GenomeNet

Database: RefSeq
Entry: NC_016477
LinkDB: NC_016477
Original site: NC_016477 
LOCUS       NC_016477            4127677 bp    DNA     linear   CON 28-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 6, complete
            sequence.
ACCESSION   NC_016477
VERSION     NC_016477.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 4127677)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4127677)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4127677)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4127677)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003007.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4127677
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="6"
     gene            complement(<3962..>5607)
                     /locus_tag="MYCTH_2129566"
                     /db_xref="GeneID:11506398"
     mRNA            complement(join(<3962..5323,5386..>5607))
                     /locus_tag="MYCTH_2129566"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665663.1"
                     /db_xref="GeneID:11506398"
     CDS             complement(join(3962..5323,5386..5607))
                     /locus_tag="MYCTH_2129566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665711.1"
                     /db_xref="GeneID:11506398"
                     /db_xref="JGIDB:Spoth2_2129566"
                     /translation="MAAPEPLRTGGFMARSGPVEIILRILQCCHSTRDLLALVSTCRH
                     VCNVWRGNVAAALWPVWLREIPHFQDALSAARMTELVVQAERRGELPPTRITPDLLQR
                     RQPTLSELRAAFGLHRLSRAIAACLCSLDLTYPDDRPGGDLRPPEDPARMPEWTARVS
                     HAVFRLLIVGAALAGAYKEPLFKALEHPDPEIQALPRRVPREPSHITWEWARDNKLGH
                     KEMAFLLQFAVCDLDASLEAQDAVFGPIADWLLESILSDKESRQAMADRFEQRRGRAT
                     YCLHWEEWEEEGLQCPVGLLTDGRGTHSDAHLVVWELMKMLWLVEQVHPIAGSYGVLD
                     RLTSRPPSTTQGVNAGEHSQGPLESAVAVFFGMFRAEETLLTARRLKGPIENLITYPA
                     VPETKEEGYGDEKLPSTMSVVVFFDYIFNNSGQPNHIVGPKYLVPPLELKFFEYFLQR
                     HLGLCFNDGAFIDDPGSESDDRSYERFVDTATIFSHDDVENRCAMSDALNFADFLDGS
                     EMLTKVPQDLTRIYLQRRP"
     gene            complement(<5630..>5974)
                     /locus_tag="MYCTH_2129567"
                     /db_xref="GeneID:11511534"
     mRNA            complement(<5630..>5974)
                     /locus_tag="MYCTH_2129567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665664.1"
                     /db_xref="GeneID:11511534"
     CDS             complement(5630..5974)
                     /locus_tag="MYCTH_2129567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665712.1"
                     /db_xref="GeneID:11511534"
                     /db_xref="JGIDB:Spoth2_2129567"
                     /translation="MTAATITTFYPLPRLPFEIRARIWELRVEPRIVEVVYYYPSPAK
                     MTDPDAWAKGSMKSLPPVRHPPALVYRSSGPTANSERRRCSLHTFSTTARRCLSSTAP
                     NSLISSSFSLDF"
     gene            complement(6238..8298)
                     /locus_tag="MYCTH_2309690"
                     /db_xref="GeneID:11511535"
     mRNA            complement(join(6238..8037,8097..8298))
                     /locus_tag="MYCTH_2309690"
                     /product="alcohol oxidase"
                     /transcript_id="XM_003665665.1"
                     /db_xref="GeneID:11511535"
     CDS             complement(join(6337..8037,8097..8192))
                     /locus_tag="MYCTH_2309690"
                     /codon_start=1
                     /product="alcohol oxidase"
                     /protein_id="XP_003665713.1"
                     /db_xref="GeneID:11511535"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR012951"
                     /db_xref="JGIDB:Spoth2_2309690"
                     /translation="MRLHIALSLFYTLGHAVGAEPQHAKRTPKCRCTPGEACWPDNSV
                     WEAFDKTLGKGKLIKTSPIAQSCYDGPQKDLDRCAYVNKMWTDQDFQTSDPIGRNYPY
                     NITCAPVDYAAGETPTSCILGSLPYYAVNASTREDITLTLNFAKQHNIRLVTSSTGHD
                     LLGRSDGYGGLELWLHSFRNGVRFQKKYTSANKCTKSGWTGSAIHIDGAYQWRDVYTV
                     AQANNVIAVGGGSPSPGAIGGWPSGGGHGPATHNFGLGADQVLEAQIMLADGRIVTAN
                     HCENSDLFRAIRGGGPGYGIVLSQHIKVHPNVKAVTAHRLAIAPRNETAENKDLLDAI
                     AVLHQQLPALSNNGVAGYGFWFRSFPGPFVGDAHSGYTHGFWTIGKRQAEAEKAVAPL
                     MNALKKFEDKLVITSTFAEYQDYWSFYWAESGLHDPVGSTSIITSRLINPEALTDYNK
                     VREAIEVVAGKPEEVSSNVVLLVSGGQVFKDKADTSSGLHPAWRVSPFVMISGQGIPK
                     VASREIRDYVQHQVTHVKGAALKKLAPNTGGYMNEGDGSDPEYIDAFYGKNYAQHLAA
                     KRKYDPDNIFFCRTCVGAEDFIERPDGPLCRK"
     gene            9545..11359
                     /locus_tag="MYCTH_2309692"
                     /db_xref="GeneID:11511536"
     mRNA            join(9545..10474,10548..11359)
                     /locus_tag="MYCTH_2309692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665666.1"
                     /db_xref="GeneID:11511536"
     CDS             join(9904..10474,10548..11170)
                     /locus_tag="MYCTH_2309692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665714.1"
                     /db_xref="GeneID:11511536"
                     /db_xref="JGIDB:Spoth2_2309692"
                     /translation="MSITATAAATAATPPAAFTPHPDAPLSGAARSVSESGLVAVVWV
                     CFSIATLFAALRLIVRFRGNHFFLADDYWIMFAWMTLLTMAILQTLQMPSLWYLTYLR
                     AGRIVPDQSTAHKTEQLTRWQFPIIKLFWTTLWSVKASFMTVFFRLVKPFPVIRRLWY
                     CVAVIAALAYIGCWLSSALTCNPPSDYFKAGKCNSPREVWNQSFNVIYSTTVDVATDL
                     MIMALPISILPSLKLDKRRKIGLGIAFSLGAIIITVAIVRMTQVIKPNSTDAVDLIGL
                     AIWGAVETATAVIVGSLPPLKALLSRNLKKYHGSSRTKGSRYGTARTPQGLATHRSHG
                     GGYGPNSESRTVMVAESIPLDAMHNQTGGGIYVQRSYQTTVEFDEASSREDDEVGIIK
                     RDPQT"
     gene            complement(<11796..>13400)
                     /locus_tag="MYCTH_2112541"
                     /db_xref="GeneID:11511506"
     mRNA            complement(join(<11796..12936,13018..13299,13378..>13400))
                     /locus_tag="MYCTH_2112541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665667.1"
                     /db_xref="GeneID:11511506"
     CDS             complement(join(11796..12936,13018..13299,13378..13400))
                     /locus_tag="MYCTH_2112541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665715.1"
                     /db_xref="GeneID:11511506"
                     /db_xref="InterPro:IPR009770"
                     /db_xref="JGIDB:Spoth2_2112541"
                     /translation="MQNGTTSSWDADLLRSRFVRALSDMYRNEVPLYGQLVDIVQGVD
                     RSVLASRGQSLDDLPKRHQLERHGAIRLGTQHEMRMISRLFGIMGMHPVGYYDLKIVG
                     FPLHGTAFRPTSEESLRRNPFRVFTTVLRPDLISSPSVRKKATEILSRRTLFSPRLCE
                     LMDAAEKDRSILTASDADELIAEALKIFKWHSRSTVPYETYLSLEQEHPMVADIVCFP
                     SAHINHLTPRTLDIDAVQAEMIAQGLPAKETIEGPPAGRKCEILLRQTSFKALEERVT
                     FSDEQGSPAGGKNGTHTARFGEVEQRGAAVTRKGRELYDRLLTSAITLAEREGRVLSE
                     VLAEAFREYPDDWDELRKQNLVYFRYRVPQGVTQKSLDAIGVAKESSVHMEQLLQAGL
                     VECEAITYEDFLPFSAAGIFTSNLKEEPGSEGNGTTRRKLQEVENSGRDELQRLLGSE
                     IPSEIDLYKELQSASVRECATLLGLKEVLLA"
     gene            26593..27364
                     /locus_tag="MYCTH_73162"
                     /db_xref="GeneID:11511507"
     mRNA            join(26593..26614,26677..26883,26931..27364)
                     /locus_tag="MYCTH_73162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665668.1"
                     /db_xref="GeneID:11511507"
     CDS             join(26760..26883,26931..27076)
                     /locus_tag="MYCTH_73162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665716.1"
                     /db_xref="GeneID:11511507"
                     /db_xref="JGIDB:Spoth2_73162"
                     /translation="MPCSHCFSRGLCCRMIESSSRCGECVRRGRSCDGSGVPVSSLSR
                     IVDESKRLDRLEQDAEEALRADRDSLAKAQRRLDESLARLDRIRR"
     gene            <36697..>37047
                     /locus_tag="MYCTH_2069736"
                     /db_xref="GeneID:11511508"
     mRNA            <36697..>37047
                     /locus_tag="MYCTH_2069736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665669.1"
                     /db_xref="GeneID:11511508"
     CDS             36697..37047
                     /locus_tag="MYCTH_2069736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665717.1"
                     /db_xref="GeneID:11511508"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2069736"
                     /translation="MEIPSTQRAALVEKTGGPEVLEHRSDHAVPQPKEGQVLVRNEIA
                     GINYIDTYFRTGLYPSPKPEVLGREAAGVVVTLGPGTDKYNLKVGDRVIWLTNAGYLR
                     SDIDLNNGLLSRAH"
     gene            <37086..>38273
                     /locus_tag="MYCTH_2120498"
                     /db_xref="GeneID:11511509"
     mRNA            join(<37086..37295,37608..37697,37732..37839,37907..38077,
                     38118..>38273)
                     /locus_tag="MYCTH_2120498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665670.1"
                     /db_xref="GeneID:11511509"
     CDS             join(37086..37295,37608..37697,37732..37839,37907..38077,
                     38118..38273)
                     /locus_tag="MYCTH_2120498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665718.1"
                     /db_xref="GeneID:11511509"
                     /db_xref="JGIDB:Spoth2_2120498"
                     /translation="MATKDTTSTKEQYYAALASNNVSPLWTVLSKMVPPRVNPTAQVT
                     SWPYESICSLLMDSGTLITAEEAERQLILPGQTAPAHRHVALVLRFIVEGSRGFTAGV
                     ILTPSWHWHDHGSEGMGPMVWLDGLDLPVYRFLPKFPWAQTAAALDANPAEMYARYEY
                     RLENGAYLSQAIGAREERVAAGTTTRSILQRRVQVRWKARDTFSVPAWSAVSHRYTLE
                     EGNAYLFAVNDMPMIEALGLYRQEVV"
     gene            <39646..>46726
                     /locus_tag="MYCTH_2120499"
                     /db_xref="GeneID:11511510"
     mRNA            join(<39646..39921,40013..40391,40498..40773,40918..46067,
                     46703..>46726)
                     /locus_tag="MYCTH_2120499"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665671.1"
                     /db_xref="GeneID:11511510"
     CDS             join(39646..39921,40013..40391,40498..40773,40918..46067,
                     46703..46726)
                     /locus_tag="MYCTH_2120499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665719.1"
                     /db_xref="GeneID:11511510"
                     /db_xref="JGIDB:Spoth2_2120499"
                     /translation="MVLTLKQFSGNVLGSSVSSQLLNATYDSIRNWIKNQRMTHLPPE
                     GSDYDKVLAWAQLFIERLHSFDTAIRELDRQSTMAAQVAYGYCFILLELGKENSQALM
                     RAFRFFYTISMPMVNLLERTELFNVSKEIQEQLILALSDLVGLVGSVATHFRNTIEDA
                     ISKPDASSKLDTSSTPISSFNLYSTFSEQIRTFRVRCERIGEIMWRYQLVMAKLDAEA
                     VSDAELVKRWLAPEDRVLTSVADRRSLLAHDREELTCLWIAPHLTRFLKGENKILSIS
                     GRPGSGKSVLSSVIVEYLQRPILGVNYDALYIPISKRIPVEASARAVAKSVLGQLFEK
                     RIGNVKLLQILCDAHDQSKHASTYEEYDQIMWMAVERALATALPGARELVLVVSGIDE
                     ASCDEAALFGRLAKATANGTNVRLITLGREAHSPADGLMSIHMSEDLILDDIMAVIRN
                     DFDVDSEFSQMSEFEQESIVTRLAESSTGSFIWAKLATKRLRRAVGLEKLREAIEEVV
                     TKKPTIKDFVIREVRSPNVRDEARHMLVWLAIANRPLSLKELAILAQIDVGNGTISNR
                     HIDVLSTMKHVQGLVFVQDGLMYLRHGLVRAALLDMIAKAELAPEITDAQGDLVARLL
                     LYIKAKVPEQHKPSVTVLNSHETGQLLDNNPLLDLAVLYWPIHLTKTQDFRSGGKEGA
                     AKAFSRVFPTTITALLLQASLWEHRPTPALLEYQNTITDIYRQLYREKSALTLQLLIF
                     QAVLHRQVGKIDQAASLFFEVVLTGNEFLGPGHTVTIQMANSYLEVTESKRTSFVTGI
                     MDKREQVLLVLVEGYKVQFGETSTQAVSILRQLEQHYRSVHQEQKAQEIKTKIDRSTD
                     RKKPEGGDYVNPDNGRVHLYHIWSTPHEDGQALRLEFEERDELLLGESKSYNFGDLLE
                     KAEKYAANGDAESAEQTYFTLWRWASEEYRVQYSEVWVERNLQTLLSYSKFLHSQHRT
                     SEAKGILVGVWKEYGSSKGWSITETSASLLVQIAQVMKSVDLSFAALSLFQQCEHYYR
                     ATRRTETSTYRELQKSIETTSREVLKWVSSSESVYSEFTLEQTVLESLGFSRSETQLT
                     LSATNSLVSLYISQHRWHDASRLLKTVLRRIWPSLFSAHAQEVKLPRESIKLCLDLAG
                     RLADCYHVRRLWGHEENIRVRVYCVLRASGRVDDKLRERATTDLVVFYRRASQTESLI
                     ALRQEILEDYTTFYGEQHPAVIKTLWELADLARPRPVFVEYYRKIVRALNKEAEISTP
                     EALPAVIVVARELWSRGMFSDALPYYRTLFATFLKAPKTSPKFQDQEWVLGCFSQYTD
                     CLRSLRVSFSVLEEVTSQFLAQCKALYGAKATITVQVTLILARLYQESRSHEQKAIAL
                     YEELLQLGSEHINREEISADLKVLHDAQVNAIKSSETRSEVTSSQLDRHSTVLRERIV
                     SVRQKYGWAHGETLSTLTELVHTYSRQGKTEALVSELEQAVVNIMATETSSTRLVEAA
                     STIASHYMAVNQVQKATELVDQVYSQILIKETADVKKTSQVDLSSRGRESLIFLAQFE
                     HSLRRSSATLTEILADLTTQYIEFEKFRSLISSSSSFLDVSASSARLYHSLLVSGRDF
                     AAAYVFSRFTQWFNDTEAKRLNLMANLSTTQVQAFLHSLLDHLGTHKSRDIVRTVGII
                     GNTQVLRLRKNGRFQDACDLAVACFHYIAARKKYRTTTMAKLVLTMGMALGGREPGAA
                     APSAKLNAESSRLLLETSRTILQSALQVLIDLNVNLAKLGIVHLNQLIGLLGEQQNWH
                     ALVSLMARLWSSRETQQEWPPSVTFALLRRYILARWLDGDSRGALRATEHIVYNCRRV
                     LGLRDPITLDMSVLLSQLYTEIGQRYQNQPHARGDENGAAMANRYYRKAAAIHENILR
                     VYSDPAYASMDDVALVTHTNGYGGAVSPSGDGDVSPTLQFDLDRLLAHGQHLHRAQPD
                     AGQVVRQHLRLLKLAIQRLGSWPKDYAEYERLSTDVFREYGADLRGVEGVERWDLRAH
                     GRGRAEADDDLNSYDNQN"
     gene            47281..48918
                     /locus_tag="MYCTH_2309694"
                     /db_xref="GeneID:11511511"
     mRNA            47281..48918
                     /locus_tag="MYCTH_2309694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665672.1"
                     /db_xref="GeneID:11511511"
     CDS             47582..48865
                     /locus_tag="MYCTH_2309694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665720.1"
                     /db_xref="GeneID:11511511"
                     /db_xref="JGIDB:Spoth2_2309694"
                     /translation="MQLRPAANEPESQPNYSPATAQRPCRVDFLHPGYPGRAVLLSLP
                     ALDDGGIDFDTALVACGLVAGNRWNDGFFSLDRSGAVSVERPDDGILREPQYFFHLPG
                     PLNPPYPTVPRFSHWRFPHNDLPPLWQRWAADAAATRMGGEAARRCVLSNYGDGLEMA
                     HLVPAGEDNWWLSNQMQQYSPTQLFSTDPIDGPANLLTLRADLHSVFNERHFCFVPKV
                     GEKSGGDGSEADTGRDGATAERKPPQLVLHVFNSTPSGQLPNLWHNRAVHPIPATVAV
                     ECLFARFAWTILSPRVFDMFLPSTSVPRRLLLWNREKGEWETEEASPEMCRKMWKNAR
                     SCSPRKRSAPRSADAAEELLAKESPRLYDSGYFRADTSENDGCYNDELGPAERQEDQP
                     RGRSRKRRHSFEEEQDCKDSDRSRLRRRMLLSIPS"
     gene            complement(49661..50973)
                     /locus_tag="MYCTH_2309695"
                     /db_xref="GeneID:11511512"
     mRNA            complement(join(49661..50662,50765..50973))
                     /locus_tag="MYCTH_2309695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665673.1"
                     /db_xref="GeneID:11511512"
     CDS             complement(join(49828..50662,50765..50856))
                     /locus_tag="MYCTH_2309695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665721.1"
                     /db_xref="GeneID:11511512"
                     /db_xref="JGIDB:Spoth2_2309695"
                     /translation="MDTSNNKVITFYDIILDPTAYPISPNPWKTRYALNFAKVPYRTT
                     WVPLAAVAETRNALQLPANRKHADGSDFPTLPIIRDPLAATTSGSEVVVGDSFDIALH
                     LQNTYLSNNPPSSSSNDPSSAAAGQQQQQQGQLFPADGSGTVALHRAFNAFVDQIFSQ
                     YGAPLAGFYMPLDPRTAESDKAAFVRRIPGVTRWEDLEIPKGSEVRSKMLAEFESALD
                     TKLGPCFPSPAPADGAKGGPQGTGPFMDGRQLPIYADFIVGGWLQFMRGCLPEWEDMR
                     NKWSGGKWGRLLDALEPWADVDGREGVVPARR"
     gene            complement(<51326..>53769)
                     /locus_tag="MYCTH_58882"
                     /db_xref="GeneID:11511513"
     mRNA            complement(join(<51326..53262,53373..>53769))
                     /locus_tag="MYCTH_58882"
                     /product="glycoside hydrolase family 3 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665674.1"
                     /db_xref="GeneID:11511513"
     CDS             complement(join(51326..53262,53373..53769))
                     /locus_tag="MYCTH_58882"
                     /EC_number="3.2.1.21"
                     /note="CAZy_ID 267875"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003665722.1"
                     /db_xref="GeneID:11511513"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="JGIDB:Spoth2_58882"
                     /translation="MRFLPSTLLLAAAALAADKGRPSLKNAVYKNPKASVEDRVADLL
                     SRMTIEEKASQLLQGDIRNWMNETTNALNQTGLEWSTRYRGSAFYVGVPVPNEWLTKH
                     IKAAQDYIQKETYLGIPAFVQTEGLHGFLAHNATIFSSPIGLGCSWNPSLVEEMAAAI
                     AKEARALGVNQLFAPVADLARELRHGRVEEMYSEDGLLAGEFARAYVKGAQSAGVSAM
                     VKHFAAFGVTEQGLNTGPVHGGERELRTTYLPPYQRAIIDGGVYSIMTAYHSYDGIPA
                     VSDPHLLTDILRDEWGYGYFTMTDAGASDRLCADFKMCASDPIDKEAIVKYILPAGGD
                     VEMGGGSYSFEKIPELVSSGKIEEELVDTAVARVLRAKFELGLFENPFPGLPSEEANK
                     VIHAPEHVALAKKLDEESIVLLENHNNVLPLSKDASVAVIGPMAHGFMNYGDYVVVNS
                     STRGITPLDGIKAASRGKVTYAKGCERWSNSQDGFPEAVAAAEAADVAVVVVGTWSRD
                     QNELWQGLNATTGEHVDVDSLDLVGAQEALVRAIVETGKPTVVVFSSGKPVTAPWISE
                     HAAALVQQFYPSEQGGAALASILFGDVNPSGRLSVSFPRSVGDLPVYYDYLNSGRGAS
                     PDAGVAYENGTLVFGHQYVLGDPRPLYEFGYGLSYSKFEYGDVTVDKTIVTAQDTVTV
                     TVTVKNVSSREGQEVVQVYVKDLIASVVVPNIRLRGFQKLKLRPGESKRVSIKVNVQD
                     LGVWDARMRYVVEPGDFLFLVGASSNDFRGNVTVTVK"
     gene            <55203..>57656
                     /locus_tag="MYCTH_104674"
                     /db_xref="GeneID:11511514"
     mRNA            join(<55203..55218,55274..55428,55527..>57656)
                     /locus_tag="MYCTH_104674"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003665675.1"
                     /db_xref="GeneID:11511514"
     CDS             join(55203..55218,55274..55428,55527..57656)
                     /locus_tag="MYCTH_104674"
                     /note="CAZy_ID 267807"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003665723.1"
                     /db_xref="GeneID:11511514"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Spoth2_104674"
                     /translation="MRFRDGQWLVAEGVQVQYAEEVYRITPTASGKGISLLCPTRKIL
                     NRGNTLNLATLSIDIEPAFDGVLSVETTHWQGAVRRGPDFDLFPAGRPEVDAKVTKTE
                     SGTTLSSGTLSATVSGKPHEFEIAFHPTGGKKPLTTLLNRSVGLAYTPAPSTPMQLAD
                     MRNFRHYIFTQTTLAVGESIHGLGERFGPFNKVGQRVELWNADGGTSSDQAYKNVGFW
                     MSSRGYGVFVDTPGRVELEIGSERCCRLQTSVEGQRLRWFIIYGPSPRDILRRYSVLT
                     GAPGSVPSWSFGLWLSTSFTTSYDEETVNSFLAGMRARDIPVEVFHFDCFWLKAFQWC
                     DFEFDRDMFPDPRGQIGRLKAGGLVKKVCVWTNPYLGQASPVFAEAAARGYLLRRRNG
                     DVFQWDLWQTGMGIVDFTNPDARAWFAACLDRLFDTGVDCIKTDFGERIPSEDVQWFD
                     PSVDPERMHNYYAFIYNKLVYEALQRRYGANEAVLFARAATAGCQRFPLTWGGDCEST
                     PEAMAESLRGGLSLGLSGFAFWSVDIGGFEGSPPPWIYKRWVAFGLLCSHSRLHGSNS
                     YRVPWTVDGDDQSEEGCSATLRKWTHLKARLMPYLFSQAQESVRGGLPLSLRAMCIEF
                     PDDPTAWTLDRQFMLGDGLLVAPVFEEDGTVEFYLPRGKWTNFFTGEVKEGPGWFAET
                     HGFGTLPLYVRPNTLLVLGKEGETRTVYDYTSDVEVRAYFASDSASAVLVDAEGKTVG
                     TLRVKDGEIIGKELLSGSSVINVVSS"
     gene            <59555..>61291
                     /locus_tag="MYCTH_104673"
                     /db_xref="GeneID:11511515"
     mRNA            join(<59555..59601,59685..60089,60265..>61291)
                     /locus_tag="MYCTH_104673"
                     /product="MFS sugar transporter-like protein"
                     /transcript_id="XM_003665676.1"
                     /db_xref="GeneID:11511515"
     CDS             join(59555..59601,59685..60089,60265..61291)
                     /locus_tag="MYCTH_104673"
                     /codon_start=1
                     /product="MFS sugar transporter-like protein"
                     /protein_id="XP_003665724.1"
                     /db_xref="GeneID:11511515"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_104673"
                     /translation="MGKVFNICLAAFAATGSFLFGYDSGVMTDVIASDDFLSFFNTST
                     GSPIIGAINSTFSGGAVFGSLMGGLTMDRFGRRKTIMIGAMIALVGSILQAAARNLPM
                     ILVGRIIAGWAVGLLSMSVPVYQSECAHPRIRGLIVGLSQQMIGVGFIVSTWVGYGSS
                     YASGGLSQFQWRFPLAFQAAPALLLVCGIMFFPESPRHLMEKDNEEEAMRVLRKLHYD
                     GTNDEWIRQEFHEIKTTIAAEKAITVPGWRIMFTVPQWRTRLMHGVAVQVFTQFTGIN
                     VIGYYQTQMYEALGVTGNRALLVAGIYNCLGPLANLIFIIFIIDRVGRRRPLLWGTVA
                     IVIALICESAINSRIDKSNPDHALSIGGVFFLFCVTVIFSWSWGPISWVYMSEVMPMQ
                     IRARGNAFATGLGNWLVSTFWSQLSPMALKKLEWKFYFLFVAWDVLVTIPVVFFFFKE
                     TKQLSLEEIDLLFGERSLGTLPKDLNKGTLDQPEVTAEEKVA"
     gene            complement(<62076..>63880)
                     /locus_tag="MYCTH_2120504"
                     /db_xref="GeneID:11511516"
     mRNA            complement(join(<62076..62897,62989..63426,63532..63609,
                     63653..>63880))
                     /locus_tag="MYCTH_2120504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665677.1"
                     /db_xref="GeneID:11511516"
     CDS             complement(join(62076..62897,62989..63426,63532..63609,
                     63653..63880))
                     /locus_tag="MYCTH_2120504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665725.1"
                     /db_xref="GeneID:11511516"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2120504"
                     /translation="MASPFLIFLAGTVAYALFRLSRVGRRPKGCPPGPPTLPILGNLH
                     QIPKKNAHVQFKKWADEYGPIYSLILGTIVTIRSGIYSSRPEAYISSRASDGCRMVLM
                     EYGNQWRRIRKFFHAFLQLKAIKAYVPCLELESTSVMADLLDKPQLIFHHIRRYTNSV
                     STQLVYEFRTPRIDDPKLLLMYDTMEKFGDVTGAGAAALLDVFPVLRYLPPGIRPLYN
                     HALSIRKASLDLAGDLWFEAKRKVREGTAKPCFCVGLADAQAKEDVDDMGLAMTASTG
                     LEAASDTTACILSGFIQAMVIYRDAQKKAQKAVDRVCGDRFPTMADMDNPEAQYIRAC
                     VKEILRWMPTATLGVPHAVIRADEYMGYRIPKGASVVLSIWGIHKDEKRYKNPRAFDP
                     SRYMDDTTTSSESALGPDPTKRDHFGFGAGHRICEGMHVVDRTLFLFISRPVWAFDLS
                     PAKDADGNDIIPNQDDLIGNFLRQPRPFPLGVKPRSESRAAAVRQAWKDAQELLDQDQ
                     QWKETPEGMPFTL"
     gene            65422..67253
                     /locus_tag="MYCTH_2309698"
                     /db_xref="GeneID:11511517"
     mRNA            65422..67253
                     /locus_tag="MYCTH_2309698"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665678.1"
                     /db_xref="GeneID:11511517"
     CDS             65543..67171
                     /locus_tag="MYCTH_2309698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665726.1"
                     /db_xref="GeneID:11511517"
                     /db_xref="JGIDB:Spoth2_2309698"
                     /translation="MASTGLSEVLFKKVDEYVDSLAPQIQPRITQELDVFQQKTIDSL
                     EEQVIDAFRSLFNKETGGSNESTARTLSDRVPDAYGRQSLPFADEIANLARSFTDVAA
                     EAGDDLRDIFDLTESRDRPGGSRSRGADHTDNVKGFLSAAVQAVQGHLENNSKGPGGG
                     DFQLDGLLGVISNTVKDAARDPEEKARLIAPEIKEKVAAKLREQHAPIAEQFTRIALD
                     HIKRWLRGNTSTRDLGDGVKGEIEEQVKDLVKGLGGLFGNKKTPSHAASRGLEDRTQD
                     RDGGETEGSGGFSKLISEKLSTGLAGVHREVRLEFRKILGVIEKQLFELLPDEFQRPL
                     EKILGGNPFDSQLDRDAGASTDRGFGDDIRAKLLSKIRGLVRKVQETLRESILAIVNG
                     GHRKFERQSWLFVQNMVEQKVQKYLPKVKISVPDDIGNEGVSVGAPTSNIQLGGGHQS
                     TAPLPTFGHSSSPASHAPVASPYQPQHSHAPQYQPQEQYQPQRPPPQQGYQSVNPQSY
                     GEYRPQQYQPGQPHGHQGCYGHGDGYQYGQNPPY"
     gene            69069..71065
                     /locus_tag="MYCTH_2309700"
                     /db_xref="GeneID:11511518"
     mRNA            join(69069..69342,69533..69889,70005..70946,70977..71065)
                     /locus_tag="MYCTH_2309700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665679.1"
                     /db_xref="GeneID:11511518"
     CDS             join(69258..69342,69533..69889,70005..70946,70977..71038)
                     /locus_tag="MYCTH_2309700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665727.1"
                     /db_xref="GeneID:11511518"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="JGIDB:Spoth2_2309700"
                     /translation="MTDQLDDRTLRLVFQSRPDILAGIQKAADTPARIALFNDIASFV
                     YEQIGAADAQNGPASKRRRVDIAQLPTHTQTNGQAHGGLPPASLSAGVDAAAADPVLL
                     EIKDISVSAPQRKKYDLCFTKHYLYARASGTSVPVQGIVYPWKDIEHAFYLPVPDKSQ
                     AQYNYVLLPRDSYLPTTKQVGANANTNDKQQPLEPLVFTVPATAPKPGTVAGPSAAAA
                     EAVSDTYSSLFHWALVTSMRSAGNHACELIASDPRLFHSVARQSHRPGEKAVHVKAFR
                     GTKDGFLFFLPTGILWGFKKPLVFLPLDRIVAVSYTNVLRTTFNMVVELDTDAPANGD
                     ANDNNTAATPIEKEVEFGMLDQEDYQAIDETYVRRHGLADRSMAEQRKAKRQLAENHR
                     KPAAAASSGGDDAAAAADEGADGLTELERAQREAEQRLQDEEDELEEDYDPGSEGDSE
                     GEGGSSEEDEDKEEEEEEEEEEEEGADRMQE"
     gene            71956..72561
                     /locus_tag="MYCTH_2309702"
                     /db_xref="GeneID:11511519"
     mRNA            71956..72561
                     /locus_tag="MYCTH_2309702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665680.1"
                     /db_xref="GeneID:11511519"
     CDS             72064..72327
                     /locus_tag="MYCTH_2309702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665728.1"
                     /db_xref="GeneID:11511519"
                     /db_xref="JGIDB:Spoth2_2309702"
                     /translation="MFWLLHNDICVGEWLDPVSASNGFRLPSFHKSCKRPPVALHTPL
                     LLLLLLLLLLLLLLLLLLLSLKWVQPSAFERGKDKERKKGGER"
     gene            77472..79954
                     /locus_tag="MYCTH_2309704"
                     /db_xref="GeneID:11511520"
     mRNA            join(77472..78088,78195..79307,79401..79954)
                     /locus_tag="MYCTH_2309704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665681.1"
                     /db_xref="GeneID:11511520"
     CDS             join(77874..78088,78195..79307,79401..79848)
                     /locus_tag="MYCTH_2309704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665729.1"
                     /db_xref="GeneID:11511520"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2309704"
                     /translation="MDHDDVPPPLPPPRLVPIDGPVDPKLQLKESMRRDNYGSPDTDS
                     LGHSFRRPGLSFRSDVSDDGYHSLDSLRSCGLPSPFGHHTLQSYRPNGDAIDNSMLDK
                     LNRSARRSGLSASVNDLPRPRPHHTQLATLSLPHRTRQPFSDASFTKSPLSVSATSPV
                     GGAPFGYNHGRGSADHRSPLEAAGSDYDRSPLSRPHRTPTGSAADDGPGPGYGAYDAR
                     EDDTDFPMEETTRMRTLAIEDQWRERDWDRDRERERERDYYQPGQKRRASSPPSDDSA
                     LASDALRRRDGSLLSRGSPTPRLLMIPQNSVSSASSVSRSGSFVSNLTASSVTSMGSF
                     ERRSPHPLSPAGLSPTDPMSCSSPYPPPSSLSASPRPSAARSLSALSSQQRTACEQPL
                     PPQVTRTVASPRKLAEIPKSHSSLAAKLKGPYMCECCPKKPKKFETEEDLRAHEAEKQ
                     YGCSFCGNRFKNKNEAERHQNSLHVRRHSWSCSALTSYERAFHDSTARPGEADVCGYC
                     GEEFPRTGRSPGGLTPSEQDWEDRIRHLQDVHKFRECNSSKKFYRADHFRQHLKHSHA
                     GTSGKWTNMLENACMMEEEPPAPTR"
     gene            81389..82766
                     /locus_tag="MYCTH_2309706"
                     /db_xref="GeneID:11511521"
     mRNA            join(81389..81477,81585..82766)
                     /locus_tag="MYCTH_2309706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665682.1"
                     /db_xref="GeneID:11511521"
     CDS             join(81431..81477,81585..82755)
                     /locus_tag="MYCTH_2309706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665730.1"
                     /db_xref="GeneID:11511521"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Spoth2_2309706"
                     /translation="MALNRIDGADELYIGGVFGLNRPRLIQEHKFTHILSVIKYTLNR
                     DEDAFRDVEHLSIDIDDMEDQDILVHLPRMVRFIDNGLRHKGRRDETTPVTPPPAPAA
                     EPPRSSSSSPRSGAVLVHCAMGKSRSATAIIAYLLWKYPHRFGRADPAGTAQQAVERA
                     LHWVRRSRPVAEPNEGFMRQLEMWWDMGRPADSDDAVEKHPAYQRWLYRREVEDAARV
                     GRAPDRIRFEDEAAAEVAGGNAGGTATAAGAGRSGAGEQQCTELRCKKCRRVLATGPF
                     IVPHQGRGAGAERSGCPHYFVEALSWMRPILEEGELDGRLTCPNAKCSASIGRYAWQG
                     FKCSCGEWVAPAFSLQTSKVDKVVTRGNQGGGGAFVASRMAALGIRMPPRMAGPPTVA
                     PPGAVVDKSKENL"
     gene            complement(85104..86218)
                     /locus_tag="MYCTH_2309709"
                     /db_xref="GeneID:11511522"
     mRNA            complement(join(85104..85304,85382..85449,85540..85818,
                     85893..86218))
                     /locus_tag="MYCTH_2309709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665683.1"
                     /db_xref="GeneID:11511522"
     CDS             complement(join(85190..85304,85382..85449,85540..85818,
                     85893..86003))
                     /locus_tag="MYCTH_2309709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665731.1"
                     /db_xref="GeneID:11511522"
                     /db_xref="InterPro:IPR013640"
                     /db_xref="JGIDB:Spoth2_2309709"
                     /translation="MSFPNIYTHRKVAEAKAKSCDICYKPSSSVLITPDNKDWFYICP
                     AHLKDPGFCTPKIDQAAIEARKKRELEEEIERVKKEYEERQKQKKNKEKKKEEEAKGE
                     AKSGDDKSKDDDKADEDKRQKVPEKTEPSRSGASTSPAAEEEEPRVFELKSTFYNRRL
                     SKKRQAEIARRNFETMQDPKFFPSVPKGFP"
     gene            87026..88574
                     /locus_tag="MYCTH_2309712"
                     /db_xref="GeneID:11511523"
     mRNA            87026..88574
                     /locus_tag="MYCTH_2309712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665684.1"
                     /db_xref="GeneID:11511523"
     CDS             87284..88540
                     /locus_tag="MYCTH_2309712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665732.1"
                     /db_xref="GeneID:11511523"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="JGIDB:Spoth2_2309712"
                     /translation="MTTGTHFLSGRHIVVAGAGMAGLSFAVALRKIWPTGVPPPRVTI
                     FERDTKQDMLGREGYSLSLAGADDTGGLVALRDLGLLDEILGHAILGTDEKGAFKLWD
                     ADWSQVLSVRLRPAPGLPTSGIRIARKHLRETLLGAVTDEIRWGTACLSATKSESGKV
                     VVRVSDNQGSQESTVECDLLVVADGASSKIRASLRPDDVLQYAGAVQMGGLAHFPEGI
                     PPPLGENWGQQVSGGRGVSCFYSPVDKHRLVWAFSFRESTPRQTIKPPTSEETARVLL
                     DEILQKGHMLGQLFETIAGSATDPKEVFCLPARDKKPFSHDLAKTGPIVFIGDSNHAV
                     SPFAGYGASLALKDGWDLAQKLTAADSVVDAVRKYDAVSVPRATKVLATSRSRIKWGH
                     STGLMFFLWRGFLKALGYVLWLTGRA"
     gene            90138..92296
                     /locus_tag="MYCTH_2309715"
                     /db_xref="GeneID:11511524"
     mRNA            join(90138..90265,90549..91120,91186..91460,91535..92296)
                     /locus_tag="MYCTH_2309715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665685.1"
                     /db_xref="GeneID:11511524"
     CDS             join(90224..90265,90549..91120,91186..91460,91535..92178)
                     /locus_tag="MYCTH_2309715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665733.1"
                     /db_xref="GeneID:11511524"
                     /db_xref="JGIDB:Spoth2_2309715"
                     /translation="MGSTPEWATGTWRSEVSARLQAARGSRGPPVRTSSNVTTNANVE
                     RGSEGPSSAITSLRDFLSAVPRPDTVTGAFSSDSAFESPTVAAPDFHGSPYATNLALA
                     ASASHVPATEPQPNEERGLLRVNQNVKRAASPEFSSPDGLLEVEQETDGDGRRKKSKR
                     SSNAAVQGGRGLPKFACPYFKRNPRKYRKWTSCPGPGWDEVHRVKTHLYRRHPLPIQC
                     PRCWEPFKTDAQLQAHLQQNPPCPIQSNRTLQEGFTKDQEKKLRSRKKTHADMTDEEK
                     WREIYMILFPDDDPDTIPSPYYSESEDGGDNHNSGLSGELEDYATFIRREMPTLVRRE
                     LETLFREEYPDIEERIRPRVADIVLSLQPRLLSLYRQSQMPLSEYGPQQHAETGRTAS
                     GSEPTLTPLLSQGTDPGSGSEPHSTPDMVVGASNITLDELEAQLGLGASGLGIQWNSI
                     GPVPQVPPIQPPEGDVGLALDSFDWDYDFDKWLNPALFMPPVGGNYTAGPSARAQRHN
                     RG"
     gene            complement(<92820..>93886)
                     /locus_tag="MYCTH_104665"
                     /db_xref="GeneID:11511525"
     mRNA            complement(join(<92820..93241,93347..93435,93516..93541,
                     93647..>93886))
                     /locus_tag="MYCTH_104665"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665686.1"
                     /db_xref="GeneID:11511525"
     CDS             complement(join(92820..93241,93347..93435,93516..93541,
                     93647..93886))
                     /locus_tag="MYCTH_104665"
                     /note="Contains conserved domain SET[pfam00856], SET
                     domains are protein lysine methyltransferase enzymes."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665734.1"
                     /db_xref="GeneID:11511525"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Spoth2_104665"
                     /translation="MVDVPSVLIGIPFLADAKPHHRRRILKQALNQLPEETRNRVYTL
                     GRGSSPYEVDAIMGPNTNTVVIADDEVHVGLFTEVARINHACRPNAYYRFSERRLTME
                     VVAFRAIDAGEEILMSYVPLETPAEERRRYLRNHWGFECSCSLCRASQLDLDNSEVWR
                     SKVKSLKETILNARSEGFYQNAITMTEEWLMVSEWDMTPPLMAEYHDTLADLYFLKGD
                     MVNATRYARMAVDGWARLGSVDDEQLERSRLFLRRIIDIN"
     gene            complement(94903..96689)
                     /locus_tag="MYCTH_2309720"
                     /db_xref="GeneID:11511526"
     mRNA            complement(join(94903..95037,95129..96142,96251..96689))
                     /locus_tag="MYCTH_2309720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665687.1"
                     /db_xref="GeneID:11511526"
     CDS             complement(join(95150..96142,96251..96388))
                     /locus_tag="MYCTH_2309720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665735.1"
                     /db_xref="GeneID:11511526"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="JGIDB:Spoth2_2309720"
                     /translation="MDDGPLKQKLASCSEKEMKRSDWSISHRGGGTLQFPEHTYSSIM
                     AGTRMGAGIQECDVTFTKDKQLVCRHSQCDLHTTTNVVTIPELNAKCTVPFQPASNGT
                     AAKAKCCTSDFTVDELKRMCAKMDSSNPAAATPAEFVGGTPAYRTDLYAKTTCERILT
                     VREYIDLVDGLGLKFTAELKTPEVPMPFPPGGDYTQARFAQQLVDEFKAAKIGPERVW
                     LQSFLYDDLLYWIKAEPEWARQAILLDESATTPEAMPQAVARLEEYARAGVRIIGPPL
                     PYLVTVGDDGEKIVPSAYARRAKELGLDIITWTLERSGWLGDGSHGGYYYLSIANVTD
                     SEGDVYNLLHVLAQDVGVRGVFSDWSATVTYYANCFGLMLSR"
     gene            complement(98492..99481)
                     /locus_tag="MYCTH_2309722"
                     /db_xref="GeneID:11511527"
     mRNA            complement(join(98492..99005,99129..99481))
                     /locus_tag="MYCTH_2309722"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665688.1"
                     /db_xref="GeneID:11511527"
     CDS             complement(join(98900..99005,99129..99415))
                     /locus_tag="MYCTH_2309722"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665736.1"
                     /db_xref="GeneID:11511527"
                     /db_xref="JGIDB:Spoth2_2309722"
                     /translation="MKLAALLASSLLCAGVWAAPATKSDDKSSTSEIDPHHGYVNHEG
                     HTCEIIDEDDVKCRAGPSTEFDIVTTFNKGFKGTFICAEKGKCVLIDGLENCTWDLIY
                     ILGVPCYVSGHYTDSECGVAKLGLCSGG"
     gene            100247..101576
                     /locus_tag="MYCTH_2309723"
                     /db_xref="GeneID:11511528"
     mRNA            join(100247..101004,101123..101576)
                     /locus_tag="MYCTH_2309723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665689.1"
                     /db_xref="GeneID:11511528"
     CDS             join(100427..101004,101123..101405)
                     /locus_tag="MYCTH_2309723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665737.1"
                     /db_xref="GeneID:11511528"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="JGIDB:Spoth2_2309723"
                     /translation="MGQFFETIPEYLMKWILEQKMFWVATAPLAASGHVNVSPKGGPY
                     FGLLDDRTFWYMDLTGSGTETIAHLYEPGNGRITVMFGSFEGPPRIVRLFGHGTVLER
                     PGHETRLIPIRISPERGGAGSTFDDFVKKHDVEVIPSSRSIIIVRLHQVASSCGYSVP
                     FYEFKGFRATLNEVFAKKEEKFVQGASDESRERYWAYRNSYSVDGLPGMRIGYETHKR
                     EGIAPIEKMVGPAAPRGYAYRNSRSFSAWHLVLVAVLSVLCTVLSFPLLVPLLQRIYD
                     PAVLSSFRSS"
     gene            complement(101578..102396)
                     /locus_tag="MYCTH_2309724"
                     /db_xref="GeneID:11511529"
     mRNA            complement(101578..102396)
                     /locus_tag="MYCTH_2309724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665690.1"
                     /db_xref="GeneID:11511529"
     CDS             complement(101649..102374)
                     /locus_tag="MYCTH_2309724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665738.1"
                     /db_xref="GeneID:11511529"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2309724"
                     /translation="MPVYCITGTNRGLGLEFVRQLARSSDNTIIAGVRSLASTDLSDL
                     RAAASPSTHILECDTGSLASIHAFAKAARLALGEDRKIDYLINNAAVNLASHQTSLNL
                     GPDELQAQMAVNVIGPAKTLELFLDAGLLSQHVRVLNMTSGLASLHLTAQSPARKCAG
                     YSITKAALNMLTLHQAADLRSHLPGAVVVLADPGWAKTRLGGEGAVMEPSDSVAGVLK
                     VLHGLRPEDSGSFFSHSGDKIPW"
     gene            103001..104563
                     /locus_tag="MYCTH_2309725"
                     /db_xref="GeneID:11511530"
     mRNA            103001..104563
                     /locus_tag="MYCTH_2309725"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665691.1"
                     /db_xref="GeneID:11511530"
     CDS             103283..104527
                     /locus_tag="MYCTH_2309725"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665739.1"
                     /db_xref="GeneID:11511530"
                     /db_xref="JGIDB:Spoth2_2309725"
                     /translation="MWRKKYYENPRRLALAAVAKETQELTATIAAKLPHLDTTKCEKL
                     KLSELAPLDPSKCPRFRLALARGSSDDSDKPGLACGTVLRVFNLDTFDAALAMPSAVL
                     GVPSSPKQTKTTATATTPLTAEAEEALRVEQLRASASAPENLDAATAGRVAVLNMASE
                     RSPGGGWLKGAAAQEEALCFRSTLAASLRRDLHYPIEPRAGLYTRDVVVFRRSMAADH
                     RLMVPDTPEPELPVVSVLSVAGIRRPEVRRAGEAVLNTEGESADGNKAEGPGGGASKG
                     ESQSKNGAALGTDQRAQRGRDNKGRDEKGAKKAPRGPLVFADAAARDLTKDKMRLCLR
                     MAGARGHTMLVLGAIGCGAFKNPPEEVAKCWDEVLSEAEFVGGWFKEIWFAVFDRRNE
                     GNYEVFRDTFDGKVVGRISASV"
     gene            complement(120483..122495)
                     /locus_tag="MYCTH_2309727"
                     /db_xref="GeneID:11511531"
     mRNA            complement(join(120483..121154,121217..122157,
                     122288..122495))
                     /locus_tag="MYCTH_2309727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665692.1"
                     /db_xref="GeneID:11511531"
     CDS             complement(join(120605..121154,121217..122145))
                     /locus_tag="MYCTH_2309727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665740.1"
                     /db_xref="GeneID:11511531"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="JGIDB:Spoth2_2309727"
                     /translation="MRDTSREGLVWVDHGLGPEAQWTREPDLGAIKRVCRRHLGIPED
                     AAEEALTVSFHRDGAFNKLYRVDCGRRRFMLRVSLPVDPRNKTLGEAVTLELVRRNTD
                     VPVPAVVAFDASRSSEIGYEWLLMDRMPGVPSHYRWRKMTMAQKERLTARVAEFQAQL
                     LRCGGHHLAEGFRGIGTLGTEPPRSDAHAHAHADSAPEPGPIVSSFFFSGQRYHYPVP
                     RGPFSSSHDWLRAQLNVIVREHTAALAEAKTDLDREYAESALRVARKLLRMLHKIFPA
                     VVHPPERTVIWHDDFSLRNILVDNSGNITAVIGWECASAMPRWVASQVPEFLRGAARE
                     TEPDRNCYTDVDKGAARAAVNDGDGPGEGGEDDDDDGLDNEGKTELYWIHLMEYEQTQ
                     LRKVYAARMRQLRPDWDLEVEESALKVDFLAAVARCAAGFYLRRIEQWVDAIERREYL
                     PLMEVLRVGMHQADGASATKTGAIRSAVTWSTNTLTLVSRLS"
     gene            <123392..>124666
                     /locus_tag="MYCTH_2069956"
                     /db_xref="GeneID:11511532"
     mRNA            join(<123392..123793,123945..124293,124380..>124666)
                     /locus_tag="MYCTH_2069956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665693.1"
                     /db_xref="GeneID:11511532"
     CDS             join(123392..123793,123945..124293,124380..124666)
                     /locus_tag="MYCTH_2069956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665741.1"
                     /db_xref="GeneID:11511532"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="JGIDB:Spoth2_2069956"
                     /translation="MSDGKALDIVVPEVGTRAPRVNGDIADFLANHPDLELGGAQGYT
                     IERRKHMEVFALHRLPKFKVNPIRAVEFTAIRGPHGTIPIRVLYPDNGEPRRGEGKMG
                     GIIYFHGGGYCTGSVDEFENGLRLLAEESACIIFAPDYRLAPEFPYPTQLDEFDAVID
                     WVLDGAAQQRGVDRTRLVAAGDGAGGSLATAVCMRRRDEGKHPVAAQVLLYPATSLPT
                     DTPAAEENRAGFYLQFNGIFGFADHYLPHTISGPSPTFMYVAPGKQPCAALASLPPAA
                     VVTNGYDPLRDVGLAYAGKLRAVGGLARWRHYADLTHAWLQMTAWSAAARDAARDVGL
                     IVRDMLYGQSD"
     gene            complement(<124891..127505)
                     /locus_tag="MYCTH_2309729"
                     /db_xref="GeneID:11511533"
     mRNA            complement(join(<124891..125554,125632..126664,
                     126732..126833,126900..126928,126999..127505))
                     /locus_tag="MYCTH_2309729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665694.1"
                     /db_xref="GeneID:11511533"
     CDS             complement(join(124894..125554,125632..126664,
                     126732..126833,126900..126928,126999..127222))
                     /locus_tag="MYCTH_2309729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665742.1"
                     /db_xref="GeneID:11511533"
                     /db_xref="JGIDB:Spoth2_2309729"
                     /translation="MGQDFSDASSRSSFDDDDDDPEAALNPHGDDDDDTDNVAPLRLR
                     RLPPRGEQDASSAVLLPGDGTIMSVYMMMHRIRRLVIAAIDDIYTLDELRAPHMDRQV
                     VRPLVDRLYNPQDPAIVYCLVANRVQFLRPRSSEALHQGVHESRAILCELVATRILRR
                     FREDHPGRPGLLLLANILVSGFDPCDAAPESVRSRRPQWAIQKRGGHERKLTALELAI
                     ISESKMLIKSPACQLVVDAVYKGVVVYTPLSFVDFLPDHYKHHPVSLYEPRRAPILNH
                     HRLIVPQIRNAIELLHFAILLLLYMLTVAHYGLGADMEGLRLYETLFNVFAAGWVLEQ
                     FAAVVEHGWEVHAQNLWSFLDLTFVAIYGAYGFVRAVELLLFDDAYYALPVLCTAAPV
                     LLTRIAFTLMPDNIVFIALHAMMRDFTRLTFIAVWCFAGFVVGLLFLARTSGEDSLNA
                     GVTWATITKWLLWIWFGLDGTGIERSADFHLILGPTLIITFAFLGNTLFLTILVAILT
                     NTFSKIISNEAAEIQFRRAVLTFQGVKSDAIFSYPPPFNMAALMILLPIKFLVGPLAF
                     HRINVAAIRALNAPVLLLIGLWERRRVWARRAKSSRFRYWRYFAGLSPHGDIQAVFSS
                     EPPPEIVDALEKMDALHDLATVDRELAAHSPKDLRAPPASAVRRRRTSNSSSIRRFEV
                     "
     gene            complement(127973..129007)
                     /locus_tag="MYCTH_2309731"
                     /db_xref="GeneID:11511537"
     mRNA            complement(127973..129007)
                     /locus_tag="MYCTH_2309731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665695.1"
                     /db_xref="GeneID:11511537"
     CDS             complement(128067..128864)
                     /locus_tag="MYCTH_2309731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665743.1"
                     /db_xref="GeneID:11511537"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2309731"
                     /translation="MAVPEDKRWPPVPPDVDRSTIEVETPELSITGNSMLYRVKGHPG
                     IVYKARAELREYELQKAAGDCAIPVRGRVMLKSASDGEIDCMGFLMDLATPITVPTGP
                     APPSAPVLPPSRRHDIMHQMIRLVQRLHAKRIVHGDVKLENMLLDNQGKLRLCDFAEG
                     RYVDEDESVWEGSSTWHYESPNRLLRGERMGRDPAPPTIEDDLYGLGLSIWHLYTGKM
                     PHEDMAGDDVGLKERQRKGETVDVAKVDDPEAREIIRGLLRQGGARI"
     gene            complement(129250..131545)
                     /locus_tag="MYCTH_2309733"
                     /db_xref="GeneID:11511538"
     mRNA            complement(join(129250..130662,130732..130917,
                     130985..131148,131246..131545))
                     /locus_tag="MYCTH_2309733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665696.1"
                     /db_xref="GeneID:11511538"
     CDS             complement(join(129517..130662,130732..130917,
                     130985..131148,131246..131447))
                     /locus_tag="MYCTH_2309733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665744.1"
                     /db_xref="GeneID:11511538"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="JGIDB:Spoth2_2309733"
                     /translation="MDPNREAVNRALSLIAELDLPHPSGALLASFVNEALHPVVAARY
                     VNDKVSAGDVQSLVSDWIYIVESVTNGRIPPPPDATEQLEIRARDGNRCCITGKTGTA
                     RDPLIVVPVLPVPSGWVADNPRIFEMLGVFFSPPYRDWWLSYVRAPERMLHYYSHWLV
                     QKSAAQAFAQGLVKLERQQPSMIEYKVEFVHIGPERPIEIKGPYPLLGDHSRAGILTV
                     DARFIGTQARLARSIRYVKIAKSIAPQILPRKPGELVLPAMNTRKPSSGRSLHWAWLS
                     PLFGHVKSLINFIGRGFVSSLRILPRSARSVTYDALRKIGEMIYGRDDPSLFVQRLPF
                     ELFLKYRGTANLARNEFNALRMVQQRTCIPAPKPLDVIPNGDDSYLLTTRLPGVPLWL
                     CQEVMSDADCDAIVTQLKDYLSQLRDIPQTVNPEAPICNTLGEACRDHRIRGGDPIGP
                     FADEAAFSQCLRFSDEPSRRGHKIVFTHADLNPRNILVDQVALPDGTTGWRVTGIVDW
                     ETAGFYPEYWDYTKALFEGFRWKPRYIKMVHRVFEEFGDYSRELDVEKRSWEAGDGI"
     gene            complement(132804..132910)
                     /locus_tag="MYCTH_t180"
                     /db_xref="GeneID:11511539"
     tRNA            complement(132804..132910)
                     /locus_tag="MYCTH_t180"
                     /product="tRNA-Leu"
                     /note="Anticodon: AAG"
                     /anticodon=(pos:complement(132874..132876),aa:Leu,seq:aag)
                     /db_xref="GeneID:11511539"
     gene            133291..134439
                     /locus_tag="MYCTH_2095899"
                     /db_xref="GeneID:11506397"
     mRNA            join(133291..133472,133617..134027,134178..134439)
                     /locus_tag="MYCTH_2095899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665697.1"
                     /db_xref="GeneID:11506397"
     CDS             join(133397..133472,133617..134027,134178..134266)
                     /locus_tag="MYCTH_2095899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665745.1"
                     /db_xref="GeneID:11506397"
                     /db_xref="JGIDB:Spoth2_2095899"
                     /translation="MATYTKTWRNKVWIGWFLMQLPIILFVDLLDYIWPASLYQPAGS
                     PLHAAYELKEWYVQKYNDPIVQWSAETASGHDSWMGLFMHLEAFFLLPTVLYGLYRLA
                     LSRRRGTSAADELLLLVYALEVAFTTLICIYDVSFLDEAAYPPAIKREMQFQLYGPWF
                     VVPALGAIDMASRILGRVKAADAVLAAKQSQ"
     gene            complement(134438..135526)
                     /locus_tag="MYCTH_2083273"
                     /db_xref="GeneID:11511540"
     mRNA            complement(join(134438..135293,135384..135526))
                     /locus_tag="MYCTH_2083273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665698.1"
                     /db_xref="GeneID:11511540"
     CDS             complement(join(134543..135293,135384..135514))
                     /locus_tag="MYCTH_2083273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665746.1"
                     /db_xref="GeneID:11511540"
                     /db_xref="JGIDB:Spoth2_2083273"
                     /translation="MQLLVLIGAALVARALAATNGHELALPSYHYGAPIRVECMNRSS
                     ETGEHIQNEKHEIEWVPFPVCNETDQPLEFHYGIEGEVNCTIPMVSDPFFHLLEFYIH
                     NDAPLACRLPARPPPHIEVMGETPPPQEYIPLVFALAGTLQLSHMHISTHLNVLLHST
                     PKQHIHPHDSGVLDSATAYSTSPLTHLEGSATRRLVIGDPLPLSFSVRWFPTPALPKV
                     SGKVEWSGMGGHIYASTVFYSLLSFFAGAAVSTAYFFGSVLPRRLRGRGLGGATPLGY
                     GLNGVGNGWGYQKRAVD"
     gene            complement(<136451..>137349)
                     /locus_tag="MYCTH_58635"
                     /db_xref="GeneID:11513494"
     mRNA            complement(join(<136451..136892,137081..>137349))
                     /locus_tag="MYCTH_58635"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665699.1"
                     /db_xref="GeneID:11513494"
     CDS             complement(join(136451..136892,137081..137349))
                     /locus_tag="MYCTH_58635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665747.1"
                     /db_xref="GeneID:11513494"
                     /db_xref="JGIDB:Spoth2_58635"
                     /translation="MFRKTALLLLAALPFSFAQISEDFEGGWDESAWPIYANDCNQGG
                     KVSLDTTTAHSGSNSVRVDGAGGYCGHIFFGTTSVPSGDLYVRTWLKAQNALTDAHVS
                     FITMPDSAQGANKHLRIGGQSKILMYNRESDDATLPDLSPQGIAASKALPTGDWQCLE
                     YHVGADGTIETWLNGEAIEGLTVKSGVDNPNAGQWQRSNVVPKPTAVYFGWESYGGDT
                     NTFWYDDIVISDTRVGCE"
     gene            complement(138549..139182)
                     /locus_tag="MYCTH_2316127"
                     /db_xref="GeneID:11513495"
     mRNA            complement(join(138549..138822,138912..139182))
                     /locus_tag="MYCTH_2316127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665700.1"
                     /db_xref="GeneID:11513495"
     CDS             complement(join(138671..138822,138912..139077))
                     /locus_tag="MYCTH_2316127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665748.1"
                     /db_xref="GeneID:11513495"
                     /db_xref="JGIDB:Spoth2_2316127"
                     /translation="MAFNTLFSSILLQLCLASIGLAAPVSTEAMDNSWQYGTGGGLVG
                     LIVLILDIIVFVEILKSRRTPVQKLIWCLVVFLFPVLGLIIYYLFSNRSAYQRDSGYE
                     SLA"
     gene            139484..140868
                     /locus_tag="MYCTH_2309742"
                     /db_xref="GeneID:11513496"
     mRNA            139484..140868
                     /locus_tag="MYCTH_2309742"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665701.1"
                     /db_xref="GeneID:11513496"
     CDS             140052..140858
                     /locus_tag="MYCTH_2309742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665749.1"
                     /db_xref="GeneID:11513496"
                     /db_xref="JGIDB:Spoth2_2309742"
                     /translation="MADNQNPVVDRRLGAEIDDDLPLPPPDHVAATIPPFYLYGEREC
                     GDHRHDTSTSTSNTNSNSDNHEAVAWQTACTNCHARATLNQIHDLPCGDRICRECLLV
                     KVLSVKLHIEANHKKIKEARAKMRAIDLCFVRRPGGAMTPARKRMLCLRHSRLRASVL
                     CLAGLACCGRDMGLHRFLPCLGPDKARELWLALKWVTSIPSEQRACGWPDCGAYVPSC
                     CSYALPGDWARRWHCVTCQGNSIDCARNLTTAQTRFPFLPKGQPALTPAR"
     gene            <141972..>143549
                     /locus_tag="MYCTH_2120525"
                     /db_xref="GeneID:11513497"
     mRNA            join(<141972..142248,142347..142833,142960..143265,
                     143360..>143549)
                     /locus_tag="MYCTH_2120525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665702.1"
                     /db_xref="GeneID:11513497"
     CDS             join(141972..142248,142347..142833,142960..143265,
                     143360..143549)
                     /locus_tag="MYCTH_2120525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665750.1"
                     /db_xref="GeneID:11513497"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="JGIDB:Spoth2_2120525"
                     /translation="MATVAAQQPVAPAGPPGQPDIGYLPDHDKYLARAKRRQETEKLA
                     KTLPHGFPQQLESDLVWDGNTLAETYDWNYHLTQDDLAEIDSALQHFKSLNKPLGLID
                     QETFPLPQLHQTLREVSRELHHGHGFKVVRGVPVTKYTREENIIIFAGISAHVAPVRA
                     RQDSQYQGRPADVVLAHIKDVSSQVDASVIGAPSHTNEKQVFHTDSGDVIGLFALGEA
                     AEGGQSYLSSFGKVYNEIAATRPDLIWTLSEPWAADTFGKQAKPYNLAPVIHLQPATE
                     KDPVRVIIQYARRTFTGYWGLPRSADIPPITEAQAEALDALHFTAEKYAVSLDFHQGD
                     IQYANNLTILHARAEFRDSAEKQRHLVRLWLRDPEYAWKTPEVLQPRWDRIYKGVTPE
                     NSVFPLEQYLRTASSSTNASAPPPVKA"
     gene            <145174..>147739
                     /locus_tag="MYCTH_2069159"
