db_xref="GeneID:11511058"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Spoth2_2308874"
                     /translation="MAVLDHKFRVRGVEGLRVVDASAFPAVPGAFPSCPTMVLSAKAA
                     EVILADASERLR"
     gene            2730752..2732207
                     /locus_tag="MYCTH_2308875"
                     /db_xref="GeneID:11511059"
     mRNA            join(2730752..2730956,2731089..2732207)
                     /locus_tag="MYCTH_2308875"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665251.1"
                     /db_xref="GeneID:11511059"
     CDS             join(2730915..2730956,2731089..2732012)
                     /locus_tag="MYCTH_2308875"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665299.1"
                     /db_xref="GeneID:11511059"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2308875"
                     /translation="MSATDPVTKVAIVGASGRIGGAFARALLQGGKHTVTALTRKGSN
                     GEIPEGAKKVEVDYDNQDSIVEALVGQEFLIITLGVSAPPELHSKITDAAGKAKVPYV
                     MPNYYGYPHHTITGSTDIYTKLSLERLSEVTRNGFSTRVHMACGFWYEWSLALGDPWF
                     GIDIAQRKVTFFDDGKRPITVSTWDQCGRAIAALLSLPQRGSSPSLADFINDKGVLVE
                     SWHLSQRDMLDSVHRVLGTTDADWQITYEPVEKRLKDGEEQMRNKDLRGFAKVLYGGI
                     FDASNPVSNYVGEANPILGLPKEDLDEATKRAVDMALSGYNPLGL"
     gene            <2733601..>2734852
                     /locus_tag="MYCTH_2129148"
                     /db_xref="GeneID:11511060"
     mRNA            join(<2733601..2734177,2734287..>2734852)
                     /locus_tag="MYCTH_2129148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665252.1"
                     /db_xref="GeneID:11511060"
     CDS             join(2733601..2734177,2734287..2734852)
                     /locus_tag="MYCTH_2129148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665300.1"
                     /db_xref="GeneID:11511060"
                     /db_xref="JGIDB:Spoth2_2129148"
                     /translation="MDKASDRTRRQRALGPRLPNLALVAGLFINPSSPIAPAGAAAAA
                     VAARQCLQAPAAPAAPRSPRSLPSPLQVRNEGEHVVLADCVDTAGVLSSQIAYFPGDP
                     GPSPQDVAVVETKEGQTALWVNDNTSALFTTTGVTFTALIGPHVKDGEFAGIGNNGYG
                     NFSCYQMYSKDLYKYAKTTCSQVYLCDHSAPPAGWVWDPSKGSSNSMSHGTIIGIAVG
                     VVGGVLFLLAAALAIWYFRRSRGGRGGAASRLSSKLLRSGTSSTAAASSDAGEPKSQT
                     QTQTPMPTPSEFSSSQHHQPVVQKITGPYEMDGRYRVELANDNGKYEMDPHGHGSAEL
                     DPTSKQQEHATPSTQNQVSPVTPAQSDSLLQHGGFPPRSPPPQYAE"
     gene            2734830..2737537
                     /locus_tag="MYCTH_2308878"
                     /db_xref="GeneID:11511061"
     mRNA            join(2734830..2735714,2735830..2736076,2736223..2737537)
                     /locus_tag="MYCTH_2308878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665253.1"
                     /db_xref="GeneID:11511061"
     CDS             join(2735387..2735714,2735830..2736076,2736223..2737522)
                     /locus_tag="MYCTH_2308878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665301.1"
                     /db_xref="GeneID:11511061"
                     /db_xref="JGIDB:Spoth2_2308878"
                     /translation="MTETTPPAAGDPADVPPPHPKYYRSPAASRRAVRPLLLLVALVN
                     LAWSLYQLPLSRVLESRLCREHYAARDPSVLRPDGSVPEQLCKIDPVQQPLGRIQGMT
                     EAAWVAGDFLMTIPLVCLADHLGHRFVLWLNLVPRVLLLAWTFAVGYFDHALPVDAIL
                     AAPVFSFLGGDCVFNSIVYAIVSDLADDNVLRATFFGYVNAVSSIFSSQLGPALASAT
                     MSTLLWLPLWLGIAILLLAIPVISALPLPSTRSYPGSATITGIVDEEEAADDPHHHAT
                     PLLAAAAAAAVAAGGGGGGGGRGGHPHTSTLRSLAARRVGALLALLASPTRSLVLLLS
                     VFFLASLASSDTKLLPLYISNRYAWTFASVGYLLSAKALFNFFLLWVAVPRVLRWQQQ
                     QQQRRKQRRKQLGRRQEGTRRRSSSSSTATTTATTPVAVGGGGGGGGGGGNGDRSGSF
                     SSRPSTPDELDTDADWRDVLRNAETCLWLSAAGASCIAGSPSIGLLVPSLGLYALGIA
                     LPMFTYSLLRAPGMGLVGKRGGRDRSRSGSRGRGRGWNRGGGGGGGGGDGEEGGDGLG
                     APVFSVVMLVRTLGTLVGAVVMPALWVTGLGVEILPLPYVASAFFYAIAAVVVKRIHV
                     "
     gene            <2737994..>2738362
                     /locus_tag="MYCTH_2129150"
                     /db_xref="GeneID:11511062"