                     /db_xref="GeneID:11513498"
     mRNA            join(<145174..145489,145590..145829,145934..146029,
                     146103..146362,146497..146765,146886..147275,
                     147454..>147739)
                     /locus_tag="MYCTH_2069159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665703.1"
                     /db_xref="GeneID:11513498"
     CDS             join(145174..145489,145590..145829,145934..146029,
                     146103..146362,146497..146765,146886..147275,
                     147454..147739)
                     /locus_tag="MYCTH_2069159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665751.1"
                     /db_xref="GeneID:11513498"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2069159"
                     /translation="MPFNWRRPFRTDGGGGGGGVQTEQQQQRNGGGSSSSVDRFDSSG
                     EVTDGSLKYTLEKGENDSPVSYQEASGAPVERRSPLGYDVGSITIIFLNVSKMIGTGV
                     YSTPSAIYKGTGSVGLAMIYWTLGFFTSLASLCVYLEYASYFPNRSGSEVVYLEQAYP
                     RPKWLISTTFAFQSVALSFSSSNAIVMAQYLWRCGTSTPTDWQLKGTAIACYTCAFLI
                     VGFHTRFSYWVSNGIGIIKVLTLIFISITGFVVLGGHVSRVPEPKANFVNAFEGHATP
                     YGLTNALYRIIFSYAGYENAFNVVNEVKNPVKQLRRNGFAALVIVTVLYIFANIAWFS
                     AIPKAELAEAKEIAAALFFSRVFGPDKAVNGLNFLIALSSFGNIVAVALGSSRLIREC
                     GRQGVLPFPRFWASTRPFGTPLGPYALKYTLTVLMILAPPAGDAFNFINDLYVYPSSV
                     FQVLLGVGLLLVRRRRRRLGLPRSEFRAWDPVIAFNILVYVYLLVMPWYPPAGGANAG
                     DVSFWYGTYIVTGIGILIGCGIYYYLWVNLIPHVKGYRIRQEVLVFEDGAQSHRLVKV
                     PVAEVAEWDATHDAVGRPLNVNNGKSGSGSHQKNDDQEEVGKVVRIGDPEKQ"
     gene            complement(148411..150673)
                     /locus_tag="MYCTH_2309743"
                     /db_xref="GeneID:11513499"
     mRNA            complement(join(148411..149669,149723..150519,
                     150580..150673))
                     /locus_tag="MYCTH_2309743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665704.1"
                     /db_xref="GeneID:11513499"
     CDS             complement(join(148660..149669,149723..150494))
                     /locus_tag="MYCTH_2309743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665752.1"
                     /db_xref="GeneID:11513499"
                     /db_xref="JGIDB:Spoth2_2309743"
                     /translation="MSRNVRQKYPPKPVRAPKSRDYDSSSLDLSDDSGYSGVEDVTDS
                     EDDDEEHVVAAEEAHIISDALRKRSSGPSRPLVDDDEDDDADEESEADEEDDPEVGAG
                     PEDADQHDDSASWEGFSSDHDDDLIPAEPVSLDLLDQVSINTGRHVRFVGVPDSDTDS
                     TTTDTSEVTDMNDFFPDIFVEQSALDPMFRREIERDDETSSNSSFWDFYAGSQDFAAG
                     DLEDQDETPTATPRPSLPPSEVSTPVPVPEETQDLDGYETDGDTTEEDIPEPIVRKKQ
                     MRRAHATGASSDSDTEKPVQCKPGRPRVGRFKLDRSDNKPIGVVDPATGKMIIFTPRR
                     TNQLDLSPESLHVDFSRQDLASSPLVRNPGYIMMGAMVPSNNLNDFVNMQPFGPAEAF
                     FPCTSDIFGGEEESDDSYFAGMEEDEEESMLRIEDFVTFNSDSSDDEEGADWNGDLVS
                     SPTRPKTATSTASGGTEAAAAAHPLLTHFDGKSDVVGAFRRNQINQQLIYSDKASQES
                     LAFSGPYYHGTLRGIKSGSLEAVTTPITPLRRQKRSNTVGSGFADLQQSSPLNVLSQK
                     RKASGTHAEANAHKRHRSISDMEVLRI"
     gene            complement(<150792..151597)
                     /locus_tag="MYCTH_2135445"
                     /db_xref="GeneID:11513500"
     mRNA            complement(join(<150792..151116,151202..151506,
                     151575..151597))
                     /locus_tag="MYCTH_2135445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665705.1"
                     /db_xref="GeneID:11513500"
     CDS             complement(join(<150793..151116,151202..151375))
                     /locus_tag="MYCTH_2135445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665753.1"
                     /db_xref="GeneID:11513500"
                     /db_xref="JGIDB:Spoth2_2135445"
                     /translation="MHGCQLPAAEGCLRCLGCARLIQYMDTWIRRTSTPQIWLQLRVE
                     PSPPWSPPTSKKSLTTKSPYRSQRFSTIPIQTSSRFSRCRRPSLSSKRPLRACQLTPA
                     RLQSSSLNEIPNPARPSTKFLADFHRLEPISASRHEAYARTDKRESALELRSTGSIVC
                     PRLLHP"
     gene            153110..156312
                     /locus_tag="MYCTH_2309747"
                     /db_xref="GeneID:11513501"
     mRNA            join(153110..153563,153644..154876,154938..156312)
                     /locus_tag="MYCTH_2309747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665706.1"
                     /db_xref="GeneID:11513501"
     CDS             join(153225..153563,153644..154876,154938..156188)
                     /locus_tag="MYCTH_2309747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665754.1"
                     /db_xref="GeneID:11513501"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Spoth2_2309747"
                     /translation="MAASTQKATNLFQVYLRLRPPQGGAATGERFLTVEEPDDDSKTP
                     KHITLNPPNDRRRAIEKFAFTQVFEEDATQLDVFNCVGVANLINGVLAPCGGDGTDAL
                     VATLGVTGSGKSHTILGSRSQRGLTQLALDVIFQSLGENIVDCDTCPTLEQSIVASDP
                     SEAAIFSAPTFLDSVFVDLSASHRPGSRAQTPMNVGYPPSSPQPRPQQEVQHGPSGRI
                     PGLGCETVRVVMGKDSIATLSPLATTTTTDKSQSISDNRRGLGAAFVPHNRQTGHAFC
                     GPRRQQVQRAKGARGRMQPSGRATASTSCVRLKSGTNQAAHSQGESIGPGHTPSRRLH
                     RPSTFPQQPDVNGLSVSCDPSAEYAVLISMYEVYNDRIFDLLTPPTKSTATKEYRRRP
                     LLFKPTEASPDRKVVAGLRKVICGNLHQALMVLEAGLHERRVAGTGSNSVSSRSHGFF
                     CVEVKKRTRGNRKHGAEPSWGGSALTIVDLAGSERARDAKTAGTTLAEAGKINESLMY
                     LGQCLQMQSDAATKDKPNLVPFRQCKLTELLFSNCYPSPSAISSGRYRNPQKAVMIVT
                     ADPHGDYNATSQILRYSALAREVTVPRIPSITQTILAAAAQQQQQASQSLSSPVEAPT
                     QARPSSPRGRGRGSGSGSGSVHYPPLLSSPDIVRGASSPAHSPANTAGSNDNSMHRST
                     VEAAVLEISRLTEEIEYLQQALEAERTARQEAEARLLSMEDRMVDLEQAVREDCTNEF
                     ERRLEIEMARWRAMMQVEMERGEEHWGRKIELFERSFGGGGGGGGVLLRNDGNHNDGD
                     DYYDGDAGGEEGDEDKENILVEDVHQENERLRRENEALRREIASMSPTKRLPLRERVS
                     DAGAVARGGKPETGSPRHARTSRAVGGGGGSYDEEGSLLDRLERLRVNDAQASARSSA
                     GGGKSRKVRKLPGKRWNAVGDDDDLF"
     gene            157479..158179
                     /locus_tag="MYCTH_2309749"
                     /db_xref="GeneID:11513502"
     mRNA            157479..158179
                     /locus_tag="MYCTH_2309749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665707.1"
                     /db_xref="GeneID:11513502"
     CDS             157765..158160
                     /locus_tag="MYCTH_2309749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665755.1"
                     /db_xref="GeneID:11513502"
                     /db_xref="JGIDB:Spoth2_2309749"
                     /translation="MRSLQDVLLVFDCTALPGIPDERRGIRVEVGMAPCSASKKTVAR
                     GLCSGEISWRNNGKDGTTGRYGKLAVYGVGDVQTSSVHRVCSLIKEDLQTTQLVSTVF
                     SSQLGGGHLLDIYLPRLAPPLTTGRQSLN"
     gene            complement(158180..159673)
                     /locus_tag="MYCTH_2309751"
                     /db_xref="GeneID:11513503"
     mRNA            complement(join(158180..158902,158980..159673))
                     /locus_tag="MYCTH_2309751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665708.1"
                     /db_xref="GeneID:11513503"
     CDS             complement(join(158199..158902,158980..159415))
                     /locus_tag="MYCTH_2309751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665756.1"
                     /db_xref="GeneID:11513503"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="JGIDB:Spoth2_2309751"
                     /translation="MDRGIHVLGLGNLGKYVAFALRQGHQTDVPSRLPPVTLFFHKRY
                     LLRHWESENRSISYIPEIDTLPPESRKLGRATGFRVELVGDAAAGIQPSEIENHPGVV
                     VGSDAPIRHLIVATKTMATTSAIAPIKHRLNKDSHILFLQNGMGVADEVSEKLFPDPE
                     SRPTYWAGICSSGIYYKSPFTFVHAGTGALSVGVVGGASPASADLPPPANMDRNPMVT
                     QLLDAPLLGARLLSPERTLRAQLLKLVVNSIINPLTAIFGCKNGHLIESAEARDMSLH
                     LLQEAGLIVRALLPRSSGELVEQEFTDAALGDFVWDVARKTANNTSSMLQDVRNGKPT
                     EIDYINGYLVSQGQRLGLPTTHHAKICRMIKQLESEHASQRSQET"
     gene            complement(159675..161975)
                     /locus_tag="MYCTH_2309752"
                     /db_xref="GeneID:11513504"
     mRNA            complement(159675..161975)
                     /locus_tag="MYCTH_2309752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665709.1"
                     /db_xref="GeneID:11513504"
     CDS             complement(159773..161827)
                     /locus_tag="MYCTH_2309752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665757.1"
                     /db_xref="GeneID:11513504"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2309752"
                     /translation="MRLPSGPPPIIRIANGTFYRQQPGSVSALTSQAHVHAHPNPPYF
                     KNLSFELPARSKTAHNWCIVGPSLSGKTTFLQVLRGQHLAFPPTSRAFPYLSTEEVPS
                     HLRTPARAVQYVGFDSQGSGSGLGPAAPTYLAARYESRREITDFSLRDFLLGNTQLNP
                     SKLPDDKGVDEKLFQRVVADLRLESLLDLPVTFLSNGQGRRARIARALLTSPEVLLLD
                     EPFMGLDPPTVSGLSPLLQSLAEKANPRLVLSARPQDPLPDWITHLVYLRTDAQVAAM
                     GTKETVLEGLRKYVRGVRNGKLAEDESLPVHALSEMGRTLTKDGVTGEGMAEDFSIGV
                     PARGGATDSETKSLGEPLVEMAGCRVQYGGKVVLGNWTEERDGETVSGLHWTVRRGER
                     WGVFGPNGSGKTTIVSLLCSDHPQTYCLPIRLFGRSRLPEPGSGERPLTFWDVQSRVG
                     HSSPEIHQHMPRNLTIRQVLESAWADTFRSKPKLDAAATEQVKATLRWFEQELNPAVF
                     HKQARPTLSDGSADGSVGWANDYMFGELSFSAQRVLLFLRAIIKHPDVVVLDEAFGGM
                     DDAVRDKCMLFLTYGEEKMYSLGPKQGNGSLTGATIVDSPASRSGSVKVTGLSDQQAL
                     ICISHVKEEVPDCVREWLCLPEANTGLPARFGRLDGPLRNSSKRWAEIWGVGQGASAP
                     PV"
     gene            162178..>162980
                     /locus_tag="MYCTH_2095925"
                     /db_xref="GeneID:11513505"
     mRNA            join(162178..162347,162519..>162980)
                     /locus_tag="MYCTH_2095925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665710.1"
                     /db_xref="GeneID:11513505"
     CDS             join(162345..162347,162519..162980)
                     /locus_tag="MYCTH_2095925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665758.1"
                     /db_xref="GeneID:11513505"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="JGIDB:Spoth2_2095925"
                     /translation="MSLRIVPADNHHKTFTHLASRETVAPSAPGLHDTLRAGVGPSAF
                     DVAANRPISSHPLEARLKAWESTREALRMETLRRVYGIAEPVRRQMELKITREGEWKP
                     MALGGGLPGASVHEDILAGRDETITWEDVFTGEDSRPLVGMHEEMERKLKMM"
     gene            complement(163465..164684)
                     /locus_tag="MYCTH_2309755"
                     /db_xref="GeneID:11513506"
     mRNA            complement(join(163465..163740,163811..164684))
                     /locus_tag="MYCTH_2309755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665711.1"
                     /db_xref="GeneID:11513506"
     CDS             complement(join(163589..163740,163811..164393))
                     /locus_tag="MYCTH_2309755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665759.1"
                     /db_xref="GeneID:11513506"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="JGIDB:Spoth2_2309755"
                     /translation="MAEPAPKNGDTEPVSQVNHDPVPQPAGPLPVNEADEGKDRTDTK
                     ETVTKATAESSAAVADAEISSKGKEKNEPSLPPAEEPKEGDSLSTGPSYPPQHAVTPS
                     HPDAPVCAITLLLPTGARHPYKIDEKYLSKRNVDVPDLTESGARDPFSISVYKLKELI
                     LREWREEWEGKPASPSSIRLIHFGKLLDDKEQLKKYHFSQDSPNVVHMSVRPPEMMEE
                     EEAAHSKASGREGRTRDGGSGCCVIL"
     gene            <168752..>169288
                     /locus_tag="MYCTH_2129615"
                     /db_xref="GeneID:11513507"
     mRNA            <168752..>169288
                     /locus_tag="MYCTH_2129615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665712.1"
                     /db_xref="GeneID:11513507"
     CDS             168752..169288
                     /locus_tag="MYCTH_2129615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665760.1"
                     /db_xref="GeneID:11513507"
                     /db_xref="JGIDB:Spoth2_2129615"
                     /translation="MFFNGAFAAMTAVFFGLALATDNGAAFRTHLQERGIFAESDMVT
                     VTWTETATITITIAGSSPCETVTDTESTDSSTTISETIITTSTGTSTSTSFVTSTATA
                     GTTDSVGTTDSAVPSSSVDVSSFSTSTHHTITEVSSSEISATATPTTAVNGAGGNKAQ
                     TVGGIIVGGAVALVMAVA"
     gene            complement(169562..172694)
                     /locus_tag="MYCTH_2309758"
                     /db_xref="GeneID:11513508"
     mRNA            complement(join(169562..171526,171582..171946,
                     172009..172084,172147..172694))
                     /locus_tag="MYCTH_2309758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665713.1"
                     /db_xref="GeneID:11513508"
     CDS             complement(join(169966..171526,171582..171946,
                     172009..172084,172147..172385))
                     /locus_tag="MYCTH_2309758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665761.1"
                     /db_xref="GeneID:11513508"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Spoth2_2309758"
                     /translation="MFMAYLPPSVYSPTRGPQGKVAELRYELNSGGKKDKHFTAKKIA
                     LKKIVANMTMSNNDMVALFPDIVGCMNIPNLEIKKMCFLYLVNYARMRPEVAVKAIPV
                     LEHDMEDPNPLVRALALRTMSYIHVREFVEATVPIVRHLIRDPDPYVRKTAAYCVAKL
                     YDHDRHMVEKSDLIDRLNGLLRDDNPTVVASALASLMDIWERSDAIKLTIDYSNASKM
                     VAILPDCSEWGQTYILEALMCYVPQESGEASLLAERIAPRLSHSNSSVVLTCIRVILY
                     LMNYIADQKQITALCRKLSPPLVTLLAKGPEVQYLALRNALLILQRRPEVLRNDIRVF
                     FCKYNDPIYVKVTKLELIFMLANEKNIDEVLTELREYATEIDVHFVRKAVRAIGKLAI
                     KIEPAARRCINLLLELVATKVTYIVQEATVVIRNIFRKYPNQYESIIGTLCEHLDSLD
                     EPEAKAAMVWVIGQYASRIENSDVLLEDFLFSFAEEPVEVQLALLTATVKLFIQRPTK
                     GQELVPKVLKWATEETDNPDLRDRAYMYWRLLSTDMEAAKRIVMGEKPAITAESERLD
                     PATLEEMCLNVGTLATVYLKPVQTVFRNARPRRLQDSPALQREDLALPIGLRSDANKS
                     LSQLGMGGQPAVFDPRTDRNYNPQMQQQHQQQQQQQQQQQQQQQQQQQQQQQNGDGSA
                     NLAQAVSDADAYFASQTRWMQIHEQGDSFGGNGGEAAGYVVNQYAPQTVYQPAQAVAN
                     NGDLLL"
     gene            <173560..>174270
                     /locus_tag="MYCTH_2068812"
                     /db_xref="GeneID:11513509"
     mRNA            join(<173560..173694,173793..174136,174198..>174270)
                     /locus_tag="MYCTH_2068812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665714.1"
                     /db_xref="GeneID:11513509"
     CDS             join(173560..173694,173793..174136,174198..174270)
                     /locus_tag="MYCTH_2068812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665762.1"
                     /db_xref="GeneID:11513509"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="JGIDB:Spoth2_2068812"
                     /translation="MSTHAAEPLPAWAAQLKNPPAHKSKQPGIPDPPGYPSAQSSSNS
                     KDGKATQRKAQTPEEMDTLKLKKAWEVALGPIKSLPMTAIMMYMSGNSLQIFSIMMVF
                     MAFKNPIMGILATNQAFERFETETNRAKMVRVKLAYVVMQLVALALGIWKVNAMGLLP
                     TTRSDWLAWEAQREAVEHAVPAL"
     gene            <175208..>175639
                     /locus_tag="MYCTH_2069908"
                     /db_xref="GeneID:11513510"
     mRNA            <175208..>175639
                     /locus_tag="MYCTH_2069908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665715.1"
                     /db_xref="GeneID:11513510"
     CDS             <175208..175639
                     /locus_tag="MYCTH_2069908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665763.1"
                     /db_xref="GeneID:11513510"
                     /db_xref="JGIDB:Spoth2_2069908"
                     /translation="AVVMIKEQVIDIAPVTTRYSTFTGGFGMIVGGVGAILGDCRLRP
                     GSCPDRVGRHARQRAAQHGLLNRGSESFDDGEKGHGVVRPPGNDHAAVERRLRGNCRR
                     AQADEALQFLCFGMAAGLVAIGYLQMRRAGPGRGRTGAYVA"
     gene            complement(176121..179857)
                     /locus_tag="MYCTH_2309764"
                     /db_xref="GeneID:11513511"
     mRNA            complement(join(176121..177432,177497..179163,
                     179563..179857))
                     /locus_tag="MYCTH_2309764"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003665716.1"
                     /db_xref="GeneID:11513511"
     CDS             complement(join(176252..177432,177497..179163,
                     179563..179714))
                     /locus_tag="MYCTH_2309764"
                     /note="CAZy_ID 268077"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003665764.1"
                     /db_xref="GeneID:11513511"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="JGIDB:Spoth2_2309764"
                     /translation="MDGRRSPPRPPPEYALPPYGDPDDSTSTGTLNHGAAVRLLTSME
                     EPYDPRPSRSRHHYEPSLDSRQSILDPPPMPPPEPSFSSYNPAVDGASPTRPWTPSRG
                     SSEFSRPPPVSNRYEPADLNGSPRPGTPASTYGGSPRRPLPPAPLFSTGPRGSTHSFS
                     DDVTVSIPLAEDTDDVFAPESDLGGSKYHQRDSYAESQATLSDEATDVSTNEKTGSYA
                     PVPEGKQERRGVRAPQMSKREVQLINGELVLECKIPTILYSFLPRRDEIEFTHMRYTA
                     VTCDPDDFVERGYKLRQNIGRTARETELFICITMYNEDEFDFTRTMHAVMKNISHLCS
                     RNKSRTWGENGWQKIVVCIVSDGREKIHPRTLDALAAMGVYQHGIAKNYVNQKAVQAH
                     VYEYTTQVSLDSDLKFKGAEKGIVPCQIIFCLKEKNQKKLNSHRWFFNAFGKALNPNV
                     CVLLDVGTRPATTALYHLWKAFDTDSNVAGACGEIKAMKGKWGKNLLNPLVASQNFEY
                     KLSNILDKPLESVFGYITVLPGALSAYRYHALQNDETGHGPLSQYFKGETLHGQHADV
                     FTANMYLAEDRILCWELVAKRGERWVLKYVKGCTGETDVPDSVPEFVSQRRRWLNGAF
                     FAAVYSLVHFKQIWLTDHTLARKILLHIEFVYQFIQLIFTYLSLANFYLTFYFIAGGL
                     ADPKVDPFGGAAKYIFLILRYVCILLISTQFVLSLGNRPQGARKMYLASMLIYAVIMA
                     YTLFACIYVVVRQFSKKGDARDENDKISLGNNVFTNLIVSTASTVGVYFLMSFLYLDP
                     WHMFTSFLQYLILLPSYICTLQIYAFCNTHDVTWGTKGDNVMKTDLGGAVGKGSIVEL
                     EMPSEQLDIDSGYDEALRNLRDRVEVPPQGISEEQMQQDYYKSVRTYMVVSWLIANAT
                     LAMAVSEAYGGSSIGDNFYLRFILWSVAGLAAFRALGSTAFAVIGLINMVVEGRVRMK
                     LEAPKWLGGWGSKITDTMSSVASGVRR"
     gene            complement(180218..185618)
                     /locus_tag="MYCTH_2309766"
                     /db_xref="GeneID:11513512"
     mRNA            complement(join(180218..180558,180628..185150,
                     185353..185618))
                     /locus_tag="MYCTH_2309766"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665717.1"
                     /db_xref="GeneID:11513512"
     CDS             complement(join(180529..180558,180628..185150,
                     185353..185389))
                     /locus_tag="MYCTH_2309766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665765.1"
                     /db_xref="GeneID:11513512"
                     /db_xref="InterPro:IPR002880"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="JGIDB:Spoth2_2309766"
                     /translation="MADVKLRRPEEAVAAIAYLASDVVVSVQPSLASDSEFSGLLKQL
                     AAKKAPSLVAKTSDAVPEIQSVRHNTDPLLSVFTPIRSGRLVSVTTTSSILLPSVAHL
                     YKLANFPVVLHVALAPKSFPDYTAITSIRNSGWTFLQSWSLQEAHDIALTAHALAIRS
                     GKGVIHFFDPTSSAGAEAIDVASLDVIRNILNLDNVRRFQSAPIAGSSIYADDGRVAV
                     VSDQPESLATGTVPVDGVPTPSAALASPTITSQSSVKSSQQPSAASSPPLPSAATTIE
                     PAAAIVSSEDIYKYVSSIWSQLNDLTGRQYSAFEWSGNPKAESCLFLFGSDVSLFSDA
                     IAHAQADESFATADLLVPRLYRPWLGATLLQALPKSVKKLAVLEQVSRKTTKWGPILI
                     DVLTSVKSAAGGVETIVGHQLGYISKETVQQALRGVFQNLNSDKPVQNLEVGEREAPQ
                     QSPEYGLEQPKLETAYTKILNQLFGDRAFIANSLDSDNAGISNTISATPEFGFGSLLA
                     RKERRKKFVSEVKAAASSGQFLTENPKRALAKWVANAEDSKKAEEAAEDVISKLTIDN
                     SRLSRSLLQNKHFFRKQSLWLVGSDAWSYDLGNSGVHHVLASGENVNMLIIDSTPYSE
                     RAAADANRRKKDIGLYAMNFGNAYVASTAVYSSYTQVLQAMDEADKFDGPSIVLAYLP
                     YFGETDSPLTVLQETKKAVDIGYWPLYRWNPENEKKNEPNFSLDSERIKKELKDFLDR
                     DNRLTQMMRSTPQFGGVLSEDYGTEIRAQQKRQAKDAYNQLLEGLFGAPLTILFGSDN
                     GNAQSLAKRLGTRGRARGLKTTVMAMEDYPVEDLPTEENLVIITSTAGQGEFPQNGKP
                     FWDAIKDNTELDLASVKYSVFGLGDSHYWPRKEDRVYYNKPAKDLDRVLANFGATRLT
                     DLGLGDDQDPDGYQTGYQEWEPRLWEALGVANVEGLPEEPAPMTNEDIKLASNYLRGT
                     IAEELKDTSTGAISAANQQLTKFHGTYMQDDRDLRDERKAKGLEPAYSFMIRCRLPGG
                     VSTAKQWIQMDDISNELGNQTMKLTTRQTFQFHGVVKGKLKPAMQAINRALMTTIAAC
                     GDVNRNVMCSPLPSQSKYHRQVYECSKKISDHLLPSTTAYHEIWLTDDDDKKTQIAGN
                     AVQDFEPLYGPTYLPRKFKISIAIPPHNDVDVYAHDIGLIAIKGDDGNLEGFNLLAGG
                     GMGTTHNNKKTYPQLGRMLGFVRADEVHIACEKVMLVQRDYGDRKNRKHARLKYTIDD
                     MGLDVFRGKVEELWGKQFQPARPFHFDSNVDTFGWTKDENGMNHFTFFIENGRIEDTA
                     EFRMKTGLREIAKVHKGEFRLTPNQHLILSNVADEDLPAIKALMAEYKLDNLQFSGLR
                     LSSSACVAFPTCGLAMAESERYLPVLISKLEACLEENGLSRDSIVMRMTGCPNGCARP
                     WLAEVAFVGKAYGAYNMYLGGGYYGQRLNKLYRSSIKEDEILAIMKPLLKRYALERNE
                     GERFGDWTIRAGIIKETKEGRDFHDGVAEEESDEE"
     gene            complement(185903..187329)
                     /locus_tag="MYCTH_2309770"
                     /db_xref="GeneID:11513513"
     mRNA            complement(join(185903..186988,187070..187329))
                     /locus_tag="MYCTH_2309770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665718.1"
                     /db_xref="GeneID:11513513"
     CDS             complement(join(186254..186988,187070..187117))
                     /locus_tag="MYCTH_2309770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665766.1"
                     /db_xref="GeneID:11513513"
                     /db_xref="InterPro:IPR013862"
                     /db_xref="JGIDB:Spoth2_2309770"
                     /translation="MPSASRRSWRWLPRPKSFLGFMSLQTGTELISIALVFNKATAVY
                     GVLTLFTGYSLSALQVTAYLCSLFVLATLAVCVPHIRTQSPLHNLALAWVYAVDSLVS
                     AAYTAAFATSWYCADIHDPKGPAGAAPGDAAASPSNGEVQLDAGQAAQAEAGTGAHDT
                     AASLVLVVAFTLVRVYFSLVIAAYARMVLLRFVDEHMGESEEIADVSPDPFALGAPLG
                     EGWKGKLGRAMVSVGRGYWLGGRKEDEEWARQVNSKFRSTRE"
     gene            complement(188947..189935)
                     /locus_tag="MYCTH_2309773"
                     /db_xref="GeneID:11513514"
     mRNA            complement(join(188947..189580,189746..189935))
                     /locus_tag="MYCTH_2309773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665719.1"
                     /db_xref="GeneID:11513514"
     CDS             complement(189220..189543)
                     /locus_tag="MYCTH_2309773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665767.1"
                     /db_xref="GeneID:11513514"
                     /db_xref="JGIDB:Spoth2_2309773"
                     /translation="MPVRIPAATKTEVFCMGAAGVTGFAPFYLMAPGAEERLSRQTVK
                     WAPSWERNITFFRNPVERGIQRISPPVERTVKRIEHGLPLEKAAKRTNTTLRRNFERL
                     GFKPT"
     gene            191566..192984
                     /locus_tag="MYCTH_117681"
                     /db_xref="GeneID:11513515"
     mRNA            join(191566..191722,191795..192984)
                     /locus_tag="MYCTH_117681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665720.1"
                     /db_xref="GeneID:11513515"
     CDS             join(191647..191722,191795..192393)
                     /locus_tag="MYCTH_117681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665768.1"
                     /db_xref="GeneID:11513515"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="JGIDB:Spoth2_117681"
                     /translation="MRVENCFFCGRPAWPSKGITFMRNDGKSFRFCRSKCHKNFKMKR
                     NPRKLKWTKAYRKNAGKEMVVDSTLQFAARRNVPVRYDRELWAKTLKAMERISEIRAR
                     RERMFYKKRMAGKRAREVAAARKLVAENEHLLPRLRGSEKRRLAELAAERGVDVEELE
                     REELAKLRTSKKTKAFGGEVRRLRVRTDGGVEEITESAAGHMHEDVDDDDDADDDDND
                     DGMDTD"
     gene            complement(193037..194159)
                     /locus_tag="MYCTH_2309779"
                     /db_xref="GeneID:11513516"
     mRNA            complement(join(193037..193472,193577..193706,
                     193773..193861,193928..193953,194013..194159))
                     /locus_tag="MYCTH_2309779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665721.1"
                     /db_xref="GeneID:11513516"
     CDS             complement(join(193138..193472,193577..193706,
                     193773..193861,193928..193953,194013..194065))
                     /locus_tag="MYCTH_2309779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665769.1"
                     /db_xref="GeneID:11513516"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2309779"
                     /translation="MAQAGAGGSYSNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNM
                     YQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDISNAK
                     SFQNTRKWIDDVRAERGNDVIIVLVGNKTDLNDKREVTTQQGEEEAKRNNLMFVETSA
                     KLGHNVKTLFKRIAQALPGMEGTDAAAQASSQMIDVKTPAAPAPQEGCAC"
     gene            194570..196374
                     /locus_tag="MYCTH_2309781"
                     /db_xref="GeneID:11513517"
     mRNA            join(194570..194828,194879..196374)
                     /locus_tag="MYCTH_2309781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665722.1"
                     /db_xref="GeneID:11513517"
     CDS             join(194677..194828,194879..196040)
                     /locus_tag="MYCTH_2309781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665770.1"
                     /db_xref="GeneID:11513517"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="JGIDB:Spoth2_2309781"
                     /translation="MPVLKAPSGNPDAPQQHKQPSRKGKKAWRKNVDISEVQQGLEEL
                     NDQIIKGGVIAEKDSSELFTIDVEGDPELPKRFPKHIKKGLKADEIIAQRSAIPAVPM
                     RKRSGDKTTDGIVPVKRQRTTYVTHKELARIKKVADGHHESTVTVEDATYDPWAQPEE
                     EPKKEDQLFLPKVEKIKKPKTLEQRPISLAASGKPVPAVPKPKGGHSYNPTFTDYQER
                     LIEESEKAVEAERKRLEALEAERIKMEAAARSAAEAEAAEARAELSEWEDDSSWEGFE
                     SAAEEAVVKAKKPRRKTQAERNRIKRRKEEERRLKHEAAMKRKRAQEDRIKQIVREVE
                     EKERQRALEKIEMSDPSEEETDDVELRRKKLGKIKLPEKDLELVLPDELQDSLRLLKP
                     EGNLLKDRYRSMLIRGKVEARRKIPFRKQAKTKVTEKWTYKDFSI"
     gene            <197335..>197517
                     /locus_tag="MYCTH_2068429"
                     /db_xref="GeneID:11513518"
     mRNA            <197335..>197517
                     /locus_tag="MYCTH_2068429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665723.1"
                     /db_xref="GeneID:11513518"
     CDS             <197335..197517
                     /locus_tag="MYCTH_2068429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665771.1"
                     /db_xref="GeneID:11513518"
                     /db_xref="JGIDB:Spoth2_2068429"
                     /translation="KKKTYNTGDSPVVTDLSTSPAVVSLTKGEQTGSRVFWRLWSYVT
                     EECLAVIHISCSSYLP"
     gene            198218..198895
                     /locus_tag="MYCTH_2309782"
                     /db_xref="GeneID:11513519"
     mRNA            join(198218..198397,198526..198895)
                     /locus_tag="MYCTH_2309782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665724.1"
                     /db_xref="GeneID:11513519"
     CDS             join(198292..198397,198526..198656)
                     /locus_tag="MYCTH_2309782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665772.1"
                     /db_xref="GeneID:11513519"
                     /db_xref="JGIDB:Spoth2_2309782"
                     /translation="MQLTTIATFVSLAALGVAPSVLSQSIPISATACTPGQYACGYRN
                     GQDAIYICSNGRLEFAASCGTGRCESIAGVPHCV"
     gene            <200357..>202325
                     /locus_tag="MYCTH_58642"
                     /db_xref="GeneID:11513520"
     mRNA            join(<200357..200430,200593..200741,200820..201005,
                     201101..201650,201785..>202325)
                     /locus_tag="MYCTH_58642"
                     /product="sugar transporter-like protein"
                     /transcript_id="XM_003665725.1"
                     /db_xref="GeneID:11513520"
     CDS             join(200357..200430,200593..200741,200820..201005,
                     201101..201650,201785..202325)
                     /locus_tag="MYCTH_58642"
                     /note="Sugar transporter-like protein"
                     /codon_start=1
                     /product="sugar transporter-like protein"
                     /protein_id="XP_003665773.1"
                     /db_xref="GeneID:11513520"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_58642"
                     /translation="MQALRENRKAVLWSVLISLSIIMEGYDTILMGNFFAYPEFAKKF
                     GHYYGEEDGWQVSAPWQTGLNMASTVGGIFGGLLNGYFASKFGYRWSMIGAMGFLNAF
                     IFVVFFAPNAATLVGGQILCGLCWGVFATLSPAYASEVCPTNLRGYLTTYVNLCWAIG
                     QLLASGVLRGCLPIVGEMAYKIPFALQWAWPLPIMVIAYFAPESPWYLVRTDRLDEAR
                     KSIERLSGDKTDDQIGAQLAMMVHTTKLESEVTKGATYLDCFRGVDLRRTEICMLTFM
                     GQILSGSSFAYTPTYFFTTAGMETYNAFNLGLGAKGMGFLGTVLSWWLITYFGRRTLY
                     VTGMGILSTVLFVIGILDVSAGRRGLWPSGGLCIFWLFTYSLTVGPLAYSIISETSSV
                     RLRPLTVVLARTAYQVANIVSQVLYSYMQNSTAWDLRGKSGFFWGGTAFLTFVWAFFR
                     LPEIKGRTYEELDILFANRTPARKFATSHVDAYALSVPPAAEKHAHAEK"
     gene            complement(<202988..>204322)
                     /locus_tag="MYCTH_58986"
                     /db_xref="GeneID:11513521"
     mRNA            complement(<202988..>204322)
                     /locus_tag="MYCTH_58986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665726.1"
                     /db_xref="GeneID:11513521"
     CDS             complement(202988..>204322)
                     /locus_tag="MYCTH_58986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665774.1"
                     /db_xref="GeneID:11513521"
                     /db_xref="JGIDB:Spoth2_58986"
                     /translation="LEGIRDDVSKYARAVVRDWRSVAPRLLSGVTPGHLALSVVCDID
                     PGHPEARPLAELVVAPILLLPPGHLRKCNIRLAMTPDGRLQQLAKDAVCRSCGIATDP
                     LPLPPNADPVLTALPRELRLRILEYTDLVTPTRQVMWSGQDRAYSVFAFAYSDRGIAD
                     ENHRAQFFRCWIGEDLAPEPPSPGCFCRRHHAAFSPACKCWVPPGPSLFLVCRTLYED
                     AQYVFFSKNRFTVHDYKISPPWALPFVEDCEEDELPPKYPYPNERFAASHFLREIIPA
                     PSLAHLRFLELVFPPYRPGSWPETHHPAMQDWRATIDWLRPRINTRRLTLQLAVSNVG
                     DIALEPYYRPITAEEARDMLKAYMDLVQPLARLADDGLARFYAHFPHPQQWTEEFRFN
                     STSHDWDRLRRAELALKEHAERCVLGSRYDSLHADGKEEPRLGDWQEMYWDC"
     gene            206119..208824
                     /locus_tag="MYCTH_2309784"
                     /db_xref="GeneID:11513522"
     mRNA            join(206119..208430,208595..208824)
                     /locus_tag="MYCTH_2309784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665727.1"
                     /db_xref="GeneID:11513522"
     CDS             join(206360..208430,208595..208611)
                     /locus_tag="MYCTH_2309784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665775.1"
                     /db_xref="GeneID:11513522"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2309784"
                     /translation="MLGARAARQVGRLGPRGANLTARTTQRSRIRLQPLFTRTPSITR
                     PEAAGQSEGTTTTTTDLHPSRPLFPAPLVLARQLSGKPLPQGKPRLLNFAYRAAAWLG
                     GSVLLIGVGVLGFFLYDASTYHTHPSQADIDISALALSPRRGGPKNLPILEYYIDDDD
                     SEEMRRQKDKPRLVILGGGWGGVSLIKELDPDNYHVTVISPANYFLFTPMLPSATVGT
                     LGLRSLVEPIRRIVHGIGGHFLRARAEDVDFSARLVEVSQVDCNGVEQRFYVPYDKLV
                     IAVGSVTNPHGVKGLEHCHFLRDINDAREIRNKVIQNLELACLPTTTDEERKRLLSFV
                     VCGGGPTGVEFAAELFDLLNEDLIQLFPRLLRNEISVHLIQSRDHILNTYDETLSKYA
                     EDRFARDQVEVLTNSRVSEVRPDSIVFTQKDADGGIVTKELPMGFCLWSTGVSQNEFC
                     RRLAKKLGSAQSNRRALETDTHLRLNGTPLGDVYAIGDCATVQNNVADHIVTFLRSLA
                     WKHGSDPERLQLRFSDWRSVAEQVKRRFPQAVGHLRRLDKLFAEYDRDQSGTLDFGEL
                     RELLRQIDRKLTSLPATAQRAHQQGQYLARKFNKLARATPALRANDILDGDLDAAVYK
                     AFEYKHLGSLAYIGNSAVFDLGKGWGLAGGLWAVYAWRSIYFAQSVSFRTRVMMAMDW
                     AKRGLFGRDLMSY"
     gene            complement(<209038..>211675)
                     /locus_tag="MYCTH_104628"
                     /db_xref="GeneID:11513523"
     mRNA            complement(join(<209038..211375,211506..>211675))
                     /locus_tag="MYCTH_104628"
                     /product="glycoside hydrolase family 3 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665728.1"
                     /db_xref="GeneID:11513523"
     CDS             complement(join(209038..211375,211506..211675))
                     /locus_tag="MYCTH_104628"
                     /EC_number="3.2.1.37"
                     /note="CAZy_ID 268078"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003665776.1"
                     /db_xref="GeneID:11513523"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="JGIDB:Spoth2_104628"
                     /translation="MSAVAYGLDGPFQTYPDCTKPPLSDIKVCDRTLPEAERAAALVA
                     ALTDEEKLQNLVSKAPGAPRIGLPAYNWWSEALHGVAHAPGTQFRDGPGDFNSSTSFP
                     MPLLMAAAFDDELIEAVGDVIGTEARAFGNAGWSGLDYWTPNVNPFRDPRWGRGSETP
                     GEDVVRLKRYAASMIRGLEGRSSSSSSCSFGSGGEPPRVISTCKHYAGNDFEDWNGTT
                     RHDFDAVISAQDLAEYYLAPFQQCARDSRVGSVMCAYNAVNGVPSCANSYLMNTILRG
                     HWNWTEHDNYVTSDCEAVLDVSAHHHYADTNAEGTGLCFEAGMDTSCEYEGSSDIPGA
                     SAGGFLTWPAVDRALTRLYRSLVRVGYFDGPESPHASLGWADVNRPEAQELALRAAVE
                     GIVLLKNDNDTLPLPLPDDVVVTADGGRRRVAMIGFWADAPDKLFGGYSGAPPFARSP
                     ASAARQLGWNVTVAGGPVLEGDSDEEEDTWTAPAVEAAADADYIVYFGGLDTSAAGET
                     KDRMTIGWPAAQLALISELARLGKPVVVVQMGDQLDDTPLFELDGVGAVLWANWPGQD
                     GGTAVVRLLSGAESPAGRLPVTQYPANYTDAVPLTDMTLRPSATNPGRTYRWYPTPVR
                     PFGFGLHYTTFRAEFGPHPFFPGAGKGDGDGEDKGESKSEIRTQQQQQQQQQQRRAAA
                     AATTPIRDLLRDCDKTYPDTCPLPPLTVRVTNEGERASDYVVLAFVSGEYGPAPYPIK
                     TLVSYARARGLKGKGGDGDGDGDGATTTVSLDWTVGNLARHDERGNTILYPGTYTLTL
                     DEPAQASVQFALEGEPVVLDEWPAPPSANSTARGRHR"
     gene            212893..214302
                     /locus_tag="MYCTH_109444"
                     /db_xref="GeneID:11513524"
     mRNA            join(212893..213402,213540..213760,213843..214302)
                     /locus_tag="MYCTH_109444"
                     /product="glycoside hydrolase family 12 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003665729.1"
                     /db_xref="GeneID:11513524"
     CDS             join(212960..213402,213540..213760,213843..213922)
                     /locus_tag="MYCTH_109444"
                     /note="CAZy_ID 267926"
                     /codon_start=1
                     /product="glycoside hydrolase family 12 protein"
                     /protein_id="XP_003665777.1"
                     /db_xref="GeneID:11513524"
                     /db_xref="InterPro:IPR002594"
                     /db_xref="JGIDB:Spoth2_109444"
                     /translation="MQPFLLLFLSSVTAASPLTALDKRQQATLCEQYGYWSGNGYEVN
                     NNNWGKDSASGGHQCTYVDSSSSSGVAWHTTWQWEGGQNQVKSFANCGLQVPKGRTIS
                     SISNLQTSISWSYSNTNIRANVAYDLFTAADPNHATSSGDYELMIWLARFGDVYPIGS
                     SQGHVNVAGQDWELWTGFNGNMRVYSFVAPSPRNSFSANVKDFFNYLQSNQGFPASSQ
                     YLLIFQAGTEPFTGGETTLTVNNYSARVA"
     gene            complement(<250714..253026)
                     /locus_tag="MYCTH_2145046"
                     /db_xref="GeneID:11513525"
     mRNA            complement(join(<250714..251197,251313..251544,
                     251605..251674,251751..251836,251892..251934,
                     252007..252151,252209..252258,252318..252395,
                     252482..253026))
                     /locus_tag="MYCTH_2145046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665730.1"
                     /db_xref="GeneID:11513525"
     CDS             complement(join(250714..251197,251313..251544,
                     251605..251674,251751..251836,251892..251934,
                     252007..252151,252209..252258,252318..252395,
                     252482..252694))
                     /locus_tag="MYCTH_2145046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665778.1"
                     /db_xref="GeneID:11513525"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="JGIDB:Spoth2_2145046"
                     /translation="MPAPEGAESPAVNGTAAPETDGTIATRAHYAPPWADVSIIGIAG
                     SSGSGKSTLSHAIVNKLNLPWVVILSIDSFYKSLDEESSRKAFRSEYDFDAPDAIDFD
                     VLVDRLRDLKAGKRAEIPVYSFEKHARLDRTTSIYSPHVLILEGIFALYDPRVLELLD
                     MKIFCEADADTCLSRRILRDQRDRGRDLEGIIKQWFTFVKPNFEKYVDPQRKVADIIV
                     PRGVENHVAMSMVVQFIQQKLLEKSTHHRAALTRLELEAQSEKLSPKVTIMKQTPQMQ
                     GMNTIIHDIDTSSEDFIFYFDRLSALLVEQALNNIPFVPVEITTPQAHTYSGLRPRGE
                     VSAVIVLRGGAALEAGLHRCITDCKTGRMLIQSNVRTGEPELHYLVLPPDIDRHEAVL
                     LLDAQMSSGGSALMAVQVLVDHGVRADRIVLVTYSAGRMGLHRLTKVFPDISVVVGRV
                     VPDIEERWVEKRYFRC"
     gene            253321..255031
                     /locus_tag="MYCTH_2309794"
                     /db_xref="GeneID:11513526"
     mRNA            join(253321..253561,253633..253709,253917..254112,
                     254309..255031)
                     /locus_tag="MYCTH_2309794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665731.1"
                     /db_xref="GeneID:11513526"
     CDS             join(253460..253561,253633..253709,253917..254112,
                     254309..254776)
                     /locus_tag="MYCTH_2309794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665779.1"
                     /db_xref="GeneID:11513526"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="JGIDB:Spoth2_2309794"
                     /translation="MSSWSAALELGELDLDSAFRDAVLSQLRQSFDRMNSSTSTATPP
                     QHAFEKRAADVKAPKSDINALILDYLLMEGYPNAAAKFCKEANLQPQQPDPSVQTRQE
                     IQHAIHSGNIEAAISALNKLDPELLDTDPKLHFSLLRLQLVELIRQCNNGDVTPALEF
                     ATKNLGPRAAANREFLEDLEQTMALVIFPHDKNLRPELASLLSPDLRRTTAARVNEAM
                     LLRQNQRREAAIRQLVRMRAWAETSARAKKKDLPESIELGLKADSPEGPGAGEGDHEA
                     MITT"
     gene            complement(255024..256155)
                     /locus_tag="MYCTH_73070"
                     /db_xref="GeneID:11513527"
     mRNA            complement(join(255024..255580,255666..255773,
                     255840..256155))
                     /locus_tag="MYCTH_73070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665732.1"
                     /db_xref="GeneID:11513527"
     CDS             complement(join(255271..255580,255666..255773,
                     255840..256069))
                     /locus_tag="MYCTH_73070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665780.1"
                     /db_xref="GeneID:11513527"
                     /db_xref="InterPro:IPR006885"
                     /db_xref="JGIDB:Spoth2_73070"
                     /translation="MSSLRTTASAARLLRTASHARTAAVPAARRYESSTTTTATATSV
                     PAKTEQEKKETSPMATLPRNAPDYNVPIDMATNTFTPVPKHVQDGSEENVTPAGLLSG
                     APMELQARTVRIYKPAKPATQSGEHGSSRWRMDWDVLGKGHRWENPLMGWQSSGDFMQ
                     GTHINFKTKEDAIAFAEKQGYEYFVQEPNERKFVPKAYANNFLYSPGKLKHIRTK"
     gene            256321..257669
                     /locus_tag="MYCTH_2309800"
                     /db_xref="GeneID:11513528"
     mRNA            join(256321..256514,256577..256591,256797..256947,
                     257013..257078,257135..257669)
                     /locus_tag="MYCTH_2309800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665733.1"
                     /db_xref="GeneID:11513528"
     CDS             join(256467..256514,256577..256591,256797..256947,
                     257013..257078,257135..257160)
                     /locus_tag="MYCTH_2309800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665781.1"
                     /db_xref="GeneID:11513528"
                     /db_xref="JGIDB:Spoth2_2309800"
                     /translation="MSYVTRRALSTLIPPKVASPKAIGAAPDAVRMQRVVSFYEKLPR
                     GPAPEVKPTGILGRYQAKHFGKNPSAKPIVQAIVFLLVVGYAQNYYFHLRHHKNNAH"
     gene            257985..262506
                     /locus_tag="MYCTH_2309802"
                     /db_xref="GeneID:11513529"
     mRNA            join(257985..258100,258253..258423,258513..259011,
                     259078..262506)
                     /locus_tag="MYCTH_2309802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665734.1"
                     /db_xref="GeneID:11513529"
     CDS             join(258361..258423,258513..259011,259078..262265)
                     /locus_tag="MYCTH_2309802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665782.1"
                     /db_xref="GeneID:11513529"
                     /db_xref="JGIDB:Spoth2_2309802"
                     /translation="MATESPKQRSDEATLTSSTEPTIKVDSDSQNVDSKQPHVNGEAS
                     AAATDELENKHISDIVDDLVNSTEVSISGGSDNEAARSDASKTKDDAKSQGRASSSIK
                     KPTSFKAINVNKTFLTSKTPAPGTQPKAAEKAAPTTSAASPAPGTTTTSRPRLVAKLG
                     SGLITKSSGGNGGKPAPDPSAVWNKNRPAPPPEPKKYTDEELRKYGIHMASRLQSDSS
                     KGHSNWADIEDDDDDWAPDTITWKDGTKVAITHPEGQPANAPASESKSQPASKDNAPA
                     ESTKASSPSSSPSVKPGVLGSGKGLVLKGAPEKPTLVAKPPPPPAPTKSPWAPLPKIE
                     RVSPAAVEAQTGPTPQPNSGDARTNQTHSQPPPREIAADDFSRTPWRDGPQGGNRELF
                     NSQSGRYEPAPDRRGPMRQEPQYGRHPAVMQRPPHHEQQGPTEYSGGLQPGRNEHQGP
                     EERRRGSSNISGGSGSWQRLKGAEHPLPPPELINARRASTTAGSDSPASPRNFSPSGA
                     QGGSQHGQAFGPRPSPGTAHATPYSSGTGPGGRTMPPPVQPSPTITPVAPITEDDIEL
                     QKRLMRERRELALKRRQEEEAREEAARRERIRLKLEALGPPPETSKSKKAAAKDQAFT
                     PTQIQSREPTNSEKPAPERSQEAQKEAPQAVTPQPQPAKQPPTQPAQSTEPAAQTVSK
                     PDGAESRPQPHPWATTPRQGDRPAAVWGPQPSTKNVWAAPNNNNNRSLGNGTFATEIG
                     APPPPSGPGPIAPPSSVRAAGPSQTNMTSAAPWQPPIGPPRQPQAPRSTGERDMKDNP
                     WAAAVRANDGRFSEMLSSQQDERERRLQAEGRSPAEAQPAIKDTWRPTRLDENGVRTE
                     GAPKQTIHIGKENPWAGSAEPKPSASQQAPSVPGGDVSEYSQLPQSSIPAHDMASASM
                     IGTKTAVPPGRGSRFFPARDARQDARDVRPEPTAEALRHNAPSPPPPDMAGHPAFDGD
                     ATHPHVSLPRPHPIVRLPPAASESKTSAPEANRTTAGSSRSQGPSFAWASQPAYKEAD
                     GPRASAQKPENPWQAKIDNLLGDRKVHPSRTAASDVQAPPQKQQESSVPEPVAPDAGV
                     EGLATTKVMAEECFEEQEMGSVPPIRLPKTVPEMAWQPSPAPKPLSKKFWPTVLSAEP
                     ISFPIDVSGAGNVWRICIPGTESKTVTVPFGRTRSNPRRGGPRGGRHSSSAQHRQGKG
                     RDGSSSYPGEQRDGVSGSNSHGRNNRGGYRGRENWSRHAASQIQA"
     gene            263252..266207
                     /locus_tag="MYCTH_2309805"
                     /db_xref="GeneID:11513530"
     mRNA            join(263252..264278,264429..266207)
                     /locus_tag="MYCTH_2309805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665735.1"
                     /db_xref="GeneID:11513530"
     CDS             join(263559..264278,264429..265577)
                     /locus_tag="MYCTH_2309805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665783.1"
                     /db_xref="GeneID:11513530"
                     /db_xref="JGIDB:Spoth2_2309805"
                     /translation="MATITNASTGGDGSSSSSSSSSNNNNNNNNVNNDISRGGTASDG
                     GGLFKGVKLAQKKKLINLLRGWPAPSLLPAADLQEATNYVLSDPAIAVPVLQYGIDPG
                     YQPLREEVARWLSELYPRYTPPGSPGSPPAEKGGGRGSDGSSSDGSGSGSGSGAGISA
                     DEITITGGASQSLACVLQSFTDPGYTRAVWVAAPCYFMACPIFEDNGFRGRLRALPED
                     EGGVDVRVLERRLKECEAEPWENRPLKNPYPDRKLYRHVIYLVATCANPSGKTMSLAR
                     REQLVHLAREYDALIISDDVYDLLQWPVTPLSSLPSPSASPSPSATGTGSGSGSESGS
                     PFPVPRPPLLPLLSQIDAALPPSRHNPAGSGKVFSHAISNASFSKLVGPGVRTGWIHA
                     SADFAYGFSVTGTNRSGGAASQFAAAVVWRALASGRVARHVDSVVRPALRRRHALALD
                     AIARFLAPLGVTVWGGNTVRGAGQGVGFFSRGDGGGSSSGGSSSGDSSSNSSSSSSGE
                     RGGEAEVGDGREEVYGGYFLWLTLPEGVDSAVVAERARAEEDLIVAPGQIFEVAGDED
                     SARFPRNLRLSYSWADEEDIVEGIERLATVLRRMLRGEGDDEARKEDAHGDAQVFK"
     gene            267671..269051
                     /locus_tag="MYCTH_2309808"
                     /db_xref="GeneID:11513531"
     mRNA            267671..269051
                     /locus_tag="MYCTH_2309808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665736.1"
                     /db_xref="GeneID:11513531"
     CDS             267884..268720
                     /locus_tag="MYCTH_2309808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665784.1"
                     /db_xref="GeneID:11513531"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="JGIDB:Spoth2_2309808"
                     /translation="MGFAQSYLLREVVCSDLTAFFRLFILNRARLNNGSARPSSPFLS
                     TALSLLLLGCSSGIPGRTMMTRARSNTAETALLNASAHYDLGNALFAAFLSADMTYSC
                     PVWAPLPRRGNSVADDDDRNDNGEEETDEEETLEAAQLRKIHRVIASARIKRGDHVLE
                     IGTGWGSFAIEAVKTTGCRVTTVTLSREQKAWVEERVRREGLGCKVDVLLLDYRAIPA
                     VPGGYDKIVSIEMVEAVGKDHLAAYFGVVHRLLKREGGIAVLQCITMPEGRQAAYEER
                     EE"
     gene            complement(269052..270506)
                     /locus_tag="MYCTH_2309809"
                     /db_xref="GeneID:11513532"
     mRNA            complement(269052..270506)
                     /locus_tag="MYCTH_2309809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665737.1"
                     /db_xref="GeneID:11513532"
     CDS             complement(269382..270380)
                     /locus_tag="MYCTH_2309809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665785.1"
                     /db_xref="GeneID:11513532"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="JGIDB:Spoth2_2309809"
                     /translation="MIELSANWKKLQAKIKAESASKPAAPKRKADDSVPDQAKEGPKK
                     RRKQQQDRGRKPAQLSRDSSKGDQPKAKPSMGNTQSSKIDAVPPKHGISPSLAVWAAD
                     NDISPESIAEAYGLGLQANSLLSTDNPGRPNEGLAPEVQVGKYIAIDCEMVGVGDGGY
                     EDELARVSVVDFHGKQVYDSYVKPRRRVVDWRTHVSGVAPKHMANARTFDEVQAQISE
                     LLKGRIVVGHDVKHDLRVLELDHPGKMIRDTAKFSGFRKYGNGPKPALRVLARELLGV
                     EIQAGKHSSLEDARVAMLLFRKHKPAFDVEHANRYPDEAKSKPKKGNKGKKTKKKR"
     gene            270666..272411
                     /locus_tag="MYCTH_85756"
                     /db_xref="GeneID:11513533"
     mRNA            join(270666..270829,270897..272411)
                     /locus_tag="MYCTH_85756"
                     /product="histone acetyltransferase ESA1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665738.1"
                     /db_xref="GeneID:11513533"
     CDS             join(270744..270829,270897..272310)
                     /locus_tag="MYCTH_85756"
                     /codon_start=1
                     /product="histone acetyltransferase ESA1-like protein"
                     /protein_id="XP_003665786.1"
                     /db_xref="GeneID:11513533"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="JGIDB:Spoth2_85756"
                     /translation="MSPGATNGEAEVGSNEPMQKSKATPDTLKIGCIALVTKDGQPRR
                     AEILSIRETKSGKQFYCNFDNFNKRLDEWVTVDRIDFDQDVEWPNPDKDKLKDAKNKK
                     TGAVSKKSQPSKKTQKRIGKREQSVASEGQTPHQWTESADGQNKPDGEDGANASLEVG
                     ATPGVGPDEMELDEDETPASAAKKEKAQPFSREQEIEKLRTSGSMTQNPAEISRIRNI
                     NKVEFGRYVLFPWYFSPYPEAFSQEDCIYICEFCLSYFGNLKSFTRHRTKCTLQHPPG
                     NEIYRDDFISFFEIDGRRQRTWCRNLCLLCKMFLDHKTLYYDVDPFLFYVMTSRDEKG
                     SHIIGFFSKEKESADGYNVACILTLPPYQRKGYGRLLIQFSYELSKIEGKLGSPEKPL
                     SDLGLLSYRQYWAENIIDLLLGYSESGEKCTIETIATRLAMTTQDVEHTLQALKMQVY
                     HKGEHKIVIPEKLLKQREKSRAKQKRVIDPSRIQWKPPVFTAANRTWGW"
     gene            272703..276311
                     /locus_tag="MYCTH_2309812"
                     /db_xref="GeneID:11513534"
     mRNA            join(272703..273060,273193..275698,275839..276311)
                     /locus_tag="MYCTH_2309812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665739.1"
                     /db_xref="GeneID:11513534"
     CDS             join(272780..273060,273193..275698,275839..275964)
                     /locus_tag="MYCTH_2309812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665787.1"
                     /db_xref="GeneID:11513534"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="JGIDB:Spoth2_2309812"
                     /translation="MATPAVTSSDAGFMTSDGPGSRTPRAGRLPGSSSGSRPAVPPSE
                     SLALSDGEAEGFADDQVPVRARPTDPANIPRVEDKIGLIIQESFENFIEGYVESPNAS
                     GQPTSSAVTTDKYYVAQIHGMRTYQLSTFYVDYKHLESWHNGALAAGIMESYYRFLPF
                     LTAALHNMIAKYEPQYFREHRQPTASSQQHSSGASNMGSASQSELSSKTANQQTDKLF
                     SIAFYNLPLVSRIRALRARNIGQLLSISGTVTRTSEVRPELALATFVCEACRSVVPDV
                     EQTFRYTEPTQCPNATCLNRTAWRLDIRQSTFVDWQKVRVQENSSEIPTGSMPRTIDV
                     ILRGEMVDRAKAGEKCIFTGALIVVPDVSQLGLPGLRRVAVRDDRSADAGGSGVSGLK
                     ALGVRDLTYRLAFLACMVSSDVSALGASGEAQIVDVVGAMTAGSNLETAETVKEVQDA
                     VLASYTQEEIADLRAMVHSDRIYSRLVQSLAPMVYGHEIVKKGILLQLLSGVSKTTPE
                     GMQLRGDINICIVGDPSTSKSQFLKYVCNFAPRAVYTSGKASSAAGLTAAVVKDEETG
                     EFTIEAGALMLADNGICCIDEFDKMDMADQVAIHEAMEQQTISIAKAGIQATLNARTS
                     ILAAANPVGGRYNRKTTLRANINMSAPIMSRFDLFFVILDECNEQVDRHLAEHIVGIH
                     QNRDAAIAPEFSTEQLQRYIRFARTFRPEFTEEAKEVLVQRYKDLRADDAQGGVGRNS
                     YRITVRQLESMIRLSEAIAKANCVEDITPEFVNEAYHLLRQSIISVEHDDVEVDEDED
                     EDEDGQTLRRAADAASGVPATDGDGDGDEPMEEEGDGERQASTGPSAAGQQQQQQQRQ
                     REKQTISYDKYISMVNLLVSKVAEDETSGSGEGIEGDALIQWYLEQKEEELQNEEDYN
                     NEMALARKVLKKMVKDNILMAIRGQGMTDADAGEGSSAQAAQIVYVLHPNCAVEEF"
     gene            complement(<276291..>278829)
                     /locus_tag="MYCTH_2068755"
                     /db_xref="GeneID:11513535"
     mRNA            complement(join(<276291..277251,277429..278122,
                     278180..278617,278682..>278829))
                     /locus_tag="MYCTH_2068755"
                     /product="carbohydrate esterase family 4 protein"
                     /transcript_id="XM_003665740.1"
                     /db_xref="GeneID:11513535"
     CDS             complement(join(276291..277251,277429..278122,
                     278180..278617,278682..278829))
                     /locus_tag="MYCTH_2068755"
                     /note="CAZy_ID 267842"
                     /codon_start=1
                     /product="carbohydrate esterase family 4 protein"
                     /protein_id="XP_003665788.1"
                     /db_xref="GeneID:11513535"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="JGIDB:Spoth2_2068755"
                     /translation="MLLNRRHLVAGVAGLLAATGVHAACSSDLVIDDFTTWLTGLNNL
                     GSENGDDGTMTAIAASPGQVVFVPKDDGSYFYESFPCQQANTEGYNAIQFSVLGPEGG
                     SFAFELQTTSSCDDEVGVYNSSWTEVGDLTGERHTITLPLEGWDDSPNYDGIVGLTWS
                     TFSENGIQWSVGNVSLVCGGGGDEGDGGGSASQSSTVATKPTATTATSSQGSTTSSPA
                     VSSPPATCSNLLIDDWASQSRLTFLGYNAMEQTSSDDESMSSVVVSDNRVTLTPRDDD
                     SYFYSQFGCLDASEQYGGISFSVQAKRGTSFSVTLAYVTKCGSQNEQSVTQSTDELGW
                     TFDGTEKLYSVPFSAFADVDTTRLTMIYFGDFSGPVTFGPMSFYCGSTPSEYELPSGI
                     PTAPPITVTTTAAPAPTKAMVIDTFGDPETNDLGHVALQQHNAVCDPDVKPYPETWDS
                     LEAARYATASDMYIPINHFAVDLTRVIGFALKGFYGTEPTRLTKMEIVDELPEDWPGV
                     PPKLASGRLVFSCTRPDSFAFAIDDGDPALAPRVMEIVQQADIPVTFFTVGLPLLDRT
                     NGLADMYKTMAARGHQIALHSYTHPPLEGLPSDAAIDWEYANDIGAVRQVFGDGSPNN
                     NNNNNPVHTNYFRPPFGTEGARMRQRLAANLEDANPYLVQWSVDVEDWLWAESDTPEK
                     QLDAFKRDVAAGGNLVVMHYLYNSTVELLPEFIEVAKATGKRLMRVDQCMEDPNAPPL
                     EDEEEG"
     gene            280758..283908
                     /locus_tag="MYCTH_2309814"
                     /db_xref="GeneID:11513536"