     mRNA            <2737994..>2738362
                     /locus_tag="MYCTH_2129150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665254.1"
                     /db_xref="GeneID:11511062"
     CDS             2737994..2738362
                     /locus_tag="MYCTH_2129150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665302.1"
                     /db_xref="GeneID:11511062"
                     /db_xref="JGIDB:Spoth2_2129150"
                     /translation="MTNGVILALAGFGAGLTRELAARPETVHVDSLVLLPGEVRSHSI
                     CRGVPPSAPIADRFGGGTPSARWTRRCNGWGTRCIRRWRHGIEAVLLRIAPEAARTKG
                     LVDQLRFKKEAWNEFLAKNQ"
     gene            complement(2738546..2744116)
                     /locus_tag="MYCTH_2308880"
                     /db_xref="GeneID:11511063"
     mRNA            complement(2738546..2744116)
                     /locus_tag="MYCTH_2308880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665255.1"
                     /db_xref="GeneID:11511063"
     CDS             complement(2738656..2743923)
                     /locus_tag="MYCTH_2308880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665303.1"
                     /db_xref="GeneID:11511063"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_2308880"
                     /translation="MTEIASPSPTHAIPPAASGDNSQHPEQPPSNTTPDPAESVKREL
                     DNPHNGFGKHGQDSENLAERHAEAELQERSGTRDAREATSTDDGPPAKRRRIRGATPN
                     NTVRKPKPESPPWKKIEPDGPSTFVTDDGRRKSGRINAVPLELQPSDKRITRQVLQNQ
                     HSSPTKNRNVATNGYGSNRVSTPNSATVAKRAVSSGKQPPPKSPANRTPQRKPAAQDS
                     KSSARSRRRSPSPKRPATPAKQSLGTRRSTRNLRRVDHDGEDTAPSGTRTTPRIKLRV
                     RPPLTTIPLVHRDQANLRPKLGPSFEEFFERAAEIPVEEGGLFVAAEDGPRYTEESLR
                     EDARLILRVEKEVEPGGILSGERCSVFEPEPEEEPPRQWAHADHLTKAMSNFRKLMLL
                     EQQRHRATAKRLAIACQAEWIRRNPQPKTAEEIELEELEQNKLKWRQVNKVISGTWEN
                     VKAEVNRRRLADWEAEEQRRVKAALNQAVNLSEQKLQARQARFDTEELSDDSLTDDMV
                     SDGDDETGSDDDSDGSGDVTTEGEDDEDNMSSSDDEEDGESELSDEGLTQEQLREKYA
                     NLPDLDDLIGNNSASRRGVLADEAADGGHNDDDTSDESIDMDDDLGSSEDESSEEGND
                     SGSDDDDESEDEPTGLLGLFFGKSELKKLQAEAAASEQTEDKEDVQMLDAEATPGPEA
                     AENVHDEAAVKKENEQPTLDTAIGGEAEQGPTNDGPPSQPLPKILGDEHSRAIPQGVQ
                     PPTDDGQTTQPTTLATVCETRSHDEQRSAEDLPMTDPPEDSGKAEDHAIPTIQQHSPE
                     TEPITNGHSPSRSQSPRASDVTKPTDVETPTSVSLLNVPKTDSRSTSPQPTAPRTEIP
                     FLLRGKLREYQHLGLDWLAALYANNTNGILADEMGLGKTIQTIALLAHLACHHEVWGP
                     HLVIVPTSVMLNWEMEFKKWCPGFKILTYYGNQEERKRKRQGWTNDDVWNVCITSYQM
                     VLQDQQVFRRRRWHYMILDEAHNIKNFKSQRWQTLLGFNTHSRLLLTGTPLQNNLTEL
                     WSLLYFLAPPENGEGGFVDLKEFHNWFSRPESQILESGREQLDDEARAIISKLHKVLR
                     PYLLRRLKSDVEKQMPAKYEHVEFCRLSKRQRELYDGFLSRADTRETLASGNYMSIIN
                     CLMQLRKVCNHPDLFVDRPIMTSFRMPRSVAAEYEVHEQVVKKKLLAVKGMEVVSLKF
                     LNMIPTEYEGMSTSDADRIYQLSTHRILHDLREAQKVRANNAYHALDPASVKSNLVYL
                     ESAARWGRFEELQHCVYLNALRRQQRPIYGKRLTELLTLDTHRRPHKQRPKVPQKIMS
                     WFEEDSFLLHNAIPTLQQRADSMETIISKFACVTPAVVTGDMTRLLLGEKGVQAFEEA
                     DLRLSAPVKYAPYMPKERPPDPWHEARMRLSIQFPDKRLLQYDCGKLQVLDKLLRRLQ
                     AGGHRALIFTQMTKVLDILERFLNIHGHKYLRLDGATKVEQRQILTDRFNHDPRILCF
                     ILSTRSGGLGINLTGADTVIFYDQDWNPAMDKQCQDRCHRIGQTRDVHIYRLVSEHTI
                     EANILRKASQKQMLDDVVIQEGEFTTDYFNKLSVRDVVNTNGEVVANEDDIAANAAMD
                     RVLGGVESANPRSAARVLEQAEDKEDVAAARVAEKEIRQDDADFLEQQPVSGRASGIS
                     SVGQGTPREGTTEPASALGKSGLGLFAGSADEAVVEEEMEYNAFGERMGTIDDYMLRF
                     MTKALESTPLELPKDKKKSRKRGRDTRKR"
     gene            <2744445..>2747060
                     /locus_tag="MYCTH_33514"
                     /db_xref="GeneID:11511064"
     mRNA            join(<2744445..2744633,2744690..2745013,2746500..2746701,
                     2746759..>2747060)
                     /locus_tag="MYCTH_33514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665256.1"
                     /db_xref="GeneID:11511064"
     CDS             join(2744445..2744633,2744690..2745013,2746500..2746701,