     mRNA            280758..283908
                     /locus_tag="MYCTH_2309814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665741.1"
                     /db_xref="GeneID:11513536"
     CDS             281121..283601
                     /locus_tag="MYCTH_2309814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665789.1"
                     /db_xref="GeneID:11513536"
                     /db_xref="JGIDB:Spoth2_2309814"
                     /translation="MTAASPRVPKTRQSLPTIAHHPLSQPPPSADNPLPARQLPLHNN
                     NNNNNNGNNGNNNNRRSTPSSAASLFRSTLSPPTSRPASPAGSLASSSARSPVRASTL
                     MTGSVFGNPLSRQQQQQQQSLLDLTAGTGAGAGAGADDGSPTDPLRLLLRSFVPHIAI
                     HASEDVDDLVRDKGFRGARGGGLWELLRPFGERVQGKVMIRDSSGAAKAWEDFAVRFV
                     RFGESVEEPEGAVSLSAGGAGSNGKEVGGASRDGKGREEVIAQVEAVVERHLRFAEVA
                     YAGSAGAPSPPLTPAREVPDVEATSPYYALYLRRLLSGMPLACHESFAHPVACVMAIS
                     SRNPAPIEALQKLYRDTSTGKRSLPPWVDGEFLRYYVLVHDEENGDIAKSMALFEQMK
                     RNFGLHCHLLRLRSSQSAETDDDSIPLPRSDWMSAAEELADIEESETREDFEDPTRYI
                     FESDATAIRTFVREMVTQSVIPTMERNVSIWNDQVASRRRGLSGRFMSLSKRFTFGSS
                     SRSSAGGTSSSSSNYDAQGFYRADTPEAIMRRLADYAFMLRDWKLAMSTYDLLRGDFQ
                     NDKAWKYHASANEMAALSLLIMPQNMSSKTRIETINQMLEQALYSYHIRCNSLYGAAR
                     CTLLGLELLRLRGGSGIDEAVRWGIRVLESKLMGPIGDALLKERMAVCYASKKGAGSQ
                     AWGSRRRKSALWSVLSAEAWVAQAKYVQAQKCLRHARAMYALLPGECGVQNFGVASDF
                     LASLNDQLKAGLQTDMTHGARDGRDGQGATEVDEESETLGSKRPRRTSLIRPPGGGAG
                     LETAPLHDTEPVMLATQEKDGGPDDGFG"
     gene            284044..286050
                     /locus_tag="MYCTH_2309816"
                     /db_xref="GeneID:11513537"
     mRNA            join(284044..284431,284496..286050)
                     /locus_tag="MYCTH_2309816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665742.1"
                     /db_xref="GeneID:11513537"
     CDS             join(284379..284431,284496..285867)
                     /locus_tag="MYCTH_2309816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665790.1"
                     /db_xref="GeneID:11513537"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Spoth2_2309816"
                     /translation="MSQSLLEFLVENEPAFRKSRLPALYSDFQTQRTLNPDGYQANVS
                     AWRKALRHIVSSGLAPAGRGSAPDLFVLHSDEQLLRALESKQYGRPLALGAVVREALA
                     AKDLIPLREFLDAKESIYRRSWSVWNLASWTMKQLGVADFLKKDSLPSGQFVVVANVE
                     EAGKAFGAQNGPAANARSRFERTFTKAHFYRTLNDQLVEGKHLSETDMDILLRFLSRD
                     KSAILYDGNTIKIKSPAGACAADEPDQITTEDASIAQLRELIASLTHQTALLGRRIDE
                     LTAQAKQAVAKSNRVAALAALRSRKLAESTLARRFATVNQLEEVAAQIEQAADNVQLV
                     RVMEASGAALASLHARVGGAEGVEEVVGRLREQMAAADEVGSILAESAGAVVVDEAEV
                     DDELAALEGEEKRKAEEAERAEREERERREAEETRRRLAAAGEAPRGDVKLPEPGDNN
                     KDDKEVRAAEDMMSRMSLTETPER"
     gene            complement(286050..287936)
                     /locus_tag="MYCTH_2309819"
                     /db_xref="GeneID:11513538"
     mRNA            complement(join(286050..287101,287160..287936))
                     /locus_tag="MYCTH_2309819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665743.1"
                     /db_xref="GeneID:11513538"
     CDS             complement(join(286233..287101,287160..287667))
                     /locus_tag="MYCTH_2309819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665791.1"
                     /db_xref="GeneID:11513538"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="JGIDB:Spoth2_2309819"
                     /translation="MESFDVPDSTDWIGTPLAGLMEVEQAFRCHVCKDFYNSPMITSC
                     NHTFCSICIRRCLSVDGKCPLCRALDQESKLRGNWALREAVDAFVKSRDAILRFAKTP
                     VTASSPKSPKRKAAEMEEPGDEGQNKRPRMTTRSSKAKAAEATAAMLREEADVPEGEN
                     NTPNQESEPDDGLAACPICWTRMKPWQVDRHIDTSCPGSPQPSKGSSSTSTNSRGGTS
                     FGSARTLSQNPPTPTKAPERLPALAYSMLKDSALRKKLAELGLSTAGSRQMLEKRHRE
                     WVTIWNANCDSAKPKKRSELLQDLEVWERTMGSRAPTMSRAANMGAQIKDKDFDGAAW
                     AAKHENSFKDLIAKARSSRSKVVQKAEGEQNKGESGSAQDERKGRDDSVSASEPSKTA
                     VVDLTCPPSSQPEPPDSPPKRAGASGESDTGLLEDLRSISGKEAGHPQADGVSACSPS
                     GKPEGAGS"
     gene            288159..292677
                     /locus_tag="MYCTH_2309822"
                     /db_xref="GeneID:11513539"
     mRNA            join(288159..288552,288607..288697,288756..291974,
                     292029..292677)
                     /locus_tag="MYCTH_2309822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665744.1"
                     /db_xref="GeneID:11513539"
     CDS             join(288377..288552,288607..288697,288756..291974,
                     292029..292670)
                     /locus_tag="MYCTH_2309822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665792.1"
                     /db_xref="GeneID:11513539"
                     /db_xref="InterPro:IPR005635"
                     /db_xref="JGIDB:Spoth2_2309822"
                     /translation="MAMRGGPRLQVGSAAWITEERNAALSIARSEIEEFSYSARNEID
                     WLNEHMAEIFSENQMNVAELFKTPGKLRGKTPRTARKAPPSSMRMPLSEMFSATINGA
                     SSPFTMQNNSQPHSPRITAAEDKVEPEVGFSESPAKPAVVRPPHQVEPRGPISFGDSG
                     YHGSQSQDTMPCDQFDKDVEMSDSPQRPLRISDHMHPLPGEPAEQGTPSASPSREALN
                     PAGENKERQAAASTAAAVPASPSGAVAQLSSPFASRTRLPILSPRSPSPQKMSSPPRQ
                     PLQRSSSPQKPPSPEKSSSSPQRRTASPLKELEKPTGDLHYAVDKDADEMVDEIDEVR
                     SPSDASSPIRPVVRKSSLNFASLPAREPLASKKSLGGARISRTSHLDFHRQSYYNRPT
                     GGKSLGGGVMRRESLEDDPDKMDVDDELKTQNNEDAAAHSKTYTQRLQDQISMLGKGQ
                     STGTTRSSKSLANLLPSQQSAPASQIQSQAEPTSEERTSSPKSRNAAAAPGAFPADED
                     DEGDWIAPPDTAAKAQGPKPVPSDTQLSDAREELSSRGTATSAEHSKRSAGSPGKPTM
                     SQWTPKHGKSVSVPVLPTTDQLDTETEGSPLKKTTSVSNSALSTVAEDNLSSPPRSPA
                     RAFMDNPLRQVKNKLSSLLKSSKGLIVSSAAVSAEGKSSLLQSPSTTRLGYHQEPSVE
                     SFKTADNVVYPDLSQHLAATAPPLSPVRSNSSRRTRSSAERERLEAMERERDEREREK
                     ERETEREKEREREMKEAKQMAEQMDKLEKAREKEREKARVFSKEQEKIAAMEKQVAAQ
                     KEQEKAAQPQPQQQDFRTPAPALKNRPRSPTKSTRPTPARANEHEGKHRSVPSDEPDV
                     EMTDATTTVPPPSIPRPTTASSIRTQKRPMKPTRETAAKPKQVPTLIRVNPLSSQQTH
                     FHPSNSVLAANLQETLGQQPGSARQVNGKASQASLQGKGSVQSLKSSVSSTGRPKALE
                     MAAKRKEQEEREAQRKRETKQEMERKRAAQEEERRQEQQRRAEAERQKEEERKAAQRR
                     AAIEKAKQTKAPPPAVRPQPNAPPEYAIAEKGTFRPPSRLGSTMHQESRLVNTVLSGT
                     AKGSTSKRPLQQDAGEESSRSQQQQQQRALPSYPTKETKRMRMSEEFDEDLDMMDHNP
                     RIIKGPPVRPSGGFKKDPQPKSAYNNGYPHAPPSSASSKDLFKTTVTAQHNSHSKPTH
                     PLDMAQFSKGAIPFAQNPNAHQQQQQHKTPARPIGGGGIPKSTKSVARSSPRMLNGEL
                     IELPDIQTDDDSEDDDGHMPIAAWADSPALRDALLRQERVDPIQVFGPPAPLNMEEVF
                     SKTKDRFHKFRARTSSANWSGSDRLTEEEVRRDAAARDKMRREGGWSYELSRELV"
     gene            complement(<333481..>333765)
                     /locus_tag="MYCTH_2068645"
                     /db_xref="GeneID:11513540"
     mRNA            complement(<333481..>333765)
                     /locus_tag="MYCTH_2068645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665745.1"
                     /db_xref="GeneID:11513540"
     CDS             complement(333481..>333765)
                     /locus_tag="MYCTH_2068645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665793.1"
                     /db_xref="GeneID:11513540"
                     /db_xref="JGIDB:Spoth2_2068645"
                     /translation="YRHFVRVYINDIFIFSKTEEEYLEYLYTIYEILNKAYIYISVTK
                     SFIEYLAVRLLRYIVNGKGIAKTNNRIAAFKKLKFLDTLDSLEHYLGIAR"
     gene            413343..416588
                     /locus_tag="MYCTH_2309825"
                     /db_xref="GeneID:11513541"
     mRNA            join(413343..413680,413745..414761,414817..414865,
                     415199..416588)
                     /locus_tag="MYCTH_2309825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665746.1"
                     /db_xref="GeneID:11513541"
     CDS             join(413584..413680,413745..414761,414817..414865,
                     415199..416471)
                     /locus_tag="MYCTH_2309825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665794.1"
                     /db_xref="GeneID:11513541"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Spoth2_2309825"
                     /translation="MVKLDYNRDYYADLELPGPVDIAEVKKQFKKLALKWHPDRNPGK
                     EEEAKEKFLVIQAAHEILTDPNTKSKFDAHRQRTPKPGASGVRGNPWQYTAQEVNQKF
                     GVPPRRPPMPTRPPAPTAAASTKHWDWAHKAKSKTDNLRANMEAWERARPQSKPSQPS
                     ASASASSARPPKPPPREPPIPRTASQARRQEAAFGSRKSGYAPASPAGDEPPVKNRHY
                     NSGTDAAEASKSTPASTDDDPLSSLFSETFLDNRQRTPYAANVGERTNPFEPLNINRA
                     KSMRDGPRRFQEGAADTPPTPPPRQRSASTGSENIKRSTDEIPRPSEQSATNGFQYHS
                     RASARYSPRGADTNSAPPTATFSGPNSSTSSVNSSTNATVNGDASDQSKQGTKFFSVP
                     TDGKDTAAHQARFTRNSADNINTRFVAEEKESFNFQFSAGTAGSVDDSFLRAKQRARG
                     GGHHSPLRNEFTPSAEPGSGAEKSNAEKSSGAQQAEPAKKQGDFVPEQWKEAFGPHIF
                     VPPQPGKASTSPTRPIRPIKKPRPVRMTAGTAGMVDDEETSGEDKSKASTPASGINGS
                     RSPNAMDIDTPPPEPAGPQAGAPRNINVEPTKPEWRPGNGATAEPKLGAGLKAPNLNP
                     TSAGSEDAEDFVRPLFSEFRNVEPFAPPKPSGLGSFADLSSNLPFPSRPSAKIPLASH
                     GNQQEKPTAKQLDVPSPPTAPRPPASLCIPGAKVSAPAWMNYVREFEAYMTSWSEFNR
                     RVTDHFAARQRQNEGNGLGWLNTRGGAGVENYLRALEVDKIVRQKWMAACEAHELHFR
                     EYLGVRERVLGGS"
     gene            417771..421731
                     /locus_tag="MYCTH_2309828"
                     /db_xref="GeneID:11513542"
     mRNA            join(417771..418551,418612..421731)
                     /locus_tag="MYCTH_2309828"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665747.1"
                     /db_xref="GeneID:11513542"
     CDS             join(417926..418551,418612..421438)
                     /locus_tag="MYCTH_2309828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665795.1"
                     /db_xref="GeneID:11513542"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="JGIDB:Spoth2_2309828"
                     /translation="MRSALALCRRLRTTTSNSLVADSAKKSATLRSATRPGSPLGHRT
                     AVRFLGPASPGTWFYAATPARFQSSSPTSGASPSPPPNVPVNRSSDETETMNGTSQMT
                     TRSKRKEPPYAVDGRRSKHQRSNGEESSAGENTSIVQDEADGGFDDYEDHRLPAVLPA
                     GPDTAEWQATIEKVVRNVVSIRFCQTCSFDTDPALTSEATGFIVDAERGYILTNRHVV
                     GSGPFWGYCVFDNHEEVDAYPVYRDPVHDFGFLKFDPKAIKYMPVTALPLRPDLAKVG
                     IEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDFNTCYYQASAAASGGSSGSPV
                     VNIDGYAVALQAGGRADGAATDYFLPLDRPLRALKCLQEGKPITRGDIQCQFLLKPFD
                     ECRRLGLTPKWEAQMRKAFPKETNLLVAEIVLPEGPSHRKIEEGDVLIKVNGELLTQF
                     IRLDDILDSSVGKPVKLLLLRGGQEVEVEIEVGDLHKITPDRFVSVAGGSFHNLSYQQ
                     ARLYGVACKGVYSCELGGSWRFDSAESGHIICSVDNKKTPDLDTFIEVLKGIPDKSRV
                     VVTYKHLRDMHNLHTTIIYVDRHWYKKMKLAVRNDETGLWDFSNLADPLPAVPPVPRM
                     GEFIKLENTSHPAIADLVRSFVQVHCSMPVKLDGFPKNRKWGMGVVIDADQGLVLISR
                     AIVPYDLCDITVTIADSVVVEGKVVFLHPLQNYAIIKYDPSLVKAPVASAKLSAEPLT
                     QGASTYFIGYNRIGRIVHAATTVTEIFAVTIPANPGAPRYRAMNVDAITVESSLSNQC
                     GSGVLVAQDGTVQALWLTYLGERNASTHRDEEYHLGFATPALLPVVRQIRQGLIPKIR
                     MLSVEFRTIQMSQARLMGVAEEWIQQVALANTANHQLFMVTKRTFEPNEREEAGLREG
                     DILLSLNGNIITKTSDLDVMYEHEELDAIVVRERQELRLKLATVAADDVETTRAVSFC
                     GAIIHAPHHAVRQQISKLHSGVYVSARTRGSPAYQYGLAPTNFITHVNGKATPDLESF
                     LAEVIKIPDNTCTFSASSLLFPFLLFFSFFFLVVRLLIGLGFADFRLRAMTFDSVPWV
                     VTMKKNDHYFPTMELIKDPSDECGWRRITYEGGKVIQGEGPDGVVGPAGESTDMDMDC
                     EVCD"
     gene            422482..423080
                     /locus_tag="MYCTH_2309829"
                     /db_xref="GeneID:11513543"
     mRNA            422482..423080
                     /locus_tag="MYCTH_2309829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665748.1"
                     /db_xref="GeneID:11513543"
     CDS             422798..423004
                     /locus_tag="MYCTH_2309829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665796.1"
                     /db_xref="GeneID:11513543"
                     /db_xref="JGIDB:Spoth2_2309829"
                     /translation="MSVSPTPTTEKSTPAREAFIPLVAVVDFHHARGPEVERWFGVEE
                     GRDPAAEYDWTLLPFMALSDGAHA"
     gene            423602..426059
                     /locus_tag="MYCTH_2309831"
                     /db_xref="GeneID:11513544"
     mRNA            join(423602..423930,424064..426059)
                     /locus_tag="MYCTH_2309831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665749.1"
                     /db_xref="GeneID:11513544"
     CDS             join(423718..423930,424064..425716)
                     /locus_tag="MYCTH_2309831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665797.1"
                     /db_xref="GeneID:11513544"
                     /db_xref="JGIDB:Spoth2_2309831"
                     /translation="MLFFGSRCERLCLTQFSLVSLIPRLLHNLQDSAGPELDSYERSL
                     TMPTSLRTSDRNSLLSYMGLPLQIFDKGSLFGPYTPLQQLDILADFGTKSYIVGSTNS
                     LLLQQKDRYSDILINLDEGTINVTSPSLRAALQLSTPDRRWIDFITQNVNDTWDEANP
                     SRPKTMGYVGSEEFIRVQFEEYLLALISSVKYRAHLARHANNPRMLLPDIDGDPSHDF
                     GNDFVEAWSRTQNFRIWNSHTDSHLFDIVEPKHPCAGGLTIEDIQRRITQQVQDLHWD
                     ERFAQGREALGRNLAAGREKASTLFGKLYADMEALREAQRRKSEEAKSAQSRDGASPT
                     AGSHGQDQQEKNGAVPAVDFTKAQQTMQAVGSKAGAFVNSWAAWAGEKRRAAWGGGKS
                     SSSSSTTTTTTTNNSSGDAPSNNTNSSSSGGGGWASGWVRIGSSSGSSNSNKNRASSP
                     QSPRGGYDALPSQPSDRASIISSASRRSTDASDRAAEQRPLNTNRFSAASTSGESMLD
                     DAAATAERASVPPSSLTPPRSPPGKEGSGKSEVGPERGRIDIGGEQQRKNKEEQGEEE
                     EGSRSKEEGIERDPKPDSNPKPELESGPEPGPSPTLSPNPAVAEAAEVQELWNRR"
     gene            complement(426061..428779)
                     /locus_tag="MYCTH_2309838"
                     /db_xref="GeneID:11513545"
     mRNA            complement(join(426061..426915,426986..427169,
                     427246..427324,427405..427761,427827..427926,
                     427979..428022,428087..428216,428302..428349,
                     428411..428779))
                     /locus_tag="MYCTH_2309838"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665750.1"
                     /db_xref="GeneID:11513545"
     CDS             complement(join(426834..426915,426986..427169,
                     427246..427324,427405..427761,427827..427926,
                     427979..428022,428087..428216,428302..428349,
                     428411..428466))
                     /locus_tag="MYCTH_2309838"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665798.1"
                     /db_xref="GeneID:11513545"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2309838"
                     /translation="MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTNQ
                     NVAVKKIMKPFSTPVLAKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGT
                     DLHRLLTSRPLEKQFIQYFLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDF
                     GLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKD
                     HVNQFSIITELLGTPPDDVINTIASENTLRFVKSLPRRERQPLKNKFKNADPPAIDLL
                     ERMLVFDPKKRITAAEALAHEYLAPYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMY
                     SEILDYHNVEAASVGQMEDQQYLAQ"
     gene            complement(433874..436892)
                     /locus_tag="MYCTH_2309843"
                     /db_xref="GeneID:11513546"
     mRNA            complement(join(433874..435666,435730..435995,
                     436060..436380,436610..436892))
                     /locus_tag="MYCTH_2309843"
                     /product="glycosyltransferase family 35 protein"
                     /transcript_id="XM_003665751.1"
                     /db_xref="GeneID:11513546"
     CDS             complement(join(434185..435666,435730..435995,
                     436060..436380,436610..436766))
                     /locus_tag="MYCTH_2309843"
                     /note="CAZy_ID 270024"
                     /codon_start=1
                     /product="glycosyltransferase family 35 protein"
                     /protein_id="XP_003665799.1"
                     /db_xref="GeneID:11513546"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="JGIDB:Spoth2_2309843"
                     /translation="MASGKLPSRERRPSVGAPIVDIQGSVGPAGISRPKHTRVFTGFG
                     AGEIKHVEASIPEPQRKTWRKHQSRGFKDKDGFEREVVRHVETTLARSLFNCDEAAAY
                     SATALAFRDRLILEWNRTQQHQTFVGSKRVYYLSLEFLMGRALDNAMLNVGQKELAKA
                     GLAELGFRIEDVIHQEHDAALGNGGLGRLAACFLDSLASLNYPAWGYGLRYRYGIFKQ
                     EIIDGYQVEVPDYWLDFNPWEFPRHDVAVDVQFYGSVEKKTNETGRTVYHWEGGETVK
                     AVPYDVPIPGYNTPTTNNLRLWSSKAASGEFDFQKFNNGDYESSVADQQRAETISAVL
                     YPNDNLDRGKELRLKQQYFWVAASLYDIVRRFKRTKRPWNEFPDQVAIQLNDTHPTLA
                     IVELQRILVDLEGLDWDEAWNIVVNTFGYTNHTVLPEALEKWSVPLMQHLLPRHLQII
                     YDINLFFLQKVEREFPGDLELLRDVSIIEESQPKMIRMAYLAIVGSHKVNGVAELHSE
                     LIQATIFKDFVRIFGPDKFTNVTNGITPRRWLHQANPRLSELIASKTGGYGFLKDLTQ
                     LNQLELHVNDKEFRKEWAEIKYANKVRLAKHIKATTGVTVNPTALFDVQVKRIHEYKR
                     QQMNIFGAIHRYLKLKSMSPEERQKQLPRVSIFGGKAAPGYWMAKQIIHLINNVGAVV
                     NNDKDIGDLLKVVFIEDYNVSKAEMIIPASDISEHISTAGTEYVKPCSLTRALGEWTG
                     C"
     gene            complement(<437356..>437890)
                     /locus_tag="MYCTH_2129660"
                     /db_xref="GeneID:11513547"
     mRNA            complement(join(<437356..437732,437794..>437890))
                     /locus_tag="MYCTH_2129660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665752.1"
                     /db_xref="GeneID:11513547"
     CDS             complement(join(437356..437732,437794..437890))
                     /locus_tag="MYCTH_2129660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665800.1"
                     /db_xref="GeneID:11513547"
                     /db_xref="JGIDB:Spoth2_2129660"
                     /translation="MRDDVSSPRQDQDLPLRAPLRRGFISVEPRPVQLSGTSDSWEAA
                     HGLRLPRSRGGLPRRRTKGLLSPQCGILQRGIKGRTTPATAEPQDPLSWGVNRRHETI
                     LENKLEAPSPEMVAQVHAAPAYNHNRWQPKPVIKGEQHMTQECSSRLLAPGGLPM"
     gene            complement(438754..440485)
                     /locus_tag="MYCTH_2309848"
                     /db_xref="GeneID:11513548"
     mRNA            complement(join(438754..439056,439113..439351,
                     439415..439544,439605..439733,439809..440154,
                     440211..440485))
                     /locus_tag="MYCTH_2309848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665753.1"
                     /db_xref="GeneID:11513548"
     CDS             complement(join(438957..439056,439113..439351,
                     439415..439544,439605..439733,439809..440154,
                     440211..440334))
                     /locus_tag="MYCTH_2309848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665801.1"
                     /db_xref="GeneID:11513548"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="JGIDB:Spoth2_2309848"
                     /translation="MGTCMSTSGEESEQRKRSNKIDKELEEDSKRLRKECKILLLGSG
                     ESGKSTIVKQMKIIHLKGYSQDELASYRPTVYKNLLECAKALCGAMRQFEIEPVLEEN
                     KEYCDFLLDYSLDANPQSRIDPKVGVAVQSVWNDPAREQLMERQTEFYLMDSAEYFFQ
                     EAHRIVSPNYLPVEMDVLRARTKTTGIYETRFKMGQLSIHMFDVGGQRSERKKWIHCF
                     ENVTSIIFCVALSEYDQVLLEESSQNRMMESLLLFDSVVNSRWFMRTSIILFLNKVDI
                     FKQKLGRSPLGNYFPDYSGGNDVNKAAKYLLWRFNQVNRAHLNLYPHLTQATDTSNIR
                     LVFAAVKETILNNALKDSGIL"
     gene            complement(443400..446657)
                     /locus_tag="MYCTH_2309854"
                     /db_xref="GeneID:11513549"
     mRNA            complement(join(443400..444339,444410..446289,
                     446347..446429,446499..446515,446585..446657))
                     /locus_tag="MYCTH_2309854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665754.1"
                     /db_xref="GeneID:11513549"
     CDS             complement(join(444151..444339,444410..446289,
                     446347..446429,446499..446515,446585..446620))
                     /locus_tag="MYCTH_2309854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665802.1"
                     /db_xref="GeneID:11513549"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="JGIDB:Spoth2_2309854"
                     /translation="MTKLREGMDLKAYMGIYTAVHNFCTSQKAVSFPLQSHVIGSSQR
                     GAHLLGEDLYKKLTEYLSEHLLTLVEESRTHTDEALLAFYTREWQRYTTAAKYIDNMF
                     SYLNRHWVKREIDEGKKTVYDVYTLHLVQWRDVLFAKISEKVMAAVLKLVEKQRNGET
                     IEHNQIKQVVSSFVSLGLDDGNSSKTTLDVYRYHFERPFLEATKVFYQNESNQFVAEN
                     SVVEYMKKAEARLNEEEERVKLYLHPEIAIPLKKACNQVLIADHSAILRDEFQVLLDN
                     DREEDMARMYNLLSRIPDGLDPLRTKFETHVRNAGLEAVAKVASDADKLEPKVYVDAL
                     LEIHTQYQGLVKRAFKDEPEFTRSLDNACREFVNRNEVCKSGSNKSPELLAKYTDVLL
                     RKSNTGVEDAELENTLVQIMTVFKYIEDKDVFQKFYSRMLARRLVHSNSSSDDAETSM
                     ISKLKEACGFEYTNKLQRMFQDMQISKDLNAGFREHVQTLGTKGLDSSYSILGTGFWP
                     LTAPGTNFNPPEEVAADCERFSRFYKNKHEGRKLTWLWQLCKGEVKANYVKNPKMPYT
                     FQVSCYQMAILLLFNEKDKNTYEEIASATQLNNDALDPSLGILLKAKVLNLEGATKVG
                     PGATFALNYDFKSKKLRVNLNVGMKSETKQEEAETNKTIEEDRKLLLQSAIVRIMKAR
                     KRMKHQQLVSETINQIRARFVPKVSDIKKCIEILLDKEYLERLDDDDIGYLA"
     gene            complement(447907..449053)
                     /locus_tag="MYCTH_2309859"
                     /db_xref="GeneID:11513550"
     mRNA            complement(447907..449053)
                     /locus_tag="MYCTH_2309859"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665755.1"
                     /db_xref="GeneID:11513550"
     CDS             complement(447924..448952)
                     /locus_tag="MYCTH_2309859"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665803.1"
                     /db_xref="GeneID:11513550"
                     /db_xref="JGIDB:Spoth2_2309859"
                     /translation="MCSPGRDRILTVGLPAWIDSYETRYGTPSEDQIRALSSPPPRAL
                     PAHHNHVPSQAHRRVSRDGFVYENPTVLGLQGATTSRVRLRNFLRRGDGTERGRKWDH
                     LRTAEPVIVPRYSRATADSPWRGYVQSSRYGRLSNEEAEIVDPETLHKMQPEFNNPVE
                     IHHATATTGGKPTRTRVLYKRLWRIILRHPLVPLAFRLTVLLTSIVALAISARIFEIE
                     HRTDHDRSSELTQAIVAIVVDSVAIPYIGYMTWDEYTGKPLGLRPANQKIGLVLMDLF
                     FIIFKSASTALAFEALVYHNAGDRETRQYSQALAAFQVISLIAWSFTLSVSVFRLVQK
                     LGVGDDDK"
     gene            450304..451708
                     /locus_tag="MYCTH_2316157"
                     /db_xref="GeneID:11513551"
     mRNA            join(450304..450990,451056..451708)
                     /locus_tag="MYCTH_2316157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665756.1"
                     /db_xref="GeneID:11513551"
     CDS             join(450551..450990,451056..451440)
                     /locus_tag="MYCTH_2316157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665804.1"
                     /db_xref="GeneID:11513551"
                     /db_xref="JGIDB:Spoth2_2316157"
                     /translation="MMRLYLLPISTRRTLLYCQRLNAPASEKQTWSDWIQAKAARTWS
                     GWEKKENGWQKSVANYGNQVLRRIPYEEWGLKLVPPLSQRRKQVELKGTEKVEVIYPK
                     SLLVMDQVPTILYRLATEREALHKRRLFWCFVGMPLTAPIAILPLIPNLPFFYLVYRA
                     WSHWRALAGGRHLQFLVKNNLLVATPSPVVDEVYAQQKQPLPSTPEPTTGSNEKLVGN
                     PGPASSTGAQDRNGETMLLSQANGKKMTQALDLPQLEAELERAIWQVETAINKKQR"
     gene            complement(<452790..453478)
                     /locus_tag="MYCTH_2316158"
                     /db_xref="GeneID:11513552"
     mRNA            complement(<452790..453478)
                     /locus_tag="MYCTH_2316158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665757.1"
                     /db_xref="GeneID:11513552"
     CDS             complement(<452822..453083)
                     /locus_tag="MYCTH_2316158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665805.1"
                     /db_xref="GeneID:11513552"
                     /db_xref="JGIDB:Spoth2_2316158"
                     /translation="MPFQTTQDQRRYRPLTPSPLNPNTYLNGDRDHQGQQRPQWPNGT
                     SRRPLKVVRCNTSSRIAQRYAALANESPTQRLLRQKAAAAWQL"
     gene            complement(454666..456989)
                     /locus_tag="MYCTH_2309867"
                     /db_xref="GeneID:11513553"
     mRNA            complement(join(454666..455590,455674..455868,
                     456370..456448,456659..456989))
                     /locus_tag="MYCTH_2309867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665758.1"
                     /db_xref="GeneID:11513553"
     CDS             complement(join(454868..455590,455674..455868,
                     456370..456448,456659..456837))
                     /locus_tag="MYCTH_2309867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665806.1"
                     /db_xref="GeneID:11513553"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="JGIDB:Spoth2_2309867"
                     /translation="MEDDAQAMAISTALEADPISRPSSVSTQASAPQNLAPALSNPQP
                     QTLSTGDSATDNPQPRPVAIAPAMYPAGTSPASTAPAPGGNLPTCQNCETHTTPLWRR
                     DETGAVLCNACGLFLKLHGRPRPISLKTDVIKSRNRVKTMRPDLAKQKKQQQQQQQQH
                     LAQTGDLNGADLGAVNGAAGVRRASQKPANGVLDDTHSPISRTGTPNLYASHMAPMYQ
                     NLEDQFQAQQLSGFGGPDGRAPSPLNGDRLDMPQTHEQLLATNASLKTRVSELEVIQE
                     LYRGRIQQLEQEEANRQAQEKTKSEADEQLRNQLNAINEAHAQLQKELEESHRRENML
                     KRRLDELEVELKEAKEALELHENGRAKKAKLDDSAANKTEEQASTSQAATSANSDEK"
     gene            457552..459058
                     /locus_tag="MYCTH_2309871"
                     /db_xref="GeneID:11513554"
     mRNA            join(457552..457939,457996..458188,458241..458397,
                     458450..459058)
                     /locus_tag="MYCTH_2309871"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665759.1"
                     /db_xref="GeneID:11513554"
     CDS             join(457685..457939,457996..458188,458241..458397,
                     458450..458807)
                     /locus_tag="MYCTH_2309871"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665807.1"
                     /db_xref="GeneID:11513554"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="JGIDB:Spoth2_2309871"
                     /translation="MPSTHKKDKPWDTDDIDKWKIEPFTKEQSSGPFLEESSFMTLFP
                     KYRERYLKDAWPLVTKALEKHGIAATLDLVEGSMTVKTTRKTYDPAAILNARDLIKLL
                     ARSVPAPQAIKILEDGMACDIIKIRNLVRNKERFVKRRQRILGQNGTTLKALELLTQT
                     YILVHGNTVSVMGPYKGLKEVRRVVEDTMRNIHPIYMIKELMIKRELAKDPALAHEDW
                     SRYLPNFKKRTLSKRRKPYKITDKSKKPYTPFPPAPEKSKVDMQIETGEYFLSKEAKQ
                     RAAEAERAEKAKQKKEEKKREREREYVPPEEDTTKSKKRKTTHD"
     gene            459059..460683
                     /locus_tag="MYCTH_2309873"
                     /db_xref="GeneID:11513555"
     mRNA            join(459059..459367,459505..460683)
                     /locus_tag="MYCTH_2309873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665760.1"
                     /db_xref="GeneID:11513555"
     CDS             join(459309..459367,459505..460549)
                     /locus_tag="MYCTH_2309873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665808.1"
                     /db_xref="GeneID:11513555"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2309873"
                     /translation="MPYSLTVKKIEGKPGEVYYPLQLNTVPIPTPGPNQVLVKLAAAA
                     LNHRDLFIRQHLYPGISFTNPLLADGYGTVTAVGASCSAAAQGLLNKPVLLLPHRGWA
                     SDPDGPENLGRDFVIIGASRGTDAGTAQEYIVVGEDDVVPAPEHLTAAEGAALPLVGL
                     TGWRALVSKSGGNAEPGRNILVTGIGGGVALQVLQFAVARGCSVWVTSGDKRKIERAV
                     EELGAKGGVCYKDADWEKQLGGLLPRERPYLDAVIDGAGGDIVGRTVKLLKPGGVIVS
                     YGMTVGPKMDWLMQATLKHIDLKGSTMGSTREFKEMVDFVKAHKIRPVVSRVVKGLDN
                     LEGIDSLFEDMKAGRQFGKLVIQISEDDSSSKL"
     gene            complement(460684..461694)
                     /locus_tag="MYCTH_2309874"
                     /db_xref="GeneID:11513556"
     mRNA            complement(460684..461694)
                     /locus_tag="MYCTH_2309874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665761.1"
                     /db_xref="GeneID:11513556"
     CDS             complement(460817..461506)
                     /locus_tag="MYCTH_2309874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665809.1"
                     /db_xref="GeneID:11513556"
                     /db_xref="JGIDB:Spoth2_2309874"
                     /translation="MPATQAPPTSEDEHGTRPLPVSRAVDILPDPRSALPRYAAYFRA
                     RHRFWEAFPEGQYVRLPTPGTDLECGFHALILSMRHQLGARCASGPGSDPGGEAGSAV
                     RVPTLEELRAVFRGAVVQGENAGAGMANLSWFTADQLAAVFAEWGRRFLGGGQRCQMG
                     WVTDRDEELGLEGWPVMMNTPDVETGEVGEGIVRVWVWNDGGSLRGGIGHFEGIRRPT
                     QRELAVMGDGQ"
     gene            complement(462780..464948)
                     /locus_tag="MYCTH_2145069"
                     /db_xref="GeneID:11513557"
     mRNA            complement(join(462780..463475,463553..463828,
                     463883..463997,464133..464948))
                     /locus_tag="MYCTH_2145069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665762.1"
                     /db_xref="GeneID:11513557"
     CDS             complement(join(463237..463475,463553..463828,
                     463883..463997,464133..464144))
                     /locus_tag="MYCTH_2145069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665810.1"
                     /db_xref="GeneID:11513557"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2145069"
                     /translation="MASKFTREYKLVVVGGGGVGKSCLTIQLIQSHFVDEYDPTIEDS
                     YRKQCIIDDEVALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSITSRESFEEIRTFQ
                     QQILRVKDKDVFPMVVVGNKLDLASERKVSVEEGKALANEFNCMFLETSAKTNTNVEQ
                     AFFEVVRAIRRFNREMQGGPTPGGGLSHNGAGMGKMDIADEDAPSGCCKCVIM"
     gene            complement(467084..468887)
                     /locus_tag="MYCTH_2309878"
                     /db_xref="GeneID:11513558"
     mRNA            complement(join(467084..467380,467459..467678,
                     467763..468055,468125..468142,468198..468292,
                     468363..468407,468515..468887))
                     /locus_tag="MYCTH_2309878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665763.1"
                     /db_xref="GeneID:11513558"
     CDS             complement(join(467275..467380,467459..467678,
                     467763..468055,468125..468142,468198..468292,
                     468363..468407,468515..468622))
                     /locus_tag="MYCTH_2309878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665811.1"
                     /db_xref="GeneID:11513558"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="JGIDB:Spoth2_2309878"
                     /translation="MASQTTASERASRKIHTAACLIIGDEVLGGKAGQEDTNSHDVAK
                     WCFNLGINLKRVEVIEDDEAEIIEAVRRMSERYDLVVTSGGIGPTHDDITYKSIAKAF
                     DLPLILHKEAYALMKKLSKPRPGQPEFNWDVDSPALRAKLRMVELPTDTSRPLEEQFL
                     FPCKDLWVPIAVVNGNVHILPGVPKLFTQLLNGLTPIILPRLSDPEGKGLTRISISTP
                     LGESEVAEYLAELAARVEPKGVKVGSYPQWGKKRNTVTLVGRDREFLEGITPEVLHYV
                     KGTLMTTGKEDAMSDAEE"
     gene            complement(469782..471245)
                     /locus_tag="MYCTH_2309883"
                     /db_xref="GeneID:11513559"
     mRNA            complement(469782..471245)
                     /locus_tag="MYCTH_2309883"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665764.1"
                     /db_xref="GeneID:11513559"
     CDS             complement(470054..471082)
                     /locus_tag="MYCTH_2309883"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665812.1"
                     /db_xref="GeneID:11513559"
                     /db_xref="JGIDB:Spoth2_2309883"
                     /translation="MAPSLEAPEPVEDVLANPLKQKPQLVAPEPEHCPGPESEQAGTA
                     DSCAGCPNQAICASAPKGPDPDIPLITARLAGVRHKILVLSGKGGVGKSTLTTQLAQA
                     FATNEDNTVGIMDTDICGPSIPKMLGVEAETIHVSSSGWSPVWAEDNLAVMSIQFMLP
                     NRDDAIIWRGPKKNGLIKKFLKDVEWGELDFLLVDTPPGTSDEHLSVNTFLKESGIEG
                     AVLVTTPQEVSLLDVRKEIDFCRKAGIRILGLVENMSLFVCPNCTHATEIFRATTGGG
                     RALAAEMGIPFLGAVPLDPRLGMSCDDGKNFFDWYPTSPACIALKQVVRALAEQLGLD
                     PKEVMPEE"
     gene            472521..474785
                     /locus_tag="MYCTH_2309885"
                     /db_xref="GeneID:11513560"
     mRNA            472521..474785
                     /locus_tag="MYCTH_2309885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665765.1"
                     /db_xref="GeneID:11513560"
     CDS             473212..474663
                     /locus_tag="MYCTH_2309885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665813.1"
                     /db_xref="GeneID:11513560"
                     /db_xref="JGIDB:Spoth2_2309885"
                     /translation="MQRSRTSASDTAREAPRGHNAWEDSTVASMFGDNESRAGSERLR
                     VPQAGHSRHYSDVPPPQRALPRPPSRAQHKHDERLPFVIGENGMLKVIPPPSAQKAPE
                     TAPAPLALNATPSGDIFDDQSVRQDEPDHEVRRIFETPTKTNGLRRTKLAYRENRDLR
                     SNASPERVGPGYSPESQTVSLSPERQTEAGGHIDKIRLQERLARERERQRERERERER
                     EREREKERQREQERNIQNQQPNPFETLTPVDFDDPDFNDTKAAVVASSSAIDADALKE
                     ALERTPRANRQPQKQLFAPQNHNNLLGEAPPPLGRTASRRQKSPTKELAPNAAPTTIS
                     RKRRQSLDYNDAELHAMSYSELRNQDFDFDPQTAALQQPSLPPTGGSIQERLEHYKSK
                     GTLDQHQFFTQISIEEWDEAGDWFLEQFGTVMQRLREARRTKRRLVQQYEEEIAAREE
                     AVRGKIENIGRTLEELKKEGQTMMEGKDVDMEF"
     gene            complement(<475160..>476269)
                     /locus_tag="MYCTH_58873"
                     /db_xref="GeneID:11513561"
     mRNA            complement(join(<475160..475773,475939..>476269))
                     /locus_tag="MYCTH_58873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665766.1"
                     /db_xref="GeneID:11513561"
     CDS             complement(join(475160..475773,475939..476269))
                     /locus_tag="MYCTH_58873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665814.1"
                     /db_xref="GeneID:11513561"
                     /db_xref="JGIDB:Spoth2_58873"
                     /translation="MEPAPDTPLQTRVVDDKSPIIIPWILSRIGEHRKQHPDRAEQRP
                     FIVGLNGVQGVGKTTLVRALAETLQEREGLPTLVVSIDDFYLTHADQLALAAAHPDNA
                     LVQHRGEPGTHDIPLLTAFLASLKAGSHPIPIPQYDKSAFSGLGDRAPPSTWPSTSPD
                     RPPRVLILEGWCVGFRPLAAPALAARWSAGGGGGGQSRTLHRHKLEHLQFVNDRLADY
                     DRVINGALDAFIHIDAEDTEYVYAWRAEQEEQLRREKGSGMTEEQVVKFVDAYYPAYE
                     LFTEGVRRGVFEGVPGKRGCQLRVVVGRDRRVVESMVI"
     gene            477165..480679
                     /locus_tag="MYCTH_2309890"
                     /db_xref="GeneID:11513562"
     mRNA            join(477165..477550,477626..478849,478906..479328,
                     479435..479580,479637..480092,480192..480679)
                     /locus_tag="MYCTH_2309890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665767.1"
                     /db_xref="GeneID:11513562"
     CDS             join(477392..477550,477626..478849,478906..479328,
                     479435..479580,479637..480092,480192..480468)
                     /locus_tag="MYCTH_2309890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665815.1"
                     /db_xref="GeneID:11513562"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="JGIDB:Spoth2_2309890"
                     /translation="MADQLRFDGQVVVVTGAGGGLGKAYATFFASRGASVVVNDLGGS
                     FKGEGNDTKAADAVVNEIKAAGGKAVANYDSVENGDKIIETAIKAFGRIDILINNAGI
                     LRDISFKNMKDQDWDLIFKVHVKGSYKCTRAAWPYFRKQKYGRVINTASAAGLFGNFG
                     QANYSAAKLAMVGFTETLAKEGAKYNIICNVIAPVAASRMTETVMPPDVLALMKPEWV
                     VPLVAVLVHKNNTTESGSIFEVGGGHIAKLRWERSSGLLLKCDETYTPGAILKKWDRV
                     TDFSNPQYPSGPNDFLTLLEESQKLGPNEQGEKIDFAGRVALVTGGGAGIGRAYCLAF
                     AKAGAAVVVNDLVNPDGVVNEIKKLGGKAVGAKFSAEDGDAVVKAAIDAFGRIDIVIN
                     NAGILRDKAFTNMDDSHWDPVMNVHARGTYKVTKAAWPYFLKQKYGRIVNTTSTSGIY
                     GNFGQANYAAAKCAILGFSRALALEGAKYNIYVNTIAPNAGTAMTKTILPEELVQAFK
                     PEYIAPLVLALCSDKVPNPTGGLYEVGSGWVGQTRWQRSGGHGFPVDVPLTPEAVVKN
                     WERIVTFDERADHPEKTQDSLQKIMANMENRSGGGKSAESNQYLDAIQKALKAEGKGT
                     EFKFTERDVMLYNLGIGAKRTDLRYVFEGNEDFQAIPTFGVIPPFDAETPYNLDELVP
                     NFSPMMLLHGEQYLEVRKYPVPTSGRLISKAKLLEVVDKGNAAIVKSGVTTVNAETGE
                     DVFYNEMTVFLRGCGGFGGQKKPADRGASTAANKPPARAPDVVVEEKTTEEQAALYRL
                     SGDYNPLHIDPAFAKMGGFKVPILHGLCFFGIAGKAVYEKFGRFKNIKVRFAGTVLPG
                     QTLVTEMWKEDGGKKVIFQTKVKETGKLAIGGAAAELV"
     gene            complement(480664..484080)
                     /locus_tag="MYCTH_2140421"
                     /db_xref="GeneID:11513563"
     mRNA            complement(join(480664..483567,483642..484080))
                     /locus_tag="MYCTH_2140421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665768.1"
                     /db_xref="GeneID:11513563"
     CDS             complement(join(481352..483567,483642..484014))
                     /locus_tag="MYCTH_2140421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665816.1"
                     /db_xref="GeneID:11513563"
                     /db_xref="JGIDB:Spoth2_2140421"
                     /translation="MYRVSALLPSWDRSRQSTPGSNNNNNNNNNSSNNSNKSNSSSSS
                     SSSNTGTSSSPLPPKTPGALDKVFGWAEKIVPASRINTSTTTTTTTTTPGARTRYGRE
                     TYWPTTLDKECDKAARIIKSFCFDGFLSQESDEPSEQSETTPAESASTTKYITKKIPP
                     RIIQNAVGLAVFSCMRSGLWMSGSGGAGLITARKADGTWSPPSAIILHTAELAFLMGV
                     DIYDCLLVINSVQTLELFTRPRLILGVDVSLTVGPLVAAGSKDPEIRWKEISETVLTY
                     VKARGKHQAVQLDGSMVTERCNENERFYCAGVTILDILAGNIPKEIPQMRPLFEVIKA
                     AEGRSDYDKAMMEWLAQQPAPGDADIESPRESLASLTSPTKVAFGIPDANDPDPFGVI
                     GLEMAGIEIREAGTKHRPTSTQFEFQPSPSSPLYGRFSRQSMDTFVSRSNRGSCMSAR
                     TQATAMTDACTQTDVTSTADTTFSRANSDDGKDSVERLPTVVEPEEVDYTKVDASILE
                     RLKRRTMEPVAPAPPAQAVETKEMKGPGVATGTEGKSTKEAETTDVTTATEVKTMEDE
                     KVEPVNRAVEPGAVSEESSPEATNEQDEDADDEDDEDVDEEPIICEVATASAQPPVRT
                     SIQRPQITQVMQVKGAIVTIPKRVPPPLPARSPARVSRGSKSDFGDVSSLKSPARSSL
                     LSIESRADDNATTPEHDHAPVTAGGSPTQVPRPSSPRHIKNSSSTCTAVAVDKTATAS
                     RPASLSIPPSTDRNASEQGHGSDDETGSQSKTASPSSTAVSATPQTTGPASPTEDDSD
                     RDPTTPQTAETDFDTASERQADVAKEDQLREEARVGRDDCLKAVNLPPGSASEKDREN
                     IESAAA"
     gene            <484727..>486004
                     /locus_tag="MYCTH_2112630"
                     /db_xref="GeneID:11513564"
     mRNA            join(<484727..484837,485060..485131,485255,485331..485438,
                     485652..485662,485816..>486004)
                     /locus_tag="MYCTH_2112630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665769.1"
                     /db_xref="GeneID:11513564"
     CDS             join(484727..484837,485060..485131,485255,485331..485438,
                     485652..485662,485816..486004)
                     /locus_tag="MYCTH_2112630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665817.1"
                     /db_xref="GeneID:11513564"
                     /db_xref="JGIDB:Spoth2_2112630"
                     /translation="MRRRARSVPILPIANQQSALNSELAASGHFQDEGGGSFMIIIRA
                     TESGSARSSWTQPQRGTTPGPHAVDRCIALAVISRTPPLRAAAGGGEITACTPVRVYV
                     LFQMITLDPFFWFNTALSSSSTQNASDKRQTKVYPRHGCSSVSDGSMCWCSYIQDNTR
                     THA"
     gene            complement(487773..489803)
                     /locus_tag="MYCTH_2309896"
                     /db_xref="GeneID:11513565"
     mRNA            complement(487773..489803)
                     /locus_tag="MYCTH_2309896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665770.1"
                     /db_xref="GeneID:11513565"
     CDS             complement(488247..489608)
                     /locus_tag="MYCTH_2309896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665818.1"
                     /db_xref="GeneID:11513565"
                     /db_xref="JGIDB:Spoth2_2309896"
                     /translation="MDSLPVELVRLVFQYCDPGSVRVLRLASRRYADVGYEYLLEPHF
                     NAVEWRDDVSRLCNIANHDRLRDGIRSLTFNFAKLDEDYARQTTFFQHWLREAEQPST
                     LLQDAWTRYYELEGEARKLPPFHSRSAAIEDAFKRLPNLRHVEITHTKCPYDIPLLQD
                     VFQVRTCRKRDRGQACKNINAVVSAFRHARPASLSIDQLPLEIFRPADDRRLWLDCAR
                     SFASLSRLDLVLDTPANLLPASRSRAVNGLGGVLHSSVNLTHLSLAFHHYHAPAQKFH
                     LSFQALFCGSDFVFPRLTDLKLEGVSCAEDDLRGFLLRHAATLERLRLGGRGLAKPFE
                     WSMGGVHLHQGSFRGLFTGLRGRMPRLRRFHMEGDAEAGDFTASSREVYMFRPVTDDD
                     WAPLGGGSGGDAAAAAAGYRGKRVETLGACVKVVDSLALERYLVEGGRYPRLGKEEVG
                     DGL"
     gene            491712..494188
                     /locus_tag="MYCTH_2309898"
                     /db_xref="GeneID:11513566"
     mRNA            491712..494188
                     /locus_tag="MYCTH_2309898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665771.1"
                     /db_xref="GeneID:11513566"
     CDS             491919..493970
                     /locus_tag="MYCTH_2309898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665819.1"
                     /db_xref="GeneID:11513566"
                     /db_xref="JGIDB:Spoth2_2309898"
                     /translation="MAFTGLLGIPGDRAMKPKSPPKTTPSKSTSSKSASSKSTALQPS
                     TTSVPEPKSTSTPEHIATESELRPLDPEQPDLRELNACLEALAAVFPDIQIQVFRDML
                     ASFDGESRLALVADALLKNRVSWVKGRWRVAPKDDQPAEELVPKKETFRSPEYKQAVK
                     NLAWHEFKGLSRSAINAVLAEHNYSYLDARQTLVDLSSKSWRFTISSLFLRRKPVTAT
                     EAENHPLIIWKSTGRASIVPTLKSTGNAELDRELFEALVKPLTERARADREAKDRQTA
                     MELNKAEAEATGSMIECACCFAESAFEEFTSCNADGHMICFRCVQHCISEAVFGQAWQ
                     RSIVKETGSLRCPAAESTECQGCISPDHIHRAMLQERNGAEVLRQLERRLADHNLVAS
                     NLPLVRCPFCGYAEVDDIYLPVSESDLRLRTESVNTFVLCTICFCCLPFLLPLILFGY
                     LLAFVLFVTVLVRSKRTFGDELMTEMRAAIVRRRRRRRGLRFNCMNPECRRASCLACE
                     KAWTDVHVCNESSLVALRTQVEQAMSMAVKRVCPRCNMSFVKNSGCNKLTCPCGYQMC
                     YVCRKDIGGVGEGADNGYQHFCQHFRPHGDGRKCTECTRCNLWETENEEEVLRRAKEE
                     AERKWSAAEKRELSGADMRYLETGLPSQPPVKSITATLREGKWPTLAEVCDVIIDIVF
                     V"
     gene            494400..497369
                     /locus_tag="MYCTH_2309899"
                     /db_xref="GeneID:11513567"
     mRNA            join(494400..495040,495159..496995,497095..497369)
                     /locus_tag="MYCTH_2309899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665772.1"
                     /db_xref="GeneID:11513567"
     CDS             join(494695..495040,495159..496995,497095..497140)
                     /locus_tag="MYCTH_2309899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665820.1"
                     /db_xref="GeneID:11513567"
                     /db_xref="JGIDB:Spoth2_2309899"
                     /translation="MSSQTGKWREDQVLIICPGSQTTLAQLGCNELTPPAHRFPTRMF
                     RDVDSDNWRPYHTYKRRKGGDGGAKKEEEGDKAAAGGQEEGAAEGAAGGEEEEWEYVE
                     DVDSVEGAVYPIQAGRIVHMDAFLAFLEHVHSQLTTTYHNTPIMLMASPQWTRPDCEA
                     IARYVFEKTKTPALCLIHSGIATQYGLKWPNMTVVDVGYEKVDVTCIHDGRVVSHKDV
                     GPDEEISGGEVFTRRLLKLLEGKGFDYDMAEQLKKSPICEVLPYAPDREELMELPVET
                     EASLSGTATAAGAPGSEASKIGEAAKSFATDADDEAGTGTEVNAVEEDGVLDVANIVA
                     SGQTREFLAKKEKEKAEKGKAGRKGKDKEGGGGDAPKPVRLPNSKKVRNVFHYEELVT
                     EDVPVAPPAQENGTKDGGGDQDANMTDAPAEAPTEAPADAPAEGEADDTTRPEAAAEP
                     QSQHAHQPEQAQREEQQQKQQQEEEQQQQSEPQPQPPSEQQPSEPAPTATERVTRRVR
                     RDIEVGLERFQFADRKEIDRIVTAIYRAVQGIEDMYMRPGCWENIVFVGNGARIRGLR
                     DNIIQTLQARHHISPSSAIMFTSELPSNMGTPSGTGSQTPTSSFAGAPHQLPTSSNVN
                     PLLQAATTANMAGANNNAAAGSGGAGDAGGGGGGTSHHFHSQTPTNIRLAPLPNYLTE
                     WAKHGFEEAMFLGAQVAARLAFCIHNLDAQGLEAQRLMSLSRVDYNELGPKGIRSHSM
                     LG"
     gene            498292..499125
                     /locus_tag="MYCTH_2309900"
                     /db_xref="GeneID:11513568"
     mRNA            join(498292..498505,498635..498796,498896..499125)
                     /locus_tag="MYCTH_2309900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665773.1"
                     /db_xref="GeneID:11513568"
     CDS             join(498396..498505,498635..498796,498896..499031)
                     /locus_tag="MYCTH_2309900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665821.1"
                     /db_xref="GeneID:11513568"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="JGIDB:Spoth2_2309900"
                     /translation="MAAERRLISSGSGFEAQIGYSRAVVSGDMVFVSGCTGYDYKTGT
                     ISDDVAEQAEQCMRNIAAALAEAGADMADVVRVRYILPDRRDFEKTWPVLRKWLGHVR
                     PAATMVQAGLMEEVMKIEIEVTARKTAASESKE"
     gene            complement(499308..502621)
                     /locus_tag="MYCTH_2309903"
                     /db_xref="GeneID:11513569"
     mRNA            complement(join(499308..500256,500365..501382,
                     501462..502126,502183..502278,502332..502516,
                     502595..502621))
                     /locus_tag="MYCTH_2309903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665774.1"
                     /db_xref="GeneID:11513569"
     CDS             complement(join(499508..500256,500365..501382,
                     501462..502126,502183..502278,502332..502452))
                     /locus_tag="MYCTH_2309903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665822.1"
                     /db_xref="GeneID:11513569"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Spoth2_2309903"
                     /translation="MFGPGLVAWLTTLSAPVALAQAVWQPNQVSTRICYWQQLRAAVL
                     HDTVYLDGGALYWEPRFADGSAGVPTFDNNLAGLIYTLNFSTPFNTTQNISAILGTLE
                     TGGGDTNSRAPNYLDGALLGNDSEFCLYGGMSAPSTGSSDPPGDSVLCYQAYQYGADK
                     PRFRPGFIDRDLGENVTRYVAYGGAASAPSENLAWYFSGLRSPTWGKIYMPPYDGGGA
                     TFANTVSNRLITMDMANPVSVTFTNDTLPRNIPGRANPELVWVPVGFRGVLVALGGVV
                     YPDWVNASNPRSANETASREQSPEFMSTIDIYDVESREWYRQKTTGGPGQLARGCAVV
                     ARAQDGSSFNIYYYGGYDGIHMTERYNDDVWVLSLPSFTWVKLTSSQVDGRAGHKCVS
                     PYPDQMLVIGGYPSLQGYLPSCLRETIRVFNLSTGEWLDRYDPAVYANYTVPSAVVAK
                     IGGSGTGGATATSPSPSWDATELASIFAKEYPTSKITTYYPYASNAPVDNTNPSVPTT
                     PADKDEGGGVPSFLPPVLGVVLGLVFVTMVAVLILLWRRRRLLRKGGGAMSEAGTIDT
                     NKNRIALWLRGQNNASPEVKAPTVATSSDYLPVNSTEPTDHSPGTNATPLSIAEMMDT
                     GVQRPVELPADTARPAELQSSKPSPEAAVAMQASLNNHAYYQSTHQTGHANSSAYYTA
                     PPVPQEESPILHRPDSDALGRAPATSSATTPTSAGTSPVTTGAPAQGASGRSNKVVSG
                     ISSLSERDRAHLRQISDTTVSSVTTAPVGPSGTTAAATTTANNANNLVTGSGGRETVV
                     SNVSLLSSPGGGPPTVVESPAAVSPPTATAGPGEGGDYLGIRPPTGSQQQQGGPGPSS
                     PSRRSVFSENLDSGTTGDTGGQRQGR"
     gene            506759..509274
                     /locus_tag="MYCTH_2309909"
                     /db_xref="GeneID:11513570"
     mRNA            join(506759..507062,507120..507278,507338..509274)
                     /locus_tag="MYCTH_2309909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665775.1"
                     /db_xref="GeneID:11513570"
     CDS             join(506839..507062,507120..507278,507338..509177)
                     /locus_tag="MYCTH_2309909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665823.1"
                     /db_xref="GeneID:11513570"
                     /db_xref="JGIDB:Spoth2_2309909"
                     /translation="MLLTRLIQGLGALTVIQFAAAAKEPLFPRASEAAASSGEDQAQE
                     DGYHADTWWCKKTVTHTVTCTVTETDTATITKTVPGPTASVIVTTTETVTDTETVTDT
                     ETVTETVSWGTTQTQEVTATTTVVQETTDVIPTTIEVSKTVINTITTTEVVPTTLTSS
                     TTITEISTSVTSYPVTVTDSTTIYTTKTVLVTTTSVSTFTTVSTYTMVREATNTVTDT
                     VTDRVTDTTTDRVTNTVTQITTVPASTITDVVTTVLPPITITVTESGTVITSVIPGPT
                     VTQTTTTTLPPVTVTLPGSTVIRDVSVCPAPTNTAPVPRPQTTQRQLWGCDPGYVCNL
                     PKPAGCNLWAEPPDRDFACDPRYCQLAPPVPNVQWPKNGTGYFPPVEGYFNLNPNAFG
                     LSYEIFELNEVVTKIGGKKTTITTGNWVSQTDLTHFPPEPTSDATGEKAYYARDPRLW
                     KRDETIVPAVCFLPCNLAFLETQRVGLIPELCEDGSPFREANDACLSCIETNGLDLKT
                     TLRAYLGDEFLQFWDFCDMDPAEPPGQTTRPPPQSQVTATPTISSSSQAPPNSETEPV
                     PITSTSTTTTTTTSSEEPPSSSSTPPASSSRSSGAPSPPSSSSEAQPEPTGPTATSSE
                     TETEPTASSSSSATLSGSLSTTASSPSEPGPATSSPPASDSGSGGGGGGGGGGAPPLT
                     EGPSTTLRTSTTGLPATSSIATAAAGRVAAPPSLTMTGLSSLGALLGGAVFSFFFLLF
                     "
     gene            complement(<510589..>511535)
                     /locus_tag="MYCTH_104582"
                     /db_xref="GeneID:11513571"
     mRNA            complement(join(<510589..510895,510958..511043,
                     511229..511390,511437..>511535))
                     /locus_tag="MYCTH_104582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665776.1"
                     /db_xref="GeneID:11513571"
     CDS             complement(join(510589..510895,510958..511043,
                     511229..511390,511437..511535))
                     /locus_tag="MYCTH_104582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665824.1"
                     /db_xref="GeneID:11513571"
                     /db_xref="JGIDB:Spoth2_104582"
                     /translation="MEPIVHTIFEPETSTWQYVVTDLSTKTAVILDPTADSLLALVGE
                     KGYIVDRLLETHVHANHLTAATYLQDLLTRDGKKLDRLLDDDEPTFFCGDSIFNCDVG
                     SARCDFPGGNAKDLFQTASKLFSLPPNFKIYTGHDYPPNTPRSTPQAFSTVAEQMEHN
                     KHLRTGTSEADFVRWRTERDAALAEPRLIHQALQVNIRAGRLPRDGLLHMPVNVEGW"
     gene            512651..514373
                     /locus_tag="MYCTH_2309910"
                     /db_xref="GeneID:11513650"
     mRNA            join(512651..513154,513296..514373)
                     /locus_tag="MYCTH_2309910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665777.1"
                     /db_xref="GeneID:11513650"
     CDS             join(513012..513154,513296..514220)
                     /locus_tag="MYCTH_2309910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665825.1"
                     /db_xref="GeneID:11513650"
                     /db_xref="InterPro:IPR007272"
                     /db_xref="JGIDB:Spoth2_2309910"
                     /translation="MNNVLTGAAMGAALTTAGVYAPDIILSQFKFTDFTMLQTFLTAA
                     AGSTLLVTAAQALHLTDLPPRGPSSLGLCGRYDGNLVGGALLGAGMAISGACPGTVLA
                     QLGVGVSSGRYALGGAVAAGVAWSWIRRRRAPGSGCPGSAPAPAPPSAVADGKEEGGV
                     VSSGKGDHRHQTGAARKDGRGETVYELLGISRGALLVGLEAGLVLAVAAAVRYTRADA
                     AEARGLPPYYAGLAIAAAQLVSIVLRGSLLGASAAFEELGGWLWGVREYSNVLFSAGV
                     VGGAWLVSRAVPALRPVTEVAIPPLRSALGGFMIVFGSRMAGGCTSGHGISGLSLMSN
                     SSFLTAAAIFGAGGLTGLLLG"
     gene            complement(525119..>525676)
                     /locus_tag="MYCTH_72978"
                     /db_xref="GeneID:11513651"
     mRNA            complement(join(525119..525376,525487..525532,
                     525579..>525676))
                     /locus_tag="MYCTH_72978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665778.1"
                     /db_xref="GeneID:11513651"
     CDS             complement(join(525320..525376,525487..525532,
                     525579..525676))
                     /locus_tag="MYCTH_72978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665826.1"
                     /db_xref="GeneID:11513651"
                     /db_xref="JGIDB:Spoth2_72978"
                     /translation="MPIEKRKSHSTYYHASLAQNIAKNSFVVMPCSCVIRSIFVEVVL
                     TIALQRRIKDAKRRAELELDKS"
     gene            complement(594582..597638)
                     /locus_tag="MYCTH_2309912"
                     /db_xref="GeneID:11513652"
     mRNA            complement(join(594582..597025,597073..597133,
                     597186..597638))
                     /locus_tag="MYCTH_2309912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665779.1"
                     /db_xref="GeneID:11513652"
     CDS             complement(join(594747..597025,597073..597133,
                     597186..597392))
                     /locus_tag="MYCTH_2309912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665827.1"
                     /db_xref="GeneID:11513652"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="JGIDB:Spoth2_2309912"
                     /translation="MLSRAPLRTCRYGPSRLLPANVFPVAILVLRNAQLTRSGFARSY
                     SSEHAHHEARIESVRNIGIIAHVDAGKTTTTERMLYHSGVTRHLGNVDHGNTTTDFLP
                     MERERGITIQSAAITFQWPPKSLCPPGYEPTTINLIDTPGHQDFRYEVDRCLPVLDGA
                     VCILDSVKGVETHTERVWESAHLSKIPRLLFVNKLDRDGASFRRSVQEVATRLRTWPL
                     LCQIPWWHKDDFIGVIDVIHRHGLRFSSTGSMSVVSEQSIAKDYPALREEMETARLRL
                     IETLSENDDQIMEEFLELEKDVSSASIKRAIRRLILDGEAKFTPVFAGASLRNIGVQP
                     LLDGVIDFLPSPIDRPPLEVMGAQAQNLSQLLEQKVKQKGHHQHQDPIVALAHVFKVV
                     DDPRRGMMSWLRVYHGAFSRSSHMWNSNVHNFEKPQHILHVSAKDHHEIPHLSTGHIG
                     AMTGLKSARTGDTLITFPRHHGNTAPEALRNLRIKAPETPPAVAFIAIEPYSRTAGEK
                     LEEALKKLSREDPSIRWSKDEKTDQLILSGMGLLHLEIAQDRLLTHYKIDRESAMWGE
                     IEVGYAECLLAPTKPHRAVYDRPIRDKAGKAACTVTIEPLEAHHHDTLLESSIERDGN
                     IIHVAILPSGAGDAETLPFDPELVRQQLFNGAIAGLTRGPRRSAPIRRCHVHISFDPA
                     HDFFGTASTGGHITNAALSAVRGALKEAHASGQVGILEPFTRVHIHCPEEAGTAIQHD
                     LASARGGQVLEVRRPDDDEALASGTGTIDITKVYVPPDPYESVQSLRGAKKGVVRMLT
                     IIGKAPLKEMMKYDSQLRSMTGGRHTLQLDPGGFELVTGPRERALEERLG"
     gene            597952..600153
                     /locus_tag="MYCTH_2309915"
                     /db_xref="GeneID:11513653"
     mRNA            join(597952..598568,598624..599077,599137..600153)
                     /locus_tag="MYCTH_2309915"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665780.1"
                     /db_xref="GeneID:11513653"
     CDS             join(598038..598568,598624..599077,599137..600050)
                     /locus_tag="MYCTH_2309915"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665828.1"
                     /db_xref="GeneID:11513653"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2309915"
                     /translation="MDYTSSIHDAEHAAEASPWGNSPTSSPGPNQSTFGPIAGDTPGS
                     PFRYPNSNNGLNDDGGFGGSDIDYRRPDTASTVSQPTEPEPEVSAGVESHPDHQDVAG
                     DQGPLSQQLQQQQEQQQQQQQHQEQQPQKATGSIDRAQEQQQPRRPPPPQFKLQAKIT
                     GLERTGRKDPILRFDVHTNLPAFRTTQYRDVRRLHSEFVKLAEHLISANPEAIVPSVP
                     PPLTSAGAGTEEDEIRVKALMQRWFNYVCSNEVLMRDDEMVLFVESDFGYSPMVKKKQ
                     PATGVRRKILKQFAPPPDDTPELQEARPIVKLFYLGAMDAGHKVDKLVKSRRGLGLSE
                     SDFGVKLGSMHVQEPHPGLANAYRKLGKVIQTVGDYHAAQATAEATTIGDPLQYHSQD
                     AFVVKETLTNRQILIREFLQAQEATRSRLNAADRLKASSNVRREKVDEAIASLDEARH
                     NELALLEKTTRVTQNLVHERRRWFARTAADLRLSIREYVLREIEAERRTLALLESARP
                     DIRSIDSSGGLSRLGRESHPPHAIRRTSMAASQGPKGDAWSGVPRRSVDVLGRSVSGS
                     LVGSSVVEAAGEDGSFAEGGERGDLSGRTRTLSGVAGVRMPGVLEEDDEDRVDARNAA
                     SRLAASTF"
     gene            605251..607507
                     /locus_tag="MYCTH_2309919"
                     /db_xref="GeneID:11513654"
     mRNA            join(605251..605455,605672..605702,605768..606042,
                     606119..607507)
                     /locus_tag="MYCTH_2309919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665781.1"
                     /db_xref="GeneID:11513654"
     CDS             join(605795..606042,606119..606980)
                     /locus_tag="MYCTH_2309919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665829.1"
                     /db_xref="GeneID:11513654"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2309919"
                     /translation="MPLSLGHESSGTVVAIGPQVTGFSIGDRVALEVGVPCGQCGICR
                     QGRYNLCKRMRFRSSAKSVPHYQGTLQERINHPAIWCHKLPDNISFDAAALLEPLSVA
                     IHAVNRAKPTPGSTALVIGAGAVGLLTAAMARQSGCSTVTIADVDRGRVDFAIAKGFA
                     THGYVVDRNNASTSSSSSSSSLYSPSSSGTSTPLDGVMTPASTLSVSSQFDYAKSLAA
                     DMLSLTAGAGASSLPLGDGDEDDGVDVTFECTGKEVCMHTSLYATRPGGKVVMVGMGT
                     PVQTLPMSVAHLREIDILGVFRYANTYATGIRLLCARDRLAKQAAGAGYVLPCLDDMV
                     THRFKGLENAHRAFELASRTVDPDGNLVLKVVIEA"
     gene            complement(<608035..609492)
                     /locus_tag="MYCTH_2135496"
                     /db_xref="GeneID:11513655"
     mRNA            complement(join(<608035..609107,609167..609492))
                     /locus_tag="MYCTH_2135496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665782.1"
                     /db_xref="GeneID:11513655"
     CDS             complement(join(608035..609107,609167..609443))
                     /locus_tag="MYCTH_2135496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665830.1"
                     /db_xref="GeneID:11513655"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Spoth2_2135496"
                     /translation="MVGHAANELLSTQKASDSGLKVVLHPLPILEISDFIVRGYQRGL
                     RGAVVGALLGQQNGREITIEHSFSCKSAKNADGLYELDQEWFKKRLEQMKLVHKSPAL
                     DLVGWYSLVPKTGPSALHLPIHRQISSYNESAVLLGFHVEDVLSPASGDPLPITIYES
                     NMEAEDSKEAGEGEDKEMKDAEAPTNMVLRFRKLPYTTDTGEAEMIAMQFIREGGANA
                     ATVDGNEKHILEQFDKKIAVNDGKGKRRAVAYEESSKSKKDAAARPTEPATRNPDANL
                     TRAEAEYMSALQAKYNAIKMMRSRLGLIITYLQNLPPAFTAGTQTTSEAADFARASNG
                     QYTIPSNNILRHIQALVTNADLVAPAEQATLEREIQRETNDVNLISMISDLMSSVNEA
                     REAGKKFHVVESARNSRQGRVAATSGSLYEQSLFESELGMGGDGDFADGSDSVLAQY"
     gene            <610465..>611769
                     /locus_tag="MYCTH_97184"
                     /db_xref="GeneID:11513656"
     mRNA            <610465..>611769
                     /locus_tag="MYCTH_97184"
                     /product="uncharacterized protein"
                     /note="Has EST support. weak"
                     /transcript_id="XM_003665783.1"
                     /db_xref="GeneID:11513656"
     CDS             610465..611769
                     /locus_tag="MYCTH_97184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665831.1"
                     /db_xref="GeneID:11513656"
                     /db_xref="JGIDB:Spoth2_97184"
                     /translation="MSEPSKKPEPVQPQPPGSGKVEFTNNLGPPFKRPVVEDEIEFIS
                     CSPVKKKRLTEQTTAHNTTTSTAPPQLQDTRSANQETRDFPQIPPAGRCRSLCGIGIG
                     QAKAPGPETAMESRGTSLPVLEKFAFPQTFPLATGRPPRLSDAISPKQFPQASLAPPE
                     TGTNTATTISTTNTSTQIPTQESSVTLDQISCLDFDGVPTNSPGFDAGRVFSADCGIM
                     SGISVGNTTSAMPPLPPFPTSSPRAGIPFTMYSTGSIMTVPQAQNRDKPSVAVLPTGA
                     KLTSCCPHCARIRQQNTFRQAPVGVSGMSPKMATQTHGHANPQGHEHASSPRSVPPPP
                     GFSPPGHIIPPRSAPAPGQEQRRLPNQWQHQNQQPPSENPLHPGPPTPNYYLRPLLQD
                     MAQTIQASFPYAQVAARHGMAPARVAEVLARVVGAPLVSRRE"
     gene            613671..615982
                     /locus_tag="MYCTH_2309925"
                     /db_xref="GeneID:11513657"
     mRNA            join(613671..613964,614061..614157,614276..614527,
                     614668..615630,615700..615849,615926..615982)
                     /locus_tag="MYCTH_2309925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665784.1"
                     /db_xref="GeneID:11513657"
     CDS             join(613769..613964,614061..614157,614276..614527,
                     614668..615630,615700..615849,615926..615965)
                     /locus_tag="MYCTH_2309925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665832.1"
                     /db_xref="GeneID:11513657"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2309925"
                     /translation="MASSAVDVESGSARRSGSGSVKEEPGPVAEKGTPVGGGSPESAS
                     VLSAPGDHTHRTLKSRHIQLIGIGGTIGTALYVQIGRGLMNGGPASLFMAFTLWCSVI
                     LAVTLCMAEMVTYLPISSPFIRFAGRYVDEAFGFAAGWNFFVFEAAMVPFEITACNVI
                     IHYWSDIVPPGGVIAIIIVLYGLINVLAVKWYGEVEFWAALGKMLLIVGLLIFTFIVM
                     LGGNPLHDRFGFRFWREPGAFAELYHTGALGRFMGFLQCLISASFTIAGPDYVSMAAG
                     ECENPRRVMPRAFNAVFYRLTAFFVLGSLAVGILVPYDDEEMRRAFESGAPGAAASPY
                     VVAMNRLQIRTLPDIVNAMVLTAAFSAGNSYVYCASRSLYGMALEGKAPRLFLRCTPA
                     GVPVYAVALVLLIALLAFLQVSNDAAVVLQWFVNLVTASQLINFSVMSLTYLRFHAAL
                     KAQAVDRRSLPYRAMLQPYAAWYALSGTFVMTFVGGYMVFLPGNWDVPTFLFSYTMIA
                     VCPILYIGWKLYHKTRIFSAEEIDLKKNLDEIDAYERSYVPSKPSNFFDRLLDWVFG"
     gene            complement(615987..619693)
                     /locus_tag="MYCTH_2309927"
                     /db_xref="GeneID:11513658"
     mRNA            complement(join(615987..616534,616697..619436,
                     619516..619693))
                     /locus_tag="MYCTH_2309927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665785.1"
                     /db_xref="GeneID:11513658"
     CDS             complement(join(616194..616534,616697..619436,
                     619516..619626))
                     /locus_tag="MYCTH_2309927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665833.1"
                     /db_xref="GeneID:11513658"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="JGIDB:Spoth2_2309927"
                     /translation="MPHLEPDGPLTKRQRTDAVVKARKTAKRGSAIFAPFRTIGLVSP
                     TAVPFTSIPLGKTTFQVTTSVGRALQTYDLKRGLNLVFVTRPQTPADITATYAWKEKV
                     FAAWGDPRSGEPQGLWAFQRGKKAAELQLPADLDQPIKQILIFGSWIVACALTRIEVW
                     KSSTLEHYTTIFTAAAKKGANEITGGVCNMPTFLNKIFVGRKDGWVEIWNISTAKLIY
                     TILPPSPDCGAVTCLQPSPALSLLAIAYSEGPLVIQNVLTDKPVLQLNAGTEDAPVTC
                     ISFRTDGQGAGQDGRKDGVMATATGVSGDVTFWDLNKGGRIMGVLRSAHNPPSYNRDV
                     RGGISKVEFLPGQPVIVTSGLDNSLKSWIFDESPFSPVPRILHMRSGHAAPVRCLQFL
                     PSDFDGAEGGNKWLLSGGRDRSLWGWSLRRDGQSAELSQGALRKKARKVGILAGSSLS
                     HGPTTTLDDLKAPEITCIASSLNRDGGMGAMPGKQVIWDKGNDKTKLSSAELSGMTGW
                     ESVVTAHKDDPWARTWFWGRRRAGRWAFKTGDGEAVSTVAISPCGSFALVGSSGGSID
                     MFNLQSGRHRQRFPSRLTPAQLRQLKMQQLKALDEVNKLQSRARKTFAPGTGRHTKAV
                     TGIVVDSLNRAVISCSLDGKIKFWDFVTGNLVDEIDWAPMIKITACRYHAGNDLVAFA
                     CDDHSIRVVDIETKQTIRELWGCRGDITDFCFSNDGRWIVAASRDSIIRVWDLPTSHL
                     IDAFRLEKPCTALAFSATGEYLAGAVEGDLGVQLWTNRTLFKHVPTRQISDKEIGQIA
                     GPTASGEGGQGLIEAAFEGGGEGGAAEEEEEEGEQDDGVTAPTIDQLSADMVTLSLVP
                     KSRWQTLLHIDLIKARNKPKEPPKAPEKAPFFLPSVGAAAGASASGLAAGSLVPLADE
                     AKKQAEAQGSRLTRLDRMRNQQALTSKLLACGASGDYTDFLEHLKSLGPSAADLELRS
                     LSVGDGSDETNELLHFIRALTSRLKSRRDYELTQAWMTVFLRLHFDLVMANESLLRAL
                     AEWKQYQTKERERLDDLVGYCGGVVGFLRSPRT"
     gene            620846..625103
                     /locus_tag="MYCTH_2309929"
                     /db_xref="GeneID:11513659"
     mRNA            join(620846..622183,622253..622274,622335..625103)
                     /locus_tag="MYCTH_2309929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665786.1"
                     /db_xref="GeneID:11513659"
     CDS             join(620992..622183,622253..622274,622335..624744)
                     /locus_tag="MYCTH_2309929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665834.1"
                     /db_xref="GeneID:11513659"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="JGIDB:Spoth2_2309929"
                     /translation="MGSTDVNAGNATLPPSEPQVNVEQATTSIGAAPPAATPAAPALA
                     AGGAGPGGGEREERPMGSEPRSQPQQQHGSHSLSPPSSSLSAHKSEQSEPDITEAHTE
                     RADASVAPPAPPPREDSTERVTVAEAGSSQNQSRGNAVPPSSLRDFAATTAVTDPDDP
                     DTPRLQANTAAEAAPSRSLPDPALRSARTSMSEGPVSNRMSVSSLYSLASARGIPSSA
                     ASVNGSENGSLSGSSVHRSASGILASGGGSKHHTTAAQAEPGVSNMTVTTGGEGSRGA
                     HQLAPRESPAQAQNPSEASKKPQQTGTAPTPRSQPTRSRSRANRRFSGSTGASSHQSP
                     SGDRVVSHRPEKEEHKPAPLGVIGVCALDVKARSKPSRNILSRLIQNREFDVCVFGDK
                     VILDEEVENWPICDYLISFYSDGFPLDKAIAYVKARKPFCVNDVPMQKILWDRRLCLR
                     LLDRIGVPTPQRIEVNRDGGPALLTPDICKYIREVSGITFDPSDSEAERIRSASPRKV
                     ELLDGGDILSVDGTLIKKPFVEKPTSGEDHNIIIYFPSSAGGGARKLFRKIGNKSSEY
                     VENLNVPRAITQPNDSFIYERFMQVDNAEDVKAYTVGPTYCHAETRKSPVVDGVVRRN
                     THGKEVRYVTALSSEEKEIASKISTAFGQRVCGFDLLRAGGKSYVIDVNGWSFVKDND
                     DYYDHCASILREIFIKEKQRRDGRTPPMPSPVIFDPDAMSARAGHVNKEREQASSQGR
                     PSVERSARESLVEQLPPAKAESKHNGMPASPLASQLSGSSQDGVATTVPGAASAATSV
                     VPEAMAQDEQEPPPPPPPKPSWKLKGVVSVIRHADRTPKQKYKFTFHTAPFIELLRGH
                     QEEVLLIGEPALASVLDAVDAAMKAGIEDPAKLKALRNVLIKKGSWAGTKVQIKPMFR
                     KKTGSKNAKSSREQDDGAGKEDEPVVQTDEDTEKKDGGKTPRRPPKRTDSLSGVTMSK
                     FTAAEESLVLDKLQLIVKWGGEPTHSARYQSQELGENMRGDLGLMNREVLDEVHVFSS
                     SERRVVTSAQIWAASFLNKKDVPEDFITIRKDLLDDSNAAKDEMDKVKKKLKGLLRKG
                     NERPPQFAWPENMPEPSEVQTRVVQLMNFHRRVMHHNYAKLYSGAVNSPNSVANPGAD
                     KNTNECGSSAVSVSSLASGRIVVAGQCGQQHPGTVVLRRGRGAVQGALGEAVRRVLRR
                     RES"
     gene            625346..625800
                     /locus_tag="MYCTH_2309930"
                     /db_xref="GeneID:11513660"
     mRNA            625346..625800
                     /locus_tag="MYCTH_2309930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665787.1"
                     /db_xref="GeneID:11513660"
     CDS             625403..625780
                     /locus_tag="MYCTH_2309930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665835.1"
                     /db_xref="GeneID:11513660"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="JGIDB:Spoth2_2309930"
                     /translation="MQASDEAKCFIYFTKESHIYTLLNCILEGGLETKIKRATIPELD
                     FLSQISFELYEMPANPPAGEDGAPAFNYSIKITISPGCHVFDPLDVQLDSRHCIGCAP
                     RRSLTAHHDWKVVIETLRAKFHQ"
     gene            625870..626596
                     /locus_tag="MYCTH_2309931"
                     /db_xref="GeneID:11513661"
     mRNA            625870..626596
                     /locus_tag="MYCTH_2309931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665788.1"
                     /db_xref="GeneID:11513661"
     CDS             626052..626375
                     /locus_tag="MYCTH_2309931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665836.1"
                     /db_xref="GeneID:11513661"
                     /db_xref="JGIDB:Spoth2_2309931"
                     /translation="MKPAEHGGQTPAVSGVAQGVEPVGTTTIKGEDVAGGGSAADTPT
                     TTTTTDSAVDTTTAAVIADIITTSNAAATNMPDPSSKPEGEGKGEDESKGGDHGGDEN
                     SAHQA"
     gene            632688..634525
                     /locus_tag="MYCTH_2316167"
                     /db_xref="GeneID:11513662"
     mRNA            join(632688..633554,633839..634525)
                     /locus_tag="MYCTH_2316167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665789.1"
                     /db_xref="GeneID:11513662"
     CDS             633114..633284
                     /locus_tag="MYCTH_2316167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665837.1"
                     /db_xref="GeneID:11513662"
                     /db_xref="JGIDB:Spoth2_2316167"
                     /translation="MALASYSQCAHSFVMIKSDNTLIEWRCHDCHDGPFWFIWECRYC
                     RHHTCRTCMDNA"
     gene            <640615..>641814
                     /locus_tag="MYCTH_104570"
                     /db_xref="GeneID:11513663"
     mRNA            join(<640615..640745,640854..>641814)
                     /locus_tag="MYCTH_104570"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003665790.1"
                     /db_xref="GeneID:11513663"
     CDS             join(640615..640745,640854..641814)
                     /locus_tag="MYCTH_104570"
                     /note="CAZy_ID 268079"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003665838.1"
                     /db_xref="GeneID:11513663"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="JGIDB:Spoth2_104570"
                     /translation="MVAIRWGSLVVRATCFTSSLRGPCREKAIAAEHSLEAAKALQGC
                     LDVPKIIANTFNNAQRVSVTAQKRVAATGLATSTYHFDHQGKRGFSQFINNYYDDEGW
                     WALALIRSWDVTHDQAYLDMAERIFEDMQAGTDDRCGGGIWWSKEKQYKNAIANELYL
                     SVAASLANRIPDKKQRYEQLAKDEWVWFKDSGMINKNNLINDGLAIDVNGRCTNNGLT
                     TWSYNQGVVLGGLVELANATGDPSYLGEATAIAKAAVELLSDENGIIREADRCEPDCG
                     ADGSQFKGIFVRNLHYLQRAAPQDAFRTAIQKNADSIWANNRNGKNQFGIQWAGPADV
                     GNGPNAATHSSAMDVIVAALAIGRQGRFR"
     gene            643602..646282
                     /locus_tag="MYCTH_2309942"
                     /db_xref="GeneID:11513664"
     mRNA            join(643602..645358,645406..646282)
                     /locus_tag="MYCTH_2309942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665791.1"
                     /db_xref="GeneID:11513664"
     CDS             join(643695..645358,645406..646156)
                     /locus_tag="MYCTH_2309942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665839.1"
                     /db_xref="GeneID:11513664"
                     /db_xref="JGIDB:Spoth2_2309942"
                     /translation="MVDPLEWHGLMLTLSHLLYRRSPPADNLADIVQALLMGLSFERR
                     STSGSPTGSNVRDAACFGIWALARRYTTPELLAVPTASFTTEARSEASILQIIAIHLV
                     AAACLDPAGNIRRGSSAALQELIGRHPDTVEQGIFVVQTVDYHAVALRSRAMQDVALG
                     VTRLSHRYGEAILDGLLGWRGVGDVDTASRRAAGVSYGMIAAELSSTEPDPIQRLTQA
                     ISLALTRVKLLEARQVEERHGLFLSIAAVFDALPAADGSQRTASLDGLIQLSLDALLD
                     ILNDCDTKTYRKPELVAEAASRLIISSFPVLQAAAFASSTLLPGHSLMSKSGDELAKI
                     VKSVSTRNDNKLSAFVTLAGSNLEKWLVWPDIDIINTASEAAVVYMIFCTNAERDVAI
                     RGWADAARARQSSKTRTTSGHFSALAAVYPMASTLALDQDKMLICDAIIERWKNDTST
                     DTRACILQSLAGSEVLRQNVKLFSDLLGEGCDDYTTTARGDVGSHVRFAAIRATRSLW
                     EKLDDDIETKGQLISTLFLRILRLAAEKLDRVRAEAQAALAVVLKPTQAAMLRKSTFS
                     SKAYFVFLLDLLDQDWLHPAVSPVKDDAEKWMDALMAGIVSSADTGNEELVIASRAAL
                     CEFCERSSASRDAVCTALGRNLKAWQGTDRVLVPTLEVVAFLFHVGVFAECSGVNYKS
                     LCLQVQKACYKTGNVRKIEACIRVYGAVAALGWEAQPVSSAAAVCGSDDLLKKREEGI
                     REARARLGALMFHPWPRVRSTVVDELWILYRDETVAQTLRSVNWGSAEKAKIKTVVDA
                     LGLASA"
     gene            complement(<648614..>649351)
                     /locus_tag="MYCTH_2129702"
                     /db_xref="GeneID:11513665"
     mRNA            complement(join(<648614..648777,648883..648973,
                     649181..>649351))
                     /locus_tag="MYCTH_2129702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665792.1"
                     /db_xref="GeneID:11513665"
     CDS             complement(join(648614..648777,648883..648973,
                     649181..649351))
                     /locus_tag="MYCTH_2129702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665840.1"
                     /db_xref="GeneID:11513665"
                     /db_xref="JGIDB:Spoth2_2129702"
                     /translation="MCDTRSRPFRGGLQLSAERGLTFRLQETAAVAAAAGGGGGGGGG
                     GEEGRKGGLAICMIEQTMEVSNEAHNVKSAPTPRRGGRGISSGAGGTMNGKALGPWLV
                     AVFDVARAAHGGDTLHTLSPDRTNETRSRSPRSDQFRSF"
     gene            650587..652260
                     /locus_tag="MYCTH_2309943"
                     /db_xref="GeneID:11513666"
     mRNA            650587..652260
                     /locus_tag="MYCTH_2309943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665793.1"
                     /db_xref="GeneID:11513666"
     CDS             650738..652153
                     /locus_tag="MYCTH_2309943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665841.1"
                     /db_xref="GeneID:11513666"
                     /db_xref="JGIDB:Spoth2_2309943"
                     /translation="MEALKHLINNVPDWLKKLDELNGQIEQRQIELARLTEENNKTNS
                     PDGPSSSGGPKSVRNRGSTESLRPRDEPAAHPADSRPQPGAGEAAGTPAAANDGNEQP
                     APSSPSESQSPSEIQRQTSQVRAAGQARARAMLRKRQRTDSVISAEGATPKYRSRSMI
                     IVYYDSYVQLFFEELVKFVSGGRNMMRKAKMAAKVAQIKRLAELETPDEQDDAPSTTT
                     TTTTTTAAAVPPLPTTTTTTATGIIEVDNPITPAPAEPAPSSQPIEAAEENKPAMHYV
                     STRRMGAGPGGRAMRANMYGRVGAGGRVMRAGAGPAPMLGADGKDAAPDVYDELDKGL
                     EYVQSMCEHAAHQFLRDGECGEEVANIKRRLAETKELADKEMERIRREEPEALLKHGE
                     NDATHGRSYRPQSMRKAAGKPSSSAAGAGPEAGAAPSLAPAPVLVPAEPTGPLEVDEG
                     VDDVDKEEAPKLVWRSTRMMR"
     gene            654885..656558
                     /locus_tag="MYCTH_2096067"
                     /db_xref="GeneID:11513667"
     mRNA            join(654885..654982,655104..656558)
                     /locus_tag="MYCTH_2096067"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665794.1"
                     /db_xref="GeneID:11513667"
     CDS             join(654913..654982,655104..656008)
                     /locus_tag="MYCTH_2096067"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665842.1"
                     /db_xref="GeneID:11513667"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="JGIDB:Spoth2_2096067"
                     /translation="MSESEANAEALVPKFKFERLLNQDQAGRRSSMLGTIDGQPALLI
                     LERAPFPSSADYLGSVPASLRAIRNLGANDIYHWYLANSGPVSGADSHEFADLKINLI
                     WPCTEKHIKKYSRQGVRFVTETPEIYRDHVRPYMQAQREAGRLNWAFNIIEGRKEAED
                     VIYRTPYGEDPEEGFLLLPDLNWDRKTLDALHLLGLVERRDLWSLRDLRKKHLPWLRH
                     MKAKFLDATTSVYPSIERDQLKLYLHYQPTYYHLHIHIVHVALEAGATQATGKAVGLE
                     SIMSQLETMAGDDEEAGMDSVTLCYTLGEASDLWVDVFEPLKRTNTAS"
     gene            <657865..662570
                     /locus_tag="MYCTH_2140435"
                     /db_xref="GeneID:11513668"
     mRNA            join(<657865..658046,658100..658117,658336..659447,
                     660075..660874,661088..661252,661451..661521,
                     661619..662323,662385..662570)
                     /locus_tag="MYCTH_2140435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665795.1"
                     /db_xref="GeneID:11513668"
     CDS             join(657865..658046,658100..658117,658336..659447,
                     660075..660874,661088..661252,661451..661521,
                     661619..662252)
                     /locus_tag="MYCTH_2140435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665843.1"
                     /db_xref="GeneID:11513668"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2140435"
                     /translation="MATPSLDDFLRPLAVDLETVLKLSRELESTFRQLSVESSDQFLP
                     TPISESVLRPATRDQGRFLAIDIHVAEVVRNGCETLGLSREAELPMGVTFSFPMQQRS
                     LSEAILMPMGKGFAITSDLDLGGHLAAGYQKHRTADMPPVKVAAIANDAVATLVSFIY
                     QFPAQVNQKAAMALIVGTGCNATLPLLLSSLHESKRPSAISVRPGQEAADVKIAVNTE
                     WSIRGSAPPLRQLGLISKWDTELDNAGEVPGFQPLEYMTAGRYLGELARIVFLDYFQT
                     VLGLPAQLLPSKLHERFGLSTTFMSHLHPESTKGPMLQQLEREFAPEDASFRWTTELA
                     NVLYRIAKAIELRAAAIVAASTVGLLRCAQELPQPGVERTTLAVGYTGGCIQHFQDYL
                     GDTQRFIDEIINHEFGPQPRVRVVLTPCHDGGITGAGILVPAALAIVAAETTQTTHPG
                     SMSGSEPTSTPNRLQPSRPRSAADGDDDEGNSGDIDPNQLDVMLSRSVQSAAPLLEPE
                     SFQHSMLRNTRARSRSRSRSRSRSRGRRQPSTNGTAVATCKLPGSGAAPDEETPLLQN
                     TTTAALEGTAKSDNPYLGGVSVTRFWLLFLQINASYFIACFDSTIMASSHPVITSYFG
                     SSNSASWLSTAFLLTSTSFQPVLGGFSDAVGRKGPYVITMAVFLFATLWCALAQSMTS
                     FIVARAFCGLGAGGVMTLGSIIVPVIVLCLIVAVLVVPSDLGLGGREKQTLHEAMRTF
                     DFKGSVLMSSSVTFLILGLSPHANLIFSNHIGAFLSNATLFNVPLYFQGVLLTSATTS
                     GFRLVVSSAVASAAGTATGFLISYTRRLKWPLVLGTSLSVAGALCLTSMQRGWPALLY
                     ILCLLPGAAGAGFQFPGTFMAVLAASEQREQAVVTGTLILWRSLGQVLGVACSSLVVQ
                     NALWYYLEALVAPGPDKEGVVARARKSVEAIRDLPLEFREPVVRSYEAALRVTFGCCA
                     ALAVVGWLLILPVRLPRLGKR"
     gene            complement(<662714..>664178)
                     /locus_tag="MYCTH_2129707"
                     /db_xref="GeneID:11513669"
     mRNA            complement(join(<662714..662746,662811..663075,
                     663197..663403,663512..663694,663753..663795,
                     663873..663935,664052..>664178))
                     /locus_tag="MYCTH_2129707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665796.1"
                     /db_xref="GeneID:11513669"
     CDS             complement(join(662714..662746,662811..663075,
                     663197..663403,663512..663694,663753..663795,
                     663873..663935,664052..664178))
                     /locus_tag="MYCTH_2129707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665844.1"
                     /db_xref="GeneID:11513669"
                     /db_xref="JGIDB:Spoth2_2129707"
                     /translation="MAAQVPPDVLGTAVGVLVYSLICLISGFFLLWLVWVHEERKSYV
                     AELNITGASTGLDLVLFYIQYYSYNVESLLVFFWAVELANSIFQLRITKIYRFHASLV
                     AKAIAALLPVARMVLLRFSGIDKSTVAFMALADAISAKALYSWPSCVVIFIPASRSPP
                     WNVGYARQQQSASGGAYGARYGRPVPKKTIYDDRWLVLRFSVAFCALSLFQIVVVNFQ
                     LRAAATNNRANIPPELDLSATRARGDFALFAPAPSAVLFAILVFATRPGTGAASCWGC
                     PTWVALLVLPAAAVAGAGGREVMVLSWVSG"
     gene            665193..666391
                     /locus_tag="MYCTH_112716"
                     /db_xref="GeneID:11513670"
     mRNA            665193..666391
                     /locus_tag="MYCTH_112716"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665797.1"
                     /db_xref="GeneID:11513670"
     CDS             665207..666277
                     /locus_tag="MYCTH_112716"
                     /note="Contains zf-RING-like[pfam08746], This is a zinc
                     finger domain that is related to the C3HC4 RING finger
                     domain and pfam07574: SMC_Nse1 non-structural maintenance
                     of chromosomes (SMC) complex plays an essential role in
                     genomic stability."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665845.1"
                     /db_xref="GeneID:11513670"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR012906"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="JGIDB:Spoth2_112716"
                     /translation="MNDDWTPPIPAGYNDANRAFIQALMARGTLTFREGQKVLAAIKS
                     AVEGGGGDDVAPESITMAEFENFVRTAREAVEPLDYDIRNMRDQVRGGERVWAFVNAH
                     SDPATQLGTARSPEEVAYIKRLLDAMFDHHNTPRLEVMAVDEGQALRVSRPARGPAAR
                     DSNVNTNTNGGMGGGEEDDDDDDNDGGTGDGSTTAAAAAASRGLKHSEVLSLLSSLVA
                     EGWLDKSRDGFYSLTPRALMELWSWLVATYNDPDAESEWQRIKFCEACKEIVTYGQRC
                     NEPDCTIRLHDICEDAFWRTRAGDRKCPKCGTPWEGNHFVGERAVTSRSGFQRGRGRR
                     RRQTEAAEVAHDNGGVEEEGGE"
     gene            666365..667999
                     /locus_tag="MYCTH_2309963"
                     /db_xref="GeneID:11513671"
     mRNA            666365..667999
                     /locus_tag="MYCTH_2309963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665798.1"
                     /db_xref="GeneID:11513671"
     CDS             666680..667897
                     /locus_tag="MYCTH_2309963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665846.1"
                     /db_xref="GeneID:11513671"
                     /db_xref="JGIDB:Spoth2_2309963"
                     /translation="MAPFFKKHKDTDKAGKKGGTGKEEVKPEGKAKTTGAGAADALAL
                     AGSPSAEPALLLNDEDEEFLERLVSNDNEDDEDGPPPPLPPRPKTPDLVWDDSESFRV
                     SRSEEGLTTTAPAATATAATTTTTKTTTKKPNRLSRIFHRKHSTSTTLTVPSSTAAEV
                     TPEEADREWADLNRVLSPLGIEPADPDSPDAPNKGAKNSSSTNTTTTTTTKAGKTSRT
                     KAAALTASAEIQSLLRQFVVVLKDIMRGAPTAVDDLTALLDGRNDVLRRGFEKLPSSM
                     QKLVTQLPKKLTSSLGPDVLAAAAEARGLKKEDTDAGGLARFLMPKTLNDLVLTPAIV
                     KSMLKAIVNTLKVRWPAFVGTNVLWSAAVFLLLFVLWYFHKRGKEEREKREKEAAERE
                     AGEGKVDEKEVSV"
     gene            complement(<668103..669886)
                     /locus_tag="MYCTH_117625"
                     /db_xref="GeneID:11513672"
     mRNA            complement(join(<668103..669309,669360..669886))
                     /locus_tag="MYCTH_117625"
                     /product="uncharacterized protein"
                     /note="Has EST support. Seems to be more expressed at 45C"
                     /transcript_id="XM_003665799.1"
                     /db_xref="GeneID:11513672"
     CDS             complement(join(668103..669309,669360..669781))
                     /locus_tag="MYCTH_117625"
                     /note="Contains conserved domain SPRY[smart00449], Domain
                     of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665847.1"
                     /db_xref="GeneID:11513672"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="JGIDB:Spoth2_117625"
                     /translation="MASEAVSPQREPTPSSLHSTLPQKRSLEDDHSPAVSSPLNPESK
                     PQKVQVQIEENQVTGREKRAKKDSLKKRESKGTSDSARATPDPRQQEPPEELGPVRYK
                     LAHPKPTDFELSRGPVFTSHHEVQDPEGRTIEFFETSDHVYNKKSFHYTHCIADPAFP
                     SMFYYRNTEPPPFGAHMSFEDAASHMFFDRNGMHVTSDKGFRMSRANIAVREGRWYWE
                     CKITRGILKERKEGEPDSHGHVRVGFARREASLDAPVGFDAYSYGIRDVSGQKVHMSR
                     PKDFFPPGEEVKEGDVIGLEIQLPSERLHRKIVQGQYNPVVDLADDEEPDQAEAPNII
                     RDRIPIRFKAHIYFEKIDYHPTKELEELMNPSPVGPGRNLEAPNPNHPVPALRTLPNS
                     YIKIYKNGVLMGTPWTDLLAFLPPASKQAQQTGGRDALDDGSLGYYPAVSVFRGGAVE
                     VNFGPNFWYPPPAEDAEMGGVDGSSGKGLNKLRAMYERYDEQIVEDIVYDIVDEVGFW
                     MQDGQKIIDRSARDEKAETVAPGREEIKELVQDD"
     gene            670079..672754
                     /locus_tag="MYCTH_2309965"
                     /db_xref="GeneID:11513673"
     mRNA            join(670079..672120,672176..672754)
                     /locus_tag="MYCTH_2309965"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665800.1"
                     /db_xref="GeneID:11513673"
     CDS             join(670108..672120,672176..672505)
                     /locus_tag="MYCTH_2309965"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665848.1"
                     /db_xref="GeneID:11513673"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2309965"
                     /translation="MPVVKGGVWTNIEDEILKASVSKYGLNQWARVSSLLARKTPKQC
                     KARWNEWLDPSIKKIEWSKEEDEKLLHLAKLMPTQWRTIAPIVGRTANQCLERYQRLL
                     DEAEQREASALGLTGPEGGETKAPTADDVRRLRPGEVDPDPETKPARPDTIDLDEDEK
                     EMLSEARARLANTQGKKAKRKARERQQEESRRLAALQKRRELKTAGINIKVTTRKKGQ
                     MDYNADIPFEKKPVPGFYDTTEEIARNEYQRAHFDPKKQQVGNKRKGEEEGDADRKRR
                     KNEKDGPSASVQAALKAGQMQKLREAEQSSKRKPLVLPAPQVSDGELEEIVKMGMIGE
                     RASAMARDSDNDATRGLVGNYSTLNTNAPIRTPRAPPQEDHIANEIRNIRALTETQSS
                     LLGGENTPLHQGSGSTGFESAAPRKQVVATPNPLATPLRPAGSAVGATPLRAGQTPLR
                     TPRDTFSLNAPSTEMDMVGGTPADARMRELSLRHQLKQRLAALPKPKETEWELELPEE
                     KEEPMTAEQMEVDAAERDRREREIREAQELLERKRRTQVMQRGLPRAVEVDYNKLVQA
                     ASEIDDPARALVAREAALLMAHDATRYPLPGAPPAAKPVPLPQIDDSALAEARLQILL
                     EMKDQPKPEEVQAVWNKENTNSLLLGLGCYDDDDEEDQVATLKSALDSALESLMSSAE
                     KGNKLEKKLGLHLGGYKNRAEMLRKKVVEAHAALEKARNALGGFRILQASEQQAIQNR
                     LAALRAEVAFVSTRERQAQELYRSVRAELEDLRIEVDARQ"
     gene            <673592..>674935
                     /locus_tag="MYCTH_97168"
                     /db_xref="GeneID:11513674"
     mRNA            join(<673592..674795,674862..>674935)
                     /locus_tag="MYCTH_97168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665801.1"
                     /db_xref="GeneID:11513674"
     CDS             join(673592..674795,674862..674935)
                     /locus_tag="MYCTH_97168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665849.1"
                     /db_xref="GeneID:11513674"
                     /db_xref="JGIDB:Spoth2_97168"
                     /translation="MAPNTSISKHYRDMRRFWPSKKDSSQQMAFAFLLVTQLPFPNGV
                     VPRVVRSQFLEMFASNTERAEQIANACANGPAIDSLVILLRLLLALGLDPRLSRQYPL
                     FKLAFHDFGRKMVDDYIVKGELLDILYPNAVGPANRVHQKTTSFEQPVEANEFERVQA
                     TLGELLKHPLVSAALWSHPSLRFFRWRTWAKKPGEAVFAPYELSKAQPGALSSLQRTP
                     YRIDNPHPIDLGEYFSRHLGIRDKNDVSIAFACEFPIVIPVIMRGVQKFDSIRSFVVE
                     GPYDYQWHKNGTLSPLTKSRAYRLRAVLNLAESDVRIYHQDTSPVIEQLDPDLIAAFK
                     NPGEPYVPKEAYLPKLHRGEHARGWTFEDSPTRHFLLIYAKYRTEKDKPFEKHRVDFG
                     EYIPVLRGNGEQRPASSPYVRLGEEQPPPNHFL"
     gene            complement(676564..677421)
                     /locus_tag="MYCTH_2309967"
                     /db_xref="GeneID:11513675"
     mRNA            complement(676564..677421)
                     /locus_tag="MYCTH_2309967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665802.1"
                     /db_xref="GeneID:11513675"
     CDS             complement(676677..677369)
                     /locus_tag="MYCTH_2309967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665850.1"
                     /db_xref="GeneID:11513675"
                     /db_xref="JGIDB:Spoth2_2309967"
                     /translation="MEIVESQEAFRFVEGKLRFSYMQYIVRDNNILYLGKWANRHQAP
                     RALSQLYDVEKLRTDDRGPQLKPSWKVTLGQSCYIKRQKLFDYAGKLDLERRILREVE
                     TCEIIRKHPHPNIAFYYGAQETRGRVSGLCFKRYVSTLLDKVNPQHLNKSTFLLSGRP
                     LVEHRMKAQLSRILDGIRHLHSLGLVHNDITPDNIMLEEDGTLTSTVAGMLGKCFETP
                     TLKGRMAGTTLL"
     gene            complement(<679743..>681250)
                     /locus_tag="MYCTH_2129714"
                     /db_xref="GeneID:11513676"
     mRNA            complement(join(<679743..680707,680794..>681250))
                     /locus_tag="MYCTH_2129714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665803.1"
                     /db_xref="GeneID:11513676"
     CDS             complement(join(679743..680707,680794..681250))
                     /locus_tag="MYCTH_2129714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665851.1"
                     /db_xref="GeneID:11513676"
                     /db_xref="JGIDB:Spoth2_2129714"
                     /translation="MTDTSSNSSVSEIEDSDLDGSSVCGGQRLPIFGRKDELKPQSTA
                     TTRQLRRRDPSDRVDYNVENHYLALEAALEPANDEEERPSIKREHRQDTIRMGSLKRG
                     AWQPAASKNLGNSNKRRKRADVPQDKPEDGQKKDRDEGAQDRAGESRAVVVLDCAGPR
                     FSSAPLQHTPTRAHALGTRPRIFNRSLPDLFTYGLKLDDSVLPDINVDGQALPNPGFL
                     STAISDNLQLLVCHPVWEGSLSLVRYALQVAVMHRVPGHIFPIAPLPNLTSRVTVMRN
                     PSLAGHPMLARDFDFASYEMSHPCARPMIQQLCDILEESVEKEDFHEADAGFREKTLF
                     LLRVQDIQAVINSTNRLAVNGMPVFRTCHDYFLHHKSLAQAERDHRASIDELEALKRH
                     KKEWVLATRRKWIVSSRHWRQESTGVAPPAEDEPGAYDMPEGDACPAHLYCEQLGRSE
                     AHLALMRGTIWPLIKTPPPVFGL"
     gene            683475..685367
                     /locus_tag="MYCTH_112714"
                     /db_xref="GeneID:11513677"
     mRNA            join(683475..684686,684891..685122,685313..685367)
                     /locus_tag="MYCTH_112714"
                     /product="pyridine nucleotide-disulfide
                     oxidoreductase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665804.1"
                     /db_xref="GeneID:11513677"
     CDS             join(683603..684686,684891..685036)
                     /locus_tag="MYCTH_112714"
                     /codon_start=1
                     /product="pyridine nucleotide-disulfide
                     oxidoreductase-like protein"
                     /protein_id="XP_003665852.1"
                     /db_xref="GeneID:11513677"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_112714"
                     /translation="MRPFFMLALTALAAVANAAALPQTQTQKEPGLGTDYDAIIVGGG
                     PAGLSAASGLARVRRNVLLIDSGEYRNAPTRHMHDVPGFDGVTPAYFRWAARQQISYY
                     KTVTMVNGTVFKIQPGNEKNTYFVVSSREPGAEGGEEVKERTARKVVLATGLRDLLPE
                     TPGVRENWGKGIFWCPWCDGHEHADQTLGLLGSLDNVPAAVREMLTLNRDIIAFVNGT
                     DTPEVRAVTEKKLARWETYLQLHNVRLDNRTISAIVRLQNGTDGSEDPSLPTAPEHDF
                     FRVDFTNGEPEYRAAFLAAFPSEQTSSVGEDLGVQLLGGRLFANQSAGLVTNIPGVYA
                     VGDANSDNTTNVPHALFSGKRTAVFLHVAIAREDAERELNETEVSKRDLEPVARSLWD
                     TVNGPPGDILYAGEFDQ"
     gene            <686624..>687455
                     /locus_tag="MYCTH_2069031"
                     /db_xref="GeneID:11513678"
     mRNA            join(<686624..686928,687039..687303,687414..>687455)
                     /locus_tag="MYCTH_2069031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665805.1"
                     /db_xref="GeneID:11513678"
     CDS             join(686624..686928,687039..687303,687414..687455)
                     /locus_tag="MYCTH_2069031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665853.1"
                     /db_xref="GeneID:11513678"
                     /db_xref="JGIDB:Spoth2_2069031"
                     /translation="MKALSLLTLLPLAAAAPTNTLAARGLTVPTGPVPETVRVVGVSL
                     LGSGCPAGTADVQIDATKTLLEVTFSEYIVQTGPGTKAADWRKNCKLTLNMEFDEGFS
                     FSTLATDMSGFAQIPAGSRGLCTNTFDFTGISGQSYYSIALPGEREGPFTLSADPDVV
                     SWSPCGVTTAILNMNTQCNISPTRDPALIAITVNVSLAWRKCE"
     gene            complement(<688286..>689422)
                     /locus_tag="MYCTH_97164"
                     /db_xref="GeneID:11513679"
     mRNA            complement(join(<688286..688309,688352..>689422))
                     /locus_tag="MYCTH_97164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665806.1"
                     /db_xref="GeneID:11513679"
     CDS             complement(join(688286..688309,688352..689422))
                     /locus_tag="MYCTH_97164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665854.1"
                     /db_xref="GeneID:11513679"
                     /db_xref="JGIDB:Spoth2_97164"
                     /translation="MDTAQDGDKEADGMLRALIQRLSDQIDTMDKSVSHAQLTSVAEQ
                     LEASLIQVQRLQERLRASLSRSLEHEQAAKRKAVAMRDISEGFRALGRLETKVDAVSA
                     KIGEHLNTCKAHKIDLNRRIAALQETLAETRDHGNAETAKKSAQESAEATTASTQLHI
                     TTGRPAPRTASSNSADVNTPNTVNDATRASNALVRTGPAPSPVHAARKRKRRRRQGKS
                     ELSVPNAADLLPSDDHRRKISELAAMPRLDCQIANEVLSCLLPCPDGGLWDANRIHDC
                     VRSLSTGESGTKKVTWLGRRMLLLWDRSHDGWFCAVHAPADRSDPVDPDGRCGSCLPR
                     TWCVQLRRAALTGLLRRYCYARVCATEHGK"
     gene            complement(690016..>691972)
                     /locus_tag="MYCTH_72932"
                     /db_xref="GeneID:11513680"
     mRNA            complement(join(690016..691268,691384..691532,
                     691603..691736,691804..>691972))
                     /locus_tag="MYCTH_72932"
                     /product="histidine acid phosphatase"
                     /transcript_id="XM_003665807.1"
                     /db_xref="GeneID:11513680"
     CDS             complement(join(690233..691268,691384..691532,
                     691603..691736,691804..691972))
                     /locus_tag="MYCTH_72932"
                     /codon_start=1
                     /product="histidine acid phosphatase"
                     /protein_id="XP_003665855.1"
                     /db_xref="GeneID:11513680"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="JGIDB:Spoth2_72932"
                     /translation="MTPTATISAVLTCAGMAYARAGAGTPLDPVQPVVLPNGAMAKNP
                     LAHLGGNGPWTTAPNVNGIPPDVPKNCYVDQAAYVLRHGSRYPDPGAHSGWLDMARRF
                     REGDYSASGPLSFVHRWDTPLAHPEIQLSQLSQTGYKELSDLGYTLRTRYPNLYQEGE
                     DFYVWANNYTRVIQTAQLFVRGYLGPNSTLLGKVVSVTGKGFPDQLANTLAPSDMCPA
                     FKDDSEVQQSAWRSRWLPSFIERLSKYIRGNLTLQDSQWNDFPYICGFESQITGRLSP
                     FCDTFTQEELEQYEYQQDLRYYYGLGPGASVSSKMMAPFLNALMQRFVDGPDAQGIAK
                     GGALFKVPRLLMNFVNDGQLIQLAAATGVFDKQKPLPVNYIPRDRLWRSSRISPMRGT
                     IAFERLNCRVRNSHGGWGLAREKNETFVRIRINEAVYPVPGCQGGPGQSCRLTDYAAY
                     IARKVKAIGSFAALCNATDPATPRTVLGASFLTDLDQPHLQIVTP"
     gene            <693444..>694441
                     /locus_tag="MYCTH_2129720"
                     /db_xref="GeneID:11513681"
     mRNA            join(<693444..693558,693897..694135,694204..694326,
                     694421..>694441)
                     /locus_tag="MYCTH_2129720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665808.1"
                     /db_xref="GeneID:11513681"
     CDS             join(693444..693558,693897..694135,694204..694326,
                     694421..694441)
                     /locus_tag="MYCTH_2129720"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665856.1"
                     /db_xref="GeneID:11513681"
                     /db_xref="JGIDB:Spoth2_2129720"
                     /translation="MIGPNEKELMRKRGSWERNRFSYQAQQGGLFPAASRNPHAPCPP
                     TPQVQAVQWRASIPFTHKGEPQPQRYDFWEQEKRIDTLRPISKRTGTEGKATGYKIRS
                     PWQINVAAAEVNSYLIDLLQACPFHVDPSKNKSHRARLDFTTLAPQLRVPKSSEWREH
                     IGTSP"
     gene            695015..696344
                     /locus_tag="MYCTH_2309971"
                     /db_xref="GeneID:11513682"
     mRNA            join(695015..695244,695351..696344)
                     /locus_tag="MYCTH_2309971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665809.1"
                     /db_xref="GeneID:11513682"
     CDS             join(695127..695244,695351..696165)
                     /locus_tag="MYCTH_2309971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665857.1"
                     /db_xref="GeneID:11513682"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="JGIDB:Spoth2_2309971"
                     /translation="MAEVDLQAVHDTLVSVAFEAGRMILAANPSTGSTNTKLNAVDIV
                     TETDKAVERMVSTRLRAAFPTFAFVGEETYQAGVTRVTDAPTFIVDPIDGTTNFVHGF
                     PNACVSLGLAVDRAPAVGVVYNPFQDLLFTGIKGKGSYMQRNASLEEGRGRGEKVRLP
                     LSSAGGTRPPPALGNLSSALVSIEWGSQRDGDNFELKARTFRKLAASKENGGGMIGGM
                     RSLGSAALNLCACAAGQLDMYWEGGCYAWDVAAGWCILNEAGGRMVSGNPGGWETELD
                     SRVYLAVRGASSGQEELVKEFWDVIGDGKMDYKH"
     gene            698093..700368
                     /locus_tag="MYCTH_85648"
                     /db_xref="GeneID:11513683"
     mRNA            join(698093..698296,698398..698763,698827..698844,
                     698904..700368)
                     /locus_tag="MYCTH_85648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665810.1"
                     /db_xref="GeneID:11513683"
     CDS             join(698227..698296,698398..698763,698827..698844,
                     698904..700024)
                     /locus_tag="MYCTH_85648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665858.1"
                     /db_xref="GeneID:11513683"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_85648"
                     /translation="MTLTQRKSHRDPDAFPTVQLFVLAIVRLAEPIALTSIFPYAWAL
                     IKRFQVGNEDDASFYAGLLISAFSLAEALMGMYWGSLSDRVGRKPVLLLGCIGTMFSM
                     IVVGIAQNIWIALVGRTVGGLLNGNIGVIQTMVGELVTKPEHEPRAFSIMPFVWSIGT
                     IIGPIIGGLFADPHESYPDLFPNGSLFERFPYLLPNLICAAMLLVSIILGYFLLEETH
                     PDMQPRVLLPNDTFLSENTPLIETSDAMKRPAVDLRDENYGTMRSRDAAASCPTPGWT
                     TKEGVRPASVFCKRIMAVVISLSIFTYHSMTFDHLLPIFFEDDRAPTSGATVHASLRA
                     LSGLGVPRNSLLYSPGGLGLSMQAVGVIMAVQGAIALFMQAIVFPLAAERVGVYRLFL
                     FVTVLHPVVYALVPWLLYVPEPLLYPAIYCVLVVRNFFSILLYPLLLILIKEATPSST
                     ILGKVNGLAASAGAACRMVAPPVAGYLYALGKKMDCTALAWYGSTVVAVVGAVQCFSV
                     KRDREDNGKRPEDVEA"
     gene            <769716..>769970
                     /locus_tag="MYCTH_2069804"
                     /db_xref="GeneID:11513684"
     mRNA            <769716..>769970
                     /locus_tag="MYCTH_2069804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665811.1"
                     /db_xref="GeneID:11513684"
     CDS             <769716..769970
                     /locus_tag="MYCTH_2069804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665859.1"
                     /db_xref="GeneID:11513684"
                     /db_xref="JGIDB:Spoth2_2069804"
                     /translation="EEYLEYLYIVYKILNKAYIYISATKSFIGYLAIRLLRYIINGKG
                     IAKTDDYFTTFKKLKFLDTLNSLVLRFSYIRQPNKAYGTN"
     gene            790996..792112
                     /locus_tag="MYCTH_2309975"
                     /db_xref="GeneID:11513685"
     mRNA            join(790996..791067,791142..792112)
                     /locus_tag="MYCTH_2309975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665812.1"
                     /db_xref="GeneID:11513685"
     CDS             join(791052..791067,791142..792031)
                     /locus_tag="MYCTH_2309975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665860.1"
                     /db_xref="GeneID:11513685"
                     /db_xref="JGIDB:Spoth2_2309975"
                     /translation="MTGDKETEPALVVGSEDQAASPLVATKADSPTAPPPEREPLPSY
                     TDQAATLATFTPHRPFPQVLSAYSSSLKPIKLCGSSADDVLFAVETHTGYSGKTVLGT
                     KPGLLLHNGTSKQDPILAAVGDTSQLAARAYVFSPESIILLPPAADIPSAPMATEYMH
                     ARTSGDDVLFFFEVEVGLGEKLHRRQFIWKKAKKGVDPDVKQGGFRLEWRPSVAGDDP
                     GSLGVSSSSPVDDQWETVALLEWGHLLSRKMFTVQFLGSGLSGKLGERWRLMVVMTAL
                     RLLLLKVKGRTAKSHVAAGEKLYKN"
     gene            complement(793289..794523)
                     /locus_tag="MYCTH_2309977"
                     /db_xref="GeneID:11513686"
     mRNA            complement(join(793289..794374,794421..794523))
                     /locus_tag="MYCTH_2309977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665813.1"
                     /db_xref="GeneID:11513686"
     CDS             complement(793589..794260)
                     /locus_tag="MYCTH_2309977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665861.1"
                     /db_xref="GeneID:11513686"
                     /db_xref="JGIDB:Spoth2_2309977"
                     /translation="MLNIFWGPEKTQAWRQMFEDANITQSAKNGISMNHQIHFWFDNA
                     RFALKPLRETPEGVVVQWHWLKRSVLKPLVDIRPDQDTLLQAGITDQNWGDNLAHRKS
                     GVRIRTGQTFLIRANKPEDRVSWDLLEMQWNLLRVAAISGAADVTDDYYDYDEPDERA
                     YDAEVAAKQRVILAEHGTAARDKSEYYGGEQSKAKQARTPGDSDSERSNNDGGPGDSS
                     GGGAA"
     gene            821864..822559
                     /locus_tag="MYCTH_72924"
                     /db_xref="GeneID:11513687"
     mRNA            join(821864..822079,822143..822559)
                     /locus_tag="MYCTH_72924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665814.1"
                     /db_xref="GeneID:11513687"
     CDS             join(821948..822079,822143..822202)
                     /locus_tag="MYCTH_72924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665862.1"
                     /db_xref="GeneID:11513687"
                     /db_xref="JGIDB:Spoth2_72924"
                     /translation="MPCSWCTSQGLVCKMIACIKRYEACICRGRSYDSSSIPLSSCKP
                     EQRRIKDAKRRAKLELDKS"
     gene            <849349..>850183
                     /locus_tag="MYCTH_2068997"
                     /db_xref="GeneID:11513688"
     mRNA            join(<849349..849556,849626..849981,850094..>850183)
                     /locus_tag="MYCTH_2068997"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665815.1"
                     /db_xref="GeneID:11513688"
     CDS             join(849349..849556,849626..849981,850094..850183)
                     /locus_tag="MYCTH_2068997"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665863.1"
                     /db_xref="GeneID:11513688"
                     /db_xref="JGIDB:Spoth2_2068997"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            <876061..>876255
                     /locus_tag="MYCTH_2069012"
                     /db_xref="GeneID:11513689"
     mRNA            <876061..>876255
                     /locus_tag="MYCTH_2069012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665816.1"
                     /db_xref="GeneID:11513689"
     CDS             <876061..876255
                     /locus_tag="MYCTH_2069012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665864.1"
                     /db_xref="GeneID:11513689"
                     /db_xref="JGIDB:Spoth2_2069012"
                     /translation="GLPIVVVVNRGSKFKGEAKAILEELGVKHIIISPYNSRANGVSK
                     ARYIPIIATLVKMTIGIRKN"
     gene            <954157..>955393
                     /locus_tag="MYCTH_59005"
                     /db_xref="GeneID:11513690"
     mRNA            join(<954157..954529,954618..>955393)
                     /locus_tag="MYCTH_59005"
                     /product="Intradiol ring-cleavage dioxygenase-like
                     protein"
                     /transcript_id="XM_003665817.1"
                     /db_xref="GeneID:11513690"
     CDS             join(954157..954529,954618..955393)
                     /locus_tag="MYCTH_59005"
                     /codon_start=1
                     /product="Intradiol ring-cleavage dioxygenase-like
                     protein"
                     /protein_id="XP_003665865.1"
                     /db_xref="GeneID:11513690"
                     /db_xref="InterPro:IPR000627"
                     /db_xref="JGIDB:Spoth2_59005"
                     /translation="MLFTKAVSGLAILAGLVAAHPGHDASKEAAERRAYLQNAKRTSL
                     AHCADKLRARGTESRNIVRRKAVVEKARQKRGLTKRDFSDVLGTDHNKTTLGYTPNTD
                     AATLFAGYNSCLLTPEVTQGPYYVAGEYVRENVVEDQPGLPLLLEYQVVDVATCEPVP
                     EVYVEIWHCNATGVYGGVVASGNGDSSDASNLDNTFLRGIQPTDAEGVAQFESVFPGH
                     YTGRATHIHIMVHTNATLQANQTLGLDNYASHVGQAFFDQALITAVEKLEPYASNQQP
                     LTTNEEDSIMAEESATDGVDPVMEYTLLGDNLSDGLFAWIAFGIDTTRSEAISPAVYL
                     EEGGGRANPDAGGPGGPGGSFPTGSFPTGGFPVPTGNVGRGIGRRARH"
     gene            complement(<956902..957916)
                     /locus_tag="MYCTH_117620"
                     /db_xref="GeneID:11513691"
     mRNA            complement(join(<956902..957573,957695..957916))
                     /locus_tag="MYCTH_117620"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665818.1"
                     /db_xref="GeneID:11513691"
     CDS             complement(join(956902..957573,957695..957796))
                     /locus_tag="MYCTH_117620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665866.1"
                     /db_xref="GeneID:11513691"
                     /db_xref="JGIDB:Spoth2_117620"
                     /translation="MNTAGAVILALVLLLIGAGVGWIIFTRIRASRLGLPPPPLRSYI
                     PFLSPGSTSYGGGGPTPAPGGIVGWVNDKIRLMRHRNKRTAAGAYEGPAPTTPYYGGR
                     YPARGNNPSAPPEDDDPWDSRLRGYNPYEEDDDEERQRGSGYGPGGEGYQMNLPVPAP
                     PEEGAASAAGPSGPAGAAKVAGPAGAAGAQQGGHDEEEWRRGRTENPFGDDADPSNLS
                     VRGVSPRPTTEGGAASSSSAARSAVREDRDRTSMFREDV"
     gene            complement(<958688..>960232)
                     /gene="phy1"
                     /locus_tag="MYCTH_104551"
                     /db_xref="GeneID:11513692"
     mRNA            complement(join(<958688..960119,960177..>960232))
                     /gene="phy1"
                     /locus_tag="MYCTH_104551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665819.1"
                     /db_xref="GeneID:11513692"
     CDS             complement(join(958688..960119,960177..960232))
                     /gene="phy1"
                     /locus_tag="MYCTH_104551"
                     /note="Phytase A precursor (Mitchell, D.B. et al. 1997.