                     2746759..>2747060)
                     /locus_tag="MYCTH_33514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665304.1"
                     /db_xref="GeneID:11511064"
                     /db_xref="JGIDB:Spoth2_33514"
                     /translation="MLTCRIVRASPIRATALPMAARRLPFIQQRTFLPQSMVGKSKID
                     EKYPDSDYPTLTDAEDPDMNGGYINPPRIKRQFRDPHADWWDKQERRNFGEPVHEDHD
                     ILGMFSPWEYTWIGTGKGLFQIGVFVAVFLSVCYGVKLTYPDRVSYPREFEGGLEREL
                     GGPGAVRVSQAFTKTGELERLRFPHFRRELLYQNHWRPGDDIGRIKLVISEGFPRDSL
                     SAPIERVKNVVAFSFQHAPLEILESNAIAWPNQSMWQCSGLNPVMPVPTYQLEDGPSS
                     HAHSPGRNSLPLRNLKNPGLPAQITVNNVFQNQTGTDFLGNPPFQMPYLGSSTTGSAN
                     TPSYP"
     gene            complement(<2749064..>2749464)
                     /locus_tag="MYCTH_2129154"
                     /db_xref="GeneID:11511065"
     mRNA            complement(join(<2749064..2749348,2749426..>2749464))
                     /locus_tag="MYCTH_2129154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665257.1"
                     /db_xref="GeneID:11511065"
     CDS             complement(join(2749064..2749348,2749426..2749464))
                     /locus_tag="MYCTH_2129154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665305.1"
                     /db_xref="GeneID:11511065"
                     /db_xref="JGIDB:Spoth2_2129154"
                     /translation="MSIYFARSPDTLEFKQRSINGSARWQQSASTTKIFYEPRVAAGT
                     EAASQSLQVRKSDPSAAIFRAPLHPPPPPPPPQQQQQQQHDAHDSRRGSVGRSPEKCD
                     PDPER"
     gene            complement(<2749818..>2751336)
                     /locus_tag="MYCTH_2129155"
                     /db_xref="GeneID:11511066"
     mRNA            complement(join(<2749818..2750540,2750600..2750848,
                     2750899..>2751336))
                     /locus_tag="MYCTH_2129155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665258.1"
                     /db_xref="GeneID:11511066"
     CDS             complement(join(2749818..2750540,2750600..2750848,
                     2750899..2751336))
                     /locus_tag="MYCTH_2129155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665306.1"
                     /db_xref="GeneID:11511066"
                     /db_xref="JGIDB:Spoth2_2129155"
                     /translation="MDHILEKQPTTASTSLERAEERPPSSHLPGLARASFMTLPSELL
                     TEICTNLCWYLHAEDDGSSDVAIRAREGQCALARLSRTCRLMREIVRPLLFGRVYASR
                     TSDLYLLVRALVGRAELGSTVTEVVVTTPHQAGEMAYSQQIAGIVHGTAGDRFAALAS
                     LLLHSAPNLTSASFHLLGPPSLVIEQALKRWNTSAVQHLTRLRLRRLTLRAFDRDHQF
                     VLDQAVYLLRAFRGLSGRAPIPNPPRLPNLTELILTDCGVARRGLANLAHALGDRLAR
                     VTVRKDGRRGRGWGPGPAGGAGGAAPEFTIASLELEEILEALRPRWAGTLRELTYHVP
                     RALRLFPAPAPESLAHFGALELLELSTDAVEFDELRRRPGVFASWLPPSLRELRIRGP
                     AVLVSSLRGLLDAVLDGRLPCLARIEITDQACASSASPASPPSPDEVREFRETVAGLR
                     SRGVHVIIHPQDPEPEPED"
     gene            complement(<2752170..>2756560)
                     /locus_tag="MYCTH_2112181"
                     /db_xref="GeneID:11511067"
     mRNA            complement(join(<2752170..2752280,2752335..2752381,
                     2752440..2753525,2753589..2753616,2753682..2753706,
                     2753808..2754060,2754116..2754265,2754304..2754341,
                     2754602..2754625,2755203..2756096,2756169..>2756560))
                     /locus_tag="MYCTH_2112181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665259.1"
                     /db_xref="GeneID:11511067"
     CDS             complement(join(2752170..2752280,2752335..2752381,
                     2752440..2753525,2753589..2753616,2753682..2753706,
                     2753808..2754060,2754116..2754265,2754304..2754341,
                     2754602..2754625,2755203..2756096,2756169..2756560))
                     /locus_tag="MYCTH_2112181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665307.1"
                     /db_xref="GeneID:11511067"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR011118"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="JGIDB:Spoth2_2112181"