                     Microbiol. 143:245-252); catalyse the hydrolysis of
                     phytate (myo-inositol hexakisphosphate) to myo-inositol
                     and inorganic phosphate."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665867.1"
                     /db_xref="GeneID:11513692"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="JGIDB:Spoth2_104551"
                     /translation="MTGLGVMVVMVGFLAIASLQSESRPCDTPELGFQCGTAISHFWG
                     QYSPYFSVPSELDASIPDDCEVTFAQVLSRHGARAPTLKRAASYVDLIDRIHHGAISY
                     GPGYEFLRTYDYTLGADELTRTGQQQMVNSGIKFYRRYRALARNSIPFVRTAGQDRVV
                     HSAENFTQGFHSALLADRGSTVRPTLPYDMVVIPETAGANNTLHNDLCTAFEEGPYST
                     IGDDAQDTYLSTFAGPITARVNANLPGANLTDADTVALMDLCPFETVASSSYYSSSSS
                     SSDRATADAGGGNGRPLSPFCRLFSESEWRAYDYLQSVGKWYGYGPGNPLGPTQGVGF
                     VNELLARLAGVPVRDGTSTNRTLDGDPRTFPLGRPLYADFSHDNDMMGVLGALGAYDG
                     VPPLDKTARRDPEELGGYAASWAVPFAARIYVEKMRCSGGGGGGGGGEGWQEKDEEMV
                     RVLVNDRVMALKGCGADERGMCTLERFIESMAFARGNGKWDLCFA"
     gene            complement(962320..964344)
                     /locus_tag="MYCTH_2310013"
                     /db_xref="GeneID:11513693"
     mRNA            complement(962320..964344)
                     /locus_tag="MYCTH_2310013"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665820.1"
                     /db_xref="GeneID:11513693"
     CDS             complement(962383..963954)
                     /locus_tag="MYCTH_2310013"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665868.1"
                     /db_xref="GeneID:11513693"
                     /db_xref="JGIDB:Spoth2_2310013"
                     /translation="MFMPTGAERNFAVLRDQPAAIPQPSAEPVWPSERTYEKTLGREA
                     SEKTKLWRSASRESSARRNLFSRTLSPSVRRLQISGPTDFRHLHSESFQFPPPPQESR
                     PRPSSFRPIELSIYRQENRLSAILPHIECNITPPPRAYTGNSSNWEDNSGSSTTLTQE
                     ATLAHERSHSAMSFHLPRKYSRQISEASMSPPRIPPKSRARAATAPNTERIVERIASA
                     MIEKERLQAEINSLVERQSLYLNSRPSTGYDVRGLEPMPSIPALPAAGRSFAERLSTD
                     DRPRTAPSYSHSMAPHEKTPELTASAQSSPPQRHDRVTTRNRYGSPSTSSDGRVITAD
                     FPLAPPLPLVLRPPLRKKKSFSRVSNWLFNPDDAAASPTVAAAGHATTSPRPVKESDG
                     FYQCVAPPEGLPRTSMDTSSSVYTWETGGNSDGNSNGDGDGAKTLPTATTATTWSPDQ
                     TPKQGWSSSTRHTTPVLGGSERAGLGFDKETGVPSGVGGGAGVAVDGEEGNGLGVDDG
                     TNANGHRPLSVGVAF"
     gene            965770..967731
                     /locus_tag="MYCTH_2310016"
                     /db_xref="GeneID:11513694"
     mRNA            join(965770..966205,966262..966542,966613..967173,
                     967245..967731)
                     /locus_tag="MYCTH_2310016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665821.1"
                     /db_xref="GeneID:11513694"
     CDS             join(966046..966205,966262..966542,966613..967173,
                     967245..967460)
                     /locus_tag="MYCTH_2310016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665869.1"
                     /db_xref="GeneID:11513694"
                     /db_xref="InterPro:IPR004728"
                     /db_xref="JGIDB:Spoth2_2310016"
                     /translation="MQAPPPPQGPQGPHGPQGGQMPPMMPSPEQIAAMQRQLAIDAEK
                     MGMTVPQFIEHLKRQAQERMHAQQQQQQQQQAQQGGGHQHEHQHPHQHPHPHQHQHQD
                     TSGQPRPIVPGPPNPVALALAKFLRSQNLKPRTCILNGERKDMFRVKRALRALQSDAY
                     KAARKKNPALPEITDRASLENAFKLLPLSMLALRVVKADPHDGHDHAKKQGGKRIKGL
                     WTVRIEPQQDAGDDMYYVWLWEGSQVMRKVYAGLALAVIFALVCYPLWPVKLRQGGYY
                     LSWGFLCFMGLFFAMAIFRVILFCLTYFILPPGLWLFPNLWEDVSVVDSFKPVWAWHE
                     PASKKKKKKKSKKSERSASGSAAAGATFSATTGQPAPATATTTATSTQVSTAPQQRSN
                     YMAPRVEELEDDE"
     gene            complement(<968883..>970447)
                     /locus_tag="MYCTH_97150"
                     /db_xref="GeneID:11513695"
     mRNA            complement(join(<968883..969657,969743..970308,
                     970397..>970447))
                     /locus_tag="MYCTH_97150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665822.1"
                     /db_xref="GeneID:11513695"
     CDS             complement(join(968883..969657,969743..970308,
                     970397..970447))
                     /locus_tag="MYCTH_97150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665870.1"
                     /db_xref="GeneID:11513695"
                     /db_xref="JGIDB:Spoth2_97150"
                     /translation="MSDHLHRGLFASVLGELIVLNQSSCHPNLPGYEGQGLCCNRPWA
                     YQDVGSETGSPRLTAGSILECHEYSHDLPLDRSNSLARAILREWRETVAYLASHIAPG
                     RLELSLVCDLHRGEVELARLVVDGLCTLPRLRDCHLRLCEPRDSRLQQLAYEAVLKVR
                     ALGSVKHHRSSERTGSGPLALPRELLRLRILEYYTDLVTPDKEVLCAGKSVHFSPAGN
                     DHRLTRPVAASAAAGTRRFHLVAPPTPFFLACRALYEDANLVFYNQNRFIIVDNPLDD
                     PFASRERGDYKRVLCGQPVLEASRAPSLSRIPPTPRAGVCPFYSVSRPWDGHPALQDW
                     DDTVEWVKDKLNLPALILRLVVAGHPWHGPENSYKITRADGKEVLATYNHMLHPLQRL
                     NPATGQGLARSYAHLPWSLTWSHWAHEQQLNGRSSDWLESKDRELKKRAECIAEAECV
                     IRSGARNRLVARS"
     gene            complement(972121..>975631)
                     /locus_tag="MYCTH_2096092"
                     /db_xref="GeneID:11513696"
     mRNA            complement(join(972121..973283,973341..973731,
                     973780..973882,973931..974167,974218..974317,
                     974450..974569,974700..974983,975080..975223,
                     975306..975345,975412..>975631))
                     /locus_tag="MYCTH_2096092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665823.1"
                     /db_xref="GeneID:11513696"
     CDS             complement(join(972385..973283,973341..973731,
                     973780..973882,973931..974167,974218..974317,
                     974450..974569,974700..974983,975080..975223,
                     975306..975345,975412..975631))
                     /locus_tag="MYCTH_2096092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665871.1"
                     /db_xref="GeneID:11513696"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="JGIDB:Spoth2_2096092"
                     /translation="MDIHSMLRKAKHGLEELLPGDEKHSHTHDGDIDDAHAEQSGNRY
                     SSFAPQSSGHAKWYVDGASYFWAVSMALEEAREYIYILDWWLSPELYLRRPPARNERY
                     RLDNMLKAAAERGVQIFVIVYKEVPQALTCKWASQHTKHALEALHPNIKVFRYPDHHH
                     SGNDIVNGLQELHSNLQNFSLKTFNLAKASQEAVEALYGVADDITLYFSHHEKLCLID
                     GKVAFMGGLDLCHPIADAHPGNVEELVYPGQDYNNARIYDFEDVDKWENNKLDRTKSS
                     RMGWSDISISLSGPIVDSLAMHFTQRWNFIFNKKYSTRDIGKYWLLEAPHTHHGAASH
                     YGGDFESHFDDLQQRFTRHVRRFVGTDEETHHASQVKSESAHIQLTRSCSKWSLGVDT
                     EHSIANAYIEAIKNAKHFVYIENQFFITATSDEQKPVCNKIGRAIVDRILRAHQNGED
                     FHIIIVIPAVPAFAGDLKSDGALGTRAIMEFQYFSINRGGSSILETLRNSGVQDPHRY
                     INFYNLRNYDRINSSAIMGRAERESGVRYEEARREYDEHSRDDYGQGSHGDSRYRRYQ
                     EAARHMSDETWDSVAACYMHNGPDLRSVPWTGSPEDEFNAFVSEELYVHSKVLIADDQ
                     LVICGSANLNDRSQLGNHDSEIAVVIEDPTPVSSTMGGRPYTASAFAASLRRQLFRKH
                     LGLLPHQRPDAADRNWTPVTHHAVNDYDWGSAADKLVQDPLSWEFRDLWRTTARRNTE
                     IFSRAFHPVPDDKMRTWDDYNDFFSRYFVIPGESADKAEEGYRQGKVDYGHAVREEFP
                     GGVEELKEWLAGVRGTLVEMPLQFLIDVDDLAEDGLMLNTLTDELYT"
     gene            <978048..>978772
                     /locus_tag="MYCTH_2112674"
                     /db_xref="GeneID:11513697"
     mRNA            join(<978048..978461,978617..>978772)
                     /locus_tag="MYCTH_2112674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665824.1"
                     /db_xref="GeneID:11513697"
     CDS             join(978048..978461,978617..978772)
                     /locus_tag="MYCTH_2112674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665872.1"
                     /db_xref="GeneID:11513697"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Spoth2_2112674"
                     /translation="MASPSMTYVFSQEQHGHLIPYIAALHASCITLDHMVGPFLPPLT
                     NEKLLPWWKERIAEAVGGTRVIVLLLPEATLGKKPLGTDLRGLAMLKLSESETGSFRG
                     HIDAVLVDRRHRRQGGAKALVAALEYEAAKRGRSLLLVDAETDSVAELVFKKLGYIEI
                     GKVPHFSRALSNGKKGETFFYKEFLPSST"
     gene            complement(980289..982901)
                     /locus_tag="MYCTH_2310028"
                     /db_xref="GeneID:11513698"
     mRNA            complement(join(980289..980820,980885..982496,
                     982549..982901))
                     /locus_tag="MYCTH_2310028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665825.1"
                     /db_xref="GeneID:11513698"
     CDS             complement(join(980482..980820,980885..982496,
                     982549..982751))
                     /locus_tag="MYCTH_2310028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665873.1"
                     /db_xref="GeneID:11513698"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_2310028"
                     /translation="MRVFDVTFLFGVAALVVAQSPTVDDDEEPPKETTYFNGKEVPPM
                     LELTPSNWDKELKASKYLMVKHYSPYCPHCIDYAPTFQTLYEFYYTSSPAGNAPKDAS
                     FTDFYDFRFADVNCVAYNDLCTKNKVSSWPTTILYEDGEPIVTFKGVKAMKVLSSAIE
                     DALEKAKPGTRPSAIELPEPGAKSYPPSNDAAVDKPDPEGKRTPANPKDQPDKGAAPA
                     STSLASEPATPESTSPKYLVVPFDPPPQVVVKPTTTPNPNGESVPLTAETFQNLVTTT
                     HDPWFIKFYAPWCHHCLKVKPTWDELAKEVKGRLNIGEVNCDAESRLCKDVGVRGYPT
                     FLFFRSGEHVEYQGLRGLGDLIQFAEQAIELASGVQDVDADSFKALEEKEKVIFLYFY
                     DHAATSEDFIALERLPLNLIGRAKLVKTRDVRLYERFKITTWPRLLVSREGRPTYYPP
                     LTPRDMRETHLLMNWIRSVWLPLVPELTASNAREIMDGKIVVLGILNRENDESFQSAL
                     REMKSAANEWMDKQIQLFQLERQELRDAKQLRIEEAEDRGDERAARNAKNIRINMDRS
                     DRKEVTFAWVDGVFWQRWIRTTYGIDVKDGERVIINDEDNRRYWDQTSTGNPIVPSRT
                     SILETINKVTANPAKIKPKLTIGFFEKLIFDVKTSFKEHPFLSSGCVLGIAFGCLSWL
                     RGGIRRLRAGHFKLDDAPSNRAPLLGLSSDGSKVD"
     gene            983434..985858
                     /locus_tag="MYCTH_2310031"
                     /db_xref="GeneID:11513699"
     mRNA            join(983434..983923,984037..985858)
                     /locus_tag="MYCTH_2310031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665826.1"
                     /db_xref="GeneID:11513699"
     CDS             join(983480..983923,984037..985314)
                     /locus_tag="MYCTH_2310031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665874.1"
                     /db_xref="GeneID:11513699"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="JGIDB:Spoth2_2310031"
                     /translation="MSRPYKRPALADGDGDGDGDGDGDGEPSRKYTPVSLTHPVSPPL
                     KKRRRAQSLEETEPARSPSASRRVFDSPFRLTKIRDLPREMNKDTITLKDILGDPLIA
                     ECWEFNYLHDIDFLMAAFDPDVRHLVKVHVVHGFWKREDPNGLELQEAASRFQNVTLH
                     SAFMPEMYGTHHSKMMILLRRDDTAQIVIHTANMIIRDWTNMTQAVWLSPRLPLMEPS
                     RCDARPEEVAAGSGAKFKIDFLNYLRAYDTRRTTCRPIIDQLSKYDFSAIRGSLIASV
                     PGRHKLDDTSPTRWGWAAMEQALKSVPVSSRRSDIAIQISSIATLGPTDTWLKSTFFR
                     SLSGGRPGGTLQQPPNFQVIFPTPDEIRKSLDGYSSGASIHTKVQSPQQVKQLAYLRP
                     MLYHWANDSANGADPQEGGGGGERRREDYENDGGDDEGDSAVVVKEAGRKRAAPHIKT
                     YIRYGDKSGPSIDWALVTSANLSKQAWGEAAVRGADGGATMRIASYEIGVLVWPGLYG
                     EGAIMRGTFLTDSLGTEEVKEGTTAVALRMPYNLPLQPYGKGEVPWVATANYSEPDWK
                     GQIWRHG"
     gene            987289..988963
                     /locus_tag="MYCTH_2310035"
                     /db_xref="GeneID:11513700"
     mRNA            join(987289..987689,987765..988963)
                     /locus_tag="MYCTH_2310035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665827.1"
                     /db_xref="GeneID:11513700"
     CDS             join(987582..987689,987765..988784)
                     /locus_tag="MYCTH_2310035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665875.1"
                     /db_xref="GeneID:11513700"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2310035"
                     /translation="MSKTVLILGGSFAGLHVAHALLKKSIRDVKVILVSKSTHFYWNL
                     ASVRAIIPGQIEDDDIFKPLEDALARYPAESWELVIGSATHADFDSKTVDIAVGDGTA
                     RTISYDQLVLATGARTHPDAPWKATGSYEQALATLHATSAKVKDAQHIVVAGAGGTGI
                     EVAGELGYEYGKTKEIVLLCAGDKLANGHGIAEAAANELRKLDVTIRYDARAAEVRPS
                     GNGTGKTDVVLAGGETITTDLYLPTTGQVPNTEYIPARFLSTDQRSATVLVDEYLRVS
                     GARDVWACGDVVSQPRAGFFITQKQAASVARNVEAALAGLKPTVAKGPPVDIFACAVG
                     RGRGVGRVNNSIRMPSLVVWLAKGRNLGIPMLKGYIDGSVA"
     gene            complement(988939..990619)
                     /locus_tag="MYCTH_2310036"
                     /db_xref="GeneID:11513701"
     mRNA            complement(join(988939..989800,989870..990619))
                     /locus_tag="MYCTH_2310036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665828.1"
                     /db_xref="GeneID:11513701"
     CDS             complement(join(989073..989800,989870..990341))
                     /locus_tag="MYCTH_2310036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665876.1"
                     /db_xref="GeneID:11513701"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2310036"
                     /translation="MAPRIEAQEIETYWNIFSARTNGGKYLTGEQAAPVLKNSGLRDD
                     QLERVWDLADVDNDGNLDFEEFCVAMRLIFDLLNGEYTDVPTSLPDWLVPESKAHLVQ
                     ASRAITGKAAQFERVEDDDESQGLKDGFDWYMSPADKAKYEQIYQECRDMRGEVSFSA
                     LQDLYDSLDVPDTDIRSAWNLINPSASSTINKDACLAFLHILNNRHEGYRIPRTVPAS
                     LRASFERNQIDYQVGSARNAAQSRWATKADDETSTGRKAKFGDQYLTRLGRSGFKTAG
                     TDFSNAQTDAEWEEVRLKKQLAELDEKIAKVEAAAERRKGGKRDSKPALVKRELEQLL
                     DYKRKQLRDLEEGKATNRPGGNLKSVHDDLQTVREQVEGLEAHLRSRQEVLEQLRREI
                     EDEKAGR"
     gene            complement(<991375..>995441)
                     /locus_tag="MYCTH_2112679"
                     /db_xref="GeneID:11513702"
     mRNA            complement(join(<991375..992614,993012..993126,
                     993201..993785,993894..994767,994827..>995441))
                     /locus_tag="MYCTH_2112679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665829.1"
                     /db_xref="GeneID:11513702"
     CDS             complement(join(991375..992614,993012..993126,
                     993201..993785,993894..994767,994827..995441))
                     /locus_tag="MYCTH_2112679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665877.1"
                     /db_xref="GeneID:11513702"
                     /db_xref="JGIDB:Spoth2_2112679"
                     /translation="MSGMRLRDSSRLRIPGRYQEDLGPSRADRPLFVHPDVPFNPDLV
                     QYCAHPSLPLDYPGMGPSEAVKARLEALAAEEAQSGNDAEQSGAGEEVPVVATCDQVT
                     QDGTSESSSECSRGHRDRRGQRRHAPSNLNNMFAGLTISEPASRSTAPMPAEPTVTAT
                     TTTTTTTTTNNNNNKKMAPFARPARVANVPWRKPGQKLAENSKKRKKHGSQDRPNWAD
                     LPDGIRYAIIHDLTRTAPLSQVVQALDLGHVEVSSLLGLISEESRKKKKFAELLLQHG
                     DDAGIPSAEELAALCPVTEGITAEEVRCGRAFLRFLGLDGVAAGLGFWEGTGADFHDV
                     QVDEGCWALVDGFDLPDGGDGERRSLRRLRNLKGAELLLRLDPPTKTLNPQRLKSGSG
                     GPSARAARSGPIRVPPSEGLHPLNYTVAGKSGRRYSTLDKSDWPAWEALRDTGMVPEA
                     GLVVMTANSLVPDEVAFLSSEDLETISVAQPAEMFGSLPADDSHVFAGQEPDPYPRAP
                     GNGHHNPFDDDYDLEVFVDSPVKQNEAVTEQQPQHRAESTSTQTALEEQATRDPATPE
                     DRDHEMENVSTQPFNLQAPAASHQLFPAGQTGPFDMDAATLALNQFLIAPRLAVRQLD
                     PELASSAAEVIARVSSAKPRVRFEDEALTDSTLSRQHSQAVDMGDSPTFDELEDLLEG
                     ADIVSPKTKLWGEATQSKNARSESGWSREFWARSLWHYNIRHKEACSRQLPSATSSSR
                     TKLAPQAEKNPRSRTSSGDGDEGEGAKEHSKLVKRRAYKPEPDENGQPIKRIRRKPTP
                     ELDENGQPKKRPRGRRPGSRTGTGKDPGQSAPRRPGFTCEGDRLLRSTEGKIMTRAEL
                     EEAYPHDQRIYRSGGNLGGGKFEIIATGVFWSFVPEDEQQAAAEEHKRRREKKANQDE
                     GMNDGTGVNAPTAASSNNNGKNAALTRTVAHSSLTSPESSTPPQPGLSTPVGKPKQTK
                     LRIFRRNAPAHITLQASASAPPATATTVPKTPTTVPAPAGISAAPAATAHAGTTAAPA
                     PAPAHVPRPLAPRPPRNTTPGGPSAQRPVVPGPALAPAAMDPRRAARVRELNERCARY
                     HVATRDRFDSDDAFLAHAESMLPLLYPDLGGSRAGSAGGGPPPPPALGSSRSFI"
     gene            complement(<1009078..>1009293)
                     /locus_tag="MYCTH_2069453"
                     /db_xref="GeneID:11513703"
     mRNA            complement(<1009078..>1009293)
                     /locus_tag="MYCTH_2069453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665830.1"
                     /db_xref="GeneID:11513703"
     CDS             complement(1009078..>1009293)
                     /locus_tag="MYCTH_2069453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665878.1"
                     /db_xref="GeneID:11513703"
                     /db_xref="JGIDB:Spoth2_2069453"
                     /translation="YLDNILIFSKTIDKYRKYIKAVLDVLYTYKLLVNREKSEFYMRK
                     TVFLGYEISLGQIRIELSKVKAIKNWL"
     gene            <1035680..>1036486
                     /locus_tag="MYCTH_90296"
                     /db_xref="GeneID:11513704"
     mRNA            join(<1035680..1035842,1035883..1036007,1036064..>1036486)
                     /locus_tag="MYCTH_90296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665831.1"
                     /db_xref="GeneID:11513704"
     CDS             join(1035680..1035842,1035883..1036007,1036064..1036486)
                     /locus_tag="MYCTH_90296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665879.1"
                     /db_xref="GeneID:11513704"
                     /db_xref="JGIDB:Spoth2_90296"
                     /translation="MRELRRIVETIKGEQPVTYDRPDSYAEHFDDQQLSHDVRNPEYQ
                     FMRANRGKDEPLEYLRSTYNGKDSGKNSNTSRATPRDCTLDMRHIRKCPGSSPTRQEN
                     GDGGLCPVEWVYDAGNRAAELLWKIEARDLESITIVPRRAWPRHCGTGRDTWDSCWSN
                     DCLYHADEKKLRIRELQMKLWHVRRKAERTQWWEAASTQWLTEMSTIDEAAISRTTGE
                     VSTDLGNGSGPFEGPGNH"
     gene            complement(<1086272..1087420)
                     /locus_tag="MYCTH_74816"
                     /db_xref="GeneID:11513705"
     mRNA            complement(join(<1086272..1087294,1087344..1087420))
                     /locus_tag="MYCTH_74816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665832.1"
                     /db_xref="GeneID:11513705"
     CDS             complement(join(<1086272..1087294,1087344..1087367))
                     /locus_tag="MYCTH_74816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665880.1"
                     /db_xref="GeneID:11513705"
                     /db_xref="JGIDB:Spoth2_74816"
                     /translation="MESSPLIKAHDHARAAAIATQTSDTTVAINEHAQAAGEFANASK
                     ITSSHEALRTLKLLEQHHKRLSELLKFPTAPPRQASSDEMAEDDEKDDEKEGLAVNES
                     KTPSPSPRNEPPPAKKTSPAKPPPTLSHQRYPGRNLSSSIASNLASARGIRASYSTKP
                     LTPSVSNDQAPGSLEVHPRREGSTRSRTTDQPEQAHKPSWVPPVIQEDAVSEPPKSES
                     SKSEPSKPAPSEDGFSRFYSTFGSLINRLSAPLAFAGLPLISEEPAPTPAAPPSEVPQ
                     KKSRQRHSASSAEPDLSKIYSRATLRSLERDGHGATDSSFYVVPTSGHTASYASILNH
                     DSKEKRRIAASLHHT"
     gene            1087752..1092259
                     /locus_tag="MYCTH_2310059"
                     /db_xref="GeneID:11513706"
     mRNA            join(1087752..1088318,1088770..1091261,1091323..1092259)
                     /locus_tag="MYCTH_2310059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665833.1"
                     /db_xref="GeneID:11513706"
     CDS             join(1088047..1088318,1088770..1091261,1091323..1091984)
                     /locus_tag="MYCTH_2310059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665881.1"
                     /db_xref="GeneID:11513706"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="JGIDB:Spoth2_2310059"
                     /translation="MESQSNGLTKLLPKSIAAKRRRKKSTSPGEVVSVDDDVEPQRGD
                     IDASRSIPGSGSGSGSGTPSLTSLKGSLNSTSNDNTTPAVDDPDPESINQRPTAISAH
                     PSQIGYLPTSSPLVQATHDPEPLDPEETHREPARSFTLSQDSSESGVQSAPTLDRGRT
                     TLEPPELRTKRSSSTSRLRDVFKPKKSSGEAKSASGQDKRQASPAPAQEAEPKSSVDR
                     SRRFSRGQQLEPLTVPPRTPPQDGAAPLIVNTPPTPTDTQPAIPTTTAGPTRPADAVL
                     KGESMITQRRRAGSNAGPSKLSNVVAPPLTPTPESGPVTPGNPNSAANFFSSMFSAVQ
                     NTASSLSTTIPSLGQGAPKNKGTPVKGQATEKESDTVAVESAASQRPSSEPKEPAIKT
                     LGMGDLSLSHLGIAETPSAAPSPITGRFAETETRARSESAPADPHGIGSDLPEDSKDV
                     NGPRPHSIQDAAAAAAANGERTIPAGSVYEDKSGVRRSGSIRSAIGHGRNRGSSIATH
                     HTAATGPIGAAIAAANSSLVNPGVGAPKLTGFAVANKKRNRDFHMLFKSVPDDDYLIE
                     DYSCALQREILAHGRLYISEGHLCFSSNILGWVTTLVMSFDEIVSVEKRSTALVFKNG
                     LEISTLHAKHIFASFASRDTTYDLIIKIWKLGHPHLQSSLNGVRLEEPGGDRTEKVDV
                     ESVSATGSHSISGSDGEESDDEEDVYDEDEDEEDSQAAGPPSDGPAVPESTDKAIPRK
                     ASGGLASPEKQDDGAQAGTPDFPGPATHAPTDCGDAATHFEKVLGDDVIPAPLGKVYT
                     MLFGPASAAWMGRWLTTDQKCTDLQMEDKRGLTEEVRTRNYTYIKPLNASLGPKQTKC
                     IVTERLEHIDLEKAVSVLVTTQNPDVPQGNTFTVKTKYCLSWAENNGTRVQINNVIEW
                     TRTSWLKGAIERGANEGQAQYCKDLFAALKAAVASRPRAGTLNGAAGARGKKRSRKSK
                     SALASSPTGDTEGAATVSAEQSWGIFEPARPILNSVVDAIRPILTGNIVYGLLVGLLV
                     ASWFGFGTRQVAPRYTLDPAFANAPQRLAAYEEMWRREESDLWQWIEERAGLERLGAD
                     PPLRKRSVDPRTVEEKLREERMDERELREAIRVTEEHLEVLKSVVNRKGTEGR"
     gene            complement(1092347..1096293)
                     /locus_tag="MYCTH_2310062"
                     /db_xref="GeneID:11513707"
     mRNA            complement(join(1092347..1093663,1093738..1096293))
                     /locus_tag="MYCTH_2310062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665834.1"
                     /db_xref="GeneID:11513707"
     CDS             complement(join(1092760..1093663,1093738..1095941))
                     /locus_tag="MYCTH_2310062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665882.1"
                     /db_xref="GeneID:11513707"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Spoth2_2310062"
                     /translation="MTLSGDKSVPSDKQLESVQTIPLRSLDRGPALARGPTPQLAPTL
                     ATPPLHIDDTSDTTTSLLPPHDDRAELQYRDPHGRGPESTAATADQTETDTDSPSRHH
                     HRHPAPDSMTKDLPPLRSAAGFSSPSYGSITPRPSNDSGDEAANSLSVRSRKPSDASG
                     HSPGEPGVRRRRGGSQPRSPTSRRASRQSEELGGSTTIHGLEGRFGATERALLNDLAK
                     EPEGEEDDEQRSYVLDSDLDEDEDDPPDNSPYAQVRASVSPTDNTSLSISTPRMWVLS
                     ILFSILGSSTNLFFSLRYPSVAITPVIALLMVHPLGLLWDYLLKRPDDPPEEYVDGFR
                     SDQASVSSADEGAHFIPPEGRGRLDRLRLWLAQGRWNEKEHSCVYVSSNVSFGFAFAT
                     DVIVEQTQFYKQEASIVYQLLLTLSTQILGYAFAGLTRRFLVRPSGMIWPGTLMSAAM
                     FTTLHKEENKEANGWRISRWNFFYAVWLGAVLFYFLPGLLMPALSYFNVITWFAPDNV
                     VVANLFGVVSGLGLFPVTFDWAQVAYIGSPLLTPFWAAMNVVGGLVLVMWIVAPIAYY
                     SNWLYSSYMPILSVAVFDNTGNEYDVSKVLTKDFMFDREAYSKYSRVFLPITYVLSYG
                     VQFAGLASLLTHTICWHGKDIWKQWKRSLEETSGEQKGSYQPVSEPGEGFSTRGANGR
                     HQRANRSSLSIDNLMSREDVHNRLMRRYKDAPMLWYFLTFVSMTAIGIFVVEYYPIHL
                     PWYGLLLALGICTILFIPIGIIMAVTNQHSSIYLICQLIAGILFPGRPVANMVFVTYG
                     YISSAQGIKFAADLKLGHYMKIPPRILFTVQIVATIISSLTQIAVLNWMFVNVPGLCT
                     PQAINGFTCPIARVHFNGSILWGVVGPGEFFGPSATYRPLVWAFAVGAVLPIPLWLYA
                     RNRKDSFVRKINLPVLFGSLGWIPPATGLNFSVWAVVCYLFNHLIKKRAPAWWAKYTM
                     TLSAALDSGLAFGIVVVFFGFVYSGAMKGFSWWGTEVYKRGCDWRACAWKTVPEGGRF
                     GPEVW"
     gene            1096791..1098102
                     /locus_tag="MYCTH_2310064"
                     /db_xref="GeneID:11513708"
     mRNA            join(1096791..1097050,1097101..1098102)
                     /locus_tag="MYCTH_2310064"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665835.1"
                     /db_xref="GeneID:11513708"
     CDS             join(1096960..1097050,1097101..1097747)
                     /locus_tag="MYCTH_2310064"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665883.1"
                     /db_xref="GeneID:11513708"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="JGIDB:Spoth2_2310064"
                     /translation="MASLNVAKQHLRNVMKQKLKNIPQHSIASQSSTVYSTLKSLSAY
                     ANAKRVSVFLSMPTGEIQTDAIVRDALSAGKEVFIPYLHENMVEAPGLPARVMDMVHL
                     RDLADYESLKPDKWGIPSIDPDTVAERQRVFGGPDAQHSDSTLLDLILMPGVAFDTDP
                     DSGAIRRLGHGKGFYDYFLFRHGLKAGSLGQQESPVLLLGLALSEQFLSPSEGAVPVG
                     PLDQPLDGLVLGNGEIKGPLAPANKTD"
     gene            complement(1098104..1098494)
                     /locus_tag="MYCTH_2310069"
                     /db_xref="GeneID:11513709"
     mRNA            complement(1098104..1098494)
                     /locus_tag="MYCTH_2310069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665836.1"
                     /db_xref="GeneID:11513709"
     CDS             complement(1098191..1098370)
                     /locus_tag="MYCTH_2310069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665884.1"
                     /db_xref="GeneID:11513709"
                     /db_xref="JGIDB:Spoth2_2310069"
                     /translation="MTGRGAGGGRRVLLPPINFLFRLLQQRTTVQIWLYEQLSIRIIG
                     TIRVGNPATVVICRC"
     gene            1098625..1102333
                     /locus_tag="MYCTH_2310072"
                     /db_xref="GeneID:11513710"
     mRNA            join(1098625..1099114,1099184..1099273,1099354..1099635,
                     1099735..1099825,1099887..1101173,1101224..1102333)
                     /locus_tag="MYCTH_2310072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665837.1"
                     /db_xref="GeneID:11513710"
     CDS             join(1098986..1099114,1099184..1099273,1099354..1099635,
                     1099735..1099825,1099887..1101173,1101224..1102263)
                     /locus_tag="MYCTH_2310072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665885.1"
                     /db_xref="GeneID:11513710"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="JGIDB:Spoth2_2310072"
                     /translation="MASNGSQEAFTVPNVLAAMLAMRSGDTEKKKAAVEYLGRYQKSN
                     DAWTTTISILQNSTEAEAQLFAATTLKGKITYDLGTQVSEADLPALRSQILLLLKKYA
                     PGPKPVRVQLCVCLAILAIQMQTWKDVLPTVVSTLGNEVESHACILDFLRVLPEEVTE
                     GRKITLSEEDLAQRTSELLSDNAEQVVQLLVNYAQSSPAAATNPQLFDCISSWLREVP
                     VSVIVNSPLMNAVLHGITDDKSLLAAADCLGIICRETKDVDDNFDTIQALLPKVLELR
                     PRIQALVDEEDIEGFKAITKVFADAGESWVLVIARQPQHFRPLVECLLECCARDKERD
                     VIGYTFSFWYELKQYLTLDHYMEARVQLIDVYARLVDIMLKQLEYPYSDDPNELDLFD
                     GDREQEEKFREFRHHMGDTLKDSCEVMGVAACLTKVHDAIKLWQEKYGSQATPTSVPH
                     WQSLEAPLFAMRAMGRMVESHDSSVLPQIFPLLVQIPISNEKLRFAAIMVFGRYTEWT
                     AAHPEFLEPQFQYIVSSFQTDSQEILRAAAQAFMYFCVDCKQLLSSQVVQLQAFYDQI
                     LDKLPVSSKEEITEGVAYVVGAQKTEDVYKLLKLYCDPLVQRLMAKANAATENKAKLD
                     LADHINLLTFFVQHVVPYLPSNAENPAVKYWQEVFPILSTILDNFIDFVPICERVCRC
                     WRFMVISYRTAITPLLGPLANKLAEGFTQSKQGCFLWATSAILREFSEDREQVEDGIA
                     ENIYVFFEAQATSVLRTMSDLPPVDLPDVIEDFYRLLIDALLYYPTKLIPSPLFTPIF
                     QAAISALALEKQEPVSAALHYIRDLLTYGGTNPAGSGSDLGPASEQLRQIVKNLLLAQ
                     GEALVKQTLAGMMITFPRDCFADGSGVLLGMFELLPAETTTWVDRTVRMLPQGTITPA
                     EADRLLARIRERLQGGDPANLRQIRVLLQDFTNTYRRRYVAPRDGLGQLEAARFHFSG
                     "
     gene            1103410..1105692
                     /locus_tag="MYCTH_2310074"
                     /db_xref="GeneID:11513711"
     mRNA            1103410..1105692
                     /locus_tag="MYCTH_2310074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665838.1"
                     /db_xref="GeneID:11513711"
     CDS             1103579..1105672
                     /locus_tag="MYCTH_2310074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665886.1"
                     /db_xref="GeneID:11513711"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="JGIDB:Spoth2_2310074"
                     /translation="MSDAVYDLSATPAEGQRIKHNNVVYTTVKEGLAHILIPEDSAKP
                     GQSVQEVFYNPIQQFNRDLTVLAMKAYGKERIAQKQAASRARAGKHADKKRKRRGEQA
                     QGEQAEGERPAKSPKLSGEEATESTEDAAPPDAEMQDVAAERAPEDAAGAEQQQPGDV
                     AAGETEANAPANSGGNEAKREPKIPFTILDALSASGLRALRYAREIPFATSVTANDIL
                     KTAAEAIERNAVHNGLRDKINISVDDAMAHMYSIVVKELRRTSLSKNKPGPSEKYDII
                     DLDPYGSAAPFLDAAVQAVRDDGGLLCVTCTDSGVWASNGYPEKCYSLYGGIPVKGWY
                     SHEVGIRLILHAIETAAAKYGLAMEPLLSLSVDFYCRVFVRIKKAPFLVKFQGGKNMV
                     VYSCGTGCGSWTTQLLMKNKPAPNKKGDGIFYKHGFTRAPTTGTWCEHCGSTMHLAGP
                     MYAGRIHSPEFIKTVIAEAEEAPPEIYGTKERIRGVLQTALEEFLPSPEEMEAEADEG
                     GDGTQNKPKKNLAEAKAAAIDPYPFYFHPAHVSGILHCSSPSEPALRGALIRLGYRVT
                     RSHCKAGSMKTDAPWSVIWHVFREWIRQKAPVKEENIKPGSVAYRLLRLEKKAAGGEA
                     AHETEDGSQESKTAEASEAPNSGETSAEKGTDVTKQEVVFDEQLGRYQDKKKYVRYQM
                     NPRENWGPMNRAKGK"
     gene            1106119..1107950
                     /locus_tag="MYCTH_2310076"
                     /db_xref="GeneID:11513712"
     mRNA            1106119..1107950
                     /locus_tag="MYCTH_2310076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665839.1"
                     /db_xref="GeneID:11513712"
     CDS             1106214..1107881
                     /locus_tag="MYCTH_2310076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665887.1"
                     /db_xref="GeneID:11513712"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="JGIDB:Spoth2_2310076"
                     /translation="MTVQDTSGDSSVQRPAASGTPENDKIHPAISTESQDGESRKNAL
                     AGIKREEIIFVLPGKGDKQGSYLIFSLSEDPTANGDKPFVLNIVQCKQHELADDLSGF
                     VLSQDSSPPTHLSSPRELHVVVSTGSGLRRAETFYQEVLCPLLDAVGLQPSESEDARG
                     YRVTVTKNSSTIREFARELGADAGAGGKTVVLLSGDGGVVDLLNGLDHASHPPRTPTI
                     ALLPLGTGNALFHSLHKPHYSTGAENPGGPSPLVVGLRTLFKTTTTAAPLPTFKASFS
                     PGATLISGPDFEEAATAAENPPAASNTGNDGDGEQQQHHHHHHHHRHHHPAVTHLVGA
                     IVASYGFHASLVWESDTPAYRVHGDKRFGMAAGELLKVGHAYDARVEVRRRRRRQQQQ
                     QQQRDAVHGGGGDGGEDDGFSVLVVPRGEDGGDGGGRRGGGRGRGKFNYVLATLVSNL
                     EKTFTISPAGRPLDGRLRLVYFGDVGGDKTMQIMMAAYRDGAHVAMPEVGYEEVEEVR
                     VTVDEDDPRWRKVCIDGSIVELEKGGWMRVEREEGTRLKVLVDAGTD"
     gene            complement(1107880..>1110543)
                     /locus_tag="MYCTH_74803"
                     /db_xref="GeneID:11513713"
     mRNA            complement(join(1107880..1108903,1109099..1109641,
                     1109707..1109899,1109953..1110162,1110450..>1110543))
                     /locus_tag="MYCTH_74803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665840.1"
                     /db_xref="GeneID:11513713"
     CDS             complement(join(1108003..1108903,1109099..1109641,
                     1109707..1109899,1109953..1110162,1110450..1110543))
                     /locus_tag="MYCTH_74803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665888.1"
                     /db_xref="GeneID:11513713"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_74803"
                     /translation="MTSISAESVSTILVSCKQTRFHIESPNYREVALLRAIADKLIPG
                     IPEETRVSILQQTSISDASAEDLLPPEAQRSSKEGLTVLEDVINKATSRSELEQEISL
                     LSAGVNSADAYGALRALRKLRHQRMQKRLFVLDKDARLRSGARGLQARKALVEHEKAV
                     AQSAALNEQPADEISAETLQAETQEAVDMLADLQLQVGPSRMAGIESRAKKILSGLGF
                     TDAYMAKQADSLSGGWRMRSALATALLQESDILILDEPTNFLDLLGIIWLQRFLQSLE
                     DLPTPPTLILVSHDRDFTSSVCTDLLILKDKNLTYFHGDLPTYEAAQAEKKQYLTRMK
                     EAQDKQRAHMQESRGVSIILPDPPDLRFPGALLSLEKVTFRYPPAKGGGGATTTTSAA
                     NPAPPTLQDVTLAVGEGDRVGILGLNGAGKSTLIRVLVGDPAPAGARQTGAVTTHPRL
                     RMSYYSQHAVEGLQSLGRAEPSLTALALLAREAGGALDEGELRGLLGSLGLPGRTASD
                     VPLRKLSGGQLVRCELTRLLWSRPGLLVLDEVTTHLDYETVAALRAALRGWKGAVVLV
                     SHDRWFMRGVVEGAVDDEERRSDAEKEQDGDGDDDEDEGGNLRRRVVYKLAAGKLTVL
                     ERGVDEFEEGMERRVKKLMGGG"
     gene            complement(<1110983..>1113186)
                     /locus_tag="MYCTH_98222"
                     /db_xref="GeneID:11513714"
     mRNA            complement(join(<1110983..1111067,1111377..1112043,
                     1112143..1112388,1112442..1113011,1113072..>1113186))
                     /locus_tag="MYCTH_98222"
                     /product="sugar transporter-like protein"
                     /transcript_id="XM_003665841.1"
                     /db_xref="GeneID:11513714"
     CDS             complement(join(1110983..1111067,1111377..1112043,
                     1112143..1112388,1112442..1113011,1113072..1113186))
                     /locus_tag="MYCTH_98222"
                     /codon_start=1
                     /product="sugar transporter-like protein"
                     /protein_id="XP_003665889.1"
                     /db_xref="GeneID:11513714"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_98222"
                     /translation="MVGVAAYPLTGTADLSRVEAPVTFKAYLLCAFAAFGGIFFGYDT
                     GWMSGVLGMPYFITQYTGLQYDYDAGRPVDVDPTQFALPSSTKSLMTSILSCRTFFGA
                     LIAGDVADFIGRRPTIIIGCVVFSVGCVLEIASTNQVALFVMGRLVSGLGVGFISATI
                     LLYMAEVAPKKVRGALVSGYQFCITLGILLANCVDYATANRNDTGSYRIPIGVQFLWA
                     LILGVGLFILPESPRFHVMKGQFQAAARDLSLVRGQPIDSNYIKDELAEIVANHEYEM
                     QVIPQTSYIGSWMAPFQGSLRKGNSNLRRTLLGAGINFIFYFGTTFFQQLGTINNPFL
                     ISLITTLVNVLSTPVSFWAIEYLGRRPLLNWGALGMFVSQFVVAIVGVTAGRPEVARD
                     GGDDTAAVRAMIAFICINIFFFACTWGPVGWVVIGECFPLPIRSRGVGIATASNWFWN
                     CIMAVVTPYMVGEEPGSAALGPRVFFIWGSLCLLSGAFAYFLVPEMKGLTLEQIDTMM
                     VETTPRRSAGWKPTTTFAAQMGRLRPCMPDLQSSSLIKVLKSNNAVSPLLQR"
     gene            complement(1114969..1115042)
                     /locus_tag="MYCTH_t179"
                     /db_xref="GeneID:11513715"
     tRNA            complement(1114969..1115042)
                     /locus_tag="MYCTH_t179"
                     /product="tRNA-Val"
                     /note="Anticodon: AAC"
                     /anticodon=(pos:complement(1115006..1115008),aa:Val,
                     seq:aac)
                     /db_xref="GeneID:11513715"
     gene            complement(1116297..1117743)
                     /locus_tag="MYCTH_2310081"
                     /db_xref="GeneID:11506396"
     mRNA            complement(join(1116297..1117022,1117087..1117743))
                     /locus_tag="MYCTH_2310081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665842.1"
                     /db_xref="GeneID:11506396"
     CDS             complement(join(1116556..1117022,1117087..1117378))
                     /locus_tag="MYCTH_2310081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665890.1"
                     /db_xref="GeneID:11506396"
                     /db_xref="JGIDB:Spoth2_2310081"
                     /translation="MLVKSIAAFAAFALAANVAAEPMPYKPTLMRTSTRALFGIARRQ
                     DDSGYQPEPVECNNGDTCAAACGAGYETCVSNDDLTHCYNPTVGEICCPNQSGGSCEK
                     GYYCTADKKGETWCCPEGMDLEACAAAYGLPGGLVSQTPPPASSTSTSTSTSTSTSST
                     STSSTTTTKPSTTSSSSHSTSASRNSTSFVVPSTTIIPTFVPSSNPIQINSTSISTVS
                     PPQPTQTKIDEGAGSVVAPATALVLLAAGIAALL"
     gene            1119708..1119799
                     /locus_tag="MYCTH_t165"
                     /db_xref="GeneID:11513716"
     tRNA            1119708..1119799
                     /locus_tag="MYCTH_t165"
                     /product="tRNA-Phe"
                     /note="Anticodon: GAA"
                     /anticodon=(pos:1119741..1119743,aa:Phe,seq:gaa)
                     /db_xref="GeneID:11513716"
     gene            complement(1128452..1129982)
                     /locus_tag="MYCTH_2310085"
                     /db_xref="GeneID:11506382"
     mRNA            complement(1128452..1129982)
                     /locus_tag="MYCTH_2310085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665843.1"
                     /db_xref="GeneID:11506382"
     CDS             complement(1128592..1129833)
                     /locus_tag="MYCTH_2310085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665891.1"
                     /db_xref="GeneID:11506382"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2310085"
                     /translation="MQRAKSAVDFSSLLNPEVSAEREQTPTQQQQKQQEQQAEGGNMA
                     AVGLIRPNGPLPAGAPAAEQPTELPRPYKCTMCDKAFHRLEHQTRHIRTHTGEKPHAC
                     QFPGCSKRFSRSDELTRHSRIHNNPNSRRGNKGHHQHAAMIQRMQHDAMAPPPGPKMI
                     RSAPPTALSSPNVSPPHYSSYPMNLPPPLSLGPYNRGALSSQSGSDVAMLARTADRDT
                     TPSQSHYPPSRQHPYYGGSLHSSRNPLPGLGAYHMSRSHSNDDHDDHYAQSYRQPKRS
                     RPNSPNSTAPSSPTFSHNSLSPTPDHTPLATPAHSPRLRPYSGIELPPFRNLSLHHTP
                     ALAPLEPAPEGLAPPLVPAPRSKGVSLTDIMSRPDGNQRKLPVPKVAVHDLLGPSDGF
                     SASGRSSSSNSLSGMDLYDKL"
     gene            1135496..1135586
                     /locus_tag="MYCTH_t166"
                     /db_xref="GeneID:11513717"
     tRNA            1135496..1135586
                     /locus_tag="MYCTH_t166"
                     /product="tRNA-Phe"
                     /note="Anticodon: GAA"
                     /anticodon=(pos:1135529..1135531,aa:Phe,seq:gaa)
                     /db_xref="GeneID:11513717"
     gene            1135788..1137585
                     /locus_tag="MYCTH_2310088"
                     /db_xref="GeneID:11506383"
     mRNA            join(1135788..1135965,1136060..1136255,1136315..1136367,
                     1136434..1136709,1136771..1137093,1137142..1137585)
                     /locus_tag="MYCTH_2310088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665844.1"
                     /db_xref="GeneID:11506383"
     CDS             join(1135908..1135965,1136060..1136255,1136315..1136367,
                     1136434..1136709,1136771..1137093,1137142..1137483)
                     /locus_tag="MYCTH_2310088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665892.1"
                     /db_xref="GeneID:11506383"
                     /db_xref="JGIDB:Spoth2_2310088"
                     /translation="MDYYTIHGHDVSSFDLPSTHRLPTVSAAQALQDLEGNTTNFIPT
                     GLAALDASLSPRLDSVEQSGIQKGNVTEVWGPPGAGKTAFGLQVAAHCLEKRHRVVWV
                     DGFHRVPLGRLRAVVGRATGEGKDADPSRLDGFIHYTCPTLPHLIALLCRPTASCIPQ
                     GTSLVVVDSLSALVNHAFPKLPEARPTRDANGRKEPSSSARRLQVLQYIISSLQKLAA
                     TRNLAILVLTQCATKMQAERGATLVPAINASVWEQGLSTRLVLFRDWLLDGSKTRGLR
                     FVAIQKLNGKEVGALLKSVCAFQVDQTGLISLDCDHTRQSMTFTSTPARKRKIGDTNF
                     EIADSEDEDYGWDDDDELPPMPSQWQGSEDLLLTRDPESDEEDNVDDEQSPQDCEAGG
                     RPSVDDDTEIPGEAARPNYTGSP"
     gene            complement(<1140296..>1141249)
                     /locus_tag="MYCTH_2129775"
                     /db_xref="GeneID:11513718"
     mRNA            complement(join(<1140296..1140719,1141044..>1141249))
                     /locus_tag="MYCTH_2129775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665845.1"
                     /db_xref="GeneID:11513718"
     CDS             complement(join(1140296..1140719,1141044..1141249))
                     /locus_tag="MYCTH_2129775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665893.1"
                     /db_xref="GeneID:11513718"
                     /db_xref="JGIDB:Spoth2_2129775"
                     /translation="MDKRLQGSDGYLKHGGERSRWLKAESRQEGRMLLAALLEEDNGS
                     VPSPLKFLALAAMGVSSSSFFRPPVCSPAQYLHVNTIKVHAGRWYYKGGDPPVRICKP
                     AAPEKRPSRASALASTDPHYGGRPGRGREMNAPSVNRPDSQMPHRIIPWHRVHTIGRG
                     PGGSIVSAAPSMMLSRGVWNRPIPIPHRSMTSGQTRSAQIRSPAAGVGA"
     gene            1141547..1143740
                     /locus_tag="MYCTH_2096131"
                     /db_xref="GeneID:11513719"
     mRNA            join(1141547..1141782,1141957..1142098,1142154..1143028,
                     1143166..1143740)
                     /locus_tag="MYCTH_2096131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665846.1"
                     /db_xref="GeneID:11513719"
     CDS             join(1141962..1142098,1142154..1143028,1143166..1143479)
                     /locus_tag="MYCTH_2096131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665894.1"
                     /db_xref="GeneID:11513719"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Spoth2_2096131"
                     /translation="MPDDQVSQQNGATDTDNAVGKSPAEETKAPAEETVAPVEPQPFS
                     WLQPHPLFVIALVGPEETPFGIQKDFLCFKSAYYRKYFAETPNEGLENLVRLPDTPVE
                     VFAYAQNFMYTGQVFPSLDNLPSYEVLIGVWKLGHELGIEGLCDATLEAMAECRRVTQ
                     HIPATPLLVQVWKDTPEGSSIRKLLLSWAAEYMRSSESRAEFARSLPQEVLSELVVTM
                     SSLDESPPQVDAAGSASAPGAQRRSAPHEADEAEGRPSKKRCASDAEANGTSSVTPSS
                     GAQAPGRKQGGPRASLPGAKPGPKPGSKRRSSAAVNGGQQFSSNQKLNFCADLLSRML
                     SGPGFWTRVVGPFKDPVDPERDGVPDYFDVIKKPMDLTTMKGKMDRHEYKDENEFLAD
                     MNQIFTNCYTYWREQDPMWAACEKLQKSFEDKYAQMNKWIAKMEGEEGH"
     gene            complement(1143755..1145234)
                     /locus_tag="MYCTH_2310096"
                     /db_xref="GeneID:11513720"
     mRNA            complement(join(1143755..1144112,1144214..1144268,
                     1144333..1144517,1144674..1145234))
                     /locus_tag="MYCTH_2310096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665847.1"
                     /db_xref="GeneID:11513720"
     CDS             complement(join(1143918..1144112,1144214..1144268,
                     1144333..1144517,1144674..1145039))
                     /locus_tag="MYCTH_2310096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665895.1"
                     /db_xref="GeneID:11513720"
                     /db_xref="InterPro:IPR013261"
                     /db_xref="JGIDB:Spoth2_2310096"
                     /translation="MNRLTVSGLRLRPSSTNAALAAVPPSLLRQLVVRCRSLPESLSP
                     SSSSSSSSPLASFSYQSRRGYATQHYQQPQTESRRRAVTPFNDDGRVPWTELSAGEKT
                     ARAAQQTFNFGMVVVGLVLTGGVGYVLYSEVFSPDSKTTYFNRAVDRIRTDPRCLELL
                     GDGKKIMAFGEETYNKWRRARPIASTVTKDAQGNEHMMIQFNVQGPKGAGRVSIHLVK
                     RAGQSEYEYKYFFLDVRGHQRIYLENADALRAKSGESKGFRLFGVKWS"
     gene            1145388..1147543
                     /locus_tag="MYCTH_2310099"
                     /db_xref="GeneID:11513721"
     mRNA            join(1145388..1145620,1145687..1145822,1145890..1146073,
                     1146146..1146888,1147033..1147543)
                     /locus_tag="MYCTH_2310099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665848.1"
                     /db_xref="GeneID:11513721"
     CDS             join(1145549..1145620,1145687..1145822,1145890..1146073,
                     1146146..1146888,1147033..1147385)
                     /locus_tag="MYCTH_2310099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665896.1"
                     /db_xref="GeneID:11513721"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="JGIDB:Spoth2_2310099"
                     /translation="MSGLASKQQSLKIFEKLKTKPANKVCFDCGQKNPTWTSVPFGIY
                     LCLDCSANHRNLGVHISFVRSTNLDQWQWDQLRIMKVGGNESATKFFQSNGGSAALNS
                     KDPKTKYTSAVATKYKEELKKRAARDAKEYPEEVVITDGVEGGESGSTPAEEEDDFFS
                     SWSRPAVKKLSPPISRTATPPVVGRTPSPLAGGQNGKDAGAPAPSPLGKDDEGEAKPA
                     AAPATRITTSAALKSKTTGPRKTNILGAKKATSKLGAKKLGSDVAIDFDEAEKKAKEE
                     AERIEKLGYDPNAEEEEVAPAPKAAAGGGGSKTESAVVSPSPASPARTGYGSSRVREK
                     SAAEVERLGMGIGRLGFGQVGRPAVAKKGAGGFGSVGPIKASAQDDDGENYAQRKFGN
                     QKAISSDEFFGKGMFDSAAQAEAKSRLQGFEGAQAISSNAYFGRPESDEGVGAGDDYG
                     DLESAAKDFVRRFGITAADDLENLTHLLGEGAGRLQGAVRAYLGN"
     gene            1151642..1152455
                     /locus_tag="MYCTH_109914"
                     /db_xref="GeneID:11513722"
     mRNA            1151642..1152455
                     /locus_tag="MYCTH_109914"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665849.1"
                     /db_xref="GeneID:11513722"
     CDS             1151902..1152225
                     /locus_tag="MYCTH_109914"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665897.1"
                     /db_xref="GeneID:11513722"
                     /db_xref="JGIDB:Spoth2_109914"
                     /translation="MRLGLLSASDQSGGNKPVAKEHPCPGSAPADRCSQTERTLAARP
                     SPLLPSRSRHGRILSPWTLAALWRPPAPSDTARPLCAKHSRVPTASTLRHQRRRRKKR
                     KRANI"
     gene            complement(<1156483..>1158339)
                     /locus_tag="MYCTH_37566"
                     /db_xref="GeneID:11513723"
     mRNA            complement(join(<1156483..1158067,1158149..>1158339))
                     /locus_tag="MYCTH_37566"
                     /product="p53-like transcription factor"
                     /note="Has EST support"
                     /transcript_id="XM_003665850.1"
                     /db_xref="GeneID:11513723"
     CDS             complement(join(1156483..1158067,1158149..>1158339))
                     /locus_tag="MYCTH_37566"
                     /codon_start=1
                     /product="p53-like transcription factor"
                     /protein_id="XP_003665898.1"
                     /db_xref="GeneID:11513723"
                     /db_xref="InterPro:IPR007888"
                     /db_xref="JGIDB:Spoth2_37566"
                     /translation="SFTQGSTSSLSAIETSTQPSSYLSLIPSVPQPPVTPYSPDGGHF
                     YTPAPPIFPGLEVRPRLGSNSSTAGQGMAHAHRSTTLPHPGTHLSAREAYASATPAFR
                     RSEHHIQRSPPFSSIRRSNLLSPTSTSTSYGSLKMDTGYPGSRTQPSIPPLGPMTSLG
                     HLSYGDTSATPIQVDISGVIDKGFFVAENEWTCYRRNYFACICSFSLTPLLPNSPIHF
                     LPTGSTQAYSVYGFAMCISAVVSDNESHTIELVQHTPKRDKGPIAKPDKVRLSPKPPQ
                     ASQHPLTSLYGAPEASLGSPRYEQGFGQPQQSSAPTEHTFERIQFKQATANNGKRRAA
                     QQYYHLLVELWADVGQQGGGDSWVKVAYRKSAKMIVRGRSPGHYQSERRGSASSGPGG
                     SSGSMGGGGYTTGLLGPGEYPANQPMMGGGGYAQQYDTRSGGYGGARPHHELNMEPLI
                     STEDVKAMTSTKGYQYYPATIYESEHHDPRQQQQQEQQQQQPQEQQEQQQQHHHHHHH
                     HHHQQVELFSHARQEVSGSGAAPSMSAMFDPTKVKPEMENGLPSLLYHSVPYYQRCGR
                     FEGKATSSGQYPKLIPPPSTTMNMT"
     gene            <1168128..>1169641
                     /locus_tag="MYCTH_2129781"
                     /db_xref="GeneID:11513724"
     mRNA            join(<1168128..1168192,1168587..1168801,1168879..1168968,
                     1169027..1169323,1169400..>1169641)
                     /locus_tag="MYCTH_2129781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665851.1"
                     /db_xref="GeneID:11513724"
     CDS             join(1168128..1168192,1168587..1168801,1168879..1168968,
                     1169027..1169323,1169400..1169641)
                     /locus_tag="MYCTH_2129781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665899.1"
                     /db_xref="GeneID:11513724"
                     /db_xref="JGIDB:Spoth2_2129781"
                     /translation="MPDFAHVAQGQPPTPDRAPSLTHAYFLSYDRHIRCGFRVSQRSD
                     KVPIRLSACLPTFAPFNSSGHAAWSPLSDADVTAHGLGLVRGVGSSEALGISTASAVA
                     WSGLNKMQWDCLMSPSNQVVHSLSYRRRGGMGNWCAFYQPQESKRMRPANGRDPEAER
                     TIGRAIKGQDASVPSGQWSKRRGGRGGIRFVKRATLREQRNPSAEARNGSEAKERPGG
                     RRVQYVQVARRQTSLGRARGTAAAVSKSVNIAQTTIVAAEQLPDRMGLDDARHALRAR
                     NEHQIQSDPLGTQGMEHAAFLTCKVA"
     gene            1171251..1172526
                     /locus_tag="MYCTH_2310107"
                     /db_xref="GeneID:11513725"
     mRNA            1171251..1172526
                     /locus_tag="MYCTH_2310107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665852.1"
                     /db_xref="GeneID:11513725"
     CDS             1171431..1172438
                     /locus_tag="MYCTH_2310107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665900.1"
                     /db_xref="GeneID:11513725"
                     /db_xref="JGIDB:Spoth2_2310107"
                     /translation="MVLRRMVLDWEWQKEYCQYHLYELPTKLRVALVVYLVTYTREGV
                     SLQDLQAILLPPRDVPEYQEDPSLAPSVVNEYFHYLDLSGSVGRSLKLRELSDFLFPP
                     QPKSIELQESWEDATEQSPAGVPRPLLPNLTHLSLALSPTTSSSSSPPHGAAAATPTT
                     VSWRHLLALAAHLPGLTHLSLAFWPEPSLTPNARLATVVSPQTGRTVPYGGTGPYSHS
                     LDDDWAEQVLILRRLSRSLYGLEYLDFTGCGEWFPALWASAGEGDTVDWSGAWGKVET
                     LVMFPGYRLREDADAAETARYWEYVDWARRVERHVRSRRAGKGRFITVETSRRPGEIG
                     C"
     gene            complement(<1172804..>1174421)
                     /locus_tag="MYCTH_2068493"
                     /db_xref="GeneID:11513726"
     mRNA            complement(join(<1172804..1173839,1173925..1174133,
                     1174218..>1174421))
                     /locus_tag="MYCTH_2068493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665853.1"
                     /db_xref="GeneID:11513726"
     CDS             complement(join(1172804..1173839,1173925..1174133,
                     1174218..1174421))
                     /locus_tag="MYCTH_2068493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665901.1"
                     /db_xref="GeneID:11513726"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="JGIDB:Spoth2_2068493"
                     /translation="MSAVQEAPRKRTAYIALGSNMGDRIGWIEKACNEMDARGIRVKR
                     TSSLWETEPMYVLDQDRFVNGACEVETTLEPLELLDALQDIEKSLGRKKLIDKGPRNI
                     DLDILLYDNIQFDHERLKIPHVGIAEREFVLRPLAELIPDKPIDPSRPWRLTVDYLDA
                     LPPSKTPLTTMTPLSSHHPPIQALNPSRKTHVMAILNMTPDSFSDGGQHKPIIPAQGA
                     ADDAGTTAADTAAARLKETIAGFLDAGATMIDIGGQSTAPGTAEVPLEEELARVVPAV
                     RLVREEFGSRPVLVSVDTYRAAVAEAAVAAGADIVNDVSGGSMDPAMLPTVARLGATV
                     CLMHMRGTPATMNGLAEYPAEQGGLIGGIARELLARVRAAEEAGVRRWRIVLDPGLGF
                     AKVGPQNVDVLRRLDELRSWPGLQGLPWLVGSSRKSFIGRVTGVPTPKERIWGTAATV
                     AAAVQGGADVVRVHDVREMAQVVAMADAIWRY"
     gene            1175296..1176947
                     /locus_tag="MYCTH_2310110"
                     /db_xref="GeneID:11513727"
     mRNA            join(1175296..1175466,1175632..1175893,1175977..1176947)
                     /locus_tag="MYCTH_2310110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665854.1"
                     /db_xref="GeneID:11513727"
     CDS             join(1175454..1175466,1175632..1175893,1175977..1176835)
                     /locus_tag="MYCTH_2310110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665902.1"
                     /db_xref="GeneID:11513727"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="JGIDB:Spoth2_2310110"
                     /translation="MASPQQIRTELTDLFKINHPILLAGMNVAAGPKLAAAVTNAGGL
                     GVLGGINYTPEMLKEQIEELKSHLHDKNAPFGVDLLLPQIGGNARKTNYDYTKGKLNE
                     LIDIIIQSGAKLFVSAVGVPPRHVVEKLHKHGVIYMNMIGHPKHVKKCLDLGVDIICA
                     QGGEGGGHTGDIATTVLIPAVVDACKGHKSPLTGKPVQVLAAGGIHNGRMLAAALMMG
                     ASGVWVGTRFVLSEEAGAPESHKEAVRTAGFDDTIRTLIFTGRPLRVRKNPYIMNWEE
                     ERAQEIKELTSKGKIPYEADLDKVMSGEAEATPAIKGSGLMNASADDDTDVDDLLDQF
                     RPFLMGQCAAVVNEKKPAKEIVDEFINDAVASIKKGHSYTAKL"
     gene            <1177958..>1179033
                     /locus_tag="MYCTH_2112701"
                     /db_xref="GeneID:11513806"
     mRNA            join(<1177958..1178107,1178170..>1179033)
                     /locus_tag="MYCTH_2112701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665855.1"
                     /db_xref="GeneID:11513806"
     CDS             join(1177958..1178107,1178170..1179033)
                     /locus_tag="MYCTH_2112701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665903.1"
                     /db_xref="GeneID:11513806"
                     /db_xref="JGIDB:Spoth2_2112701"
                     /translation="MKYPGGGGPFHEKAFKISLVVTSFISVLLTAIVLSAGTDAGRLE
                     QLHILYIDTSKIGKEVVSNAGSKVSDACDSIPDVDPPKLPKIPIFGRDSARDVLEVRS
                     LSDACKNAVKEGEKKVGEVTESAAASIGLKQYYSVHIGALCEGDIEDEKPKVKTCTRK
                     FHAGSTEISNSVEPLKKIPGAEDIGEKISEIPNKIARTAYPFLVIVLLLALAFLFAIG
                     VACLEGDSKLQNILQEISLWGAIICVTLSSLGLFVCATLITAVAEEIKDKINKFNNVG
                     IFAGTSPALYALMWVSLVFTWISLGMLIYLWILAHKGTRTSKDRSQTTTPGGSTSGFM
                     MPK"
     gene            1179640..1180977
                     /locus_tag="MYCTH_2310112"
                     /db_xref="GeneID:11513807"
     mRNA            join(1179640..1179944,1180022..1180205,1180275..1180419,
                     1180469..1180977)
                     /locus_tag="MYCTH_2310112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665856.1"
                     /db_xref="GeneID:11513807"
     CDS             join(1179791..1179944,1180022..1180205,1180275..1180419,
                     1180469..1180579)
                     /locus_tag="MYCTH_2310112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665904.1"
                     /db_xref="GeneID:11513807"
                     /db_xref="InterPro:IPR001185"
                     /db_xref="JGIDB:Spoth2_2310112"
                     /translation="MPRLTDDTDEDHALLDEGRRRASRILHGFVDFAFQGNVLEIAFG
                     LILASMFTALVTSFVSDILLPPLSVLLPIHKNLEEKFAVLKPGPHQSADGGYNTLQQA
                     QDDGAVVMAYGFFLSRLLNFMGVGFSLYVLAAVYQYFSRDPIIKRTVKCKYCRKIISE
                     KALRCVNCSSWQDGREDQPQATSLHPHYVPNIAETTP"
     gene            complement(<1181456..>1182183)
                     /locus_tag="MYCTH_2129788"
                     /db_xref="GeneID:11513808"
     mRNA            complement(join(<1181456..1181803,1181944..>1182183))
                     /locus_tag="MYCTH_2129788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665857.1"
                     /db_xref="GeneID:11513808"
     CDS             complement(join(1181456..1181803,1181944..1182183))
                     /locus_tag="MYCTH_2129788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665905.1"
                     /db_xref="GeneID:11513808"
                     /db_xref="JGIDB:Spoth2_2129788"
                     /translation="MKYSALLLVTAGLAAAQLSVVTVVLPQFDQQAIDASVIAAAPTA
                     TTYRLNCPPGADSSDCGMPDEFEFVYGPSTFAYTMSLDLPKDTADCVGTMSKEGLSTV
                     ARDTLTDLTSFMLPITITAGLDKLAASTGAGTAPEAPARTTTTGGTTETAGSTGTTGS
                     TVATSSTQTGGVPPQITQNAVLVGAAALVGGAMLM"
     gene            1184040..1185285
                     /locus_tag="MYCTH_2310117"
                     /db_xref="GeneID:11513809"
     mRNA            join(1184040..1184313,1184409..1184542,1184617..1185285)
                     /locus_tag="MYCTH_2310117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665858.1"
                     /db_xref="GeneID:11513809"
     CDS             join(1184173..1184313,1184409..1184542,1184617..1184953)
                     /locus_tag="MYCTH_2310117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665906.1"
                     /db_xref="GeneID:11513809"
                     /db_xref="JGIDB:Spoth2_2310117"
                     /translation="MRPQRPALLARLCAAAGSAQGQSTVSVYLPEYGNSDWGALRGSI
                     ISSNNSVTAYTVFCADQSPNCHLAGEIPFVFTEGAHTLVYKGTDAGTLTADLECKLDG
                     KTAATCTGSTSVGTSHREGQLTGPTETVWTSTFTGADVTWGVLTLSTPAPPPSTTGID
                     GTALAPMTSTPAPLSGGSRSLSMESSRAVMILLSVTVFGFLLG"
     gene            <1186649..>1187977
                     /locus_tag="MYCTH_40869"
                     /db_xref="GeneID:11513810"
     mRNA            join(<1186649..1186739,1186794..>1187977)
                     /locus_tag="MYCTH_40869"
                     /product="glycoside hydrolase family 76 protein"
                     /transcript_id="XM_003665859.1"
                     /db_xref="GeneID:11513810"
     CDS             join(1186649..1186739,1186794..1187977)
                     /locus_tag="MYCTH_40869"
                     /note="CAZy_ID 267896"
                     /codon_start=1
                     /product="glycoside hydrolase family 76 protein"
                     /protein_id="XP_003665907.1"
                     /db_xref="GeneID:11513810"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="JGIDB:Spoth2_40869"
                     /translation="MRFLRSLKPALATTAAIAAIAPKDLDINDPSSIKGVAKTIASGA
                     MSYYSGTAEKFVDLPEPYYWWQAGALMGSMLDYSHYTGDKSYDRIIATALLGQVGPNF
                     DFMLPSHFGQEGNDDQAFWGFAVMAAAERNFPQPDENVPSWLQLGANLWNSLASRWNT
                     TACNGGLLWQIFASNPNGLDYKNSVSNGGLFQISARLARATGNNTYLEWAEKVWDWTE
                     GVGMIDKDFNVHDGASASHNCTDINPVTFSYTAAIYMYGAAVMADVTGDKKWVQRTER
                     ILDAARSFFSPFPNATNIMYEHACEQVGTCNADMRSFKGYLSRFAYAASVFVPSIKPV
                     IEELWHPTAKAAAKSCSGGPDGTQCGQRWYYGGFDGTTGLGEEMCALETIQGLLVGEA
                     EPPLKGDQIKTVRTFEGSSNTKRGGRYDARLA"
     gene            complement(1188181..1189889)
                     /locus_tag="MYCTH_2310121"
                     /db_xref="GeneID:11513811"
     mRNA            complement(join(1188181..1189557,1189679..1189889))
                     /locus_tag="MYCTH_2310121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665860.1"
                     /db_xref="GeneID:11513811"
     CDS             complement(join(1188270..1189557,1189679..1189752))
                     /locus_tag="MYCTH_2310121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665908.1"
                     /db_xref="GeneID:11513811"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2310121"
                     /translation="MSPFNLETCARPNILALEPYRCARDDYKDDGTNILLDANENAYG
                     PPLTTTTAATTTSTTIPSSSPPQSQVDGTAPLSLDLSALHRYPDPHQTRLKQLLCDLR
                     TTTTTTRTKGGERSRALSPDNVFVGVGSDEAIDALLRCFCAPGRDRILVCPPTYGMYA
                     VSAQVNDVALVRVPLRPAEEGFQLDVDAITAALSASASAGGAAEGPIKIVYLCSPGNP
                     TGALLRKEDVRAVLEHPTWNGVVVVDEAYIDFASAEEDSLAGWVVEWPNLVVMQTLSK
                     AFGLAGIRLGVAFASPEIARLLNSLKAPYNVSSLTAEIAEYALSEKGGLARMRENRAK
                     LIAQRERMVREMAKIEGVGRLRGGQDSNFLLYEMLDKEGKPDNVTALAVYERLAETKG
                     VVVRFRGKEHGCLGCLRITVGTEEEVTRFLDSLRKTLAEVRGRTPVADEEQREAEASG
                     VVA"
     gene            <1191196..>1192286
                     /locus_tag="MYCTH_40885"
                     /db_xref="GeneID:11513812"
     mRNA            join(<1191196..1192156,1192216..>1192286)
                     /locus_tag="MYCTH_40885"
                     /product="carbohydrate esterase family 16 protein"
                     /transcript_id="XM_003665861.1"
                     /db_xref="GeneID:11513812"
     CDS             join(1191196..1192156,1192216..1192286)
                     /locus_tag="MYCTH_40885"
                     /note="CAZy_ID 267858"
                     /codon_start=1
                     /product="carbohydrate esterase family 16 protein"
                     /protein_id="XP_003665909.1"
                     /db_xref="GeneID:11513812"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Spoth2_40885"
                     /translation="MRLSWVLVGASIALAKSHKDHNFETLVTFGDSYTDNGRLGYYIN
                     HGGKAPRPGTMHDETTTTASGGLSWAQFAARDAGATLMDYAVSGAVCSNQIVSRYFDL
                     INRTFPAILDDEIPSFQADVLFKSLYPHRTAENTVYAVWIGTNDLGWGAFLSDSQTPG
                     KTISDFVSCVFSVLDHVYKTGGRRFVILNTVPLELAPLYALPENGGTLDSQYWNTKTK
                     YNMTEYGQKIREYSTSVNTMLENGALVMASLKKRWPKAMVDVFDVHSLFNDIYNAPTK
                     YLDAPHNVNSYYHQCGPAGSPCTDQPGSLNGYMWYDELHPSNKTSSIVARNFLDVVAG
                     KSKYGTRFH"
     gene            <1193833..1195842
                     /locus_tag="MYCTH_74772"
                     /db_xref="GeneID:11513813"
     mRNA            join(<1193833..1194100,1194346..1194976,1195039..1195842)
                     /locus_tag="MYCTH_74772"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665862.1"
                     /db_xref="GeneID:11513813"
     CDS             join(1193833..1194100,1194346..1194976,1195039..1195651)
                     /locus_tag="MYCTH_74772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665910.1"
                     /db_xref="GeneID:11513813"
                     /db_xref="JGIDB:Spoth2_74772"
                     /translation="MYSAPYGYQNAAAGPIFNGAPPQQAAHMQPSPSPNQQQQMMYNT
                     QQFPMPGQPGAFPVGPNPALMGGGAAGSAGMMQNPGMPHMAANGQMSFQVPFTTSPYV
                     AAVPSSTAPQPQLPANFMMAGQMGPYQMNPGLPSQQPMMQRMMPAQQNPAGISVSTPQ
                     RQFSQSQGTPTSTMPPQQQQFSTPQTQGTPQNQTPTTAHPPPGSLATPQTPTFPADQG
                     QPQVNGTSSGSTPQSPATDSRDRERMAVLLEINQELLYESIQLVNSRNELKKEQAAAQ
                     ASGVKNNDVDYAEEEKLANLDYNQCMRRLQANLTYMFALADRKGKAQLPPSPAYLTPP
                     PLNLQLKLRVPPSTPGDPIERPADPVADRAERDQLLKSLYKKLHTLYPGIDPNKEPPA
                     QPPAGVRPSGGAPGGAPAAPTTEAGGGGGGGGAGPNPTHNPNPNNANVLAGTAAPAPR
                     SVAGAKASPQQQNGGVSGAFQVPNQNSPAPGPGRIQGTSMTSMMAEAAAPGLV"
     gene            1197688..1201093
                     /locus_tag="MYCTH_2310128"
                     /db_xref="GeneID:11513814"
     mRNA            join(1197688..1199010,1199074..1201093)
                     /locus_tag="MYCTH_2310128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665863.1"
                     /db_xref="GeneID:11513814"
     CDS             join(1197821..1199010,1199074..1201054)
                     /locus_tag="MYCTH_2310128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665911.1"
                     /db_xref="GeneID:11513814"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_2310128"
                     /translation="MEPDRDGGETRPACALQDSTSPKESAPGPTNSPPTTSETSSETS
                     THDSLVTVRLSEPPSLHLVTGAPPSTIPAKTSPLTNYESSDAQAETPGEDDDDSESEI
                     FEPENSASKRRPNLLQELGRANAESTDDGGGENNRPGSSSSVGSERVDWEELQKKEEL
                     ELKEQGSNNVRSPSQGTPIPVPAATDTSCTRQTTASLLARTEQENVRSATGSKGGRSK
                     ATEKRQSRESRPRPPSMAQLRKMVNGPTPPALRYSKLPPTPMTELDFYLALVKDPKQT
                     AARLPTLLTNKVRKGIPPPLRGVVWQSMAGARDSALEEIFDRLSGESSPYEGVISKDL
                     GRSFPGVDMFRDPDGDGQRMLGRVLKCFSLYDTKIGYCQGLAFLVGPLLMHLPDKQAF
                     CVLVRLMENYDLRQCFVPDLSGLHIRIYQFRELLRQHLPTLSAHLDGLQVEPAYVSQW
                     FLSLYAVTCPLPMLFRIYDVIFAEGASETIMRVGLSLMRKNQVRILACTELEDVMRLL
                     LSRGLWDCYNYNADEFVQDFVALANVVTKERLIALEQGYREAKISPSANLRGAQAAQA
                     SADVTTAASRFLGRIWTSSSTPKLAPIPAAAQPSGSTSNSTLNPGIGTGSRSLSMLRR
                     STSKQSLSSMEAASSTTSSAASVLSSVSTEATTISRDSAPDDLPREATPLASKTAPTA
                     FSGSVNTSKDGSKYLHSQIEDLLTALSELQRNHALLANQLQREKEEREDDRRAVRSLL
                     DGLRKKADAKMERNETTPTEQATVSGGASTGPTAEQLSDLLDVVELRFNEPAASPRSS
                     THETKMQLREELARTREQLSQERAKVKEYDRKIQELEQEVATVRDQLRDTHAHVRSVH
                     QEKQRLERQIHGLRARASDTPPSADNGEWFPRTVGGGVAGTGLRGLKLGRSRSTPSQA
                     ASNHGNKRVSSATMKKQDGNEPLPSGGTQNNTPPNENDALVLELVQAKTAEAVARQEL
                     EEAKQKLEQFRKAFGLAPGESPPVLQHGGNSTPPPPSTSTSFSGMIGRLTGSSTMPVG
                     SESFTKASLSPTTNNTSSGGFWGWRR"
     gene            1202137..1203910
                     /locus_tag="MYCTH_2310132"
                     /db_xref="GeneID:11513815"
     mRNA            join(1202137..1202582,1202828..1202989,1203049..1203350,
                     1203445..1203910)
                     /locus_tag="MYCTH_2310132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665864.1"
                     /db_xref="GeneID:11513815"
     CDS             join(1202528..1202582,1202828..1202989,1203049..1203350,
                     1203445..1203894)
                     /locus_tag="MYCTH_2310132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665912.1"
                     /db_xref="GeneID:11513815"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="JGIDB:Spoth2_2310132"
                     /translation="MADSAAANGSSNVEALKASPVAQNVMDQSSKASAEFSNLAASRH
                     TPSYTAATGQPLTHYHSFFSELLSWRNPRASAIAYASIITLIFSVRYLDIIRWAFKIT
                     WMVLGITIAAEVTGKVLLNNGFATQLRPRKYYTIPRETLDLVIGDVHELINFFVIESQ
                     RVLFAENVYASAAAALAAFISYYLVKIVPYWGLAVIATTVIFFTPLIYTTNQELIDNQ
                     LKHASDIVNAQTAQLRTVAQKHTAQATQATKQYVGDYTAKAQALIKGARHHVEQPQKA
                     TPIKETDFPAPPKEDIKLPAETESVSEPAHGPEPVAKTDDEPLIAA"
     gene            complement(<1205190..>1210725)
                     /locus_tag="MYCTH_74764"
                     /db_xref="GeneID:11513816"
     mRNA            complement(join(<1205190..1206902,1206959..1209557,
                     1209601..1210538,1210657..>1210725))
                     /locus_tag="MYCTH_74764"
                     /product="DNA topoisomerase 2-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665865.1"
                     /db_xref="GeneID:11513816"
     CDS             complement(join(1205190..1206902,1206959..1209557,
                     1209601..1210538,1210657..1210725))
                     /locus_tag="MYCTH_74764"
                     /note="Contains multiple conserved sub domains all
                     contained within PTZ00108, DNA topoisomerase II.