                     /translation="MARLSALIASTAVFLAFNMLAAPFGLSRGPRLPEKALRCNRVFF
                     GDVLPPDATLEKVAVVREGGSYGEGEANVAYSVDPTGLPALCVITVRVRSSSTSSYRL
                     GLFLPDKWNSRFLVVGNGGFAGGINWLDILYNFPVTDPKHLSVADTALIADEVIRQCD
                     LADGVQDGIVSTPDRCAPELTVLLCSGKDNGAKNAPTSGKADCLRPAQLETARNVYSD
                     WTLPPNNELLHPGLTFSSEGEWLLILNGSEPVPYGIGYARDFLFDDDGGGGGGGSGSD
                     APPWDWRTSFNESVVRYADEHDPGNATADDCAALGAVRERGGKVVIYHGLADGLVPTK
                     GTGVYWNRTLDALGGLGGLGGLEDFMRLFLVPGMGHCYGTAVDAPWNFGGAFQAGLIG
                     SGVWSVPGFEDAEHDALMALVDWVEKGKPLDSIVATTAQETLLVGRWEGHHRLVHGPA
                     CHLALTRVRPQLLKTLGLRVSCIKIDPYVSVDAGLMAPAEHGECFVLCSGGEVDLDLG
                     NYERYLSVRLTSDHNITTGKVYLNVIQKERRGDYLGKTVQIVPHVTDSIKEWIRRVSK
                     IPVDGSNEEPDVCIIELGGTIGDIESMPFIEALTQLRHEAGSGNFMNIHVSYVPTVHG
                     EQKTKPTQHAVKSIRSHGLIPDIVACRCETPLAESTVAKLALHCQVEADQVLVVRDMP
                     TIYQVPLLLREQELIRQLRAKLALDKLTITPEMVAQGEALWDLWTSVVTPTYQEEVKI
                     ALVGKYVRCQDAYLSVVKALEHSAMRIRRKLNLMWIDSSDLEPTTGGGAAQAKYHKAW
                     HDVSTAEGIIVPGGFGHRGTEGMMRVTKWARENNIPFLGVCLGFQVAAIQFARDLCGM
                     PEATSEEFDAQAKDLVVVNMPELDKQNMGGTMRLGLRKTIFQPGTEWSRARALYGGVE
                     VIEERHRHRYEINPQLVETLEKAGLHFVGKDETGDRMEVFELKDHPFFVGTQFHAEYQ
                     SQVVHPSRPYLGFIAASAGCLDKVLNQKPVEPFKTVAVLNGTK"
     gene            complement(2758239..>2760333)
                     /locus_tag="MYCTH_2095369"
                     /db_xref="GeneID:11511068"
     mRNA            complement(join(2758239..2759025,2759160..2760078,
                     2760250..>2760333))
                     /locus_tag="MYCTH_2095369"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665260.1"
                     /db_xref="GeneID:11511068"
     CDS             complement(join(2758559..2759025,2759160..2760078,
                     2760250..2760333))
                     /locus_tag="MYCTH_2095369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665308.1"
                     /db_xref="GeneID:11511068"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2095369"
                     /translation="MSSDSVHETDPEKAAAAHKAELDAETNEKTPADAAVGYTAAEER
                     ALLRRQDLTILPLSAAIYFLCYLDRSNIGNARILNSTSGDDMQTEIGATPRQFNIALM
                     VFLVGYALFEVPSNVLLKKLRPSRWLAFLMFSWGAITMGMSGVRSFSATAGVRFLLGA
                     AEAGLFPGLVYYLTFWYRADERSVRVAFILASATLAGAFGGAIAYAIGHMNGARGWSA
                     WRWLFLIEGAPSCASALLVWFFLPDYPEESLSGRHRQVAIDRLRVEGSKAGHRTMTWA
                     DAKATLTDWRLYGHYIIYFAVSLPFSSLSLFTPSITAGLGYKDLQAQLMTVPPWAAAY
                     VTQIVVSYSADRFNARGIHSAALALVGGVGFMASALLPPDAYLHRYGCLIVATAGSFA
                     CIPPLLGWLTSNVHSTASVGLAIAINVSFGAGMGQIPGVWIYKADEAARGYPTGHWAN
                     AAMLFLVALGALGLRVLYGYRNRKLLRESGGQEVRLYKL"
     gene            complement(2763017..2765294)
                     /locus_tag="MYCTH_2308893"
                     /db_xref="GeneID:11511069"
     mRNA            complement(join(2763017..2764710,2764837..2765294))
                     /locus_tag="MYCTH_2308893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665261.1"
                     /db_xref="GeneID:11511069"
     CDS             complement(join(2763228..2764710,2764837..2765015))
                     /locus_tag="MYCTH_2308893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665309.1"
                     /db_xref="GeneID:11511069"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2308893"
                     /translation="MAPTVSLVLGGLAATYVFLRVLLTLTQDAREPPAILTDIPFVQP
                     LIGMIREKAGFYIRLRDETRLPIYTLRLPFQRIYVVNATELIPVLQKQWRVISFAAIA
                     ADAGNVVGISKEGLEIMKRDLTSEHGFSTSWPRYIMPTMAPGPDLDAINRRAIEIYVD
                     EMARLRARAAGEEGQPGKVVVGLWEWTRRMMVDSTTEAVWGPENPYRDPAVADAWKTF
                     EAGFLTMSMFPLAWLLFPKLHAAREVAARAMIDYMRRGGYKTASGLVRRRVEHHCDLF
                     GLSLDDVGRGELGNTFAVLGNTTPCALWVLYQIVSDDRVLADVRAELEALVEEEVVEG
                     EEEEAEDGPTLVSSIDLARIKESCPVLLSTFQETLRFRAVNPGPRVLLEDVSLDGGRT