                     Provisional"
                     /codon_start=1
                     /product="DNA topoisomerase 2-like protein"
                     /protein_id="XP_003665913.1"
                     /db_xref="GeneID:11513816"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="JGIDB:Spoth2_74764"
                     /translation="MDSDVDSVFGDYQDDSDDYTPEVKPKAKAAPKKMATTKPGKMVQ
                     TTLTGAKAPAKKRPKPDSDAEDDMPKKKKAPAKKANAKPLAEIENDSMAIDNNDDDDA
                     PVSKPAGKPKSATETYQKLTQLEHIIKRPDTYIGSVERTDQKMWVFNKTEKLMENRTI
                     SYVPGLYKIFDEILVNAADNSQRDSSMTYLKVTIDRESGEISVENNGKGIPVEIHEKE
                     QCYIPELIFGHLLTGSNYDDNEKKTVGGRNGYGAKLTNIFSQRFTIELQDSTNGKRYK
                     QTWTDNMGNMEKAKIVSNKSSDFVKVTFLPDYKRFGMENGIDDDLEALLYRRVYDMAG
                     TVNFKTYCEMYAKAIANERGDAAVDGEKPAAKVEFDQQRSNGRLWQVGFTVSDGSFQQ
                     VSFVNNIATTSGGTHVNYIADQICEALGKELNKKKKGHSLKPSHFRNHIFIFINCLID
                     NPAFTSQTKEQLTTKVSAFGSKCQLSDQFLKKVKASEAIANIMEFADRKADKMMAKSD
                     GNKRSRISNDKLIDANWAGTKRGHECTLILTEGDSARGLAVAGRAVLDPDRIGVFPLR
                     GKMLNVRDASLDQIMKNKEIENIKKILGLKHKQDYKDTRGLRYGHLMIMADQDLDGSH
                     IKGLLINFLEVQFPSLLRVEDFFQEFITPVVKVWQGNNPKKPQNLKMFFNLPQYETWK
                     EAHKAELRRWKYKYLKGLGSSSNEDAQIYFKDLDRHLKKFDILKPEESQLLELAFSKK
                     KADARKEWLGNFIPGTYLDSTMSRKTIADFVQKELILFSMADNMRSIPSMIDGLKPGQ
                     RKVVYAAFKRNLVSDQKVAEFAGYVSEVAAYHHGEMSLQQTIIGLAQTYVGSNNVNCL
                     EPSGNFGSRLSGGSDAASARYIHTRLSPFARRVFSKLDEPNLENQYDDGKMIEPKVYV
                     PIIPMVLVNGADGIGTGWSTQIPNYHPLDIVENLKRRMGRLDPNDPEEKPFKPMTPWW
                     RGWKGVVEPDGPNRFKFNGVIKQDEQNPNEIHVTELPIRMWTDDFKSRLEEILRAEKT
                     PSFIKDYREFNDHQTVHFIIEMEDKHLKAALDEGLLEKFKLTKTVTTTNLVAFNTRGQ
                     IHKYESPEEIMEEFYQYRYNMYTERKKHWLGVYHADYRKLKNQYRFVSEIIENKLVVN
                     KKKKDVLVQELRDRKYEAFPPKEDKKVKSTDEELGKDDAEDEDVSSDARDYDYLLSMP
                     IWSLTNERLEKLKNQIAAKKAEYDELEALSEKDLWVKDLDEFVEEWHTQLKLDEEITT
                     GIRRMGRRTSHKIGAGKGRRPKDDDEYQPEKKTKARAPKVEKVETKSHERFTEKFQAA
                     TKPKPKNDLSDDDFALLGKNAVVKQESEPSASRPDTTSGRNKRAAATKAKYALSDSDD
                     DDFMDLDQPEVKDESEVSEAKEVAEKPAKRTTTKPGALNMDDEFNESASDATAEKPTK
                     RTATKAKPSYVDDDFGESGSEEVVEKPAKRAATKAKPTSVGSEPDRSTSEEVAEKPAK
                     RAAARKRSYVDDDFGSTEDDDDNGDDMLGDVGAMVKGIGAPATNNGRLSLFSMSRPDA
                     ADAPIPKLKAKQSRSILDTDDHDDTNYEALAMSSPRKPTKTDDLDDFLSDDNLPGATK
                     PAAKIAAAASKAKAPLSVVPAAGAKKRGRPVGSKNKPKGDDASAPKTTKSVASRPKTL
                     TTLSPAAKAYAAKKAKSTKKAVSDDDDEDELMEDPAPASPKPAAKRPGRAAAAKAKAN
                     PIYLDDDDDDSFVSADDGSGGAGGRGRRGKGKKDDDDAFNMDEDSD"
     gene            <1214565..>1217175
                     /locus_tag="MYCTH_2112712"
                     /db_xref="GeneID:11513817"
     mRNA            join(<1214565..1214928,1214998..1215113,1215165..1215249,
                     1215314..>1217175)
                     /locus_tag="MYCTH_2112712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665866.1"
                     /db_xref="GeneID:11513817"
     CDS             join(1214565..1214928,1214998..1215113,1215165..1215249,
                     1215314..1217175)
                     /locus_tag="MYCTH_2112712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665914.1"
                     /db_xref="GeneID:11513817"
                     /db_xref="JGIDB:Spoth2_2112712"
                     /translation="MVSVAELLNPAPPTPPRAPLPTSRPLCFPARQTVAPSNEQAPVT
                     PSIEVLRMTQNADGPPRRKTRAVVNFPPFEVLDEHSIREVRRFRVHPFGSIQETGERI
                     PYNSGKKDFFSKTGREGFEVFHYNFKVPGDDTDYTVMWDHNVGLVRMTPFFKCRGYSK
                     TTPAKMLNLNPGLKDITYSITGGSIKAQGYWMPYSCAKAVCATFCHKISGALIPLFGP
                     RFALECIPEKVPGYGRMVIDPDIVKRARKDAAALFRPNAALPSPRPSRSVSPLLAQRS
                     VRVSNPHDLHSDHDQRLPISPYTDADADYRLGGSDHEGLRPYATSVAPLRIPTSRLPT
                     GPAAVPTPQHSPAWTTVNHPPPQAYAASHHHIRRETPNLHEELPSLNVSATANPWLSA
                     VPRSPVPGVVGVGGDGGSSGDNSSSTNRWHPYKPRSHHSRYGHFEHLHHGTSPISATL
                     PERGIILPPLRLKRRFSKVDATVTGPCGNRSVDNNRNVDSNINDNNDDNIDDDAAYDA
                     RESHAASSWKRSSNSNGSSSSSGSSPESVTAAPPPTPASASSKKSKSSPSSSSSSSSS
                     SSSSTPPPLPRAAVRTDTCATTTTTTNSAAAAASAQSKPGNNNRTAPRRQREDNNDND
                     SNDDGGDGSRAAAGRGRGRGRGAPPRRESERDAAMMLMRMRRRGGGSSSLGGSDVEEG
                     DEEQEEEGGAGAGAGGGRGKGERRREEDADAGAEPRSPRTARHRHHHHLLGDAVVVVA
                     AAAGEDDTEAGAGAAPGAVRPASSYMPPPSAIGMAVVADGLVIEPPHPPRPASAGPTT
                     RSKRRRTLER"
     gene            complement(1217521..1219316)
                     /locus_tag="MYCTH_2310137"
                     /db_xref="GeneID:11513818"
     mRNA            complement(1217521..1219316)
                     /locus_tag="MYCTH_2310137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665867.1"
                     /db_xref="GeneID:11513818"
     CDS             complement(1217747..1219087)
                     /locus_tag="MYCTH_2310137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665915.1"
                     /db_xref="GeneID:11513818"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Spoth2_2310137"
                     /translation="MDQVTKNTESLNLGSSQPNESAGSAPEPGPMLPELPPGRTLNSG
                     MTLEETVADLNKHPLFMTELDDAEDNEHLAALQALAYEGTPLENAANFKEQGNECFRE
                     KRWADAKEFYGKGIPILVAEERRRAKGEKKRVKKAAEKPVSINPDANNSASGPGPDLQ
                     EEEQQAPQPNEDEYEEVDDDPAEVKSEQALLETLYVNRAACHLELRNYRSCTLDCAAA
                     LRLNPRNIKAFYRSARALLAVGRVTEADDACARGLEVEPSNKPLLALAKDIVKAAEAD
                     AARRRREEEEQARERHREALLRAALEARNIRTRSTGKPPDMEDARVKLSPDEHDPTSS
                     LVFPTLLLYPCHLESDFIKAFNERESLEQHFGYVFPLPWDRAGEYSSAGVECYAETVS
                     GGLVKVGKKVPLLKVLSGGNVEVVDNLLKIFVVPKSKADAWVKEFKEKKAAGAP"
     gene            1220102..1222778
                     /locus_tag="MYCTH_2310138"
                     /db_xref="GeneID:11513819"
     mRNA            join(1220102..1220532,1220723..1221367,1221435..1222118,
                     1222182..1222778)
                     /locus_tag="MYCTH_2310138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665868.1"
                     /db_xref="GeneID:11513819"
     CDS             join(1220204..1220532,1220723..1221367,1221435..1222118,
                     1222182..1222623)
                     /locus_tag="MYCTH_2310138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665916.1"
                     /db_xref="GeneID:11513819"
                     /db_xref="JGIDB:Spoth2_2310138"
                     /translation="MTTVKPEPVDDNNVAGSADHVDTISYLQRLIAPDNPPEILEKGV
                     SIGVRVLENLKKSLASGPAQTSGPGWLKAIADLEALAKPTRTIVGVVGNTGAGKSSVI
                     SAVLDEERLLPTNCMRACTASPTEISYNYSEDPDELYRAEVDFITADDWLKDLRGLYS
                     DLLDGNGEVSRECSNQDSDAGVAYAKIKAVYPRMTKEMIAQATPESLVNQTAVRQVLG
                     TVKKLRATTSASLYRQLQDYVDSKEKNTEKRMEYWPLIKVVRIYTKAAALSTGACLVD
                     LPGVQDSNAARAAVAANYMKACTGLWIVAPITRAVDDKTAKSLLGDSFRRQLKYDGTY
                     SAVTFICSKTDDISVTEAAESLGIEEEISESWSRIQELSDDIRKLKSDMNDLRDERDA
                     CNDLIDKIEQTWDKWEALGSKLANGATVYPPNSPSKKRKRQSGPKGSRKNCCSSDIDS
                     DFSDTDGSDSSDKENQEARNEEREPLTSEQVDAKLASLKNEKKEVRAKKKEIEEKIKA
                     FRERIKQLTAEKEVILAEVKAVCIQGRNEYSRKAIKQDFAMGIKELDQENAAEEDEAN
                     FDPDVDLRDYDAVAASLPVFCVSSRAYQKLSGRLQKDDFNGSGFQSPEDTEIPQLQAH
                     AKKLTEAGRTAAARRFLDSLMQLLNSMTMWASDDGTGSSLTDTEKGKEETRLRKQLRK
                     MEQVSDPAASAPTHRSD"
     gene            1224257..1225634
                     /locus_tag="MYCTH_2310143"
                     /db_xref="GeneID:11513820"
     mRNA            join(1224257..1224550,1224671..1225634)
                     /locus_tag="MYCTH_2310143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665869.1"
                     /db_xref="GeneID:11513820"
     CDS             join(1224326..1224550,1224671..1225435)
                     /locus_tag="MYCTH_2310143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665917.1"
                     /db_xref="GeneID:11513820"
                     /db_xref="JGIDB:Spoth2_2310143"
                     /translation="MSHMTNPLATPDQLFQRRSFEALPIELQDAIFFATQCLTQAAGI
                     LLQLPQSVTAQANVLLARYWLVEPMMSHEFSDVSAATVYLTAKLSAHPRSPRDLANVY
                     AYLLSPSSSLFQPPTAPPPANEPASYYLSESAYHAFHARVLALEARALYALAFDTHVA
                     LPHPLAVTYLQALDFLAVAPRERIGSRAVAYLNAALLSPQMLYLTSQPNALAVAAVYN
                     AARDVGAKMPECEWWEVFDVDREELGFLVVGMRSLDGWGRKMRADLARIMRGAERGMV
                     TRRDVEDELRRRGIEVVVVRAPRGGGAAEADDAEEEAARRMDEKMADLEARGV"
     gene            complement(1227369..1230624)
                     /locus_tag="MYCTH_2310145"
                     /db_xref="GeneID:11513821"
     mRNA            complement(join(1227369..1227617,1227719..1230087,
                     1230144..1230624))
                     /locus_tag="MYCTH_2310145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665870.1"
                     /db_xref="GeneID:11513821"
     CDS             complement(join(1227474..1227617,1227719..1230087,
                     1230144..1230489))
                     /locus_tag="MYCTH_2310145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665918.1"
                     /db_xref="GeneID:11513821"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2310145"
                     /translation="MLSNPLHRFSPYHIPSTTLLSNGHVPGGHLHAAGLDSLAPGSHY
                     ALQQLQQHVGVHTPHLARTGPQPKHRQHPYGPAARSSGAAGPIRRRISRACDQCNQLR
                     TKCDGQHPCAHCIEFQLGCEYIRERKKRGKASRKDLAQQAAAQAAAQAAQNGQKTENS
                     TTENTKPAENRNDTPSNTKPVLTVNTDQPPALDKNVTDVPEDPNLREQRTGSIEALGD
                     MSAHPAPMSAHPGAIEREHLDNPTALDLNGYGSVHSAYDRQMGAHMMNGPPHAPYGPN
                     QGNMSSYPELPYALQTQSPTGYPANAANGFRLANSPLGPYSMGGEAPSPGGWMNMSSP
                     PPQFASHMPQNGYNRSQLRYPVLEPLVPHLGNIIPLSLACDLIDLYFASSSSAQMHPM
                     SPYVLGFVFRKRSFLHPTKPRQCQPALLASMLWVAAQTSDAPFLTSVPSARGKICQKL
                     LELTVSLLKPLIHTPSEEASPVSSPIVDGVALGGLGVALPGSISMDALTSESGAFGAA
                     GSLDDVVTYIHLATVVSASEYKGASLRWWNAAWSLARELKLGRELPQNAPASRQGGAA
                     EMEGEGNGAEMTIPGVITEEEREERRRIWWLVYIVDRHLALCYNRPLFLLDIECEHLY
                     QPMDDTDYQNGNFRAYTTDPNVLGSDTEGKRTRVKGPSFVCSGHSIFGYFLPLMTILG
                     EIVDLTHAKNHPRFGVGFRSSREWDDQTAEITRHLDMYEQSLKEFEKRHLSINAQAQA
                     ADEKAAEAAGVPTANANDLPGTPSGHSVHSVHTTSSRMTESDIQTRIVVAYGTHVMHV
                     LHILLTGKWDPINLLDDNDLWISSQGFITATGHAVSAAEAISNILEYDPGLEFMPFFF
                     GIYLLQGSFLLLLIADKLQLEASPSVVKACETIIRAHEACVVTLNTEYQRNFSRVMRS
                     ALAQVRGRVPEDLGEQHQRRRELLALYRWTGDGTGLAL"
     gene            <1232547..>1233615
                     /locus_tag="MYCTH_2112717"
                     /db_xref="GeneID:11513822"
     mRNA            join(<1232547..1232618,1232654..1232735,1232789..1233002,
                     1233153..1233235,1233444..1233544,1233583..>1233615)
                     /locus_tag="MYCTH_2112717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665871.1"
                     /db_xref="GeneID:11513822"
     CDS             join(1232547..1232618,1232654..1232735,1232789..1233002,
                     1233153..1233235,1233444..1233544,1233583..1233615)
                     /locus_tag="MYCTH_2112717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665919.1"
                     /db_xref="GeneID:11513822"
                     /db_xref="JGIDB:Spoth2_2112717"
                     /translation="MGPAAPAGTQCASGGRAPWSPMLAMEPSNADGRDHPDPPRYKTP
                     VISLQWWSRSEVSMFVGGIAESTWGPCVSRDPKESLFEVDRWRPVFKGFARAQHRTLS
                     TRAAYGSSGLNEVGYAKPVPLKEQCSRNMETTMPVFLITPAPGNSAKEKQADPSCGAF
                     PVASPLGQNVSRPVLGLNPTLVPTISAKKAAKKW"
     gene            complement(<1235961..>1236497)
                     /locus_tag="MYCTH_2129802"
                     /db_xref="GeneID:11513823"
     mRNA            complement(join(<1235961..1236040,1236118..1236320,
                     1236460..>1236497))
                     /locus_tag="MYCTH_2129802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665872.1"
                     /db_xref="GeneID:11513823"
     CDS             complement(join(1235961..1236040,1236118..1236320,
                     1236460..1236497))
                     /locus_tag="MYCTH_2129802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665920.1"
                     /db_xref="GeneID:11513823"
                     /db_xref="JGIDB:Spoth2_2129802"
                     /translation="MRSVTLVKSQGRSPKPSSPSPTDEESVTIGVFAIMVRRALVGSP
                     WPFPWLESTSDAARVQQLQPPTPPPPPPTQFKHVALLATHFGGAIAGLSPTTGSRSLP
                     VRDR"
     gene            1240817..1240932
                     /locus_tag="MYCTH_t167"
                     /db_xref="GeneID:11513824"
     tRNA            1240817..1240932
                     /locus_tag="MYCTH_t167"
                     /product="tRNA-Arg"
                     /note="Anticodon: ACG"
                     /anticodon=(pos:1240849..1240851,aa:Arg,seq:acg)
                     /db_xref="GeneID:11513824"
     gene            complement(1241368..1241451)
                     /locus_tag="MYCTH_t178"
                     /db_xref="GeneID:11506384"
     tRNA            complement(1241368..1241451)
                     /locus_tag="MYCTH_t178"
                     /product="tRNA-Arg"
                     /note="Anticodon: CCT"
                     /anticodon=(pos:complement(1241417..1241419),aa:Arg,
                     seq:cct)
                     /db_xref="GeneID:11506384"
     gene            complement(1241602..>1242099)
                     /locus_tag="MYCTH_2310148"
                     /db_xref="GeneID:11506395"
     mRNA            complement(1241602..>1242099)
                     /locus_tag="MYCTH_2310148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665873.1"
                     /db_xref="GeneID:11506395"
     CDS             complement(1241737..1242096)
                     /locus_tag="MYCTH_2310148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665921.1"
                     /db_xref="GeneID:11506395"
                     /db_xref="JGIDB:Spoth2_2310148"
                     /translation="MGFGGRPRFAAKEAAFKAHPHLRLGFHDILILSSSDAEELTGER
                     ALAGPGASAPVALIRAGEGAGAGARDQMARVSISHDGEYATATCIGFEAGSAGSGQCT
                     SEPPRKGWAAWFSRIWS"
     gene            complement(1242121..1242757)
                     /locus_tag="MYCTH_2310149"
                     /db_xref="GeneID:11513825"
     mRNA            complement(1242121..1242757)
                     /locus_tag="MYCTH_2310149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665874.1"
                     /db_xref="GeneID:11513825"
     CDS             complement(1242208..1242519)
                     /locus_tag="MYCTH_2310149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665922.1"
                     /db_xref="GeneID:11513825"
                     /db_xref="JGIDB:Spoth2_2310149"
                     /translation="MPPLPLAFPYPLRIGTDICRVARIAHILRSRQGARFIRRVLAPE
                     ELARARPAVHQVLRVAAAQQAGEEEERAKGSARQEDEADEAKGGDLDAYARAATYMAG
                     R"
     gene            complement(1243115..1244832)
                     /locus_tag="MYCTH_2310154"
                     /db_xref="GeneID:11513826"
     mRNA            complement(join(1243115..1243444,1243611..1243924,
                     1244130..1244221,1244315..1244531,1244590..1244832))
                     /locus_tag="MYCTH_2310154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665875.1"
                     /db_xref="GeneID:11513826"
     CDS             complement(join(1243208..1243444,1243611..1243924,
                     1244130..1244221,1244315..1244531,1244590..1244608))
                     /locus_tag="MYCTH_2310154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665923.1"
                     /db_xref="GeneID:11513826"
                     /db_xref="InterPro:IPR013920"
                     /db_xref="JGIDB:Spoth2_2310154"
                     /translation="MDRFHQLNPFAKRESHSARSIVWYKVLTLITWLLSVVVTVYYTL
                     ERPQDGKYHRGTIWHQNHRHPSGFSLNPVITSIYWIVLFLLQLGYISQLFSSKTESVN
                     AACSVGSHFIVNNLLHFAFVMLFVRSHFVWAEVLLLLNFANLTSLYFRHSAHPRLSVH
                     LPAVSGPLAWTFVAIYWNGAIMVPHHNSLVARVFANIFVWSILGYGLFFIVFYRDYTM
                     GFALSVLSASLGVAQFLRQIVALQWIFAFTIMAVLFVLTVVVALPAWAGRQAPWGGRA
                     ERRQQTDAERAPLLNE"
     gene            1246101..1248104
                     /locus_tag="MYCTH_2310160"
                     /db_xref="GeneID:11513827"
     mRNA            join(1246101..1246123,1246288..1246646,1246700..1248104)
                     /locus_tag="MYCTH_2310160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665876.1"
                     /db_xref="GeneID:11513827"
     CDS             join(1246492..1246646,1246700..1248062)
                     /locus_tag="MYCTH_2310160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665924.1"
                     /db_xref="GeneID:11513827"
                     /db_xref="JGIDB:Spoth2_2310160"
                     /translation="MTKFRNGTRRSAPRLPDKEWERMKQVIMDKYRILPLEAVVKYMK
                     KEHNFSATRRQYIHRLKGWGVRKYKPTHSGPVRRSSPAPATSGSDAPPPPVDVDELCV
                     VRVRPSSDYPELTANAGWPKRGRGQPGPLRDSLLWLADMLSLLGDFRNVGHIVTEQWK
                     TNLRRYGGDAWLSTTRAKMEPKVARMLARSGDRQPVPSQDSWERLCWEFRHAYTYCTA
                     GGEETHGEEQIAIALDRIIFQDGQGADRLKQLDRRVSGLDTPAYVLLRSALARYNSVH
                     PDDKKFDLDNIMQQFVAQHLPTTTRSGPDITCLSSCLRWCISELEKNDAGVPPQVPRP
                     PGTRRRHSAIRPGADDFFTTLCTFWHHLSQESGGILPCRRGAGARAPAWALDAEDQLG
                     IQAPYLLGIVVCMITAADLQETCGEAARRPVLERALAGAKALNRLLDRGQSGKDALLE
                     AFLRQACAVGWPLTELHDRDLGCRVRDVRVDADSMAPYRRYIAESLRVTDLSPPT"
     gene            complement(<1248802..>1250015)
                     /locus_tag="MYCTH_2069574"
                     /db_xref="GeneID:11513828"
     mRNA            complement(join(<1248802..1249192,1249241..1249650,
                     1249854..>1250015))
                     /locus_tag="MYCTH_2069574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665877.1"
                     /db_xref="GeneID:11513828"
     CDS             complement(join(1248802..1249192,1249241..1249650,
                     1249854..1250015))
                     /locus_tag="MYCTH_2069574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665925.1"
                     /db_xref="GeneID:11513828"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="JGIDB:Spoth2_2069574"
                     /translation="MAFTMHSHSGQFCPGHAKDQLEDIILHAIKVGYKTIGLTEHMPR
                     TELSDLYPEELDPSPEETLASLAPRHEAYLAEARRLQQKYASQIHVLIGFEGEWIRPA
                     YGPLIRSLAADPAVDYFVGSIHHARGVPIDLDAPTYADAVRACGGTERALFAAYFDEQ
                     FAMLEAVRPRVVGHFDLVRLFSSAPGRSLRRGKGGEEVWARVVRNLECVRRYGGWLEC
                     NTSALRKGLAEPYPQREIAEEWVRMGGRFTFADDSHGIAQVATNYRRGLDYLEGLGVK
                     EVWTLERRRAPAAEEGGGGGDEDEAELVERSVSIDEFRASMNLE"
     gene            complement(1250411..1264252)
                     /locus_tag="MYCTH_2310162"
                     /db_xref="GeneID:11513829"
     mRNA            complement(join(1250411..1251252,1251316..1263596,
                     1263656..1264252))
                     /locus_tag="MYCTH_2310162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665878.1"
                     /db_xref="GeneID:11513829"
     CDS             complement(join(1250785..1251252,1251316..1263596,
                     1263656..1263947))
                     /locus_tag="MYCTH_2310162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665926.1"
                     /db_xref="GeneID:11513829"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="JGIDB:Spoth2_2310162"
                     /translation="MEAITSPPATSPGGNSVAATPFAAVDPVRVVDHLASLLEAALGA
                     TRKELEAPGSLLSKARYAETLQRCTRFAVDTQVALYVQKDLVPTDTVEDGEAEEAPSH
                     AYTISSDFSSSSTTVAYLVLLKRPQPLDPNIPITSQIQMLNLPGPAYLSANGGEQGPT
                     ASPFEILQLYLHNGLAPYFDASTKSQQTLSGGRGRADVDAKTGIPVTKKRWTELELAL
                     LHLQQNVEIPEVSLPFHPIVQTALDEAVARGTKPTLDLIPPSVLQDSTFLNNLQATVN
                     NWIKSIQVITKMTRDPTTGTATQEINFWLSMESALEGIENQLRSEGVMLTLEILKHAK
                     RFQATVSFTADTGLKEAMEKVQKYNQLMRDFPLDELLSATTLLKVKDSIGQIFTHLNK
                     KLRICPYPIRRALPLVETISGDLDEVLHRLLPGTELVKLDYQEFRRVMKQTDDIFRIW
                     DENIKEFTNVAREVTRRRNERFIPIKIVPRHAELQARLKYVSNFRDNHEQLQRTIVNV
                     LGPKATVNGISDGSGANGTAVVEEIGDVDAVEEVRQAWEGLKDVDLLDVTPEGTAKWA
                     RAENIYNERTSRVENSIIARLRDRLATAKNANEMFRVFSKFNALFVRPKIRGAIAEYQ
                     TQLIDNVKQAITALHERFKQQYGHSEAHAMAQLHDLPPVSGAIIWARQIERQLDGYMK
                     KVEDVLGADWALHAEGQRLQSESDLFRKKLDTRPIFEAWLHDVQRKQISISGLLFNIN
                     RIRSAGNTLELAVNFDAQVIALFKETRNLVWLNFPVPHSINNVAKEAKRVYPYAVSLM
                     ESVRTFAQTNRQIADMSEVAVLLSGHRDEVYTLIAKGIPLKWESFVNTYEVHFKNYTA
                     NGGLDNFKGGESKHVMFIREFAAAVSLLQSKTITLANIHATVQKAMAELEKCPYEVSE
                     FESRLETIQSAVDQLNLEQYVNLGYWVERMNRQIKAILLARLQHAVQAWIEAFEDEHL
                     ERSGDRRRPLQTTDGAKADVPVIKKLVHEITMRNQVIYLDPPLEFARASWFSQLQEWI
                     GVVCNLKKIKATRYQMSISTTVYDEPRFSDLPSECTPALLRVQTSVEKKISEISAYVD
                     KWLQFQSLWDLQSEHVYDVLGDQLSRWLQLLQEIRKTRQTFDTTEVSRSFGHITIDYD
                     QVQTKVNAKYDQWQHDILIKFASRLGTRMREVHAEVEKARRDIEGQAIEANSTAQAVQ
                     FITTVQTCKRQVKLWAPEVETFRQGESTLVRQRYQFPNDWLHVEHVEGAWDALNEALA
                     RKAKIVQDQTDALRAKIIAEDKVILDKINEIAHLWNEEKPVSGTIPPDVASATLSDFE
                     TKITRLQEESAMVAKAKEALDLQPTPETSLGIILEEVQDFKSVWASLSTIWNNLNELR
                     ETLWTSVQPRKIRSSIDNLIKMTKEMPSRMRQYAAFEHVQNVLRQLMKVNPILTELKS
                     EAVRDRHWTKIYKQIKPGKRYSPVSMTLGDVWDLNLVATEVIVKDIITQAQGEMALEE
                     FLKQVRETWTGYTLELVNYQNKCRLIRGWDELFAKCSENLNSLQAMRHSPYYKEFEEE
                     ASSWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPIESSRFQNINSEFTA
                     VMKKVYKQPNVLDVLNIPNVQKSLERLAELLNKIQKALGEYLEKERVSFPRFYFVGDE
                     DLLEMIGNSNDTMRIAKHFKKMFAGLTGLVMDEESVITGFTSKEGEVVRLKKEISLVK
                     TPRINDWLALLENGMKATLAELLAEAIDEFSPIFASEVIDREALRKFMEAYPSQIVVL
                     ATQVVWTTSVDQSLAAGGTTLQTLFDREVQLLRLLADTVLGDLEVLMRKTCEQLITEC
                     VHQRDVIEKLIKANARSNTHYLWLLQMRYVYTPEGDFLQRLHIKMANAKLSYGFEYLG
                     VPDRLVRTPLTDRCFLTLTQALCQRLGGSPYGPAGTGKTESVKALGVQLGRFTLVFCC
                     DDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQNIQLGLKHGAEDEN
                     AQIELVGRQLRVNANTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDKELIAEVML
                     YSQGFNQAKQLSKQTVPFFDQCSVKLSKQAHYDFGLRALKSVLVSSGGLKRARLTNSG
                     GNLGAEEVVEPEIIVQSIRETIAPKLIKSDVEIMMGIEEVCFPGVKYVPANLAKLEEA
                     IRRLAAERHLVVSELWMTKVLQLYQIQKIHHGVMMVGNSGSGKSAAWRLLLDALQQVE
                     NVEGVSHVIDSKVMSKEALYGNLDSTTREWTDGLFTSILRKIVDNLRGEDTKRHWIVF
                     DGDVDPEWVENLNSVLDDNKLLTLPNGERLNLPPNVRIMFEVENLKYATLATVSRCGM
                     VWFSEDTVTPDMMVTNYLETLRSVAFEDLDEDAVATGQSSAKALEVQGQVADLLHAYL
                     TTDNFIILALQQAESFNHIMEFTVARVLNTLFSLLNKAVRNIIEYNAQHSDFPLDPEQ
                     VEAYISKKLLLAMVWALTGDCPLADRKVFGDKVAGLASFGSPPLDGSSSLIDFDVALP
                     GGEWTPWQSQVPTIEVNTHSVTQTDVVIPTLDTVRHEDVLYSWLAEHKPLLLCGPPGS
                     GKTMTLFSALRKLPNMEVVGLNFSSATTPDLLIKTFEQYCEYKKTLNGVMLSPTQIGR
                     WLVIFCDEINLPAPDKYGTQRAISFLRQLVEHNGFWRTSDKSWVTLDRIQFVGACNPP
                     TDAGRTPMGARFLRHAPLIMVDYPGEQSLMQIYGTFNSAVLKIIPSLRGYAEPLTQAM
                     VRFYLESQQRFTPKIQPHYVYSPRELTRWVRGIYEAIKPLETLSVEGLIRIWAHEALR
                     LFQDRLVAEEERKWTDEAVHRIAMEYFPTIDEQKALGGPILFSNWLSKHYMPVDREQL
                     RDFVKARLKTFCEEEVDVPLILFNDVLEHVLRIDRVFRQPQGHLILIGVSGSGKTTLS
                     RFVAWMNGLKVFQIKVHGKYSAEDFDEDLREVLRRCGCKGEKICFIMDESNVLDSGFL
                     ERMNTLLANAEVPGLFEGDDLAALMTACKEGAQRQGLLLDSQEELYKWFTGQIVKNLH
                     VVFTMNPPEDGLSSKAATSPALFNRCVLNWFGDWSDQALFQVGHELTHSVDLDRPNWV
                     APDTIPVAYRGLSLPPSHREAVINSMVYIHYSLHRFNAKLHKQQGKVTYLTPRHFLDF
                     VAQYVKLYNEKREDLEEQQRHLNVGLEKLRDTVDKVRDLRASLAEKQKQLEQKNDEAN
                     EKLQRMVADQREAEQRKATSLEIQAALEKQEAEVASRKEVVLRDLARAEPAVEEAKAS
                     VSNIKRQHLTEVRSMSAPPQGVRLALDSVCTLIGHKVSDWKSIQAVVRRDDFIASIIN
                     FDNEKQMTRALRLKMRNEFLANPEFTFEKVNRASKACGPLVQWVEAQVNYAEILDRVG
                     PLREEVKQLEEQALQTKAEAKAVEETIQNLEASIATYKTEYASLISETQAIKAEMSRV
                     QFKVDRSVKLLDSLSSERTRWEEGSKSFETQISTLVGDVLVAAAFLAYSGLYDQTFRK
                     SMMEDWLHQLHLSGIQFKQPNPVTEYLSTADERLGWQENTLPVDDLCTENAIILKRFN
                     RYPLIIDPSGRVTEFLQRECKDRRLTVTSFLDDSFTKQLESSLRFGNPILIQDAEHLD
                     PVLNHVLNKEYQKTGGRVLIQLGKQQIDFSPSFRLYLSTRDPSATFAPDICSRTTFVN
                     FTVTQSSLQTQSLAEVLKSERPDVDERRSNLIKLQGEFKVHLRQLEKRLLQALNESRG
                     NILDDDNVIETLETLKTEAAEISTKMSNTEGVMAEVEEITLQYNVIARSCSAVFAVLE
                     QLHYLNHFYQFSLQYFLDIFHSVLHGNPHLAGETNHTVRRDIIVKDLFVNTFKRTALG
                     LLQKDRITLAMLLAQASPYKMDKGLLDVILDERIEGKDVSTDTAAKEEVFARAKRISA
                     LKEKLDGVSEADWDRFFTEELAENFVPKVWDDSTAPAGQALISLLLVKLFRLDRFVPV
                     AERFVTLVFGSDLFDIVEDLKQTVDQVSATRPIALVSSPGFDASYKVESLVERMRVRC
                     TNIAMGSNEGVASADKAIANAAQTGSWVLVKNVHLAPTWLQSLEKRMESLNPNKDFRL
                     FLSMESSPKIPVNLLRASRVLMYEQPAGVRANMKDSMSSLSTRSVRSPVERTRLYLLL
                     SFLHAVVQERLRYAPNLGWKGFWEFNDADYECSAFVIDTWIDAAAQNRTNIAPANIPW
                     DMIRYLITETYGGKIDDDADFRELNKLVETFLTPAAFEIGHKLVAASTAEQEGGEAPA
                     ELVVPSGTSLQEFMGWIQRLPEREPPTYLGLPANAEKLLLVGLGKSLIGNVKKVTDLL
                     DEGEALMAEA"
     gene            complement(1264854..>1267083)
                     /locus_tag="MYCTH_105286"
                     /db_xref="GeneID:11513830"
     mRNA            complement(join(1264854..1265528,1265991..>1267083))
                     /locus_tag="MYCTH_105286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665879.1"
                     /db_xref="GeneID:11513830"
     CDS             complement(join(1265125..1265528,1265991..1267083))
                     /locus_tag="MYCTH_105286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665927.1"
                     /db_xref="GeneID:11513830"
                     /db_xref="JGIDB:Spoth2_105286"
                     /translation="MSSANNHPGLSFGLRRSFPPPQQHNPTNKPSPSLSQHASPYPPH
                     AYQHQHQQHPTSQYPHHLFTPPPSQIPNVASLQNASRPPPPQAPPQLPGPRQRAPPPR
                     QMQQPSSISYLHQSLNSQPMGQQSMPPQSMPQQSLPQQSLAPQSMTPQNLNPQPMNPQ
                     QLSQPSMGQQSLGQQSLGQSSLGQQSLGQQSLGQQLQQPLSQPPMAPSMTQSMSQQSM
                     GQQSMAQQSMSQQSISHSVHSVQHNDGSILSQQSTPRPSSQPTLPPAQQPMSQVQQVQ
                     QVQQVQQVQQVQKLPQAQQVQQVQSVSQVQPVQQQPAARHSDSAEPVQENHQEEDAEG
                     ASHDESAETETALEPKLIESSPFVPRQPMGGVGVSQTLEILQQENPHVPLLPRDIYNA
                     RAAINRNPQKVASGLAENRPAIYSKPHPTAEERIRADLRRELANTREELEKVKKDSEK
                     EIEELKAKLREKDKMIEKFEQFIDICNQRVIVSLSNKEDNRTGGSTAS"
     gene            complement(1268018..1270857)
                     /locus_tag="MYCTH_2310167"
                     /db_xref="GeneID:11513831"
     mRNA            complement(1268018..1270857)
                     /locus_tag="MYCTH_2310167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665880.1"
                     /db_xref="GeneID:11513831"
     CDS             complement(1268128..1270521)
                     /locus_tag="MYCTH_2310167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665928.1"
                     /db_xref="GeneID:11513831"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="JGIDB:Spoth2_2310167"
                     /translation="MLHEILLSLAGHPSPLLRSAASPPNPDDPLSSDVVISPPERALL
                     ATLARLSDLHIRLVTATAHVSATHPSVICRAVASAVDGLHLAAFRRKVLEVERTLLRK
                     DAALVGAYDIVPLTAVVAEFAGWERRLEWLARVVGVVREQGCTGARAMDFLRGELQTG
                     FRDIEEAARSLVGVAEAAWVKQVAAWVLYGRLPEFGERDFFVVVKKAAEGEEGGEEFA
                     CESALLPGFVTPATAASMLFIGKSLNQIRAKSVDDHRLRGTDHLSTQLTRLSALRHPI
                     DSATFARTIADIRHFLSRTTLQRLLPLSKVLETLQLLRDFFLLRRGEFAMALTQQADE
                     KIRSRWKRAENLAYERRDGLSNVTVKEGEVAAVLAKTWAAMGSMQGEHAEEDEGLELA
                     RDLLRLSIAKPRATTPATPVSAEGGLPLVAPTPFRNLLFSVPVVLSMQIPSPLDLFLS
                     HSDVQTYTAINSYLLSLRRAHIRLTDLWKITSLRRHHPAPPRPPYGSTRGGRERVHLL
                     RQRYATRSSILRNSWATASAAIFFLGEIEGYLQTEVVAGLSDGFHRWLTTGEDDQRHD
                     DDNSGRKQTPIPASPKDDIDMTDEDDEDNEEDIWLEGSNSASQQTTSKASLHHDPQTL
                     ATAHRLYLRALVHRLLLTQQSFTDPLYELLVQIDHLVALVHRLHSVWTAADLEADAGV
                     VDAFVDLEREERDVQGEIRSVEERVKKGIEGLIAELRRLEGSAALQGGGGGGGGGGGE
                     FAGGADEGQGEGDSAMRERGEYVPRRVGGVDRLLMKLDFGRWFGRGGDEGAVDDGGF"
     gene            complement(1270823..1273115)
                     /locus_tag="MYCTH_2316205"
                     /db_xref="GeneID:11513832"
     mRNA            complement(join(1270823..1272038,1272104..1272785,
                     1272842..1273115))
                     /locus_tag="MYCTH_2316205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665881.1"
                     /db_xref="GeneID:11513832"
     CDS             complement(join(1271194..1272038,1272104..1272785,
                     1272842..1272859))
                     /locus_tag="MYCTH_2316205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665929.1"
                     /db_xref="GeneID:11513832"
                     /db_xref="InterPro:IPR009686"
                     /db_xref="JGIDB:Spoth2_2316205"
                     /translation="MASGHNDPKLLYAINGVSAYHIVNGKEEPLTPAGPQTLSLLMVP
                     TTSAFADPAIDPDATPEQDFYLHLHLPPELDLPLPATTQIYHQPPTSYLIPRWDLGPD
                     SGAFTRIEFPQVESRKGIQEDVDTFETILAQCTAFLERAPPPKIGKDEQWWEGGSESQ
                     KSAARKAAEAAGDALPAYNPADFKPGEGYVRGSHSGAAKGQIVLVDEEDGSVIGELAD
                     GYQVVEDSKLKPGSKDPVEITLPAAGGQNINVAPISQDLYAANLHPAYKKSFLVSNAS
                     AASRLIITGSDMLSKLLQNQADNFTKKVQPDAKPLTFKPTTREHIRRISAFTGSAAAL
                     SAKTVGQITKVAQNWGASLGGHGKNKDGSPHKGFDKDGKPIPTYKPGLLNKSMMAFST
                     VMDGVEQAGRNLLASTSEAATTVVGHKWGPEAGEVTRSLGSGVKNVGLVYIDVTGVSR
                     RAILKSVAKGMVVGRTSTGDNIIVGGGDGGVATLNRERQDTQSLSGMTVAEGKQPAGS
                     LNEKYK"
     gene            1276501..1279744
                     /locus_tag="MYCTH_2310172"
                     /db_xref="GeneID:11513833"
     mRNA            1276501..1279744
                     /locus_tag="MYCTH_2310172"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665882.1"
                     /db_xref="GeneID:11513833"
     CDS             1276945..1279563
                     /locus_tag="MYCTH_2310172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665930.1"
                     /db_xref="GeneID:11513833"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2310172"
                     /translation="MSGSPGSPGAIDSKKGIKRTPLRSSIACQRCRKSKIKCNNTGGD
                     QPCETCIRNGKECTYPEVTPAPPKRSEPSSGVKMEQGPERKRLRRIEDIVKMEGAVPP
                     AVVAEDVLSAPYLTETVWNQLFDIYRLHFATELPFLHLATLKEKLGNRFRAKPADTSP
                     EINLVLLGILTLTARFHSTLVSYVTAPRNSPAGPGVPKPRQGGPAQDASSASEYYADV
                     LTKALGGLRTSMTVASVERVQAFLMLGLYEWSQARPRVGGMAAWMYVGVAIRMAQALG
                     LGDGDKESGKVFRSRPVKPAQQTMTPTQRITAKEIRRRTMFSCLILDRLLGCGKDRVS
                     TIRSEDLQIQLPCAEVSFDLSDDVYTGFLKPTPGVDPNRPISDSVLGRFVRLVDLWGE
                     ISKWSFSGGRFTEDHPPWSPESNFFQLRRKLEAFYGDLPDHFKWSDSNYYKHENHQAS
                     SVYVSLHMLGAVCRIMLHREYIPFIPILCSTPVGPLDEPTFAPGQEPQGFWEASAEEI
                     FHAAKDIVDLAEICRDKLPMSSLVLFAIWTAAFVGIYAVHFPHMDTKGHMLPKEETKG
                     PIDVTKHGPTGLTYKLLTHMSLWLKLAETYVGYFNEMARYYETVKQDYERYVGSNNKS
                     RRGGGGLEEWKERAFKVVNNGEILVVDEGKSTSRDSTVEPGSSVGPDGSSHPTDHAKT
                     PRSTSMSFTPINTSQSHQGQSDSASEAAAEAAASTLWRIQQPHGHQHNSHHPHPHPHQ
                     HQHQHQHQHQHQHQHQHQQPSPSQTSGAVPSPQMAQHPHPHANATMAMSTMAVPKLPP
                     YDAGEVAMYLEQNQSMPWNLAPGGVDQFAHGTEDLDHLDQGNLFWGSMPENWTGSTTA
                     GVGVGMGGMLQGYSGY"
     gene            complement(1280535..1281150)
                     /locus_tag="MYCTH_113387"
                     /db_xref="GeneID:11513834"
     mRNA            complement(join(1280535..1281038,1281116..1281150))
                     /locus_tag="MYCTH_113387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665883.1"
                     /db_xref="GeneID:11513834"
     CDS             complement(1280689..1280955)
                     /locus_tag="MYCTH_113387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665931.1"
                     /db_xref="GeneID:11513834"
                     /db_xref="JGIDB:Spoth2_113387"
                     /translation="MSAQQSPFDAVGMLPEQGHHAQHSRSSSTQSSSSSAADGAVPDL
                     VRLDMEFFMARLTRTSSSSSSSSSSSSSSSTGPSVVSDIFAASR"
     gene            complement(1281765..1285911)
                     /locus_tag="MYCTH_2310174"
                     /db_xref="GeneID:11513835"
     mRNA            complement(join(1281765..1283444,1283552..1283950,
                     1284035..1285275,1285397..1285523,1285640..1285911))
                     /locus_tag="MYCTH_2310174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665884.1"
                     /db_xref="GeneID:11513835"
     CDS             complement(join(1282606..1283444,1283552..1283950,
                     1284035..1285275,1285397..1285523,1285640..1285685))
                     /locus_tag="MYCTH_2310174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665932.1"
                     /db_xref="GeneID:11513835"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="JGIDB:Spoth2_2310174"
                     /translation="MSSNGNDQSNPSTLSGMLSTLAPVALVSAVYISIFLVLRKSQRR
                     YYAPRTYLGSLREGERSPPLPSGLFNWVSRFWKIPDVYALQHQSLDAYLYIRYLRMAL
                     VMCLVGCCITWPILFPVNATGGGGQKQLDILSYANIDRENRSNRYYAHVFVGWLYFGF
                     IMYMITRECIFYINLRQAFLLSPFYANRISSRTVLFTSVPDPYLNEARLRKVFGPAAK
                     NIWITADTKELDKLVEERDKVAMRLEKAEVKLIKLAHKARQEAIKKKKGASAEEPDMD
                     PIVADAESGSIAARWVPQKKRPTHRLGPLGLVGKKVDTINWCRAELERLIPEAEAAQA
                     KYRAGGYKNIPGVFIEFRTQSDAERAAQILAHHQGLHMSPGYIGIRPGEIVWKSLSIP
                     WWQKVIRRYAVIAFISAMILFWAIPVAFVGAVSNITYLESLSFLTWLQKIPSVIMGVV
                     TGLLPSVLLSVLMSLVPIVMRLCAKLAGEPSDSRVELFTQNAYFAFQVIQVFLVTTLA
                     SSATAVAKQIVDNPASATTILANNLPKSSNFYISYFIVQGLSIATSVLTQVVGFFIFT
                     LLYKFLANTPRTLYQKWSTLSAISWGSTMPVYTNIVVIAITYSCIAPLMLGWATVAMF
                     LFYFAWRYNVLFVTDTQVDTRGLIYPRAIKQLFTGLYLAEVCMIGLYGASVAPGPLVL
                     MVACLVFTVLFHISLNSALNPLLYNLPLTLLAEEESGRLLDPEKTVSAEPVASTAEST
                     AENKAGSKEDRAAEDLDATEARVREAREARKAAAAGGNPFTRFLKPWVYADYAVLRRL
                     VPRSLDLDPYPDEVAANAYYPPSVTSTPPLLWVPRDAAGVSRQEVAHSGRVIPITDEG
                     CELDEKGRLVWDREKTRPPVWEEKIYY"
     gene            1287980..1290065
                     /locus_tag="MYCTH_2310181"
                     /db_xref="GeneID:11513836"
     mRNA            1287980..1290065
                     /locus_tag="MYCTH_2310181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665885.1"
                     /db_xref="GeneID:11513836"
     CDS             1288237..1289859
                     /locus_tag="MYCTH_2310181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665933.1"
                     /db_xref="GeneID:11513836"
                     /db_xref="JGIDB:Spoth2_2310181"
                     /translation="MAKRDRRGERRAVPSHLAEHEDDEHAGQRGYVKGTDYALPYFSQ
                     WSRLYESEPEIRDGLLRHVNCGYLSTHGVPPTLLALKQHAQSLCVLIHALNPTLESAE
                     IAPGGSGGGGDDPLALRYKLNDAFDFLDDLTVPYINDDPDHHKPLAALANEVRARDEA
                     VGTTAYHCPLAETRPRGGAGADKQRPYANHHNLVMHANACLERLDHELGSTGGLMSLL
                     PPANTSSGSDLAAAAARDSLLGQWLHFTQSLVGRMHELERAYGSALDALAGEAVVPAA
                     LALSLSLSQYQTRSPPAGGGGGGGGGGGGGGRELVYPQDRWVLANAGDDAFERVHALL
                     DRREALAAARERVWRRNGVIGDALWQQQRPRRDDEDEDDEDDDDEDDEEEDRGHARGI
                     VTVDILTRYYRVRGAGGAGSRSTVFVVPAWEQHPGVEYTREAEARPTVVACAQPRFPE
                     RATELERRFRDRINRARAVERDNLRLRNRMDELEAEVAVLSRHNHMLAKTRDALILAV
                     GGGSSNSTSTSSSAGADVAEPAPKLHEQRDRP"
     gene            1290723..1294403
                     /locus_tag="MYCTH_2310183"
                     /db_xref="GeneID:11513837"
     mRNA            join(1290723..1293506,1294112..1294403)
                     /locus_tag="MYCTH_2310183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665886.1"
                     /db_xref="GeneID:11513837"
     CDS             join(1290965..1293506,1294112..1294275)
                     /locus_tag="MYCTH_2310183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665934.1"
                     /db_xref="GeneID:11513837"
                     /db_xref="JGIDB:Spoth2_2310183"
                     /translation="MPPAPKGDAALRSGAAPRQVGARSLAGTRRCPGARRRRARTAST
                     LVTAVLGLAARASAEPVLPYTPTTILLAPDGAAGSGAAYIFAPSGDDRDAVDFLALNV
                     SSLRASALEPTKLTPDLPFLSKDAADCATFAPTILRNGTIVVLAGDCSSTAASTLWSY
                     TPGQPDARWTQHPVVPSASWDNAQAGPYHLGGLVNFSPQLSPVLSEPTLYFYGGMCPR
                     KSSSSADTWQSNAAYSNRMLRLIPPSPPPSSSSSSSYTLDYASAGGQQQPPVAEAGFT
                     WTELTPSLSNRTIITTTSDGGGKDGAGTEQVTTSIIITQQTSHVLLGGHTQGAFVNMS
                     TAAVWSLPEETWTFVSIAPPPAASSSSSSSSSSDDDDDDGRADLARQRERQEEEENNK
                     KKQKTKTKRRLRREAAAAAPGMVVDSRSGHTTVLSEDGTRLVVYGGWVGDVSRAAEPQ
                     LAVVRLGVGLADWEWEVPADQGSAPSSSSGGGGGVYGHGAVVLPGNVMMVYGGYETSE
                     GGKIRKRRTGGSMFYNITSGSWSDVYVSPLVQGNSGKSGGDGGDGGGGSTHGGDAGGD
                     SGLGGPAGNGNSSGDWTKAKRIGLGVGLGVGLLVLSILACLGVCWFRRRRQRRRSRDE
                     TLRGLSQGLNGPLARGVGEEDDGEMLERDHGMGMSFFPWTAATARDWYMGMGGDDPYM
                     QGRRSLGYESLRGGYRPSSSSSSSSLYMPPPPSASTFSHRPKAAKGLHHQPSSSYDFT
                     PLTRGPNRIEPIYEADEDSEGDLGKNYPLGPDKEERVGNDTDHDDDDDPFLTPTLSTP
                     TGGAFPRPHTANSSPRNSGSPTPPAAQRKKQQQQPAEETKLAAAAGGGGGGGGGGGGG
                     GGGGGGRGAAAAAGGRDGRRLRLRAGQSEQEQGEEELVREPEEGV"
     gene            1298390..1300858
                     /locus_tag="MYCTH_2316209"
                     /db_xref="GeneID:11513838"
     mRNA            join(1298390..1299002,1299076..1299356,1299753..1300858)
                     /locus_tag="MYCTH_2316209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665887.1"
                     /db_xref="GeneID:11513838"
     CDS             join(1298855..1299002,1299076..1299356,1299753..1300319)
                     /locus_tag="MYCTH_2316209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665935.1"
                     /db_xref="GeneID:11513838"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_2316209"
                     /translation="MGSQHFAPRWASFGIAALLCSMSRAQQQADGPSVPQVYCATVNT
                     ADMDPLFSNWQSDGRCYGNCTDLNYALAIVQNKNCWCSNLVPNKADRKPLSDCQNPCP
                     GYPSDYCGGDGVFGYMYAGGSTPTGTAAPGGSATGEPSSSTTGATTSGPPSVTTITVG
                     GTIRTVTAPTVPTATDGTSIGDDNGSGLKGGAIAGIVVGVVGGLLVLAAFLWFCFVKR
                     RKDREAADLGLQTGVGGSPGRMATPKSGEMTESRYGSTPGGAAAGAWDSQNKRRSHLM
                     PVDPRLDPFATGLYSGDQNRSRESLTSLQDNQDYSRRVHQAPRVLRATNPDPEED"
     gene            complement(1302497..1310668)
                     /locus_tag="MYCTH_2310189"
                     /db_xref="GeneID:11513839"
     mRNA            complement(join(1302497..1310372,1310550..1310668))
                     /locus_tag="MYCTH_2310189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665888.1"
                     /db_xref="GeneID:11513839"
     CDS             complement(1302843..1310267)
                     /locus_tag="MYCTH_2310189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665936.1"
                     /db_xref="GeneID:11513839"
                     /db_xref="JGIDB:Spoth2_2310189"
                     /translation="MMPPKRKRLDRGPSDAGSSRPSPHRPADTALGQHDRSFDGGRGG
                     RGGRNSRRGERRGSFQSQSANSSLNGPDPRSPPPPARPSSSSSSAALPPPTTAAPLAP
                     PPVPATPASSAAPASPVQTFYDYSIVTDDCVSRWAKGGRQEIIDHGVQSREDEDLTEV
                     VMIFQELIHSVTDGRLQGSDAGDVVREILGPEISEADRNDGAFDPHILFLDTVSTFLD
                     VESGPLQPQLRDFMVASNVSPALMRLVLDPPILQHLDLIRDTFVRMGIRQSTNLLYRQ
                     ANYNLLREESEGFAKLVTELFTISGAEPPTSEVVQTTFNKVMSLIGTFDLHPGRVLDV
                     ILDIFAAVLIKQFRFFIKFLRVSSWWPRSQLSLPTDRFVGGLPIWALPEHPGWVATEE
                     EEALLAQQRLERDIAFWERARKLKLDAYFELGGRQLAPSEEERLADGASGTGPESSIE
                     QEWIRITKTLPPPGNRDAAQMLGFKLRFYTSEARDPEDTLPANLLYLISLLIKVGFVS
                     LTDLWNHVWPLDEDMETVKEQKLKELEEKERAKRPGGEQNALMMAGALPDDMPPPPSN
                     NSRRDAATTKQDQNNKTPTAAEKPESRGPDDQKVLLLKCLLTIGAIPESLFIIGRHDW
                     ILRAFPDLVPLLHRILHHSIDVLYQQARPTSSTPIECPPKPQLDPDQTGVPKGHLKLK
                     TPPVKRALRWPNADQADVEGISYRFYWDEWADNVPVCRTVDDLFTLSDSLLNIVGVKI
                     GEDASLVTKLARIGSKSLSDDPSAHNTERWLGFLKRVLVPALSLGDANASAVDSVWDL
                     LKRYPVRSRFGVYAEWYEGATSRLEPVQKAFAHTKLLTLSKMKRLSHSNIMQMAKELA
                     KVAYQSPGIVCKVALQQIESYDNLIEAFVECAKYFTDLGYDVLVWSVLSSLAGQERSR
                     TQATSVLLTSKWLQALSRFSGKVFQRYSNMDPLPILRYVHAQLLRGNSTDLVILEELI
                     ESMGGIVSAFDFTDAQLRGMTGGEVLRRQTLISLGDKREVSARSAQRLMRALSHSNLA
                     GQLLINIAQYRQNAIYKITDDKAVIKYLSALVDGSHKVLSRYLDLLLSNLDPDTFNRL
                     VPDVVQLMRDYGLDANLAFMIRRNTIRWDTKALPPTKESPSQATKPTTDVDGDVTMAT
                     AAADGTPGDASNTEATKDGAGDNSSASRTPSRLPESLSDALAPLIEEIPKLLPQQSWK
                     YISPACYVFFWSLQLGNLVWPQDSYEAANKRLKAQAAELTTDRTDTPRSAANKKRKRE
                     EIMDQQQRLLQETKDGIERFQKTKLHIGRQTSGWFPAGIAHADATSDALLEECILPRL
                     QISPVDADYCFRLIKFLHEFPKSNFQLMSLYNRLFNHNRLRALIFTCTVREAEHLARF
                     LKFILGDLSKWHGNKNAYEKEALGLRELQGTKTREYIGFATAFDADGKPTEFIEHDAF
                     KELLFRWHKELNSALRSCLNGMEWMHIRNAISILKGVIDYFPAINFMAEKFLEQLNTI
                     KDRESANSNAPESAQGHRVDLSVTAQTTYSELAKRKSKWVLVQAFRPGAVSTSAVSLK
                     SSSCANHAQKSDGKDEKGPTMPANSSLRGSAAPFKPNAGRAPQSSEVEDGEVDESKAG
                     QASPGGNVSSLPRPPPAREPPRETNPPAPKTSSAATPSGRPSTPKPAPAPQSGTRQEP
                     PRFSTLPPGGPGLPNRPEPPARHDSSGPRFSQPRQDRRDLPTREARDYRDSREPRDQH
                     QRDPREPQGARDGRDYRTPEGSRPERSRDISSSDRRGPDPGQREPGPRDSSRDTGRDA
                     SRASDRGRAEPPSRRHDHAPAADRDSRPDSRPDSRPPPRERGAPHGSSRSDSRPGREP
                     AVSTPPATTSQSAPQGPPINPERARIIEGERPEIINPARAALINDTREPSGRHSPREQ
                     PRERPPRADSPRRSDRPPTNPPLPDNGRDDRHGRRRHSPGPEIPRDSHMEPAAPPLRA
                     ERNMEREDRNAGPRDSYTSQSRPDHDHGRLGQQDPDYGRLNPIQSVVDMPPGPPSGPR
                     GRGGRSVARPPPVNGPPMRPDNRFPPLEPIRPPTPERHPPTGPSASRPRRGPYDNGSG
                     IGSPTSSTPPTVGVHPDRMRQISQASSAPPPPPPPPPPPAASGPPGPSGIHPDRLNQI
                     ATQPPGPAIHSRAPIHTPDRPPMSTPGSGSRPAPSGPSADFSSTPTGPAAANDRMRPG
                     GRQLRGIQNTLDKASADNARGSGPRTSRSRPNLAGSDAQILVGASPVSTPVHERPAES
                     FRDSSRREPSDRPPRGGPEPIQVVSDSRGGRETSSGRGPANGDDYGSSRSEHDRSRRE
                     HHRSERSSRPSGRSSRDRTPDREREPKDSREYRDRRSSNVPSSSSRDDRDSRRSMRES
                     TGGGREQIPGGGRDLAPPRESSSHRSHRGEPGPRGDGGSGGGGRGEGGRGGDDYGRGG
                     SSRSNGPPRDSRSSRPGDERGDPRGGDDRARKRRSEGVEVGSGSHQDKRQRR"
     STS             1310514..1311372
                     /standard_name="P_turq_G03_G082"
                     /db_xref="UniSTS:526409"
     gene            1311299..1313242
                     /locus_tag="MYCTH_2310192"
                     /db_xref="GeneID:11513840"
     mRNA            1311299..1313242
                     /locus_tag="MYCTH_2310192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665889.1"
                     /db_xref="GeneID:11513840"
     CDS             1311624..1312961
                     /locus_tag="MYCTH_2310192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665937.1"
                     /db_xref="GeneID:11513840"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2310192"
                     /translation="MVICHALTGSADVGDWWGPLLGGPGRAFDTSRFFVVCMNSLGSP
                     YGTASPVTAKDGDPSKGRYGPEFPLTTIRDDVRYVVMFLSWRGVGSHAHHHYHHHHPC
                     RLHKLLLDDLGVKQIAAVIGGSLGGMFVLEWAYFGKDYVRCIVPIATSSRHSAWGISW
                     GEAQRQSIYADPKYEDGYYSFSDPPSTGLGAARMAALLTYRSRNSFESRFGRNIPDPS
                     RRQTIRERPAPSTPSEAHFHIHNDGHKWTKSPSRRASEAQQAPKNEGSGSASPDPQFH
                     GSKNGSLTGGEVIPPTSTYFSAQSYLRYQGNKFVKRFDSNCYIAMTRKLDTHDVSRGR
                     AGTIAEALAMIEQPTLVLGIESDGLFTFAEQEELAEHIKNARLERIDSPEGHDAFLLQ
                     FEQVNHYILDFLREVLPDIMNKDTDGAVVESSVGELTKSSTFGEAEVEDITAW"
     gene            complement(1313243..1315513)
                     /locus_tag="MYCTH_2310196"
                     /db_xref="GeneID:11513841"
     mRNA            complement(join(1313243..1313629,1313790..1314209,
                     1314344..1314519,1314671..1314708,1314813..1314962,
                     1315073..1315164,1315267..1315292,1315382..1315513))
                     /locus_tag="MYCTH_2310196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665890.1"
                     /db_xref="GeneID:11513841"
     CDS             complement(join(1313599..1313629,1313790..1314209,
                     1314344..1314519,1314671..1314708,1314813..1314962,
                     1315073..1315164,1315267..1315292,1315382..1315471))
                     /locus_tag="MYCTH_2310196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665938.1"
                     /db_xref="GeneID:11513841"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2310196"
                     /translation="MADSDELAGASSPKKTWTEHETERIEVDATLADDLDDTVGEPSY
                     TTSLASSVVDYPIEYGRRYHAFRHGRYSRPNDEKEMERLMLLHNIVTRLIGGLYTAPI
                     DKSKTHRILDIGTGNGIWAISIADEFPDATVIGNDLSANQPSFVPPNVKFEVDDVEDP
                     WVHPAKFDWIFCRYMAASIHDWPKLMSQIYENLNPGGYAEFQDFNLTYYSEDGSLTES
                     HALRRWNGRLTDAAFSLGRDPNPGSKLEGWVKAAGFAGVTARRYRVPIGPWARNPLLK
                     EVGAWNLAQVLNGLDGLSMRLYTTVLGWKEDEIWALLEQVRKDLADPSVHALFELHVV
                     YGQKPE"
     gene            complement(1316017..1317384)
                     /locus_tag="MYCTH_2310200"
                     /db_xref="GeneID:11513842"
     mRNA            complement(1316017..1317384)
                     /locus_tag="MYCTH_2310200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665891.1"
                     /db_xref="GeneID:11513842"
     CDS             complement(1316232..1317353)
                     /locus_tag="MYCTH_2310200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665939.1"
                     /db_xref="GeneID:11513842"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Spoth2_2310200"
                     /translation="MDGPTPTLKESIAPSFQSTVFPTAPYSSRPPSPPYIHVPPPMHS
                     SLSLGSSSKHDRNGAGTLEEEDDPNHDSDVLMTIRPSPSAVHTAGLTQQELYTVTQGL
                     LPQSARDGSSTWVYESRRQAQQVLSYLYLGPASAVKDRAFLEREGITMVLCARDARFA
                     TGTGGEGMLVSGVRRAVEGMGVEVEGIDVADGRELVGAFPVAAAKVNQHLLAVAAARE
                     GVGAGAGAGAERPGRVLVVCETGNDRSAAVVAAYLMAMYGLDTVQAVQFMQLKRFCVA
                     LGDDFRFQLQTYGDILRARGDVGATGGQHHHHQQQQQQQGPAQPGEAGNRAPGTAAKR
                     RIEQTMGETDEGGEGDMSMEIDDERYEGRSFAPFVDRSY"
     gene            complement(1318089..1319465)
                     /locus_tag="MYCTH_2310201"
                     /db_xref="GeneID:11513843"
     mRNA            complement(1318089..1319465)
                     /locus_tag="MYCTH_2310201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665892.1"
                     /db_xref="GeneID:11513843"
     CDS             complement(1318163..1319449)
                     /locus_tag="MYCTH_2310201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665940.1"
                     /db_xref="GeneID:11513843"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="JGIDB:Spoth2_2310201"
                     /translation="MADSLDSIVKGAPVTLPGQDPAKVVGGTTPIGSSDSPPASGKIG
                     DPLSHTPSSPSMIYLNLLILEASLRAQYLELRARRRHHTFFLTLLTLWTAFFGYALFF
                     APREDGRGVGGSVYWVIETTEHMCFLAGIITGLLVWATGIWERGVRWPRRWLAVSNRG
                     LRGFNCKLVVLKRPWWKEALSTIGWFLTYGLFSDNGSSYRWVEPSLLREVDRELNLTR
                     ESHPAVHVNNRDEERGGHEEDLAPGGDYVKLLLLAKPFSPTFRENWEFYRAEYWEKEN
                     ERRALLRAKLKERDRKLSKQKGGWFWWLPGRRVADKPPATSHEKAHHPRHAAVAGEHR
                     RTRSGSASTRRGSVSSGMSGMHGPRTPASKIDGEDHPGIARKGSSSSDASDKKRKKLT
                     AGAKSRPPRVESRSATPETPSPLAKESTPKADSQTP"
     gene            1320165..1322147
                     /locus_tag="MYCTH_2310203"
                     /db_xref="GeneID:11513844"
     mRNA            join(1320165..1320549,1320666..1322147)
                     /locus_tag="MYCTH_2310203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665893.1"
                     /db_xref="GeneID:11513844"
     CDS             join(1320304..1320549,1320666..1321994)
                     /locus_tag="MYCTH_2310203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665941.1"
                     /db_xref="GeneID:11513844"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2310203"
                     /translation="MFKTYTAATFLLPKRLKLASLLPPQPTALSTDASLSPQQDPRQP
                     ILLASHQAMSQTRADSPPRPQRPMAYFPLGYKEAVQQWWASVSSRQAERNVLAFVPYL
                     REASAETVVGSQLQDLANCDPFGLRVWRTSMVELSGKNRALNELSIERVGEQADDTLV
                     MLHGYGAGLGFFYKNFEPLSRARGWKLYALDMLGMGNSSRPPFKIRAKDPKEKIAEAE
                     GWFIDALEEWRKIRKIEKFTLLGHSLGGYLAVSYALKYPGRLNKLILASPVGVPEDPW
                     AIDSSMPEPQESTLANEFTQDQESIVKGEPARVRAPAADNKSTTTIAAPPKRPIPSWL
                     VWLWDANVSPFSIVRMAGPLGPRFVSGWTFRRFNHLPPAEKDALHMYSYSLFRQRGSG
                     EYALPYLLAPGAYARSPLINRIQDVGRQVLRPATDTTPAVRETGIPVVFMYGENDWMD
                     VAGGYAAEEKLKQRRVQALLNATDDEKRRENGSAKVIVVRKAGHNLYLDNPDEFNEVV
                     LREMEETRQRRLRLGE"
     gene            complement(<1323087..>1326563)
                     /locus_tag="MYCTH_29375"
                     /db_xref="GeneID:11513845"
     mRNA            complement(<1323087..>1326563)
                     /locus_tag="MYCTH_29375"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665894.1"
                     /db_xref="GeneID:11513845"
     CDS             complement(<1323087..>1326563)
                     /locus_tag="MYCTH_29375"
                     /note="Contains conserved domain Hist_deacetyl[pfam00850]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665942.1"
                     /db_xref="GeneID:11513845"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="JGIDB:Spoth2_29375"
                     /translation="VDRPSSNNDGKEGDGGDLAQSLDRLTISTSPPAKTPRSPRSVRP
                     AGPAPLKTATDRSPSFPSPGNAVRSPLRCSSSASVLHPSQSATPTLLRKASLNSLHSA
                     NTVTPSRRASSGSILPSSRVRSGRSPLRSVSPELPEIVIPTPHSIATDHFKAELDIHH
                     GPEPTRRAETVVILQDACYGHRYSRPRASRAQLSTIVERPERIKACVLGLSAAYVRLG
                     ERHQDGAFPLHPDTDAASLPSIPFRIQKSTRRLSLGSQTVTNVHGTKWMEELKMMCET
                     AEAKLVGGGKELQRPDIDRGANAEAPQKFHEGDLYLCSESLEAIEGALGGVCDAVDAV
                     FQPQGPRRAFVAIRPPGHHCSASHPSGFCWVNNVHVGIMHGVLSHGLTHAAIIDFDLH
                     HGDGSQAIAWQHNARGVGLAKNAAWWKKTSIGYFSLHDINSYPCEMGDEEKVRNASVC
                     IDGAHGQSIWNVHLQGWKTEADFWALYESKYAVLLEKTRAYLRSHTERLKASGLNSRA
                     AIFLSAGFDASEYEDPGMQRHNVNVPTEFYARFTRDVVRLAAEEGTSVEGRIISVLEG
                     GYSDRALCSGVFSHLCGLAGDGPSNKDQELGSGASETGQQFTQQRARKDSSASERGVR
                     RYESSWWSTAQLEQLEATLAAPVPAPRVIRNTPPPTYSSPTQASQAKAVNPKNRSGSV
                     LSPTTSNGASRVSFQLPPPPEVPWAIATVQLSRLLIPSGRQTASCTVEELNADATRIR
                     RERQAALAGSAPPTASSAPEDRPPTRMGLRERKPKPPPVDDDVDRKTRRKTVAGPAVL
                     DTEAGSRGATSVPGKQSRPSRRLSAASTAVSSESSEVPPSVPRIVPIRSSSKQEVVNN
                     AEASSDVAGPGGSSNLQVKKTRAPTKKEAVPRAPKGKKSTGPANGAPAQTTPSANVTA
                     ASSADKAGDAVDKLAGEMKKIKITVVTKAQKEARERERLAREKLSQAKTVPGPPPAAG
                     DGSPSQSTPGAADTTTTTTTTTNSNNNNSYLTSETEHQLPSPTPSPAPQAPQIQTPVN
                     PSTPPAEEDRNIATTPSVASPPPTDPRHVPLPASSPPPALTETPLKNDATPPHTSEDS
                     FVHYQPEGPTPGPPPQSAAEQPQQQNQQLQWLPPNVSATPVPSPIKKKDLPVFSSTGF
                     IPFAPRPGTHSDG"
     gene            1327702..1329216
                     /locus_tag="MYCTH_2310208"
                     /db_xref="GeneID:11513846"
     mRNA            join(1327702..1328251,1328317..1328512,1328593..1328687,
                     1328757..1329040,1329100..1329216)
                     /locus_tag="MYCTH_2310208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665895.1"
                     /db_xref="GeneID:11513846"
     CDS             join(1327927..1328251,1328317..1328512,1328593..1328687,
                     1328757..1329040)
                     /locus_tag="MYCTH_2310208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665943.1"
                     /db_xref="GeneID:11513846"
                     /db_xref="JGIDB:Spoth2_2310208"
                     /translation="MARRLLTALALAHSATAVLDRFVDVLVQVDEFRIHAEALAVNDD
                     DGFEACKTADAVIGACYYAGYLNPSAPGDDGYLCGCCYDTTAMPEIYSSCASWALDQD
                     YTSIYSVASQMSSACADVTVCSDSDPVRTVSDLPTSISLPPACVSMRSIYSSCAAIPS
                     IYTAAPRDVAACFCPEEDGKINKSFQSYASSCAPFARSSFPGDYSIITQLQTYCDANM
                     ALKSTKPLVFTTIGTRTGLGFGPPSITSSASSPTSDASTASESAVTTASSTGLASQGL
                     TAPGIAAWLFELATLLLSFFVMI"
     gene            complement(1329157..1330558)
                     /locus_tag="MYCTH_2310212"
                     /db_xref="GeneID:11513847"
     mRNA            complement(join(1329157..1329181,1329243..1330558))
                     /locus_tag="MYCTH_2310212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665896.1"
                     /db_xref="GeneID:11513847"
     CDS             complement(1329333..1330253)
                     /locus_tag="MYCTH_2310212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665944.1"
                     /db_xref="GeneID:11513847"
                     /db_xref="JGIDB:Spoth2_2310212"
                     /translation="MTSPSLRSSFPHSSSSLSSSPSSSSSFTLFRHLPPELRLQIYRH
                     ACHPRVASLTYLPAPQDTFYCPTRPPALLHVCRESRAEGLRIYVKCPLPNLHHTTTTT
                     TTKPDDGREGQGDDVNGGERGRDERYFYFHPHHDTLYLPRPGPAADPFGLGYADWARE
                     LAAAVAATFAGVVRRLAVDYVPAEVRRPWEAYGKICLIGGCPRLEEAYLVVSGAGAGA
                     CAAGERGGAEREVELVDPGDGDGEIAEIMERVRESFRVELGDGIAGLLGAPGKDGERS
                     GRSGEVGLELIPKAKMPSPSWAGRRLVCAS"
     gene            1331026..1332744
                     /locus_tag="MYCTH_2310216"
                     /db_xref="GeneID:11513848"
     mRNA            join(1331026..1331376,1331459..1331709,1331783..1332744)
                     /locus_tag="MYCTH_2310216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665897.1"
                     /db_xref="GeneID:11513848"
     CDS             1331795..1332703
                     /locus_tag="MYCTH_2310216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665945.1"
                     /db_xref="GeneID:11513848"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="JGIDB:Spoth2_2310216"
                     /translation="MVSLLKLANITEEGVRFLSPHDGSPMLLTPEHSISLQNSIGSDI
                     MMQLDDVIVTTSPDKVRMREAMERSVRWLDRCIAAHKKPDTQNLFCIIQGGLDLDMRR
                     ECCREMLARDTPGIAIGGLSGGEAKEDFCRVVAACTELLPDLKPRYVMGIGYPEDLIV
                     SVALGADMFDCVWPTRTARFGNAITKHGVLNMKREIYAADFGPIEEGCGCPCCRPIEE
                     EGAMGITRAFVHHNAAKETVAAHLLTLHNVWYQLDLMRRAREAIIEDRFPAFVKEFFG
                     NLYPNKDFPTWAVDALKGVGVDLLET"
     gene            1332925..1334609
                     /locus_tag="MYCTH_2310217"
                     /db_xref="GeneID:11513849"
     mRNA            1332925..1334609
                     /locus_tag="MYCTH_2310217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665898.1"
                     /db_xref="GeneID:11513849"
     CDS             1333017..1334417
                     /locus_tag="MYCTH_2310217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665946.1"
                     /db_xref="GeneID:11513849"
                     /db_xref="JGIDB:Spoth2_2310217"
                     /translation="MAARNVSPGGALLRTSRMFALPNPIPPPPHDGQAGANFHSETAT
                     LAFPTHQIITTLSASRKQGDWGLKRPLPLKSTTKSTHAMLRVKAIDTIEQITDYSSAT
                     DHGITLRKFQELHMPLTARRPAGGDHKDNTSTMGLPQKSVFEDSLDVTDIHPDKRAEA
                     IDNRWKFTGPWLAGMTQGEFNKWLAKEVRPKRPAFREFLKKKIASELHATAAKEALDK
                     GQEQPPAIDPSSVTEDQLLDYLRKLRHDNQALYDMVGQFLDLAPLTPPTVSQTGLPTS
                     KVSQLKFTEMKNPYAERGPPVTHPSAGISYLRSSMYMENHPIYGPQKHHSPVVARIVR
                     PRRQAQAMPAKLGVAGFIVDTPLGDTGSNYRSGSSAIFDRLDPSIEGGAKLWVQPKIA
                     SVDSSGRVILRVDDASRESTLVAQELLGNAVCLGAKPAEDEMNKRESASDIRQKYRAA
                     DTPPTMSSARDYGLRV"
     gene            <1334878..>1335476
                     /locus_tag="MYCTH_2039818"
                     /db_xref="GeneID:11513850"
     mRNA            join(<1334878..1335024,1335105..1335296,1335396..>1335476)
                     /locus_tag="MYCTH_2039818"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665899.1"
                     /db_xref="GeneID:11513850"
     CDS             join(1334878..1335024,1335105..1335296,1335396..>1335476)
                     /locus_tag="MYCTH_2039818"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665947.1"
                     /db_xref="GeneID:11513850"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="JGIDB:Spoth2_2039818"
                     /translation="MGRVRTKTVKKSAKVIIERYYPRLTLDFETNKRVCDEIAIIASK
                     RLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDFSEAGQLEVD
                     AETKDLLKHLGFDSIPVNVTTVTQSPVIERGGRRFGGR"
     gene            complement(1335779..1337295)
                     /locus_tag="MYCTH_2310220"
                     /db_xref="GeneID:11513851"
     mRNA            complement(1335779..1337295)
                     /locus_tag="MYCTH_2310220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665900.1"
                     /db_xref="GeneID:11513851"
     CDS             complement(1336054..1337127)
                     /locus_tag="MYCTH_2310220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665948.1"
                     /db_xref="GeneID:11513851"
                     /db_xref="JGIDB:Spoth2_2310220"
                     /translation="MATSTNDRQSKPKPKGILKQPSTFPQPQPQPSSSPPPPPPLAAE
                     LTRAERLAQQEAAARLRLLQKLRETEVKPAVPIETFELLSQEFPRHADRAASSPHPDD
                     VAELLRLLADFTPQEYLDLIEERNCLGKCGYALCARPRRTHDGPYKINTRVGSVARTE
                     DLNKWCSDACAKRALYIKVQLDNPSYVRNDQGRLVVKLDLRDEGAGGGGSGGGSGGGG
                     GGGGGGGGGSGPGKGKTGTEGGVRSSAAASPRGKEEDRDQLAQAMAQLEIDRHKQAKK
                     DATTLAGERGDATDGLLAGMTRVDVTISERVVDGPHEAPSSVEGTESMIEGYKPKNGT
                     DTGKKPEEGADSDDDDDFFTVRF"
     gene            1337935..1340253
                     /locus_tag="MYCTH_2310222"
                     /db_xref="GeneID:11513852"
     mRNA            join(1337935..1339740,1339798..1340253)
                     /locus_tag="MYCTH_2310222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665901.1"
                     /db_xref="GeneID:11513852"
     CDS             join(1338063..1339740,1339798..1340054)
                     /locus_tag="MYCTH_2310222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665949.1"
                     /db_xref="GeneID:11513852"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="JGIDB:Spoth2_2310222"
                     /translation="MFKVKALYDYASGHEDDLEFTVGQIITVTDEVDDDWYGGEYVDE
                     SGIKHEGIFPRNFVEKYEPTAPPRPTRSRPKKEPEVVPAPAPEAPAAAAPPAPPPDSP
                     KQATPEPEETPKPAGPAPSSETSSAAPRVPAPVAKPPAPQPVQPVQPVQAPAPAPAPA
                     PPAPQPAQVPSAASPPAPKSGPSSPKPSGPPPVSEKPTSSSFKDRIAAFNKPAAPPIA
                     PFKPGNLSSSGAAFIKKPFVAPPPSRNAYIPPPSQVPVAKIYRREEDPEVKEQEAEVL
                     ENAGKAGLIPTASTNEGQASEDQPKPMSLKERLALLQKQQMETAARHAEAAAKKEKSK
                     RLPKKRLDSQDTVEGESAERTEETTRTSTDEAPPPRVAHPPRRRSSKGTEPRDGNEAD
                     MSGAGETTEGQEELTERDDSDGKPKHVASASKQEDSSRDEGEEDEEEEEEEEEIDPEI
                     RRREELRARMAKMSGGMGMPGMGMPLFGAPAPILPKKKKAVPEKRVEEAEEPTSPTAR
                     APPVPLPGLMRPPPAPEPKQPGPEEEGDEEEKEEDEESQIKTPHQEAAAPPVPLKESD
                     VPPPVPGGRPAPPPVPADCEYHRAHRFAPWNIIVNLVKHVRRHRLQLPLRSSRPAKDR
                     CRMTNSRSDLSRSLVLPETV"
     gene            <1340888..>1341697
                     /locus_tag="MYCTH_2069203"
                     /db_xref="GeneID:11513853"
     mRNA            <1340888..>1341697
                     /locus_tag="MYCTH_2069203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665902.1"
                     /db_xref="GeneID:11513853"
     CDS             1340888..1341697
                     /locus_tag="MYCTH_2069203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665950.1"
                     /db_xref="GeneID:11513853"
                     /db_xref="JGIDB:Spoth2_2069203"
                     /translation="MESGFVADDIDLAKPSSWWLQPNGLPPQLHGRKDIFFESEESSS
                     ADPHQGGKTIVTRDIYVLFQDYSQTVITVRFSPQDPSDVHLEQRHEPPPRALRQDQLE
                     QSYERFGRAIGEAAASKKDTVVGDGTPQALVYELLRPFKDALLPVGARAYGALVYSNL
                     ANASTTQNDEIRPGDIVSIRNAKFQGKHGAMHAKYSMEVGKPDHVAVVAEWDGTKKKV
                     KAWEQGRESKKVKLESFRLDDLRSGEVKIWRVMPRSWIGWESNTGAGGAGN"
     gene            1348029..1349407
                     /locus_tag="MYCTH_2310225"
                     /db_xref="GeneID:11513854"
     mRNA            1348029..1349407
                     /locus_tag="MYCTH_2310225"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665903.1"
                     /db_xref="GeneID:11513854"
     CDS             1348159..1349385
                     /locus_tag="MYCTH_2310225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665951.1"
                     /db_xref="GeneID:11513854"
                     /db_xref="JGIDB:Spoth2_2310225"
                     /translation="MAAQYPRRQPSSQSSSSHGSRSRGSNDSYDSHSTAPTSLYSSPC
                     PSDLKSSPSSAEAGAYAGAKHRQAYDSRDDVSPATSLYPRSSVETYASTTASREDLDA
                     ADLDETVDFEDSSIPPLPVYRREVVEPYVRPATPQEFGKLFPSLNRLTIRHDEFTSDG
                     NMNLRIDTVVTGRRRTAIQLFHLRMYDLAKREFSLRRYSRDSGREVCNSKRKFTEPAV
                     PRPNTAADERPTLKQSMSTALRTFGGGKPVLRRAKSGMTVQGRPGTGYSTCEGDDELV
                     FDASNLSRLSLDSRLVRSKAQRPTPTNTIKLEFSNYARVDVNRRGGKGSKRYEFEWWG
                     HRYNWKRAVDKQLALVSFHLIRDGNTGAPVAHIVPETRAPTQVFADDSAGGWVPPCFM
                     WIADESVIDAVTDVAE"
     gene            1349392..1350213
                     /locus_tag="MYCTH_2310226"
                     /db_xref="GeneID:11513855"
     mRNA            1349392..1350213
                     /locus_tag="MYCTH_2310226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665904.1"
                     /db_xref="GeneID:11513855"
     CDS             1349457..1349687
                     /locus_tag="MYCTH_2310226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665952.1"
                     /db_xref="GeneID:11513855"
                     /db_xref="JGIDB:Spoth2_2310226"
                     /translation="MATGLIALVDDCIKERWQTKKAHRIPMPSPLKSVNLDAVSPKAL
                     MQHVFGRRYSNDHQRPTTPSSPLRFTSFAAAR"
     gene            complement(1351175..1358072)
                     /locus_tag="MYCTH_2310228"
                     /db_xref="GeneID:11513856"
     mRNA            complement(join(1351175..1352545,1352601..1357841,
                     1357912..1358072))
                     /locus_tag="MYCTH_2310228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665905.1"
                     /db_xref="GeneID:11513856"
     CDS             complement(join(1351398..1352545,1352601..1357809))
                     /locus_tag="MYCTH_2310228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665953.1"
                     /db_xref="GeneID:11513856"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_2310228"
                     /translation="MHINNGNGTGPQTGAVTPRSSASLRPLTLSHGSLETSFLIPTGL
                     HFHASRLKEGFVATLPAPTDELAQDDEPSSVPELVARYMGYIAQEVAEGEDDAQGSAE
                     EVLKLILNEFERAFLRGNDVHALVATLPGIDAKKLEVIRSYFAARAASNRAMKTHESA
                     LFRAADEGAAKLYSIFGGQGNIEEYFEELRELYETYPSFVGDLVASSAELLQTLASHP
                     SAEKLYSKGLDIMSWLHHREATPEVDYLVSAPVSFPLIGLVQLAHYQVTCKVLGLHPG
                     VLRERLSGTTGHSQGIILAAVTAAANSWESFEDVAKSALTILFWIGARSQQTFPITSL
                     SPSMLQDSIDNGEGTPTPMLSIRDLPQAEVQKHIDQTNQYLPADQHISVSLINSPRNL
                     VVAGPPRSLCGLNAQLRKVKAPTGLDQTRIPHTERKVRFVNRFLPITAPFHSKYLANA
                     NALIADDLKDVEIDVKSLGIPVYDTNTGKDIREEIDGNIVPALVRMITSDPVHWEKAT
                     VFPGATHILDFGPGGISGLGVLTSRNKDGTGVRVILAGTVNGTVTEVGYKSELFDRDE
                     EHAVKYAVDWVKEYGPKLVRTSSGQTFVDTKMSRLLGLPPLMVAGMTPTTVPWDFVAA
                     TMNAGYQIELAGGGYYNAKTMTEAITKIEKAIPPGRGITVNLIYVNPRAMGWQIPLLG
                     RLRAEGVPIEGLTIGAGVPSIEVAQEYIETLGLKHISFKPGSIEAIQAVINIAKANPT
                     FPVILQWTGGRGGGHHSYEDFHAPILAMYGRIRRQENIILVAGSGFGGADDTYPYLTG
                     AWSTKYGYPPMPYDGCLFGSRMMVAKEAHTSKAAKQAIVDAPGLDDSEWEKTYKGPAG
                     GVITVRSEMGEPIHKLATRGVLFWAEMDQKIFSLPKEKRVPELRKNRDYIIKKLNADF
                     QKVWFGQNREGKAVDLEDMTYGEVVRRMVELLYVKDEARWIDPSYMKLTADFIHRVEE
                     RFTNKPGQVSLLQGFAALEEPYSAVERILSHYPEAETQLINAQDVQHFLLLCQRRGQK
                     PVTFVPALDENFEFFFKKDSLWQSEDLGAVIDKDVGRTCILQGPMAAKHSTKVDEPVK
                     EILDGIHNGHIEGLTRDLYGGDASKIPTVEYFGGKLIETEIPLDIEGLTVSIDAHKNT
                     YRLSSAPSTQLPSLEAWLSLLAGSRKNWRYALLQSDVIVQGQKYQTNPIKQIFAPTRG
                     LFVEILNPNDPAKTVILVKEQPRHNRYVDVIEVKLVGEKEIAVNLIKDTTALGKPVAL
                     PLRFIYRPEAGYAPIHEVMEGRNDRIKEFYWRAWFGDDPLDLDAPVTGIFDGGKATIT
                     SEAINEFVHAVGNTGDAFVDRPEKTMYAPMDFAIVVGWKAITKPIFPRSIDGDLLKLV
                     HLSNQFRMMPGAEPLKKGDEVYTTAQVNAVVNQESGKMVEVCGTITRDGKPVMEVTSQ
                     FLYRGVYTDYENTFQRTVEKPMQVHLSSTKDVAVLRSKSWFVLDDLATPEVELLGQTL
                     TFRLQTLVRFKNKTVFSHVETRGQVLVELPTKEVIQVASVDYEAGESHGNPVMDYLER
                     HGVSIEQPVNFENPIPLGGKTRLQIRAPASNETYARVSGDYNPIHVSRVFAAYANLPG
                     TITHGMYTSAAVRSLVETWAAENKNNRVRSFHASLTGMVLPNDDIDVKLQHVGMVAGR
                     KIIKVEAINKETEDKVLLGEAEIEQPVTAYVFTGQGSQEQGMGMDLYDSSPIAREVWD
                     RADKYLMNTYGFAITNIVRNNPKELTIHFGGPRGKAIRQNYMAMTFETVAADGSIKSE
                     RIFKEINEKTQSYTYRSPAGLLSATQFTQPALTLMEKASFEDMKAKGLVPRDSTFAGH
                     SLGEYSALAALADVMPIESLVSVVFYRGLTMQVAVERDESGRSNYSMCAVNPSRINKT
                     FNEEALRFVVNNIAETTGWLLEIVNYNIANMQYVCAGDLRALDTLTGVTNYLKAMKID
                     IEQMRKEFQPEMVKEKLVEIIKACAQETEAKPKPLELQRGFATIPLRGIDVPFHSTFL
                     RSGVKPFRSFLLKKINKTTIDPSKLIGKYIPNVTAKPFALTKEYFEDVYRLTNSPKIG
                     HILANWEDYQDDSSELTTALTNGENDAKVNGVKGQNEVNGSVEH"
     gene            1359837..1365885
                     /locus_tag="MYCTH_2310232"
                     /db_xref="GeneID:11513857"
     mRNA            join(1359837..1360528,1360587..1365541,1365595..1365885)
                     /locus_tag="MYCTH_2310232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665906.1"
                     /db_xref="GeneID:11513857"
     CDS             join(1360003..1360528,1360587..1365541,1365595..1365705)
                     /locus_tag="MYCTH_2310232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665954.1"
                     /db_xref="GeneID:11513857"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="JGIDB:Spoth2_2310232"
                     /translation="MRHEVEQELAHTLLVELLAYQFASPVRWIETQDVFLAEQVAERI
                     VEIGPADTLGVMAKRTLAAKYEAYDAAKSVQRQILCYNKDAKEIYYAVDPVEEEPEPA
                     APEASSSSAPAAAPAAAPAPVAAAPPPPCAGPAAQVPDAPVQALDIVRALIAQKLKKS
                     IQDIPLSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGAAIQATFDGN
                     LGKTSQGLIARLISSKMPGGFNITTARKYLETRWGLGSGRQDGVLLLAITMEPPARLG
                     SDADAKAFLDDVTQKYASNAGISLSSAAAAGPAAGVGGGMMMDPAAIEALTSDQKALF
                     KQQLELIARYLKIDIRAGDKAFQASQESTKVLQSQLDLWLAEHGDFYATGIEPCFSPL
                     KARVYDSSWNWARQDALSMYYDIIFGRLKAVDREIVSQCIRIMNRSNPTLLEFMQYHI
                     DNCPTERGETYKLAKELGAQLIENCKESLGVDPVYKDVAIPTGPKTTIDAEGKMSYEE
                     VPRASCRKLEHYVQQMAEGGKISEYGNRTKVQNDLSRIYKLIRQQYKFSKGSQHEIKS
                     LYSEVIRSLGMNESQIIPKENGRINGLSKKGKPKGKVETIPFLHLRKKTQHGWDFDRK
                     LTKIYLDCLEGAAKNGLTFSNKYVLMTGAGVGSIGAEVLKGLISGGAKVIVTTSRFSR
                     EVTEYYQSMYARYGSRGSQLVVVPCNQGSVQDINALVDYIYDPKNGLGWDLDYVVPFA
                     AISEQGRQIDGIDSKSELAHRVMLTNTIRLLGNVKAQKAARGYETRPAQVILPLSPNH
                     GTFGSDGLYSESKLGLETLFNRWASEDWGNYLTICGAIIGWTRGTGLMSGNNIVAEAV
                     ERFGVRTFSQQEMAFNLLGLMSQTIVDLCQNEPVFADLNGGLQFIPNLNETMTKERKT
                     LTETSEIRYAVSKETAAENKIINGEDSEALYKQKIIEPRANIKFDFPPLPNWDSEVAP
                     LNEKLRGMVDLDKVVVVTGFAEVGPWGNARTRWEMEAYGEFSIEGCIEMAWIMGLIKN
                     HNGPIKGQPCSGWVDAKTGEPVDDKDVKPKYEKYILEHSGIRLIEPELFDGYDPNKKQ
                     LMHEVVIEEDLDPFQASKDTAEEFKREHGDKVEIFEIPETGEYTVRMKKGASLWIPKA
                     LRFDRLVAGQIPTGWDAKRYGIPDDIISQVDPVALFVLVSTAEALLSAGITDPYEFYK
                     YVHVSEVGNCVGSGMGGAKALRGMHRDRFLDKPLQNDILQESFINTMAAWVNMLLLSS
                     SGPIKTPVAACATAVESLDVGYETIMEGKARVCIVGGFDDFGEEGSYEFANMKATSNA
                     VDEFAHGRTPKEMSRPTTTTRNGFMEAQGCGVQVIMTAKLALDMGVPIYGILALTTTA
                     SDKIGRSVPAPGQGILTTAREHRGKYESPLLDINYRRRQIERRTRQIEQDKEADLEYL
                     AAEAEALKADGRSEGEVAEYVADRARHIEKEAERQKKEVLRSYGNNFWKGDPSIAPLR
                     GALATWGLTIDDLGVASFHGTSTKANDKNESSVICQQLAHLGRKKGNAVLGIFQKYLT
                     GHPKGAAGAWMMNGCLQVLNTGLVPGNRNADNVDEVMEKFDYIVYPSRSIQTDGVKAF
                     SVTSFGFGQKGAQAIGVHPRYLFATLDKETFEEYRVKVEARQKKAYRYFHNGMINNSL
                     FVAKDKAPYTDEQLSSVLLNPDARATADKKTGLITFPSNFMKLSEQTQTHSERKATLE
                     SVLSRNARQLESINTRVGFDVEDIAAINADNDTFLERNFTPAEMQYCLGSTTGRSPQK
                     AFAGRWSAKEAVFKALGVASKGAGAAMKDIEILTDQNGAPTVKLHGAAQEAAEKAGVK
                     SVTVSISYTENHAAAIATAQL"
     gene            1366521..1368664
                     /locus_tag="MYCTH_2310234"
                     /db_xref="GeneID:11513858"
     mRNA            join(1366521..1366562,1366644..1367008,1367092..1368664)
                     /locus_tag="MYCTH_2310234"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665907.1"
                     /db_xref="GeneID:11513858"
     CDS             join(1366753..1367008,1367092..1368287)
                     /locus_tag="MYCTH_2310234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665955.1"
                     /db_xref="GeneID:11513858"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Spoth2_2310234"
                     /translation="MRQTNLESRNKVFLGSFVHSKVLDELEYLHQTAVFVDKSGTIVA
                     IEKDCDESKARETVLPRLGWAEADVEVVKAKEGQFFFPGFIDTHIHAPQYPNAGIFGS
                     STLLQWLKTYTFPMEASLSEAAKARRVYTRVIRKTLSHGTTCAAYYATIDVSSTNLLA
                     DLCMGFGQRALIGRVCMDSELSPDYYRDASPEASIAATKATIAHIRSIDPAFSLIRPV
                     ITPRFAPACTLPLLRQLGALAEETALPVQTHISENKPEIALVQELFPRSLTGAADGSY
                     AAVYDAAGLLKPRTVLAHAVHLTEGEADLVAARGAKVSHCPCSNSALTSGAAPVRRLL
                     LDRGIVCGLGTDVSGGYSASVLEAARQAALVSRHVAFGPGGQERDKLGVEEVLFLATR
                     GGAEAVGLGDKVGGFEVGMEWDAQLIGLGAIREDGEEEEVDDEEGGGGGAGNVDVFGW
                     ESWPERVAKWVYAGDDRNTIKVWVKGRLVHQRK"
     gene            1370027..1371307
                     /locus_tag="MYCTH_109897"
                     /db_xref="GeneID:11513859"
     mRNA            join(1370027..1370373,1370451..1370686,1370765..1371307)
                     /locus_tag="MYCTH_109897"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665908.1"
                     /db_xref="GeneID:11513859"
     CDS             join(1370209..1370373,1370451..1370686,1370765..1371029)
                     /locus_tag="MYCTH_109897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665956.1"
                     /db_xref="GeneID:11513859"
                     /db_xref="JGIDB:Spoth2_109897"
                     /translation="MPGGGLFGVGVPPSQPVWLLYIKIAVLVLSLVIMGISGYVLSLT
                     NGGAASLDMFAAIFSLLVYGAAGALELWSPNNLFRVGGLVCYPLSIIFWLSAWAWSAS
                     QSSAWMSLNGWWKAGTIGGCLGACAGIGALIWILAIVHLFFFIRACLSDSGAAAGVGQ
                     AELGQVKPEGQSQQYQQPYPAQQPYPAQQPYPAQDPYAPQQYPQQYPQQYPQQQTSPY
                     PTQ"
     gene            1371652..1375407
                     /locus_tag="MYCTH_2310240"
                     /db_xref="GeneID:11513860"
     mRNA            join(1371652..1374445,1374554..1375407)
                     /locus_tag="MYCTH_2310240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665909.1"
                     /db_xref="GeneID:11513860"
     CDS             join(1371789..1374445,1374554..1375046)
                     /locus_tag="MYCTH_2310240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665957.1"
                     /db_xref="GeneID:11513860"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2310240"
                     /translation="MLAPSSPIAFPPSSSPAPSSKRPRPADAPKPPKPPKPRVLGGFL
                     ADSDSDDDDDDDDEVITDEPSPKRRMLHRGTQQDAQAGLDTGAGAGAGAARAEDPLMN
                     ETMSAAQEVVSTPPDSQTQDDLREEAERYERLFGTQGLPTLAAFTSKDPRPASYHVST
                     CSGQMVPIRERRPAAAVPYAHMVAARSRTKEGRAHRSYYGVAIHELIDSANKELAEAR
                     KTSGSANATTPLTPPAKPDRPVRSVEAQQSNPKRPKRTMLWTEKYRARTFMDLCGDDL
                     TNRQVLRWLKRWDPIVFPHAANKNKPAVRRHGAQHHQHAGQPPEEEKPHRKILVLHGP
                     PGLGKTTLAHVCARQAGYEVMEINASDERSRDVVKGRIRTSLATESVKTVEHKKPDPG
                     KQQKVARPVCVVVDEVDGVVGGSGASGDGGFVKALIDLVMLDQKNSSASGSAAAAPGP
                     GRRKKKSDDFRQMRPLILICNDVYHPSLRPLRQSGLAEIVHVGKPTVEAVVGRLKTIF
                     EKEGIPCEKDAARKLCEAAWGMTSGIDARRGAESNAEGDLRGVMVVGEWVAGRLRAAC
                     PDGATPTLTRQWVDKHIIRDLAHGGGGARGLGRGGTREIVNRIFQEGAGFPKQSTPAV
                     QPSKNTIHEQPQAQLGVSEQQKKYAMARLQEMIDSSGEVDRIMTEVFLEYPNRDFNDD
                     SFMTKPDLAYEWLHFHDTCSSRLYSSQEWELVPYVSQPILACHHLFASPRRHQPHTTM
                     SGYGARWGEEADDGEADAAPLPFSGPRADYAAHEAEKANRAALQALHAQLPPTLTRAF
                     RSPEHIATDFLPYLVRIVSPDVKPVVVGGSADKGGAVASVRRESEKAMVKRAAQVLAE
                     VGIALHKGKLESDVTAGPAGRTQWVYRMEPDLDALATFETASAYILASQAPTRYAVRQ
                     VLEQELHKALAQKESAARQARLRSGEGGAAGDGGRQQQQHAPGSGDDDGDEYKENANS
                     HSHSKMAAERAGVAVKRDFFGRVIVERPLAETDANAGKRIKRKQDAGKAGRVWVTYNE
                     GLNNAVRRPISLEDFLRGF"
     gene            complement(1375586..1378408)
                     /locus_tag="MYCTH_2310241"
                     /db_xref="GeneID:11513861"
     mRNA            complement(join(1375586..1377123,1377186..1377732,
                     1377795..1377940,1378002..1378408))
                     /locus_tag="MYCTH_2310241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665910.1"
                     /db_xref="GeneID:11513861"
     CDS             complement(join(1375667..1377123,1377186..1377732,
                     1377795..1377940,1378002..1378248))
                     /locus_tag="MYCTH_2310241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665958.1"
                     /db_xref="GeneID:11513861"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="JGIDB:Spoth2_2310241"
                     /translation="MAANKYADRLKSFLGIDPDQSLDDSAFRDDSYYVEEEPTVKEAL
                     VELIPTGRDILNYIKELFPFLGWIFHYNLTWLLGDFIAGVTVGFVVVPQGMAYALLAN
                     LPPEYGLYTSFVGFLFYWAFATSKDITIGAVAVMSTIVGNITIKVQESHPDLAPETIA
                     RSLALISGIVLLFLGLARLGFIVEFIPLVAIGSFMTGSALSIASGQVPKLLGISGVNT
                     RDATYLVIINTLKGLPRAKLDAAMGLTALFGLYFIRWFCNFMGRKHPRYQKTWFFIST
                     LRMAFIVILYILVSWLANRGVSDKKEAKFDILGTVPSGFQHVGAPRFDAEILGAIGSD
                     IPTTILVLLIEHIAISKSFGRVNNYIINPSQELVAIGFSNIFGPFLGGYPATGSFSRT
                     AIKAKAGVRTPLAGIFTAIIVLLALYALTSVFFYIPSAGLSALIIHAVGDLISPPREV
                     YKYWKTSPIEFVIFFAGVFVSVFTTIENGIYVTMAASGAVLLFRIAKSPGRFLGKVTV
                     QSVPRDSLRGGGGTASPGDKSHAAFLPLDRADLYNPDVTIASPYPGVFIYRFGEGLNY
                     LNSARHLDTLTIHIFQHTRRTRLDRYDKVGDRPWNDPGPLPWKSGAAEEREAMAARPT
                     LRAVVLDFGAVSALDMTAAQALIDLRNQFDRYADPDRVEWHFAGVASRWTKRALVASG
                     FGAGPESSRRRGSSTVGSAADSEQDKLALEPLIGAAEVASATGAEDSKAAEARSKARE
                     VDIEAAAGEVTPVVSSSGKRLVPLFGANRPYFHVDVETAVAAVIRKLEARASEWSGRE
                     "
     gene            1381257..1382966
                     /locus_tag="MYCTH_2310243"
                     /db_xref="GeneID:11513862"
     mRNA            join(1381257..1381802,1381870..1382966)
                     /locus_tag="MYCTH_2310243"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665911.1"
                     /db_xref="GeneID:11513862"
     CDS             join(1381566..1381802,1381870..1382718)
                     /locus_tag="MYCTH_2310243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665959.1"
                     /db_xref="GeneID:11513862"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Spoth2_2310243"
                     /translation="MQATPATGLSYSPGLEEAESSFPERHLDEDKPQFSASGGIGTGR
                     YQSGVVKRQVFEPSLPTVYARDWPGPGQSISQDGHVSSHGPLVDGTTLGGPFPQPQPN
                     SGSLSAGWNSFREQPQDGFFWPPSRREFSVDDDSDSIQSRNESHEDFCPSIPALSGQR
                     PRRRSSHRVTKPAKPPTPIATHHLAARTERPYIPDFDYSTDWLEPSDASVASFSHSSH
                     DPTPITPGNEIEIALRDNASSSSKVDSKRIAHKLSEKSRRNRLTIAIREIQKLLPSGV
                     DGEDLLPTPKEADYVVRPGVPSSKLDIVEMAVGFIRDLKAMNKSMAEKIKDLEKELEA
                     CQCRHPRAEEAEAAPSGEPTMMERTAG"
     gene            complement(1383958..1385073)
                     /locus_tag="MYCTH_2316220"
                     /db_xref="GeneID:11513863"
     mRNA            complement(1383958..1385073)
                     /locus_tag="MYCTH_2316220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665912.1"
                     /db_xref="GeneID:11513863"
     CDS             complement(1384203..1384976)
                     /locus_tag="MYCTH_2316220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665960.1"
                     /db_xref="GeneID:11513863"
                     /db_xref="JGIDB:Spoth2_2316220"
                     /translation="MEHLLVSTSSDASYRSSTPCEFHCHLNRAWPITPPQDAGDGDLF
                     RCIVDHGRNPFSIVWQGSPEYPDLSNFPALDRVEVFPLPLSPALAAIWRNSALLDYGS
                     YASIRASEHSRFPILKLAHPDTQSLELIEHEFNILTDLQSLGLPVPEIDTQPIVDGGR
                     ICGYRMKALSKLKQYELHHRQHDIQRVLLRLHSAGFCNGDVTPSNIMKDGNDRIILID
                     FGFAGRVGSAVPPFIPNWVYASGIFEAEGDLKAFKRFIR"
     gene            complement(1385658..1387128)
                     /locus_tag="MYCTH_2310246"
                     /db_xref="GeneID:11513864"
     mRNA            complement(join(1385658..1386800,1386883..1387128))
                     /locus_tag="MYCTH_2310246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665913.1"
                     /db_xref="GeneID:11513864"
     CDS             complement(join(1385783..1386800,1386883..1387040))
                     /locus_tag="MYCTH_2310246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665961.1"
                     /db_xref="GeneID:11513864"
                     /db_xref="JGIDB:Spoth2_2310246"
                     /translation="MATQLSGGQVLSLSTDEHLSDNTQDGSPQIQTFTGGGDNVSETK
                     RGLLAQQLLQAPSIDATALTALLDRIPSESDHRPVQSYYPSPSRSSTVEPPEDEEHEY
                     EIKCHQALLDDNCRPLFHVDLLPHVEANPDAHTHLLRPWTIQQHPADAKGKWQALSRQ
                     WNRWKEFRAWQLRGRRRRPGFGEYLDVYRRDYFMSGGTSRRAAEPEFEQTARLRWERD
                     YSDYGEDEEDVERHAEVVRRLLPRGFVIRRPLRLLLDPKTQDLWTTYAEYLAFEAECL
                     YLLAGDARRLEKKAKGKYEVAKAKVDQQQCRVDWVLSEIEKIKEEQKAAACEGSSGKT
                     GSSKKRRPTDGSDGLQDVVEPRLGKRRRMGKTDEDTTDKDKTDETEEVLASRSNNLS"
     gene            complement(<1387377..>1389039)
                     /locus_tag="MYCTH_90226"
                     /db_xref="GeneID:11513865"
     mRNA            complement(join(<1387377..1387524,1387600..1388485,
                     1388852..1388858,1389001..>1389039))
                     /locus_tag="MYCTH_90226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665914.1"
                     /db_xref="GeneID:11513865"
     CDS             complement(join(1387377..1387524,1387600..1388485,
                     1388852..1388858,1389001..1389039))
                     /locus_tag="MYCTH_90226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665962.1"
                     /db_xref="GeneID:11513865"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_90226"
                     /translation="MAARCLLMPSPRKLPDFGISREGDTLKTFCGTYAYLAPEVYEGK
                     SITRRRRPTYTALVDVWSLGVVLARLLCGLPKQEEIDEYMGVEWCESIREGVERALRQ
                     GYRQGRRQDLLSFVLESMLCLDPDDRETAAECHKAALRLLLFDSNSVPESDNDRGEAD
                     GHHQHQQSDTEASTILAGKADGSLSSLSRYIDHTDELLGRRRDRSCRAPSPETVVPLH
                     VGQLLEKLRNPHDGLFCKSSFGEASDSDSGSDCSTSAPATVMIARDTVVEPQTQQQEQ
                     EDRPSDAPIREALVNYLNNGTGATLSVKRSRPASRSPGSKSPRVLSAGGADGGVGDGL
                     SARTAKRNRTVLGAGPDGLSESAVI"
     gene            complement(<1389517..>1392250)
                     /locus_tag="MYCTH_2070221"
                     /db_xref="GeneID:11513866"
     mRNA            complement(join(<1389517..1389915,1390010..1390161,
                     1390217..1390580,1390662..1391097,1391201..1391317,
                     1391761..1391958,1392030..>1392250))
                     /locus_tag="MYCTH_2070221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665915.1"
                     /db_xref="GeneID:11513866"
     CDS             complement(join(1389517..1389915,1390010..1390161,
                     1390217..1390580,1390662..1391097,1391201..1391317,
                     1391761..1391958,1392030..1392250))
                     /locus_tag="MYCTH_2070221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665963.1"
                     /db_xref="GeneID:11513866"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_2070221"
                     /translation="MGLEKTLETLACIAGNPPSKEDQKNGLRTTLVIVPANAIDQWIS
                     EIGKHCDSAVSHYKRSDTRNEVARQHSPIWITSYNELMQHYPSDNMIRKATQNPLLTA
                     EDCEAHRPQYLGPLFQIRFYRLVLDEAHAIKNHTSRRMQYRTQNTKFFGHALFELPRP
                     HVLEPIMVNMSREEALIYRRVEGILRRKVSKLFRRAKEQNQKVKGRWWLIEVLRLRQA
                     VLHPFLLENMMKDHFEPKDIEWLISELSKIQTSNPFIDQIGHWCEEQLQVRRSEQGSK
                     APKHEGLDASFDMIRQLEKVNKHKDWEKRAHDLCRRCGFVPDDQFYPKCGHVLCQSCI
                     ESYAAENRSSTMTGGCGPCNALLANVRRSLPPTQDPEIVEIGYWRGPSAKKRRGRGDD
                     INGIQPTTKSKTTFLADSDREIGNNMLTPSAKTLVLKSILLDWCKRYPNDKIIVFTLF
                     VDGGRIVGRMLQDANIDFLYYFGSMSHAEKQKAVKDFAEKKEIRVLALNLACANRVII
                     LDMWWNSAMEQQAFGRVYRMGQKKETYFGRILVRNSVDVRLAQLQLAKLEMIAKTIKD
                     HDSSDMALSIEDQAALLGRVVRDEDGNIIEIVADYDDEADTDAINATWNNDEWDQETM
                     VKDI"
     gene            <1394785..>1395352
                     /locus_tag="MYCTH_2129842"
                     /db_xref="GeneID:11513867"
     mRNA            join(<1394785..1394818,1395048..>1395352)
                     /locus_tag="MYCTH_2129842"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665916.1"
                     /db_xref="GeneID:11513867"
     CDS             join(1394785..1394818,1395048..1395352)
                     /locus_tag="MYCTH_2129842"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665964.1"
                     /db_xref="GeneID:11513867"
                     /db_xref="JGIDB:Spoth2_2129842"
                     /translation="MSRQGSFTSLLAVQIYRLCGGFALYDDCDERIESCIADPRHVDT
                     CGPSCDGPGICWPFAEICGGEEKLPCPEGKGCFNDLLCFPLRFGSDYYEKSKLEEVHR
                     TDQDGWQEDS"
     gene            complement(<1395740..>1396074)
                     /locus_tag="MYCTH_2129843"
                     /db_xref="GeneID:11513868"
     mRNA            complement(join(<1395740..1395872,1395908..>1396074))
                     /locus_tag="MYCTH_2129843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665917.1"
                     /db_xref="GeneID:11513868"
     CDS             complement(join(1395740..1395872,1395908..1396074))
                     /locus_tag="MYCTH_2129843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665965.1"
                     /db_xref="GeneID:11513868"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Spoth2_2129843"
                     /translation="MSQVLAIVGATGQQGGSVANFVLSDPVLSTRYKVRALMRDTTKP
                     AAEALVPGAPSSAAGAGARFVFAATRTVYDEQVKERELRQSKDLADDDYCMHFIE"
     gene            complement(1396983..1403146)
                     /locus_tag="MYCTH_2310248"
                     /db_xref="GeneID:11513869"
     mRNA            complement(join(1396983..1400821,1400935..1403146))
                     /locus_tag="MYCTH_2310248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665918.1"
                     /db_xref="GeneID:11513869"
     CDS             complement(join(1397232..1400821,1400935..1402969))
                     /locus_tag="MYCTH_2310248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665966.1"
                     /db_xref="GeneID:11513869"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="JGIDB:Spoth2_2310248"
                     /translation="MASTMGMSLDNRRARLHQLAAEWGIHPLPPVAPPSPAPQSRTPN
                     DEFHAEELLKRRRMSVIQEKPSQGTLKRAFSSNRKTWEPSEIFEALNAHVANGGAPGV
                     ADALIAKLLSVGGNLNVANGKSKTNLLTRRRSTENMERSRVLQKAVENRQADMVAVLA
                     QHADPLTLDRALPLALRAGDLAMVHLLLSRGANVSQTQDALDAFRQICIMGGNADLVG
                     LVLQSEGPPPPSWLSMCMVDAARKGCLQTVLRLSRSSADCEYNKAEALRAATAQCRVD
                     IALAILTAAKPPTTGGQGILESFGLLLQHATVGPNEKLALTEALLCAGASGDPVSVLL
                     SQACANEFHDMITLLVSYGASVEFQDASIVRNAVSRGQSTLVHLLLGDSTILNPIYAS
                     QCVTSIPKAIAPEDRYAILSLLLKKGAAGTPLHDALVDAVKAGDLPSVQLLTTPQFPS
                     PRPSTNPNRRSSLPGMVYIRHEMASVDHKSGLALDIAVQTGNLPMVKQLLAGKPSTKT
                     LDQVFSSALKLEPAVRYDIVECFLTAGVSRASVSAALQQAVEEQPPHRDENLISVLLR
                     HDVDVNFNDGAGILAAITIRDLPLLETLLKSKPAPQTMAAAVARAMVVEEKPVRYEMM
                     RMLIGAGAGRAGTEVSEALTQLLPVKPTDMQLATLLLELGRADANFNQGLPLSIAVTD
                     GDPALLDLILRHGRPNPDSIYRGLELVAGLSTDPSKPAKLAALLRYRPTPEFLNAILF
                     KEVQTLLALPPASRSLTSLRALLAAGADVNAHKAAALCCAVKAADAPIVDLLFGGGGG
                     GGGASLTARPSPASLAAALPQSLNISDPMDRLAFTQRLIRAGAPPAEATRALIYAITA
                     HPADLPLITLLAGHADHQSLPSGKKQGGALLVAVEGGNVEAVEVVLEKGAGRYGKAVL
                     GAALREAVSAQVVPDGNKRVGITKALLKRGVDAGALGDALLVAAREGDLELGRLLVEH
                     GASVEHREGQAIVEACSGGSAEVLKMLLGGKGEVKMVTLIKGFQAAAAQVGDLGKRAD
                     VFRLLLDKGVAGEVVDAQLVSAAKCGIEGERLVRLLLEFGASVDYDAGEAIWNATRSA
                     ILGSLKLMLGVEKVGERQKTPSQTTLLRSLKASKKLGSDLRYQVIQWLFQAGLTPCEE
                     INIALNRAVKDEPDSRLVRLLLEHGASPLANGCETLIDAAQLLLDDILSILLEADIPA
                     KDASWAFQQAFTPGTATTWLTEKGLHVAKMLLHKGAEGECLAVALSTAIDAYGSDIDA
                     VARGFAQALLQFNVDVSHEHGLVLQKAAQKADSELIQQILQQRPDSIAVSMAFPYIFD
                     ADLSESETLHLIELFVNYYEGGERLDVMFVHPVSEPILFRALNKFPRSVRILKTLLDA
                     GYYHDQTTVMRVMDDVEEPEQVSLLFWSLSQPQKKVSSAVIELLIDSGAKVDFETRVT
                     KTTPLTVAIQNRRHDLVKSLVLAGAEVDVVDATGNTPMTLATRIGGDLGISLMSSILA
                     ADPSINDGSLHNAARDLNLKAMQVLVEHGHDVDFPSTLHGGRSALGELCLNAAHAGPL
                     TAAQEKQMEKAMAFLISKDSDLTIQSDGKSVLLLALHSTDPIPTTRALLKVGLWKHVN
                     KPYNHYTDGTYTYSATQYVARVLPCSDDLRPQLLQLLKANRAIDVYYANDGPQPKDAV
                     NLPPELLRAERERRAREERIAKENEEHAIALARTKEIAQIQNQIFVARAELEDARARR
                     KREDEMAALRERQAAEEAAFAAELQRRKAAREAAIAHEQRLTEAGLTRARLVADAELE
                     MEGKKREMMIKWERDMSRQKENDAKALSSIRIKEREAIERLDAAADERATRRIAEQRR
                     LVEGQTALAARLANGAGGLDRRQIGYVTGELD"
     gene            <1403695..1406746
                     /locus_tag="MYCTH_2140504"
                     /db_xref="GeneID:11513870"
     mRNA            join(<1403695..1403723,1404646..1404673,1404768..1405301,
                     1405346..1405458,1405648..1405841,1405880..1406253,
                     1406309..1406600,1406650..1406746)
                     /locus_tag="MYCTH_2140504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665919.1"
                     /db_xref="GeneID:11513870"
     CDS             join(1403695..1403723,1404646..1404673,1404768..1405301,
                     1405346..1405458,1405648..1405841,1405880..1406253,
                     1406309..1406600,1406650..1406693)
                     /locus_tag="MYCTH_2140504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665967.1"
                     /db_xref="GeneID:11513870"
                     /db_xref="JGIDB:Spoth2_2140504"
                     /translation="MDSSRLDSGDDQTPYAQRSRLLDPSTHEIRLLTFTYPPLRPSLN
                     DTPNNPNPTYTLTLTLTFTLTLTLALALTHAPLSHPTGPCTPPSFSALSYVWGPPASS
                     SSADPPPPTVTIDGHRVPVTASLRSALACLARERWADALFGSQVSKYSSSSSSSSSSS
                     SSSSAGWGRVEGFVKTVLQFAITAADGATRMGPAQGRALVAWRRLWIIQEVVLARKAV
                     LVLGTDPEAGVTWIGRIDLGMPLLDAILWTSIGTSPDGAIQATDLRDNRIYGLLGMVR
                     QRDRCRIPVDYSPDMTISKVLFCHILSFCQRTPESIVREGVRSWVPDWTAPGVMPTIG
                     GVFLEEDHEAQLRGNASGSTNRRDWVSKCRIQDITYDDPAVSLPCVLVGSVERVGHEF
                     KAVPTSPNYLDNCRDWLLEIDEMVTASGRDSGRADVEDPSRFIYGFKVLRGSVLPPPD
                     LGTDDAKREWIMSESWDYRRAWKAHKRRAFVDPFGRPGLGPADMVTGDQIAVLAGAQL
                     PFLLRGDNAAGTHPVSEGTLFKWLKLV"
     gene            1407147..1408806
                     /locus_tag="MYCTH_2310250"
                     /db_xref="GeneID:11513871"
     mRNA            join(1407147..1407484,1407646..1407960,1408066..1408360,
                     1408428..1408806)
                     /locus_tag="MYCTH_2310250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665920.1"
                     /db_xref="GeneID:11513871"
     CDS             join(1407330..1407484,1407646..1407960,1408066..1408360,
                     1408428..1408679)
                     /locus_tag="MYCTH_2310250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665968.1"
                     /db_xref="GeneID:11513871"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Spoth2_2310250"
                     /translation="MAPVPKTMSGILIEETGGVEVLKWKTDLPVPELKEGEVLVRNEF
                     IGVNYIDTYFRTGLYKTPLPLVTGKEAAGVVVASAAPGLKEGTRVAYVADHAYAELTA
                     VPADRVASIPDGLAVETAAASLLQGLTALTFVREVAGLAPPHAPTNQLGVSEGPWVLV
                     HAAAGGTGSLLVQMLAVHGAKVIGTAGGKAKCEIARRNGAQWVVDSKSEDLVARVKEI
                     TGGKGVDVVFDGVGKATFEADLEIVARKGTVAVFGNASGPVPPVDILRLGAKNVKLMR
                     PVLFAYIATAEERAAYTKELFDLLLTGKVNIHIHDIYPLQEVGRAHADLEGRKTTGKL
                     LLKV"
     gene            complement(1408742..1410262)
                     /locus_tag="MYCTH_2310252"
                     /db_xref="GeneID:11513872"
     mRNA            complement(join(1408742..1409208,1409286..1409971,
                     1410075..1410262))
                     /locus_tag="MYCTH_2310252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665921.1"
                     /db_xref="GeneID:11513872"
     CDS             complement(join(1408805..1409208,1409286..1409971,
                     1410075..1410103))
                     /locus_tag="MYCTH_2310252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665969.1"
                     /db_xref="GeneID:11513872"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_2310252"
                     /translation="MAVGTVLVTGGTGYIGSFTTLALLENGYDVVIVDNLYNSSKVAI
                     DRIELICGKRPVFHQVDITDEAALDAVFAQHPEIDSVIHFAALKAVGESGEIPLEYYR
                     VNVGGSISLLRCMERHNVTNIVFSSSATVYGDATRVPNMIPIPEHCPIGPTNTYGRTK
                     VMIENVITDHIEAQRRNSQKAGKPYEQWNGALLRYFNPCGAHPSGIMGEDPQGVPYNL
                     LPLLGKVATGEREKLLVFGDDYPSRDGTAIRDYIHVLDLASGHLAALNYLREHKPGVK
                     AWNLGSGRGSTVFEMIKAFSKVVGRDLPYEVVGRRHGDVLDLTAHPALANKELHWKTQ
                     LTLEDACADLWRWVSNNPKGYRQDPPAELLEALEAKKA"
     gene            1411514..1415066
                     /locus_tag="MYCTH_2310254"
                     /db_xref="GeneID:11513873"
     mRNA            1411514..1415066
                     /locus_tag="MYCTH_2310254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665922.1"
                     /db_xref="GeneID:11513873"
     CDS             1411710..1414877
                     /locus_tag="MYCTH_2310254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665970.1"
                     /db_xref="GeneID:11513873"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="JGIDB:Spoth2_2310254"
                     /translation="MSPDSHLAYSRLGIMADITTSRQSSPAIARGLASELRGTPEVIA
                     SMPPRRRVRGPASPSPAPQGSRGSTPADRGGMARTPVPAKYSTSYGSPMTQLPDRSTA
                     GGGSITKAAAEIFTKVKRDNVAAEARRRSKDQARAARAARATRAARAGSQNTTASPLR
                     AATPPTIEEVDMESEEGSEGQSSSGAEGSEYEDRNGTQPERRSPRKPQPRDVRKRARD
                     DEDEARAEKERKERDARLALERSAEAQKVKNQKLAEAQAAREKAEQERKADEERQAEQ
                     RRLAEQERQAEQERRAQQAAREEAARAAMPPPPQPLVPRPAPTATPTAPHATNSADAM
                     DHRPGSARSFIEEGKLFQEANVQTPTPPPPRQVRRPGPSAPPAPPAPPQAAQGTTVRT
                     RLSALPPGPPSPPSVLKRPPRRPGGTTPAPRHERRPSPANDDRGSTSRSSPEEPSPEP
                     DEENHRQHDSPSNPFVAASYAQRLRSRFKPLAGKSEVNGAAGGHTQAESPQAPASSDY
                     LPRWSGAKRSFGLLSVLKLLAGAFVMLHLIRLVHTLVRPDLFEPAITWYGWNDWTNNI
                     GQFLPSPLLHPLGVLTDDQYDDLKDYLQRRTTATEAAVNNLQSVLPKVVSVRKDQKGK
                     VIIADEFWTALKDKIEHDSRILSLDGKSRISEPHWRAIEQRLKDAGLLAKPLSADDVE
                     KIVDKSAPASWEKWLAKNKQRVADIIGHGTDSSRGSLSGSPKGTTESVVSRSEFLREL
                     TARLSESKKEVETEMGGLRKDLDGVLREVKKLASEGGMSRAETTSLINRIVDKEITGR
                     LTRIGSKSGAAKIDAAFSNRVNLFSPGNNAQVDISLSSPTYEIVPPPVGSKKYLKSMP
                     RQAPFLPDKSQALRPWTEPGHCWCAAILGARNRTHPAVLAVRLAQFVIPQHVLLEHID
                     PAATTDPLAMPRDVEIWAMFDDHARRERVLDWMAVQFPADITGAQNGNSNNNNNNNQK
                     LISEGWAKIGHFVYKHRPEDEGVYVHHLSRDLVDLLGAATDLVMVRALTNYGAKDHTC
                     FYRVRLYGEVVEEEELLAERESRKW"
     gene            complement(1415067..1418089)
                     /locus_tag="MYCTH_2310255"
                     /db_xref="GeneID:11513874"
     mRNA            complement(join(1415067..1417616,1417739..1418089))
                     /locus_tag="MYCTH_2310255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665923.1"
                     /db_xref="GeneID:11513874"
     CDS             complement(join(1415256..1417616,1417739..1417870))
                     /locus_tag="MYCTH_2310255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665971.1"
                     /db_xref="GeneID:11513874"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2310255"
                     /translation="MAAGSTKDGLPHRKKPILKKEVKSLKRKRGEEDLNKLKAAIEQL
                     DPKSADLNNFTDLPLCEATATGLRASHFEVLTDIQRAAIPLALKGNDILGAAKTGSGK
                     TLAFLVPVLEKLYHAKWTEYDGLGALIISPTRELAIQIFEVLRKIGRNHYFSAGLVIG
                     GKSLKEEAERLGRMNILVCTPGRMLQHLDQTANFDVNNLQILVLDEADRIMDMGFQSA
                     VDALVEHLPKTRQTLLFSATQSKRVSDLARLSLKDPEYVSAHEAAPTATPTTLQQSYV
                     VTPLAEKLDTLWGFLRSNLKSKIIVFLSSGKQVRFVFESFKRMQPGIPLLHLHGRQKQ
                     VARMEITSRFSSAKYACLFATDVVARGVDFPAVDWVIQVDCPEDAETYIHRVGRTARY
                     QSKGRAVLFLDPSEEEGFLKRLEHKKVPIQKVNVRASKKKSIKNELQSNNFQSADLKY
                     LGQKAFISYVRSIYLQKDKEVFKFDELDLDGYAESLGLPGTPQIKFQKGEDVKRLKNR
                     PRAALSSDSESDSDAEGGGRRKKDKDQVRTKYQKMAERQNQDVLSEHYRKLIDEGDTQ
                     AGEGGGGGGSDDEAGFLSVKRVLADDAQIDAAAGGGGKDSAGAEPKVVKLGKSELVID
                     SHRREKLLKSKKKLAKYMDKGTKLVFDDEGNAHPIYELQGEEDFAKEGPADKLRQQFV
                     EAEAEKVKEADVEDKQIAKKRLKEKRERRKAREREELGLAPRGDGGTVQLDADGAAEG
                     EDPLALLRSLPIAGQESGGETDGEKEEEEEEEDREPPRKKAKKWFQDDSDKEEEKKKK
                     KKKKGGKKVIEIGHEPDNLEDLEALAAGLLED"
     gene            complement(1418095..1420755)
                     /locus_tag="MYCTH_2310258"
                     /db_xref="GeneID:11513875"
     mRNA            complement(join(1418095..1419657,1419787..1419866,
                     1419943..1420252,1420505..1420755))
                     /locus_tag="MYCTH_2310258"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665924.1"
                     /db_xref="GeneID:11513875"
     CDS             complement(join(1418458..1419657,1419787..1419866,
                     1419943..1420252,1420505..1420591))
                     /locus_tag="MYCTH_2310258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665972.1"
                     /db_xref="GeneID:11513875"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="JGIDB:Spoth2_2310258"
                     /translation="MAERPGVLRRLANKVAVDSEPGLTSAQMMLTNHDLKPVEPERRQ
                     WGPWNFVGFWVADSFNINTWMISSSMIVGGLSWWQSWLCVWIGYSISGSFICMTARIG
                     ATYHIGFPVASRSSFGIWGSLWPVFNRAAMACIWYGVQSYIGGHCVYLMIRSIWKSWD
                     RETIPNTFSQDSGTSTADYVSFFLFWFCSLPAIWFPVHKIRHLFTVKAYVVPCAGIAF
                     LIWSVVRAGGVGPIVRQPATKEGGELAWEFIKGVMSSIANFATLIVNSPDFSRFAGKP
                     RDALWSQLFTIPIGFALTSFIGIIVSSSSAVIYGGKPIWDPLDLLEHFLDDGGSAQRF
                     GVFVIAAAFALAQLGTNIAANSVSAGTDMTALLPRYINIRRGGYICAAIGLAMCPYNL
                     LTSSNMFTTYLSAYSVFLSSIAGVMIADYYLVRRGFLEVKELYDARRTGPYFYTAGIH
                     WRAYAAYIAGILINVVGFAGAVGTPVPIGATYLYNLNFFCGFGVSAAVYWLLCRIWPV
                     PATSDRWMEVGDEIGDLRVAYHDRRSSSLVGVEEEEVESGSAAKDAGKAV"
     gene            complement(<1423811..>1426997)
                     /locus_tag="MYCTH_98157"
                     /db_xref="GeneID:11513876"
     mRNA            complement(join(<1423811..1424152,1424277..1424566,
                     1424632..1424809,1425395..1425676,1425779..1426456,
                     1426662..>1426997))
                     /locus_tag="MYCTH_98157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665925.1"
                     /db_xref="GeneID:11513876"
     CDS             complement(join(1423811..1424152,1424277..1424566,
                     1424632..1424809,1425395..1425676,1425779..1426456,
                     1426662..1426997))
                     /locus_tag="MYCTH_98157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665973.1"
                     /db_xref="GeneID:11513876"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Spoth2_98157"
                     /translation="MTALAADNTAAVAEVARPGEAEDISEKTTNITKTKEGAPESPEI
                     DAIPPTYDKESSQSKDDASDDAIIVTGADAAVHLLSLRDDGGQALTFRSILLATILSA
                     FQAVMYQIYTFKPTAITIQGTFIVLIAYFLGNGWAALLPRGDRLLARWREPGGQGRPP
                     LWITLANFLNPGPWNLKEHAICAITATSASNAAASVQVFAAQDLFYDLPLSATTVVLA
                     VISIGLFGYGLCGIMRPVAVWHVDAVYWSNLPTVKTLQGLHWEDVKNSKPLRWFWYSF
                     VGMFFYEFLPAYIWPWLNAISIPCLAAMHTVGKKAAVLTNLFGGSINNEGLGLFSISL
                     DWQYITSFNTALPLPLQAHAAFGYLVCYAAMLGIYYTNAWGAKSLPFMSTRLRSQDGG
                     TYPTAEVFVGGVLDREAFQKYGIPRLTGSFAYSLFMANAASTILYSRYGNGIATNNLS
                     KMLAGLILPERPIGNMYFACWSHNVIANCVNLSGDLKMGEYLKIPPRVMFLTQVYGTI
                     LGGFINYAVMISIVGGNRELLANTDGNSSWSGANMQSYNTNATSWALAKYMFTSGATY
                     FKVPIGLAIGFGIVILHRIFAHFVPKIRSFSVYDINMPQFIQYAGYIPYNASQTCVLL
                     SQVLSGFYVQYWLRNYRPRIFRDYSYLITGAFDGAALFALFILSFAVFGAGGRSVPFP
                     KWWGNNVDGYYDLCPVPEE"
     gene            <1430339..1431659
                     /locus_tag="MYCTH_2310262"
                     /db_xref="GeneID:11513877"
     mRNA            join(<1430339..1430587,1430774..1430814,1430964..1431227,
                     1431289..1431659)
                     /locus_tag="MYCTH_2310262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665926.1"
                     /db_xref="GeneID:11513877"
     CDS             join(<1430339..1430587,1430774..1430814,1430964..1431227,
                     1431289..1431531)
                     /locus_tag="MYCTH_2310262"
                     /codon_start=3
                     /product="uncharacterized protein"
                     /protein_id="XP_003665974.1"
                     /db_xref="GeneID:11513877"
                     /db_xref="JGIDB:Spoth2_2310262"
                     /translation="MVEMRLSAVVCCSLAAGVASASRQGMALIPGSSSRGFGLLARQN
                     PFCTTESTCAECFGEGYVVCDDIGCFNPDEYDQCCAGAVICVGKDNSCCKGWGGPGVT
                     GKAGVPTGTTPATATPTDADADTGSYSSYRDDTGEECCQRAPNPPLHWCSGNFPNFRC
                     YNPKNQFCCTNGKVCDEKDCCALFNESTTHPWSSARSSTAGPSSSSSSSSSPATGTVT
                     QAPTSATAAATADSSSTSTTSTGAGSVSGPSYIALGLAALGLALSY"
     gene            complement(1431683..1434645)
                     /locus_tag="MYCTH_2310263"
                     /db_xref="GeneID:11513878"
     mRNA            complement(join(1431683..1433034,1433121..1434371,
                     1434499..1434645))
                     /locus_tag="MYCTH_2310263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665927.1"
                     /db_xref="GeneID:11513878"
     CDS             complement(join(1431788..1433034,1433121..1434371,
                     1434499..1434553))
                     /locus_tag="MYCTH_2310263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665975.1"
                     /db_xref="GeneID:11513878"
                     /db_xref="JGIDB:Spoth2_2310263"
                     /translation="MELTVAEASGLIAAGVFILQQLLSLIFPAALVGFVREENTAVTW
                     SVLGRSLQSSPWPTILQNDTAARHGVRRRISNGLTLQTVTMLLISVAAIVTPLGLYQS
                     IEPGDRELARFEFVKDESPFGYATHARLSGPFSRSCGSSRPCPGSWGNTTCTRQGLAE
                     VCTSQFGRAIPEIWRSTFREGARQVNESVSSIFDIQWRNQINTSDPYGEWSRYMQSGY
                     RQTGILVLDPTIQLVDGLIVDAKDGGIGFRNHTAPATAYEYGSTWSEDILFIEPEAQC
                     VNLNLTFDFQLVDTTYSRRLEPRHLSLTDHGGFSALSRTSPDLSLPSHGNGQGPVDLR
                     ERAYKAAWANNFLTLAHFNATDLDPNNITRLDVTPGMRLLADDSGIDVPKNNTNTTAG
                     TETAFFVDFQSVRSNLQFGEYLDLGSTSAGKRPRVTVDQFDFVSELCGGVAGASPANI
                     NSSLVGCGLVYGAAYRTDGGDELSPQPLSNWTVPVYSCAASVRATIRTVTFRHNGSGL
                     AGLRVTAAQPKTYASPAEHPVWAVEAMPREYMIRDSQPLWGLLPESAPPALGNNLSTV
                     RQPWLRLPGLVNSIDSPLANGLDYVANRPGQNLPGVDFYALALQNAFGVARPGSGLYS
                     LYGDYSGLTSLAMYSKWRNLTSSEAGTAHLLRLLWTDIAANSVVGTKGWGLDDPAALG
                     EGEGESGNRVRKRDGDDDWNGDGNGSQDVGAVVPVTVYRLRVRYQLPYMAPAIVVLVL
                     AAGVLCTWLALTAMRRTGPAKMRWLLDATSPGRILGSFLWPEKAATLRGTNEWVKTLG
                     TKMVVVGSKGPGGPVAVAAGGEDKPQEGNARPEGEETVQLMSKDRPAGTAAA"
     gene            1437298..1438782
                     /locus_tag="MYCTH_2135569"
                     /db_xref="GeneID:11513879"
     mRNA            join(1437298..1437344,1437959..1438782)
                     /locus_tag="MYCTH_2135569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665928.1"
                     /db_xref="GeneID:11513879"