                     LLKKGAMLMIPAPVQHTDTDAWGDDARQFDHRRFAPPSAGDGGGSAQGNNKKRKKPNR
                     VAFRAFGGGHVLCPGRHFASTEILSLAALLVLQFDVVPVAGRWVEPTWDNSPAQAGFP
                     VIDQDIPVELRPRDPRRKWRVVYSGSDKAMNIVAEDISAGGRGAL"
     gene            2766203..2768924
                     /locus_tag="MYCTH_2308894"
                     /db_xref="GeneID:11511070"
     mRNA            join(2766203..2766703,2766843..2767389,2767556..2768924)
                     /locus_tag="MYCTH_2308894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665262.1"
                     /db_xref="GeneID:11511070"
     CDS             join(2766632..2766703,2766843..2767389,2767556..2768631)
                     /locus_tag="MYCTH_2308894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665310.1"
                     /db_xref="GeneID:11511070"
                     /db_xref="JGIDB:Spoth2_2308894"
                     /translation="MAVDTSSALFAPTGNDNIAPTPFYVLNWVFFVLCVVAFVMRAYV
                     RYLCFRRLVLEDYLMLVALVLHCAEAVLVQLYVGYMYDVEAVEKGDFSVMGPDFFPNS
                     KKGFAALGASVNITIVGVLIIKLNFLIFFKRLGTCIRKFNIAWWAVTFFTVASAITQI
                     GMQTFGCFFGSTDYIFSEHCAAEPALTRIFANAIYSAVVDAVSDVLIVCLPVWILWGS
                     GITLRKKLALTFVFSLVWLTIAITIVRGSIFHKQYSMAASGEGSQMQSATFTWFWFYT
                     EFSVAFLIACFVSFRSLFVQRSKQASTPRQQQELREKAYQSALRRRADRSWRARWHYL
                     HESLLDMCRTLEGWSGSDDETLRSRGWLPHVPSGLMTVDFQDDDNWMRKRNLNNTAIK
                     STDKNNNNNDNNNNNNNNKTDDNNGKAAQDTIIKTVTTTMTTTTTMSTLREEEEGVAV
                     ESPYDPYQENPPRYDLEQQQQQQQQQQRYLRYGLYPQHQQYSYPRQQQPQYYAQHPQH
                     PQHPQHPQQQQEQQQQQQQYTMDTRPGSLHSEEMLLQEPEPAHVRRGGLGPVGMAR"
     gene            complement(<2768988..>2770386)
                     /locus_tag="MYCTH_95817"
                     /db_xref="GeneID:11511071"
     mRNA            complement(join(<2768988..2769024,2769145..2769343,
                     2769555..2769653,2770006..2770214,2770340..>2770386))
                     /locus_tag="MYCTH_95817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665263.1"
                     /db_xref="GeneID:11511071"
     CDS             complement(join(2768988..2769024,2769145..2769343,
                     2769555..2769653,2770006..2770214,2770340..2770386))
                     /locus_tag="MYCTH_95817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665311.1"
                     /db_xref="GeneID:11511071"
                     /db_xref="JGIDB:Spoth2_95817"
                     /translation="MRSQNFGCEREDWARVCGVATIRPVPRSQDETNEKPRPARFELD
                     PLGDLSPPLRRQRGAVSTGAAPARPNNLRQAAKTRCLLGKVVRPGDCGAAQRGAAAPA
                     PPADHLNDLGLPRYHSGGARMQPFGGYLAQPTPCVACCTRLSVQLGPPSVFRECRAGT
                     SIPYGVLLVDSRFLWSPSLWRSSSVQGITQYVSWGV"
     gene            <2770929..>2773195
                     /locus_tag="MYCTH_108615"
                     /db_xref="GeneID:11511072"
     mRNA            join(<2770929..2771331,2771427..2771464,2771576..>2773195)
                     /locus_tag="MYCTH_108615"
                     /product="cytochrome P450-like protein"
                     /transcript_id="XM_003665264.1"
                     /db_xref="GeneID:11511072"
     CDS             join(2770929..2771331,2771427..2771464,2771576..2773195)
                     /locus_tag="MYCTH_108615"
                     /note="Cytochrome P450-like protein"
                     /codon_start=1
                     /product="cytochrome P450-like protein"
                     /protein_id="XP_003665312.1"
                     /db_xref="GeneID:11511072"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_108615"
                     /translation="MALLALMLWAPLAWLAAWTAYSWYCLYCNYQEARTLGVPVRVIP
                     IDHLNKLWLLVDKQVVSLVRRLPGPLGNNSFTRFNYRGWHEDDGLRAHDEMGDAWVLV
                     TPCRNWLYLADPDALMSMYRRGKDFPRWVEITKMLDVFGGPNIATASGDEWRRIRRIA
                     NSAMNERCNAVVWDESAALGEAMARYWASKGVFTSVGEDSRTVTLHVLAKACFGQSFP
                     FEGHDERAPTSASARFRFSLLTVMENALLILALTPRFFTCPWLPLPPAWRRLGAACEE
                     FKRHMASFYRRELRALREEEGEGEGEGEEENGEKKKTKRDYTLIGALVRESRGRLGKS
                     IDESNQDWEKQLQKDENSKKEEGEEESWEEESWEEGAGHYGIGTGKATGKIGGGGGGG
                     GGMTEDEIYGNMFVFSFAGHDTTAHLLTYAVFFLAANPSVQSWVAAEIRRVLGTRPRS
                     EWSYHGDFPRLRRCLAVLYETLRVKTPVCEVKWTAGRAQQLPLGVGGGGGGGGGMGVG
                     VGGPRSITVPPRTLVVPSYLYVQKHARYWGPDAAEWRPERWIARRDQVLTADGQLTCH
                     AGNDNTRFNNAAVADAGAGAGDGDGDEILLPPPSRGNFLGWSEGARDCPGKRFSHVEW
                     VAFLAALFRDWKVEPQLRDGETFAEARTRLLDFVEADTGYGGLLLQLLHPERVPLVWK
                     PREP"
     gene            2774721..2776946
                     /locus_tag="MYCTH_2308895"
                     /db_xref="GeneID:11511073"
     mRNA            join(2774721..2775143,2775330..2775836,2775989..2776946)
                     /locus_tag="MYCTH_2308895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665265.1"
                     /db_xref="GeneID:11511073"
     CDS             join(2774959..2775143,2775330..2775836,2775989..2776940)
                     /locus_tag="MYCTH_2308895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665313.1"
                     /db_xref="GeneID:11511073"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2308895"
                     /translation="MALVLVPIAGAAVVALVVFLLDRLLNLPHDPQEPPLVRPKIPLI
                     GHVIGLLRHGTRYYSMIAEECKQPIFTLGVPRGKMYIVTSPGLIAACDRRSKVVSFAP
                     YVVEFGKRILAGSEHSVRLLSEDLLEEKEEAKGSGGDGSSSSSSLRPETMAAMHRSQA
                     PGEHLDALMRVALRSAATHIDSIIGDAAAQGAAGVPLFGWVRQFMTRAGTDAVYGEEK
                     NPFRDPEVAESFWAVDRDFALLGLMVLPDLLAPRGSRGRKRFFRAFREYYASGGLETA
                     SYLIKARYEVNKKYGVSDEDIARFDLGVCTALLVNTAPAVGWTLCHAYSDRALLAELR
                     RGIDAAVFPGGAPQTAAAVDVTVNICEVAEALPLLESFVREVLRVQSNSASARFVLRD
                     TVLDEGGGGGGAGGRRYLVKAGSFLGMPSAPVHSDEAVWGPTARSFDPTRFLPERQKE
                     RKVPASAWRTFGGGNALCPGRHLALREIMSVLVIMVLRFDLEPCEDGGRWEMPAKRHH
                     ISTSILTPVDDIRVRVRPRKELARVTSWNFVWEPTAPKE"
     gene            complement(2777573..>2779376)
                     /locus_tag="MYCTH_2135245"
                     /db_xref="GeneID:11511074"
     mRNA            complement(join(2777573..2778028,2779209..>2779376))
                     /locus_tag="MYCTH_2135245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665266.1"
                     /db_xref="GeneID:11511074"
     CDS             complement(join(2777834..2778028,2779209..2779376))
                     /locus_tag="MYCTH_2135245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665314.1"
                     /db_xref="GeneID:11511074"
                     /db_xref="JGIDB:Spoth2_2135245"
                     /translation="MLLGIGLHHRLPSVSLPPQNGNGEGEYDGGGSGGGGGGGGGGGC
                     FGLVDMPIPNPSSLPAGPNDVLATGFDTAHVQVTTGSGLHDRTVAEHTLGLLLKRDLA
                     LLRNARLPGAAKHLVYIE"
     gene            <2780260..>2780898
                     /locus_tag="MYCTH_56270"
                     /db_xref="GeneID:11511075"
     mRNA            <2780260..>2780898
                     /locus_tag="MYCTH_56270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665267.1"
                     /db_xref="GeneID:11511075"
     CDS             2780260..2780898
                     /locus_tag="MYCTH_56270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665315.1"
                     /db_xref="GeneID:11511075"
                     /db_xref="JGIDB:Spoth2_56270"
                     /translation="MPALSPLLLAGLATLVSAETRGITPHDMYSSSVGVLGCKIDTNR
                     VAYWPMAVDCDNICVRVTYNGRSVDLLRIDQSGGAYDISYDAWAYLQTGQSAAQNPIT
                     GGAVNMQIETVSADNCLKHLKTGGLPLSASNSINYVASCLGQPNSWVAQHYQLFNIQD
                     PVCHWGWDEQCSLNLAVSNQPTCPHQLGTTNGRLPDSVFNIQYGTGKTVAAP"
     gene            <2807694..>2807956
                     /locus_tag="MYCTH_2066477"
                     /db_xref="GeneID:11511076"
     mRNA            join(<2807694..2807841,2807889..>2807956)
                     /locus_tag="MYCTH_2066477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665268.1"
                     /db_xref="GeneID:11511076"
     CDS             join(<2807694..2807841,2807889..2807956)
                     /locus_tag="MYCTH_2066477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665316.1"
                     /db_xref="GeneID:11511076"
                     /db_xref="JGIDB:Spoth2_2066477"
                     /translation="ISNYGFIVIACSYCIEYNQVYKMIEKSCRYKACIRQGHTYNGSS
                     VLVSSLDHIIYEQRRLKAKEKEAKALL"
     gene            <2820417..>2820758
                     /locus_tag="MYCTH_2066229"
                     /db_xref="GeneID:11511077"
     mRNA            join(<2820417..2820558,2820577..>2820758)
                     /locus_tag="MYCTH_2066229"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665269.1"
                     /db_xref="GeneID:11511077"
     CDS             join(<2820417..2820558,2820577..2820758)
                     /locus_tag="MYCTH_2066229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665317.1"
                     /db_xref="GeneID:11511077"
                     /db_xref="JGIDB:Spoth2_2066229"
                     /translation="FMPSNQGEKPYFLLEVRNDLIGFIEAEVLPNKLARAVKNFINYN
                     IFLLIVVNRGSKFKGEVKAILEELGVKCIIISPYNSRANNINKARYIPIIATLAKITV
                     KIRKN"
     gene            <2848842..>2852252
                     /locus_tag="MYCTH_95813"
                     /db_xref="GeneID:11511078"
     mRNA            join(<2848842..2848859,2849031..2849047,2849705..2849744,
                     2849883..2849891,2850032..2850049,2850137..2850150,
                     2850593..2850599,2850686..2850703,2850954..2851060,
                     2851261..2851283,2851349..2852064,2852121..>2852252)
                     /locus_tag="MYCTH_95813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665270.1"
                     /db_xref="GeneID:11511078"
     CDS             join(2848842..2848859,2849031..2849047,2849705..2849744,
                     2849883..2849891,2850032..2850049,2850137..2850150,
                     2850593..2850599,2850686..2850703,2850954..2851060,
                     2851261..2851283,2851349..2852064,2852121..2852252)
                     /locus_tag="MYCTH_95813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665318.1"
                     /db_xref="GeneID:11511078"
                     /db_xref="JGIDB:Spoth2_95813"
                     /translation="MARVGLAYKLGKKEKGKNKYRSYKEVGQIISLYILLDTRKKIYL
                     LYKTYADGAKIRLRIRQHVSWNSLALPGVRRRWQPSRWQLPRGLNQGLSNICALAGYG
                     DENNFISLASRPPPFPWRTTQMQDAETPASNRTSTEANKKFPHALRLFTSTYTIVYRR
                     FGDNTILSYLHVTLVFIYHLTFCPDAIAHVAPHLPWKLTALMLNPLVSFSSSSAEQQH
                     NGSNLLESEGFPAIREVRKGEDEDVEVTKTTKEESSAGNGGQENTKSLKLDLARRGRR
                     PLPDDYAMRGFPWVERYFPGNWFNTDKRVDDDDKYLELASMILERRNRLLWLGTRMFG
                     VNPAYEVELDLQLPEMPPIPSQSVDMDIEDLPDAGSVA"
     gene            2852955..2854463
                     /locus_tag="MYCTH_2308902"
                     /db_xref="GeneID:11511079"
     mRNA            join(2852955..2853129,2853180..2853454,2853519..2853721,
                     2853773..2854463)
                     /locus_tag="MYCTH_2308902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665271.1"
                     /db_xref="GeneID:11511079"
     CDS             join(2853008..2853129,2853180..2853454,2853519..2853721,
                     2853773..2854102)
                     /locus_tag="MYCTH_2308902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665319.1"
                     /db_xref="GeneID:11511079"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2308902"
                     /translation="MRRSTRKMFPFEHGQILQGRISSYTIAAALRNRQGGPWLATGPK
                     QERVTVKAAPAKRLENEARMLRLFQGCDSIRQLVDKVEDPRSLVLEYMDDTAFNLLKA
                     KRLPKAEAKRALKATVQALVVLHEKNIVHTDIKPDNILVKYSPAGTLYKLGDLGDCST
                     PDVPSNDGGHLIGAELFCAPEVLLGIPWTVKADIWGLGATGITLITGRYIFLPRNAPP
                     PGDPRLSLAVLQIQNDFYGPISRQALHGLADDSIQPLLEQFEVNYRPFPLSSASDMIN
                     QEDLDFFGHIMKIDPRQRPTAKEILGHPWFNGV"
     gene            complement(<2856557..>2857415)
                     /locus_tag="MYCTH_95811"
                     /db_xref="GeneID:11511080"
     mRNA            complement(join(<2856557..2857367,2857408..>2857415))
                     /locus_tag="MYCTH_95811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665272.1"
                     /db_xref="GeneID:11511080"
     CDS             complement(join(2856557..2857367,2857408..2857415))
                     /locus_tag="MYCTH_95811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665320.1"
                     /db_xref="GeneID:11511080"
                     /db_xref="JGIDB:Spoth2_95811"
                     /translation="MATYVDRVLKQDILLSLDPGRDDCLYRVRRISSGVNRVVYVTIT
                     NLNIIPEEKRTYGPSVIKELSKLSEWSGDWTTLRVYMDGDRIRCETDAFQPHALPEEH
                     VLERYPKYDIFSFDVRRSVNHRVSEVVYGGRTAFLKIARFPFELPLLIREVEAYHRLA
                     ESDVAPKLIGYVFEESPDRVVGFLVESVEGRVANVADFEECSKALEKLHNLVVHGDLC
                     RYNIIITTNGPKFIDFEHSTPITEAENGLVDDEKQSLAEKLVDESGAGRPWDMN"
     gene            complement(<2857424..>2858340)
                     /locus_tag="MYCTH_2129170"
                     /db_xref="GeneID:11511081"
     mRNA            complement(join(<2857424..2857614,2857736..2857882,
                     2858262..>2858340))
                     /locus_tag="MYCTH_2129170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665273.1"
                     /db_xref="GeneID:11511081"
     CDS             complement(join(2857424..2857614,2857736..2857882,
                     2858262..2858340))
                     /locus_tag="MYCTH_2129170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665321.1"
                     /db_xref="GeneID:11511081"
                     /db_xref="JGIDB:Spoth2_2129170"
                     /translation="MSSHLMAATTHVLPPPLSILLALLRASIADQLRSKIIVEHPIRN
                     SLNAFRGSYRSIYNRKSIAFSINAFDQLDHEGRVVAPYGATFYDLSSDDFDLDRIKPL
                     RKVDLADDSDDSCIWDRVYDAVTESTPPPRPVASSV"
     gene            2859313..2860960
                     /locus_tag="MYCTH_2308910"
                     /db_xref="GeneID:11511082"
     mRNA            join(2859313..2859964,2860112..2860960)
                     /locus_tag="MYCTH_2308910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665274.1"
                     /db_xref="GeneID:11511082"
     CDS             join(2859353..2859964,2860112..2860483)
                     /locus_tag="MYCTH_2308910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665322.1"
                     /db_xref="GeneID:11511082"
                     /db_xref="JGIDB:Spoth2_2308910"
                     /translation="MNIDSANNDDTNAPEKPYQGRSGQPPPSSTLNLYRRLPFGRKHF
                     FGHENPDRAAEFFVVNPVPHKHHNSWRPIFYRGDNPKYSGLSTPVGRALRTKMWNRFY
                     IQIGDGVAEVLQNKERVKKRKKYERKQKLRKFFCQGEKPPPEPLEDPQEVRGLVAVFE
                     MKRCGFLGRALEWELGGQRYQWKGTRRFQTGAFRGLKGVSHDFKLVDANNNIVATFEK
                     DRWASCKRSEKLGRPPNKKRLFLGTLQRYPAADAPPPAAVLEAVRSAGPDAAYGLPEK
                     LTKYLNLQGSHSGDLTEEAIAFTCWIAVEAEHRLRYKIFDLIEEVLENIGS"
     gene            complement(<2861097..>2861815)
                     /locus_tag="MYCTH_2026172"
                     /db_xref="GeneID:11511083"
     mRNA            complement(join(<2861097..2861419,2861521..>2861815))
                     /locus_tag="MYCTH_2026172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665275.1"
                     /db_xref="GeneID:11511083"
     CDS             complement(join(<2861097..2861419,2861521..>2861815))
                     /locus_tag="MYCTH_2026172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665323.1"
                     /db_xref="GeneID:11511083"
                     /db_xref="InterPro:IPR000026"
                     /db_xref="JGIDB:Spoth2_2026172"
                     /translation="TIPTLTLAIYAVATAATGSLEPRQGTDSLSSVTCGSTSYTKQEI
                     DDAVAEGCRLYAAGEQLGTNNYPHRFNNREGLTFSISGPFQEFPLLASGAVYSGGAPG
                     PDRVVINPNYRGSCVYAGAMTHTGAPNRNGFVKCEEEEESSPSDGAGSTTRTASSTAF
                     SSHTASRTSTSATSTSDPTSTANPDDNAAGRVVSGTGGQGLVMGIV"
     gene            2862592..2863761
                     /locus_tag="MYCTH_2315969"
                     /db_xref="GeneID:11511084"
     mRNA            join(2862592..2862973,2863038..2863761)
                     /locus_tag="MYCTH_2315969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665276.1"
                     /db_xref="GeneID:11511084"
     CDS