     CDS             join(1437335..1437344,1437959..1438518)
                     /locus_tag="MYCTH_2135569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665976.1"
                     /db_xref="GeneID:11513879"
                     /db_xref="JGIDB:Spoth2_2135569"
                     /translation="MTRAPIRSSRARAERPQVKMPSQRPFFLSTFFAAFRQQTPASLS
                     GASASTQQPNKHTTQASTSSQQTPSATPRAISTAAASTGTSQATSPQSRSGGVMNQLP
                     LHSPRHQQHHHHHHSAGIPIPQSPGRRDNHGRRRGSDSSSEGFRDALGAEKLYIGGRT
                     ATGEERFFKLGVVRRVRSGDRLSLDRLSL"
     gene            complement(<1439051..>1440924)
                     /locus_tag="MYCTH_2069347"
                     /db_xref="GeneID:11513880"
     mRNA            complement(join(<1439051..1439865,1439923..1440060,
                     1440111..1440628,1440686..1440774,1440829..>1440924))
                     /locus_tag="MYCTH_2069347"
                     /product="glycosyltransferase family 59 protein"
                     /transcript_id="XM_003665929.1"
                     /db_xref="GeneID:11513880"
     CDS             complement(join(1439051..1439865,1439923..1440060,
                     1440111..1440628,1440686..1440774,1440829..1440924))
                     /locus_tag="MYCTH_2069347"
                     /note="CAZy_ID 270023"
                     /codon_start=1
                     /product="glycosyltransferase family 59 protein"
                     /protein_id="XP_003665977.1"
                     /db_xref="GeneID:11513880"
                     /db_xref="InterPro:IPR007006"
                     /db_xref="JGIDB:Spoth2_2069347"
                     /translation="MQIITTFGFFVLWLASRWWLALVDKYVPEPYLDEVFHIPQAQKY
                     CAGHFRDWDDKITTPPGLYLLSVAYHRFRLLSECTPFSLRSNNLLATILTAFLAAQCR
                     HLIETRAAGRNGETSSVAMPFGSYYTGLNIALFPLIFFFSALYYTDVMSTLVVLVAYR
                     NHLLRLQARRLGIVNDLWTVVLGVCALFMRQTNVFWVVVYMGGLEAVHVLRSVHSGSQ
                     KDSTLHDPPLSQSGPQDWFLCVLTLAVAALSNPFRVVRQIWPHLTILALFAGFVAWNG
                     GVVLGDKSNHIATIHLAQMLYIWPLFAFFSAPLLIPSVLSAATRPIQYLHTLFSLTSK
                     RAAFISVSYTLVTVLLSLVVVRYNTIIHPFTLADNRHYMFYVFRYTILRSHALRLSLV
                     AAYTVCRWLVWDQLAGAAGPAQNPPRPVKEAAAATAAAAPRTSTALLWLLTTALSLTT
                     APLVEPRYFILPWVFYRLLVPAWRATDAPAPPGIGRAWPRGGLAGRLWLVAGSVDVRL
                     PLETAWFVAINVGTMYVFLFRGFYWRGEHGELLDGGRVQRFMW"
     gene            complement(1441342..1442557)
                     /locus_tag="MYCTH_2310269"
                     /db_xref="GeneID:11513881"
     mRNA            complement(join(1441342..1441588,1441649..1441702,
                     1441765..1441858,1442087..1442140,1442265..1442320,
                     1442441..1442557))
                     /locus_tag="MYCTH_2310269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665930.1"
                     /db_xref="GeneID:11513881"
     CDS             complement(join(1441580..1441588,1441649..1441702,
                     1441765..1441858,1442087..1442140,1442265..1442320,
                     1442441..1442452))
                     /locus_tag="MYCTH_2310269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665978.1"
                     /db_xref="GeneID:11513881"
                     /db_xref="JGIDB:Spoth2_2310269"
                     /translation="MSFPTPSLRAPAHPQYKSPYGPKYFYQSHVAGITTKTLVRTGVK
                     SGLYGGVALFAVIFFASGIPRIQQDILQKVPIIGKRFVREIHPADNPF"
     gene            1442714..1443948
                     /locus_tag="MYCTH_2310270"
                     /db_xref="GeneID:11513882"
     mRNA            1442714..1443948
                     /locus_tag="MYCTH_2310270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665931.1"
                     /db_xref="GeneID:11513882"
     CDS             1442869..1443918
                     /locus_tag="MYCTH_2310270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665979.1"
                     /db_xref="GeneID:11513882"
                     /db_xref="JGIDB:Spoth2_2310270"
                     /translation="MDKDLDGRFERLEKALGNMIDGLAKNNPSEKVAEELLAAENDLF
                     DALKLLEKHQNNNARIQQLRQETARYDTQIKDIASSLWNMRKELKAVPVTANPPSGKK
                     NQFTTAELLAYARRISRNTLPLPGVTNGVDMSTTAPPTQSADPEDSFRLQSQPSQTRT
                     PNTSFNLSFSGAVGTPGGPTNTPTPNTANDTQPTTQPSPSQPPKTATEDRLPQHLKPA
                     INPLHDAAFHPWPTEAQIRSGALAAIQRLVDAGIDPKGYDPEEEERKRKAEEQARREA
                     EERARQEREAAERRAREERERMARERELARQREGEAAAAGGLERRDSVAVGRAKPKQF
                     TFLGADDDDDDDEDD"
     gene            complement(1444537..>1446725)
                     /locus_tag="MYCTH_2096246"
                     /db_xref="GeneID:11513883"
     mRNA            complement(join(1444537..1444794,1444853..>1446725))
                     /locus_tag="MYCTH_2096246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665932.1"
                     /db_xref="GeneID:11513883"
     CDS             complement(join(1444727..1444794,1444853..1446725))
                     /locus_tag="MYCTH_2096246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665980.1"
                     /db_xref="GeneID:11513883"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="JGIDB:Spoth2_2096246"
                     /translation="MRVKNSAPLGRLLAALLAGPQLVSAFYLPGVAPTSYKEGDPVPL
                     YVNSIRPTAGPDAMLHSVVSYDYYHPLFQFCKPPDGPQSVGESLGSILFGDRIKTSPF
                     ELKMGKNESCKALCKTTYQKTAAIFVNNQIRSGMSINWLVDGLPAGQKIVDVLTEEEV
                     YNPGFLLGQQIGDSDQVQFNNHYDILVEYHQVAGTEDQFRVVGVIVQPESKRYTAPID
                     EESCTTPMEPVILNESGDTEVQFTYGVYWIPSPTAWATRWDKYLHVFDPKVHWFSLIN
                     SAVIVVSLVLMVMSILVRALKKDIARYNRLDQLSLDDLSGTAALMEDGVQEDSGWKLV
                     HGDVFRTPSHPLLLSVFLGNGAQLFVMAGFTIVFALLGFLSPSNRGSLGTIMILLYTV
                     LGFVGGYTSARMYKSLQGEKWKLCIVLTPVLVPGIVFATFFLLDLFLWAQNSSGAVPF
                     TTMLVIILIWFIISVPLSVAGSWLGFRAPTIEPPVRTNQIPRQIPPVTSYLRPVPSCL
                     LVGMLPFAAIFVELYFIMSSIWFSKIYYMFGFLFLCYVLMIMTCAAVTVLMVYFLLCA
                     ENYNWQWRAFMAAGTTAGYMFLNAIIYWISKLSLGGFAGSVLYIGYSLLISFLFFILT
                     GSIGFFASWLFVRKIYSSIKID"
     gene            1447221..1448584
                     /locus_tag="MYCTH_2310272"
                     /db_xref="GeneID:11513962"
     mRNA            1447221..1448584
                     /locus_tag="MYCTH_2310272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665933.1"
                     /db_xref="GeneID:11513962"
     CDS             1447321..1448466
                     /locus_tag="MYCTH_2310272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665981.1"
                     /db_xref="GeneID:11513962"
                     /db_xref="JGIDB:Spoth2_2310272"
                     /translation="MAAPATLPALLDSLTKSISSTLEVAPKIANIELPKDGISLLDVK
                     NELLLSYLQNLVFLILLKLRQAKSGDTKSNTEGQSLDDLVVSKLVELRLYLEKGTRPL
                     EDKLRFQIDKVLRAADDAERNAKQAEEASKANGNGSGSESESESDSEEGSDEESDEQE
                     APAAAGFKMSDLQHRPNLSNFQRPAAAAKYSGKETDASGVYRPPKIAPVVMPTTERRE
                     KGDRRPLKSATLDEFIADEMSTAPIAEPSIGTTIADRGRKIKTAAERRKEDERREFEE
                     TNFVRLPKESKKERAKRLRQEGGSRRMNFGGEEWRDLSEGVDRISRLTKSKSSGGGTK
                     ALLEKSRKRGIDTVDGPRGSGVSMGERFQKRLKVLEAGRGTRGKGRK"
     gene            complement(1448585..1450363)
                     /locus_tag="MYCTH_2310273"
                     /db_xref="GeneID:11513963"
     mRNA            complement(1448585..1450363)
                     /locus_tag="MYCTH_2310273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665934.1"
                     /db_xref="GeneID:11513963"
     CDS             complement(1448703..1450271)
                     /locus_tag="MYCTH_2310273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665982.1"
                     /db_xref="GeneID:11513963"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_2310273"
                     /translation="MGSQSRAYNPLLHPILFLFQLFQWLTDKILSPNPPGPSTRLSRP
                     KIAVIGAGITGVTSAAHCIGHGFDVTIFEAGGEDELGGVWSRVNNTSSLQIHSVMYRF
                     HPSVRWARGYPDCQQILAQVRDLWTRYGLEGRTRFRTKVDRVYRDDRARWVVNNASLG
                     RFDGVVAAVGTCGEPKIPRMPGMDKFRGEIHHSSRLPGACSTRDKTVIIIGGGASAVE
                     ALEFAHEEGADKIYILARSDKWIIPRNPLWNTLLAMNVFGQPQTFLSWIPELLLRKMF
                     YRDLEDLAPAPANKGGIFTDTPMVNSDIMDKLRSGRAEWIRCDVEGFTETGVRINRGA
                     KGVPRGGPGRQDVVEGDVVVMATGFARPKLDFLPDSCFEKPYEPPNWYLQTFPPNHPS
                     ISCINCTYMNAIGTVGNWHIGIYTRILLMFLIDPLTRPSPFWMKRWIDMTRLFKKTSP
                     VGPSEFFTYLELVWWFCFCVALNPFRWKWALFVFFGLGFMLPKHVVAAEDRIRNGLGM
                     REQDTTGQDVGLSL"
     gene            complement(1451678..1452241)
                     /locus_tag="MYCTH_2310276"
                     /db_xref="GeneID:11513964"
     mRNA            complement(join(1451678..1452141,1452201..1452241))
                     /locus_tag="MYCTH_2310276"
                     /product="carbohydrate-binding module family 18 protein"
                     /transcript_id="XM_003665935.1"
                     /db_xref="GeneID:11513964"
     CDS             complement(1451697..1452083)
                     /locus_tag="MYCTH_2310276"
                     /note="CAZy_ID 270022"
                     /codon_start=1
                     /product="carbohydrate-binding module family 18 protein"
                     /protein_id="XP_003665983.1"
                     /db_xref="GeneID:11513964"
                     /db_xref="InterPro:IPR001002"
                     /db_xref="JGIDB:Spoth2_2310276"
                     /translation="MLSYLATLCLILFGALAAAVTNTGTGTGTPGLARREVSPDNTCG
                     GETGYTCPGELACCSQHGYCGSTDEFCLSTAGCQADFSNSTDACHEPIPGESFSIDGT
                     CGTEGAGTEGYRCPANATITSCCSAA"
     gene            <1452941..>1454016
                     /locus_tag="MYCTH_2112769"
                     /db_xref="GeneID:11513965"
     mRNA            join(<1452941..1453162,1453311..1453331,1453468..1453845,
                     1453999..>1454016)
                     /locus_tag="MYCTH_2112769"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665936.1"
                     /db_xref="GeneID:11513965"
     CDS             join(1452941..1453162,1453311..1453331,1453468..1453845,
                     1453999..1454016)
                     /locus_tag="MYCTH_2112769"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665984.1"
                     /db_xref="GeneID:11513965"
                     /db_xref="JGIDB:Spoth2_2112769"
                     /translation="MMSTVLSNIPLKNSLVWSSPEKGSRACDDNTACQSILHEQDNFP
                     LPSLSADSETRTLMAKEGTYNCLHLAAPRWYYDPRLYQIRYWNESTSRREESSELNRP
                     TPSVWRPHPPPPEQDVQRGEPEARQQQARHDGGEGGAEQGRQQPDAGVDGARAVDHLE
                     TLRDGDDCGHEGEARNTSHRVSETSFLFIVPKDNHERTSVRDLTHPASCRRE"
     gene            1454712..1456185
                     /locus_tag="MYCTH_2310277"
                     /db_xref="GeneID:11513966"
     mRNA            join(1454712..1455476,1455605..1456185)
                     /locus_tag="MYCTH_2310277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665937.1"
                     /db_xref="GeneID:11513966"
     CDS             join(1454831..1455476,1455605..1456047)
                     /locus_tag="MYCTH_2310277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665985.1"
                     /db_xref="GeneID:11513966"
                     /db_xref="JGIDB:Spoth2_2310277"
                     /translation="MESLPPSMPPPTTAGSVHRDGPQMMEMDVDGDLVLRVGSELGKA
                     QDFRVCSATMRRASPIWKIMLFGPWKEAKPTEGNWRVDLPDDNPWPMGILLAIIHSKF
                     GLVQRVESLGEVHEILLVADKYDMTALLQPWAACWIHLRLPTPPGTGSRVTGRELMLR
                     IHAAWELGDEGMLSSVITHLVFSVSISNDSDSETQVSYKGETIRPEQNYGPPDLLELI
                     QKRRLAVIQKLLDFYHEQVNRRTTDTPDRTFSGSWDPAGTQRDCQVLGSTSRSQRQRL
                     EELGPLPAQATAVTQSANAIMQALSDVFARGRSLHRDRKSRDPSLAYQDLLATIEELK
                     MERDVLEPHHKERLAAQRMKMGLGTGAS"
     gene            complement(1457334..1458290)
                     /locus_tag="MYCTH_2310279"
                     /db_xref="GeneID:11513967"
     mRNA            complement(join(1457334..1457890,1457965..1458052,
                     1458141..1458290))
                     /locus_tag="MYCTH_2310279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665938.1"
                     /db_xref="GeneID:11513967"
     CDS             complement(join(1457774..1457890,1457965..1458052,
                     1458141..1458184))
                     /locus_tag="MYCTH_2310279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665986.1"
                     /db_xref="GeneID:11513967"
                     /db_xref="JGIDB:Spoth2_2310279"
                     /translation="MSGTQNKNPGNFANRPEEEVREIASKGGQSSHSGGFASMDPDKQ
                     REIASKGGQASSGSFEPGSERAREAGRKGGSRTAADTD"
     gene            <1460620..>1461587
                     /locus_tag="MYCTH_40175"
                     /db_xref="GeneID:11513968"
     mRNA            join(<1460620..1460842,1461031..>1461587)
                     /locus_tag="MYCTH_40175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665939.1"
                     /db_xref="GeneID:11513968"
     CDS             join(<1460620..1460842,1461031..1461587)
                     /locus_tag="MYCTH_40175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665987.1"
                     /db_xref="GeneID:11513968"
                     /db_xref="JGIDB:Spoth2_40175"
                     /translation="VIKDSWQYLERDKEGELLRKAASKGIVHVARYYHETVRVRNIED
                     DVCNNVRKGPDITKAIDFWQSRSLVSLSTTITLLSALADCISGHESLRQRAGLLHRDI
                     SIGNLLIGEDNRGFLIDLDLAVKEQRLGASGSKGKTGTRAFMAVGALLCERHSFTHDL
                     ESFFWVLFWICIHCDGPGRGRVVDRLDRWNYADIEELAKLKLGTVSDEDIFRITMEES
                     CYSSVATVSIALEGCKQVRHHSGIRAVGGTPRPTITIYRSR"
     gene            complement(<1507114..>1507948)
                     /locus_tag="MYCTH_2068637"
                     /db_xref="GeneID:11513969"
     mRNA            complement(join(<1507114..1507203,1507316..1507671,
                     1507741..>1507948))
                     /locus_tag="MYCTH_2068637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665940.1"
                     /db_xref="GeneID:11513969"
     CDS             complement(join(1507114..1507203,1507316..1507671,
                     1507741..1507948))
                     /locus_tag="MYCTH_2068637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665988.1"
                     /db_xref="GeneID:11513969"
                     /db_xref="JGIDB:Spoth2_2068637"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            complement(<1546977..>1548899)
                     /locus_tag="MYCTH_2068961"
                     /db_xref="GeneID:11513970"
     mRNA            complement(join(<1546977..1547870,1548027..>1548899))
                     /locus_tag="MYCTH_2068961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665941.1"
                     /db_xref="GeneID:11513970"
     CDS             complement(join(1546977..1547870,1548027..1548899))
                     /locus_tag="MYCTH_2068961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665989.1"
                     /db_xref="GeneID:11513970"
                     /db_xref="JGIDB:Spoth2_2068961"
                     /translation="MSAPWEEIPFVGPVLGSLVDVTQHQAIQLGEQVGTAASVVADAI
                     IGKERKERAVTAVPAWLVDKFADKDRIVQAASETVRDAADDSLVQLSTQVLQRWRPIQ
                     DGAADAIERAQDDEVESVLRCLWGLVTSISEKVSPGKLLKALPELPRLVLETALGTVG
                     RLGVLRGGILSNEINVATLGLVWNHFDELVKFFVDLIECVKCYAPASSLDGKAAQGDP
                     HGPYNELDLLQPMNRHAVACQLQRLVKSVVFILKRAAAPVKFEQIDMTKETILPSDDC
                     GLGTLIVVRPSGWQCVTREKWLFVNGIATELFWLHLACEKLAKRYSREVTGVFNRGDG
                     ILWDLIECAGERDARGVGSAGSQKAATNRTKSSRMAQEKLEEQLRAALRQAGEGRAYD
                     HVVVIAHSQGCLLLRPALEELILSAGKDSRGADDIRRTMLDRLCVFTFGSPSVDWRLG
                     RDEDGAFPAPLRGSKQEKRGTDLGFLSSHVLCTEHFANAADFVAKLGVLSEHKDEHDS
                     GYESDSVFVNREKDWVGHLFGTQYSLESRHYGAEKGPEKEIGRVAQMAGFSSVLLNCQ
                     GGISIRDAMRNANAGQQPDGMV"
     gene            1551607..1552706
                     /locus_tag="MYCTH_2310287"
                     /db_xref="GeneID:11513971"
     mRNA            join(1551607..1552576,1552639..1552706)
                     /locus_tag="MYCTH_2310287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665942.1"
                     /db_xref="GeneID:11513971"
     CDS             1551657..1552505
                     /locus_tag="MYCTH_2310287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665990.1"
                     /db_xref="GeneID:11513971"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Spoth2_2310287"
                     /translation="MGWHWSIIGMGASAFITCTDGKTVLKGQDVWENGRHCASFECPS
                     EDAIVREAAIYKLLGDHPQILRCSGLSEIHPGVRALRLELAPFGDVRHYLEQHPDDPP
                     PLKTRLNMVLDVAQGLAHVHSRGVWHFDFSTKNLFLFPDFHVKIGDFGGSVCEALGYN
                     GGTLEDQDYELPCRGRDFMERPRDKRELFALGSSMYEIVAWARVFPGLSEEEVDERLK
                     NEDFPPVDTLAIGHIIDGCWKEHYSTANDVLQDLRSRVLLVNGDGVDNTVKGNGQALS
                     ARYGGP"
     gene            complement(<1553797..>1554003)
                     /locus_tag="MYCTH_2069178"
                     /db_xref="GeneID:11513972"
     mRNA            complement(<1553797..>1554003)
                     /locus_tag="MYCTH_2069178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665943.1"
                     /db_xref="GeneID:11513972"
     CDS             complement(1553797..>1554003)
                     /locus_tag="MYCTH_2069178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665991.1"
                     /db_xref="GeneID:11513972"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2069178"
                     /translation="ICLEPFRDQSLVRALPCHHLFHAECIARWFRKHHDTCPICMARD
                     DSVSGSGSGGSALPEPPPPAFLAF"
     gene            1555164..1559477
                     /locus_tag="MYCTH_2310289"
                     /db_xref="GeneID:11513973"
     mRNA            join(1555164..1555375,1555486..1556436,1556515..1559477)
                     /locus_tag="MYCTH_2310289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665944.1"
                     /db_xref="GeneID:11513973"
     CDS             join(1555282..1555375,1555486..1556436,1556515..1559399)
                     /locus_tag="MYCTH_2310289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665992.1"
                     /db_xref="GeneID:11513973"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="JGIDB:Spoth2_2310289"
                     /translation="MAQNERAFQSSLPPQNDSDISIDIAAAGSQPDFESRPGGIRPDP
                     GEEELFNIEDNPFAFSPGHLSKLIEPKSVAVLQQLGWLQGLVKGLRTDIRAGLHIGSE
                     GEGDGDGADRRRVFGENRLPERKSKSFLELAWVALQDRMLILLCVAAVVSLALGLYRT
                     FHGHSGAEGARVEWIEGVAIVVAVLVVVLVSALNDWQKEWQFRKLNQKKEDRSVALVR
                     SGRTAKVSVHDVLVGDVMVLEQGDVIPVDGVLIDGHSVGCDESSATGESGVVRKMPAE
                     AVSQAFRRAHDADARTLAKMDPFLLSGSRVLDGVGTFLVTAVGRHSVHGRTRMALRTD
                     PGMTPLQARLNVLAGYIAKLGSGAGLLLFTVLFIEFLAKLPGNPASGDEKGQTFLRIL
                     MTAVTIIVVAVPEGLPLAVTLSLAFATKKMTRENNLVRHLQSCETMGNATVICSDKTG
                     TLTENVMTVVAGSLGTGEGVVTFGDGRIASSEGSDSGYGPLENRRKATETQDGGVETP
                     GWPAGDATEQPQRPQQKKQHEQQQQQQQQQEQQKTQKHRQQQEFLAATSPEFRELVKE
                     SIAINTTAFEGQDERGKLVFVGTKTETALLDWAKRDLELGPLSAERGKHPLVHLFPFS
                     SRRKCMGSVIQRPPGYGDDGGGGDNGENDDSGSGGRGYRPHRNRYRLLVKGAPEVVLE
                     RCSAGVADPGGAGPLPRSPLREPDKARIAETASRYASRSLRTLTLAFRDMDEWPPPRT
                     GNGAGIGRRGNHDDGVDGDDNGGRDEDWAVELDDVFRDMTWIALVAIQDPVREGVPAA
                     VLDCRRASVAVKMVTGDKIETARAIALECGILAQEDEGGNGHGQEHAVMEGAEFRRLG
                     EEQRRGIVRELRVLARSSPEDKRVLVESLRSLGEVVAVTGDGTNDAPALKAADVGFSM
                     GIMGTEVAKEASDVILMDDNFSSIVKALAWGRAINDAVKKFLQFQITVNITAVVLTFV
                     SAVASDQERSVLNAIQLLWVNLIMDTFAALALASDPPTGSLLDRAPEPRLAPLINLTM
                     WKMILGQCVYQLAVTLTLHFAGPSLLPSSYSEPQQHTLVFNVFVFMQIFKLVNSRRID
                     NRLNILEGLHRNPLFVFMMAVMVAGQVLIIFFGGDAFVVTRLTGPQWAISLVLGFFSI
                     PIGVLIRLLPDRWIRAGVRWAARRLPSWRRRKNAEDEERGRVVGAAADTDALWDAYAV
                     EDAEAGGVGRDFGSTMFSVRDDLAFLKRVRGGRMAALADAFAVDRTKKTEGERKLRQR
                     KRSGSAMRSAVGAPGLLAASIGAMSPGNRPRSEARQNSQWGLERRLP"
     gene            <1561236..>1562642
                     /locus_tag="MYCTH_2112775"
                     /db_xref="GeneID:11513974"
     mRNA            join(<1561236..1561519,1561687..1561819,1561915..1561979,
                     1562042..>1562642)
                     /locus_tag="MYCTH_2112775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665945.1"
                     /db_xref="GeneID:11513974"
     CDS             join(1561236..1561519,1561687..1561819,1561915..1561979,
                     1562042..1562642)
                     /locus_tag="MYCTH_2112775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665993.1"
                     /db_xref="GeneID:11513974"
                     /db_xref="JGIDB:Spoth2_2112775"
                     /translation="MLHIRGGEGATLDEGQRLVLTAVTRLASTLSALGVLTILLTFCF
                     TKHFRNPMHRLIVINAFYNALDVTCTMISTSGPRAGDTSALCQFQGFLNQIYDIESLR
                     RLEWKYVASITTVTFIPAFVMLFIRTPDKGPMYGGVTLWCAIAPKWVLFRIIIYYVPI
                     WSSIIITIALYLLVGLEIVKRRRVLESITSRMHRATATVTAAGADDDGDIPPVTAVSY
                     PDSSRNSTTADYGGPNGAATTTTTTTIISSSGGGGKSYAASTSTRIIPSNPSSLSFRQ
                     YILMPLFFFLALLLVWVAPSTNRVASFAKPGFSSYPLLLVVGFTGSLRGFWNSIVFVV
                     VGMRSWKRRRRREEPDEMALRPVTRG"
     gene            1568003..1569922
                     /locus_tag="MYCTH_2310298"
                     /db_xref="GeneID:11513975"
     mRNA            join(1568003..1568467,1568531..1569922)
                     /locus_tag="MYCTH_2310298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665946.1"
                     /db_xref="GeneID:11513975"
     CDS             join(1568413..1568467,1568531..1569672)
                     /locus_tag="MYCTH_2310298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665994.1"
                     /db_xref="GeneID:11513975"
                     /db_xref="InterPro:IPR013118"
                     /db_xref="InterPro:IPR013131"
                     /db_xref="JGIDB:Spoth2_2310298"
                     /translation="MAQRNAPKKAVHFGAGNIGRGFVACFLHNSGYEVVFSEVNDATV
                     SKLNSQKSYRVIEVGADGTSESIITNYRAINSRTHEAELVREIATADLVTCSVGPHIL
                     KFIAPVIAKGIDARSPELTPVAVIACENAIGATDTLAGFIKSPENTNPDRLADYDKRA
                     RFANSAIDRIVPAQDPNAGLDVRLEKFYEWVVDSTPFADHAPPDIKGVRWVNNLQPFI
                     ERKLYTVNTGHATAAYHGYIRRKSTVYDALQDREIQEEVKKALQNTADLITQKHGISH
                     EEQQAYVEKIVRRIGNPHLEDAVERVGRAPLRKLSRKERFIGPAAELAEHGKDYAALL
                     DAAEMAFRFQNVEGDDESFQLAEIMEKNSPEDVVKQVCGLQPNEKLFPAVVEVVKRVQ
                     ADTQSD"
     gene            1570540..1574178
                     /locus_tag="MYCTH_2310300"
                     /db_xref="GeneID:11513976"
     mRNA            join(1570540..1570676,1570919..1570942,1571000..1571045,
                     1571105..1571246,1571306..1571496,1571555..1571626,
                     1571677..1571804,1571856..1571981,1572032..1572849,
                     1572910..1574178)
                     /locus_tag="MYCTH_2310300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665947.1"
                     /db_xref="GeneID:11513976"
     CDS             join(1570659..1570676,1570919..1570942,1571000..1571045,
                     1571105..1571246,1571306..1571496,1571555..1571626,
                     1571677..1571804,1571856..1571981,1572032..1572849,
                     1572910..1573858)
                     /locus_tag="MYCTH_2310300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665995.1"
                     /db_xref="GeneID:11513976"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="JGIDB:Spoth2_2310300"
                     /translation="MRLDVKRQLFARSERVKGIDFHPTEPWILTTLYSGHVYIWSYET
                     QQIVKTFELTDVPVRAGRFIARKNWIVCGSDDFQIRVYNYNTSEKIASFEAHPDYIRA
                     IAVHPTQPFVLTASDDMTIKLWDWEKGWKNVRVFEGNSHYVMSLAINPKDTNTFASAC
                     LDRTVKIWSLGSSTPNFQLEAHETKGVNHVDYYPHSDKPYLLTTSDDRTVKVWDYTTK
                     SLIATLEGHTNNVSFACYHPELPIIISGSEDGTIRIWNANTYRFEQSLNYGLERAWCV
                     AYQKGKQGIAVGFDDGSVVIKLGREEPAVSMDGSGKIIWARHNEVLSAVIKGGDAIKD
                     NEPITLSTKELGNAEVYPQTLIHSPNGRFAAICGDGEYIIYTALAWRNKAFGQALDFV
                     WASKDNSNDYAIRESATSIKVFKNFQEKKGGLDVPFAADGLTGGVLLGVKGQGGISFY
                     DWATGGLVRRIEVEPKQVYWSDSGELVALACEDTTYVLRFSRDAYNEALQAGQVDDDG
                     VEAAFDVVTDISESIRSAEWLGDVLIYTNGTNRLNYLVGDQTYTVAHFDKPMYILGYL
                     QRDSRVYLTDKDLSVTSFALSLPVLEYQTLVLREDMETAAELLPSIPHDQLNKIARFL
                     EGQGHKELALEVATDPEHKFDLALSLNQLDIALDLARQADSDHKWKTLGDAGLAAWDV
                     PLAAECFVKAKDLGSLLLIYTSTCDREGLAKLAEQASETGAHNVAFSCKWSLGDVPGC
                     IDVLVKTGRLAEAVLFSQTYQPSLTAGLVAQWKESLEKNKKGRVAKALGVPGEDEELF
                     PEWDEWLRLEKEGPAVAEETNGAGENGEEGEQASEEGVE"
     gene            1574544..1576280
                     /locus_tag="MYCTH_2310303"
                     /db_xref="GeneID:11513977"
     mRNA            join(1574544..1574999,1575140..1575281,1575338..1575369,
                     1575465..1576280)
                     /locus_tag="MYCTH_2310303"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665948.1"
                     /db_xref="GeneID:11513977"
     CDS             join(1574815..1574999,1575140..1575281,1575338..1575369,
                     1575465..1576248)
                     /locus_tag="MYCTH_2310303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665996.1"
                     /db_xref="GeneID:11513977"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008273"
                     /db_xref="JGIDB:Spoth2_2310303"
                     /translation="MADAPVERVLSVGGHDIGYPHGHLGHLTEDEANRLQQFKNYLEE
                     KGLYKPGPPPSHDDQTLLRFLRARRWSVNDAYGQFKDTEEWRRANQLEVLYDTIDVDA
                     YEQTRNLYPQWTGRRDRRGIPLYLFQIRHLDSKTVSSYEKEAEAANVSKAQTDGSTPQ
                     RLLRLFALYENLTRFAQPLCTEMTDRPHPSTPITLSTNIVDVSQVSLRMFWNLKAHMQ
                     AASTLATAHYPETLDRIFIIGAPYFFSTVWGWIKRWFDPITVSKIFILNPNEVKSTLE
                     EFIEPRNIPKQYGGELDFDFFDRPNVDPHIKEALTWENGYTDFPEGPAYWVPVDGGRK
                     LACLAVGSKNGKERRETVCTIPVASFKGDAAAKDASAAAAGAVNGA"
     gene            complement(1576887..1577904)
                     /locus_tag="MYCTH_2310306"
                     /db_xref="GeneID:11513978"
     mRNA            complement(1576887..1577904)
                     /locus_tag="MYCTH_2310306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665949.1"
                     /db_xref="GeneID:11513978"
     CDS             complement(1577031..1577735)
                     /locus_tag="MYCTH_2310306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665997.1"
                     /db_xref="GeneID:11513978"
                     /db_xref="JGIDB:Spoth2_2310306"
                     /translation="MAKSKKLAKGTPDSPSTTTTTTVPQSIVPTPTWLNDGHPLPRLI
                     VFDLDYTLWPFYSDIHISPPIRQVPGSDPPALVDRNGELFSLFPDAFPILRLLSSPAL
                     PDTRLAVASKSPVRDLCREVLKLLRLPPPPPSSSGADRGAGGGGSAAGSGPKRVIDAF
                     DAGLEIYEGTKLRHFQALADRTGIPYNQMLFFDDERPNLEVERLGVTMRLIRDGLTWE
                     ELGNGIMQWRGNQGFV"
     gene            complement(<1632173..>1633011)
                     /locus_tag="MYCTH_2070469"
                     /db_xref="GeneID:11513979"
     mRNA            complement(join(<1632173..1632262,1632375..1632730,
                     1632804..>1633011))
                     /locus_tag="MYCTH_2070469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665950.1"
                     /db_xref="GeneID:11513979"
     CDS             complement(join(1632173..1632262,1632375..1632730,
                     1632804..1633011))
                     /locus_tag="MYCTH_2070469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665998.1"
                     /db_xref="GeneID:11513979"
                     /db_xref="JGIDB:Spoth2_2070469"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            complement(<1638738..1640042)
                     /locus_tag="MYCTH_2310316"
                     /db_xref="GeneID:11513980"
     mRNA            complement(join(<1638738..1639115,1639174..1639326,
                     1639402..1640042))
                     /locus_tag="MYCTH_2310316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665951.1"
                     /db_xref="GeneID:11513980"
     CDS             complement(join(<1638757..1639115,1639174..1639326,
                     1639402..1639845))
                     /locus_tag="MYCTH_2310316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003665999.1"
                     /db_xref="GeneID:11513980"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Spoth2_2310316"
                     /translation="MASEQPSNPIKKIRLVRIAHVWYEHADIEKVKQFALDFGFVETA
                     QIGKTTFFRGYGTEPFALALVASDKNEFGGAAFVVESEEDLVHASKTLPKECRATEVH
                     EMKDVPGGGKRVTFYDPVDGFPFHLVYGQTPVALEDPGFPALKFNYPIEKNRGPNQFQ
                     RFKKRPAPVHKLGHFGMCVTDFAKCYEFYNTYFNFHPSELVYNEQGVNKTVFFRLDRG
                     DELVDHHCFFFFEGPKMHVHHSSFETHDFDAQVLGHDWLRSQGYKNCWGVGRHVMGSQ
                     IFDYWFDPAGFIMEHYVDGDLLDMREPTHYTKAAPDNLHVWG"
     gene            <1648018..>1648489
                     /locus_tag="MYCTH_2129884"
                     /db_xref="GeneID:11513981"
     mRNA            join(<1648018..1648132,1648191..>1648489)
                     /locus_tag="MYCTH_2129884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665952.1"
                     /db_xref="GeneID:11513981"
     CDS             join(1648018..1648132,1648191..1648489)
                     /locus_tag="MYCTH_2129884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666000.1"
                     /db_xref="GeneID:11513981"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Spoth2_2129884"
                     /translation="MSWLERSDYFYGDLWPENILLSETEQVKVCDFGRARTRVAGLAY
                     EQFDIGSCIYTIPTGEVPYGQQETPEQFREMYDARVRGKFPPTEDDGVLGHVVSSCWH
                     APYDRMEDMWKQLSNGPSACRLVEISPRHSLTWLC"
     gene            complement(1648529..1649461)
                     /locus_tag="MYCTH_2310317"
                     /db_xref="GeneID:11513982"
     mRNA            complement(1648529..1649461)
                     /locus_tag="MYCTH_2310317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665953.1"
                     /db_xref="GeneID:11513982"
     CDS             complement(1648585..1649265)
                     /locus_tag="MYCTH_2310317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666001.1"
                     /db_xref="GeneID:11513982"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="JGIDB:Spoth2_2310317"
                     /translation="MGTAAADLLASLRGAGLLSSSVIPSDFTPSLLLNVRFPGTDADT
                     CHGTLMRVSQVQSAPVLSVAPLNSALATTTTTTTTTTTKTFTLLMIDPDAPTPDDPKF
                     AYWRHWVVANISLPATAETKDETGSGSGSGSGKGAQLQLDECTSGARVLTPYLAPGPK
                     DESRPHRYLFLLFAEPDGFRPEKGDVGGDEFVQRRSFPADEFVRRHGLRLVAAQWMLG
                     AGDGWREE"
     gene            1651303..1651987
                     /locus_tag="MYCTH_2310320"
                     /db_xref="GeneID:11513983"
     mRNA            join(1651303..1651652,1651779..1651987)
                     /locus_tag="MYCTH_2310320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665954.1"
                     /db_xref="GeneID:11513983"
     CDS             join(1651385..1651652,1651779..1651918)
                     /locus_tag="MYCTH_2310320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666002.1"
                     /db_xref="GeneID:11513983"
                     /db_xref="JGIDB:Spoth2_2310320"
                     /translation="MISAAPAIAQEAMSASIVSVSGCPAVVSTTDVCSTCVAAACVVP
                     ATITAGCGDCPESPPTVYRSFPCEEGCNNIGCRTVYRVVTATGSVCPAAPTPTPSQDP
                     DNPADGDDPTEPATSATTASTAGAARLMPFRLW"
     gene            1652763..1655491
                     /locus_tag="MYCTH_2310321"
                     /db_xref="GeneID:11513984"
     mRNA            1652763..1655491
                     /locus_tag="MYCTH_2310321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665955.1"
                     /db_xref="GeneID:11513984"
     CDS             1652963..1655350
                     /locus_tag="MYCTH_2310321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666003.1"
                     /db_xref="GeneID:11513984"
                     /db_xref="JGIDB:Spoth2_2310321"
                     /translation="MNHLSFLAALGGFSVMTAAFGTINAPAVLGQHNEHEMITRLAFQ
                     CPGDQKSDGICFEPRSLDQLAGYHVNVMGIALTGSGTNGAVGAPDTFDPFPEGPEAHC
                     DDADYLDIPGYPQSRAEASAKLQACVDHLRHRFRQAVGAADRLLDDRHRIRREMVQLS
                     LPYGDCTFAFPEWQHDDYGRAKCSTLEGFGRALHGIQDFYAHSNWADSADPTQPISIS
                     NPPGLGMTGTAPFLDLRADGAIPEDQIPLNLTTGCFNLPDITFGSGACKGRVTHHALS
                     KDRGIINLDGTFGATEADPRSEAVSSNFQRAVQAAVQHSRELWADLRDEIRRQYGNVT
                     GDLMICSLIRDDPVKDCRNRTMVVAVDNSLTSESNGGILLEESVAQEITSRLNTEGLD
                     SVAVVDSQEPAVLRYPMGPPAYVSFSFPRPSGDLCVASGLELGIAETIGAQPETYADR
                     GAIILLATTAESPECSDCTMTQLRRAAEEGIRVHYACIDMHGSAAAGGAINNTPKHAG
                     WVRCSPGDSLVGPVLKTGGIAVFIGPAARVPAHFANLVMDRGLTATDEDENTPESTRV
                     YPGITLADFLNPDQPAKSFTYPVSTGESLNLTVSSVSRDGRGAEACFGVTLWYKYPDT
                     EISTHTRCGDSSPLLLRYHANESFDLVLEAEYGDTAPRNELLHREEILFLLSVDTTMP
                     DKNETTVGRTTSILSTPGRNGSSPTSETVEVLSGTATVDDSTSTWTESSRKTATDDAS
                     LSCRRPPSGRYYYSPMCSVPTIPFMSMEGNLSAGVEGSARQDDIGNDCIRDIEYV"
     gene            1657059..1658525
                     /locus_tag="MYCTH_2310322"
                     /db_xref="GeneID:11513985"
     mRNA            join(1657059..1657220,1657329..1657810,1657940..1658525)
                     /locus_tag="MYCTH_2310322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665956.1"
                     /db_xref="GeneID:11513985"
     CDS             join(1657109..1657220,1657329..1657810,1657940..1658293)
                     /locus_tag="MYCTH_2310322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666004.1"
                     /db_xref="GeneID:11513985"
                     /db_xref="JGIDB:Spoth2_2310322"
                     /translation="MHPAGLLLVSLLATGSSAHGVVTLIKGANGVDMPGLSVVDGTPR
                     DCSTNRCGSQADTSIIRDREISSGRVGPLGRTQGSGPVNASTMIAAFMGTGATPPNIT
                     DPEAASVGVEDDLGQLDNDDDGGSGGRGGGGRGFRNAARQLLKGLLGGGGGGGGRNAG
                     QAPAAKTEGNVAALAGQGATSGLPTCSDDGIITMVFHQINQDGAGPLEAAVDGTSGGT
                     DPAAFQQATVTQDVPGIGVGGLSLATSRDFPLQVQMPAGMTCDATVAGVDNVCVVRVR
                     NSALAGPFGGSAAFTMSPAARKRALAYRMKQKRAREFRA"
     gene            complement(1658555..1660784)
                     /locus_tag="MYCTH_2310324"
                     /db_xref="GeneID:11513986"
     mRNA            complement(join(1658555..1659772,1659893..1660005,
                     1660126..1660784))
                     /locus_tag="MYCTH_2310324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665957.1"
                     /db_xref="GeneID:11513986"
     CDS             complement(join(1658758..1659772,1659893..1660005,
                     1660126..1660641))
                     /locus_tag="MYCTH_2310324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666005.1"
                     /db_xref="GeneID:11513986"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2310324"
                     /translation="MVGKLKPHTAEDDVSFSRNGGDPDTATEAATGSDSDDFRIIDPH
                     SGVKRGLKTRHLSMMALAGIIGPGLLIGSGGALSAGGPASLLIGFGVIGIIAFSIMQS
                     LGELTTLYPTGGAFTALSDRFVDKAFGVAVGWNYYIIWFCVLANEYNVISSVLVFWSD
                     RVPIWGYFLIFWFAFLAFQLLGVETFGEAEFWLALIKIIGLIAYFLFSIVYASGGVKG
                     ADAVGFRYWHEPGAFTDGFRGVASVFVFCSTFYAGVESVAVAATETRNPGHAVPLAIR
                     QVFIRIAVVYMGSAFFFGLTCPADAPDLVGGTSRALKSPMTVAIQKAGWEGGVHLINA
                     FIFITCLSAVNSSIYIGSRTLLYMAQDGKAPRILGWTDKRGVPIPAIVFTNLCGALSM
                     MNVSTGASKAYGYIVNLSGVSTFLVWGAISFTHIRFRSAWKAQGHAPAELPFRSLWYP
                     YNAYFGLAANVFLALIQGWSTFAPFDGGLFVDAYILLPLFGLIFVVYKLVFRTHWWKA
                     HEVDLQSGRRRDLDEAKRQGSAPGRAAGSKWWTTIFKSV"
     gene            <1662108..>1662716
                     /locus_tag="MYCTH_2129891"
                     /db_xref="GeneID:11513987"
     mRNA            <1662108..>1662716
                     /locus_tag="MYCTH_2129891"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665958.1"
                     /db_xref="GeneID:11513987"
     CDS             1662108..1662716
                     /locus_tag="MYCTH_2129891"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666006.1"
                     /db_xref="GeneID:11513987"
                     /db_xref="InterPro:IPR005065"
                     /db_xref="JGIDB:Spoth2_2129891"
                     /translation="MKPSFDIHEKERQPHPAERRRRRRLTPRVRVIVVFLAAVYALYC
                     YFISKPLLAHPLPQHTGPYAVGDITIPAAVDAPLTDQAIPTSQDGGEGASERERGSPP
                     GGEDGRPGPDPEGGFPVIIFSHGTVSSRTDYSHFAGELAARGHVVVMMEHREGSCLGK
                     PGQGGGSDKGFVEDLRQGGRADWRRYYWKIHVLPAGSVGEKQ"
     gene            complement(<1662836..>1663846)
                     /locus_tag="MYCTH_39035"
                     /db_xref="GeneID:11513988"
     mRNA            complement(<1662836..>1663846)
                     /locus_tag="MYCTH_39035"
                     /product="carbohydrate esterase family 8 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003665959.1"
                     /db_xref="GeneID:11513988"
     CDS             complement(1662836..1663846)
                     /locus_tag="MYCTH_39035"
                     /EC_number="3.1.1.11"
                     /note="CAZy_ID 267928"
                     /codon_start=1
                     /product="carbohydrate esterase family 8 protein"
                     /protein_id="XP_003666007.1"
                     /db_xref="GeneID:11513988"
                     /db_xref="InterPro:IPR000070"
                     /db_xref="JGIDB:Spoth2_39035"
                     /translation="MLSKVLGFVSLAAAAAAAPLQSRAARTSPPEGCLTVGSSGTYKT
                     VQSAVDALSRSATSEQCIFIYGGTYQEQVTIPALRSALVVYGETEDTSRFSANKVTIT
                     QSRSQDDSADNDATATLRAHTANLRVYNVNLVNTRGKGSQALALSAQADRQGYYACQF
                     RGYQDTVLANEGAQVYARSYVEGATDFIFGQRARAWFDAADIRVLAASKGYITANGRD
                     SADNPSYYVIHNSAVSARSGDSVPAGAYYLGRPWRNYARVVFQKTSLSGVVNAAGWSV
                     WNTGDERTDEVEFGEYGNTGAGAGASGSRAAFAKQLSAPVSIETVLGSDYASWVDTSY
                     LS"
     gene            1664817..1664887
                     /locus_tag="MYCTH_t168"
                     /db_xref="GeneID:11513989"
     tRNA            1664817..1664887
                     /locus_tag="MYCTH_t168"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:1664849..1664851,aa:Gly,seq:gcc)
                     /db_xref="GeneID:11513989"
     gene            <1667998..>1669031
                     /locus_tag="MYCTH_90182"
                     /db_xref="GeneID:11506385"
     mRNA            join(<1667998..1668517,1668619..1668860,1668951..>1669031)
                     /locus_tag="MYCTH_90182"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003665960.1"
                     /db_xref="GeneID:11506385"
     CDS             join(1667998..1668517,1668619..1668860,1668951..1669031)
                     /locus_tag="MYCTH_90182"
                     /note="CAZy_ID 267843"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003666008.1"
                     /db_xref="GeneID:11506385"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Spoth2_90182"
                     /translation="MHFTSYLSVLSVLGTSGGVLAWAPPSYDGYRLVWSDAFPGAPGT
                     LPNENNWNIITGNLGVNNELEVYQRDPRNLQMSGGNTLQIVPWLDGSTWSSGRIESKY
                     TFTPQPGGRTMAEAQIRFGSNDISTKQGLWPAFWLLGDSIRHGTGWPACGELDILETI
                     NGQLTGYGTAHCTACNEPVGRGGSVPIPNQDFQRWRIVWDLTNGDWRAQTITWFMNDQ
                     QFHQLSGATIGDQGVWSTLTNKPLFFILNMAVGGNWPGYPNDRTQGGYGAMMEVGYVA
                     HYST"
     gene            complement(1673458..1674946)
                     /locus_tag="MYCTH_2310333"
                     /db_xref="GeneID:11513990"
     mRNA            complement(join(1673458..1673821,1673915..1674112,
                     1674231..1674297,1674372..1674946))
                     /locus_tag="MYCTH_2310333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665961.1"
                     /db_xref="GeneID:11513990"
     CDS             complement(join(1673499..1673821,1673915..1674112,
                     1674231..1674297,1674372..1674542))
                     /locus_tag="MYCTH_2310333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666009.1"
                     /db_xref="GeneID:11513990"
                     /db_xref="JGIDB:Spoth2_2310333"
                     /translation="MADTVETPPDENRGPEILAVCGSLVGFSLVVVILRLYVRAKMVR
                     RVGADDWTIVAAMTVMFVEMMVIIPEVQLGAGRHVQYIDPPENVTKGLHLNFVTQPLC
                     LVALCLTKVSVGFFLLRLTPASRLNWFIIGTMVFTVLSSIGNFLTVLFQCRPLALTWD
                     SSVEGTCIPPSQLKFAAFFNSSVAALTDVVFALLPIPLLWNVQMNWKVKSAVTAILSL
                     GIFAAASAIVKITFLGSYGQHNDFLWDSADITIW"
     gene            1676944..1678961
                     /locus_tag="MYCTH_60685"
                     /db_xref="GeneID:11513991"
     mRNA            join(1676944..1677360,1677580..1678961)
                     /locus_tag="MYCTH_60685"
                     /product="tyrosinase-like protein"
                     /transcript_id="XM_003665962.1"
                     /db_xref="GeneID:11513991"
     CDS             join(1677104..1677360,1677580..1678597)
                     /locus_tag="MYCTH_60685"
                     /codon_start=1
                     /product="tyrosinase-like protein"
                     /protein_id="XP_003666010.1"
                     /db_xref="GeneID:11513991"
                     /db_xref="InterPro:IPR002227"
                     /db_xref="JGIDB:Spoth2_60685"
                     /translation="MKPAALLGAALAAVAFPAGAHARCSSDAPPPAPVGDDLTEPKEL
                     TDLFEKAKKAVIDRLHEDEKALRARGEAPRCTADKLIFRREYGSLSKDERLAYVNAVK
                     CLQSKPPRTPASVAPGARSRFDDFVVVHIQQTLDIHYSGIFQAWHRWFVYQYEKALRD
                     ECGYTGYQPYWDWPKYASAPQDSPLFNGDPYSLGGNGEYVPHDGPVIVPPEGVSGGNI
                     SLPAGVGGGFVRTGPFANMTVNLGPVGGLADTAPGPQGGLGYNPRGLKRDLGGAMNTR
                     YANYTTVLRLLTQPDVDAFRTVSEGVPYTVEIGPHGGIHYTIGGDPGGDLFTSPGDPA
                     FWVHHAQMDRVWATWQALGLLPPADGGDPDPARRYTDLGKGDYAHRTWQNSPPSPFAE
                     LSDVIDMGYAAPSTTIGAVMSTTEGELCYFYL"
     gene            complement(1679782..1683543)
                     /locus_tag="MYCTH_2310338"
                     /db_xref="GeneID:11513992"
     mRNA            complement(join(1679782..1681130,1681222..1683543))
                     /locus_tag="MYCTH_2310338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665963.1"
                     /db_xref="GeneID:11513992"
     CDS             complement(join(1680085..1681130,1681222..1683127))
                     /locus_tag="MYCTH_2310338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666011.1"
                     /db_xref="GeneID:11513992"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2310338"
                     /translation="MDQFSLSAAPPPIPRRSSERERVRSGNQSPDRRPRDSSSCYPAK
                     AAKPRRDRDYDDVFADWTSRSRDRHADRHHRDQEDDQVGPLPPASPEVISSLITSLST
                     ISRPVSNHFDGPSYLSPIGVGSPVSLSPVSSPAGGSFGVDYGAYSKPSLKELEEEDVP
                     LEDLPASAPVVRTSKPPSGLSPVTGPRSPKSPSARDSSGFRGILSRRSSGALSRPSSK
                     GSITSGAESIGKLSIERSQEPLSPAAEGHGLKNQQSHDSWGKKGGRNQRGLMYMTSKE
                     RLREKEADKKRASIGTGGGNGKRLSAASGPTTPRLDPLSADSVIDEEPAGDFSLGLDG
                     PIDAFADPRLIPARDSSLGRKKRSSARASRTSKRDSESGGYGAIPELEEQPNGNSGWQ
                     GDSTNRRSSKNREGLDPLSLTISLPPDPASPNNRRVSATSPSTPAAGMFPDIDLDDGA
                     PSPSVAQGRRRDREASAEYRRRSGRHTPDPFGGYASEGGGTTDKKKRSSSKLRRLSGA
                     PSPTPDSAEQGTATGNNRHSDQPHVAYERPRSADSIDEAVEKYLCSPRLSQKIRHPQS
                     GRIVSFSEVGDPNGSAVFCCVGMGLTRYITAFYDELALTLKLRLITPDRPGVGDSEPY
                     AEGTATPLSWPDDVYAICQALKITKFSILAHSAGAIYALATALRMPQHIRGRIHLLAP
                     WIPPSQMNVVGASDKTPLPPTNAIPTSQRILRALPTPILKAANSSFMTATSSSITSSL
                     PKQKRVKRDKRGNGTGTRDNKDQPKGMFHAALENKENLNPDNLNSKYSTIPAAADEDA
                     NGGAPEGSNAAASAPQTHGIGHRHFRPSVSRQGSNPRRESEDPILPASAQMEDRERQE
                     LYDNRLTHAIWQLATTGANPAVDLLVCLERRHTIGFRYVDITRPVVIHHGSRDTRVPV
                     ENVRWLGKTMRRCEVRVLEGEGHGLMASAQVMGSVLMEISREWEEWSRVTGATRREHE
                     RARRNTVGQGK"
     gene            1684452..1686044
                     /locus_tag="MYCTH_2310340"
                     /db_xref="GeneID:11513993"
     mRNA            1684452..1686044
                     /locus_tag="MYCTH_2310340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665964.1"
                     /db_xref="GeneID:11513993"
     CDS             1684691..1685575
                     /locus_tag="MYCTH_2310340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666012.1"
                     /db_xref="GeneID:11513993"
                     /db_xref="JGIDB:Spoth2_2310340"
                     /translation="MAAITSNDFVSWDDFVRIRNSQDEQLGREFAALRQRLDGVEQTV
                     AAEFGMFRDFLIEVQLDSRRTAARLQNYMLKHSYLPISPVPAYDPLHGIINPDPALFP
                     GSVGAFYKLLHPSNDDEIQMLSYLISFYDIQLFTPQDEDEARPEGSDFERAVERLEVI
                     LGLNGDNFSKLKEPLAEGHGAEGRRPRLEPRPNIPVVHKSRLSEEFSNNTRLEWRART
                     RSTPSSQRPTIYNLWKAMEAEKRAEQEKLAEQEKLAEQEKLAEQEKLAEQEKLAEQEP
                     LGSDATGSTRPFTNPRKP"
     gene            complement(1686569..1689482)
                     /locus_tag="MYCTH_2310341"
                     /db_xref="GeneID:11513994"
     mRNA            complement(join(1686569..1686919,1686997..1689482))
                     /locus_tag="MYCTH_2310341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665965.1"
                     /db_xref="GeneID:11513994"
     CDS             complement(join(1686637..1686919,1686997..1689182))
                     /locus_tag="MYCTH_2310341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666013.1"
                     /db_xref="GeneID:11513994"
                     /db_xref="JGIDB:Spoth2_2310341"
                     /translation="MSALRSWFRGSSATPSSKPSSKATTPGQQSPTGSTSSLNGKTKP
                     RVSSERQETSDLEDAMAAAGLIMNDDIDGAEALLRLREDSSTFHKLGMGVSTFIRSIL
                     GFEKDVMAEAARRLNETENRAWDDTKKAQKEADGSVSRIYPPGSEFALVNAEAQLMNA
                     VVGVMHESLTEAIKGFYKLRKAYLTLESIVEAEARYLRSIGQDGVTSSSPSTQDSSSD
                     DTVPGLPDGPVCDELEGGTPTAKDRGTGDHGSSGAVEVSQTPEAQDAASQDMTLLDEK
                     LKKLAADERSRSSPLLLPVSQDPKGDGKLTPGSIALDQLNTAGADKSLFKSSIEIFVH
                     SGANMCFGILLLILSMVPPAFSRLLSIIGFKGDRDRGLKMLWQSTKFPNINGAMAALV
                     LLNYYNTFLGMADILPPEYDVDDSSASSSDSGGSNGASSNSGTSSTSSTRSNSSESEN
                     DFEAVGYPRERCAALLAAMRERYPESRLWRLEEARMLANGRQLDEAIERLSANMDSKM
                     RQITALNNFELSMSSMYVLDWPAMRDNFCRCVELNTWSHALYYYIAGCAEIEMYRDAF
                     HKVAALPAGGDAAAERSVLLTEAQKHKKAAEEYLRKAPTVAGKKRFMARQLPFEVFVS
                     RKLLKWEERAKAAGVDLADAVAVSPAMEMIYLWNGSKRMGTKHLERARTLLAWERCTA
                     PADKVAKFREEKDEDAIALLAECALLRHLGKGAEAKALVEPLLTMDKSLFKGHTRDDY
                     CLAAAHYEVAAVAWMDVCDRESWPKGTVDEIQAFRRQKADECRQYLDKVSKWEGFVLD
                     ARFGLRVKAGMETVAWLRAKKGWE"
     gene            1690131..1691110
                     /locus_tag="MYCTH_109876"
                     /db_xref="GeneID:11513995"
     mRNA            join(1690131..1690486,1690594..1690705,1690799..1691110)
                     /locus_tag="MYCTH_109876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665966.1"
                     /db_xref="GeneID:11513995"
     CDS             join(1690354..1690486,1690594..1690705,1690799..1690838)
                     /locus_tag="MYCTH_109876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666014.1"
                     /db_xref="GeneID:11513995"
                     /db_xref="InterPro:IPR007834"
                     /db_xref="JGIDB:Spoth2_109876"
                     /translation="MASSQSTTKKDDKVADAKTEQQPVAEQKPAALEEDDEFEDFPVD
                     DWAAEDTEAASGAGARQHLWEESWDDDDTTDDFSAQLKEELKKVEAAKKR"
     gene            complement(1691113..1692737)
                     /locus_tag="MYCTH_2316240"
                     /db_xref="GeneID:11513996"
     mRNA            complement(join(1691113..1692021,1692084..1692504,
                     1692566..1692737))
                     /locus_tag="MYCTH_2316240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665967.1"
                     /db_xref="GeneID:11513996"
     CDS             complement(join(1691252..1692021,1692084..1692504,
                     1692566..1692631))
                     /locus_tag="MYCTH_2316240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666015.1"
                     /db_xref="GeneID:11513996"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="JGIDB:Spoth2_2316240"
                     /translation="MSLANKLSITDVDLKGKRVLIRVDFNVPLDADKKVTNTQRIVGA
                     VPTIKYAIDNGAKAVILMSHLGRPDGKVNPKYSLKPVVPELEKLLGKSVIMAPDCVGP
                     EVEEIVNKADNGQVVLLENLRFHIEEEGKGTDAEGNKIKADKAKVEEFRKGLTKLGDI
                     YINDAFGTAHRAHSSMVGVDLPQKAAGFLMKKELDYFAQALEAPKRPFLAILGGAKVS
                     DKIQLIDNLLDKVNTLIICGGMAFTFKKVLDNMSIGTSLFDEAGAKTVGDLKQKAEKN
                     GVKLVLPVDYITADKFDKDANTGKATDAEGIPDGWMGLDCGEESVKLYKAAIDEAQTI
                     LWNGPAGVFEFDKFASGTKATLDAAVAAAQSGKIVIIGGGDTATVAAKYGVEDKLSHV
                     STGGGASLELLEGKALPGVVALSERQ"
     gene            complement(1693206..1695007)
                     /locus_tag="MYCTH_2140529"
                     /db_xref="GeneID:11513997"
     mRNA            complement(join(1693206..1693626,1693712..1694265,
                     1694355..1694445,1694605..1695007))
                     /locus_tag="MYCTH_2140529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665968.1"
                     /db_xref="GeneID:11513997"
     CDS             complement(join(1693513..1693626,1693712..1694265,
                     1694355..1694445,1694605..1694673))
                     /locus_tag="MYCTH_2140529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666016.1"
                     /db_xref="GeneID:11513997"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="JGIDB:Spoth2_2140529"
                     /translation="MSWELNRRRWLRTINSRFIYGRIPLLHAIVFFIEMALFARLTSR
                     FNAYYDERPILTMMVTNSILGGIADTVAQTITSIRERAVRKHPKGRLDPREDALAIEI
                     HELDRKNPFSNRDLIPDSKSLPPPFDFERLTRFMAYGFCMAPIQFRWFKFLERSFPIT
                     KSAAFLPAIKRVAFDQLIFAPFGIAAFFTVMTIAEGGGKREVFHKMRDMYVPTLKANY
                     VLWPAVQVINFRLMPVQFQLPFVSTVGIAWTAYLSLTNAAENVQEHRIPDRADIRLP"
     gene            complement(<1695922..>1696947)
                     /locus_tag="MYCTH_2112795"
                     /db_xref="GeneID:11513998"
     mRNA            complement(<1695922..>1696947)
                     /locus_tag="MYCTH_2112795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665969.1"
                     /db_xref="GeneID:11513998"
     CDS             complement(1695922..1696947)
                     /locus_tag="MYCTH_2112795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666017.1"
                     /db_xref="GeneID:11513998"
                     /db_xref="JGIDB:Spoth2_2112795"
                     /translation="MAFTGHDRTILGRLTTVFTPPAPCTYAVGRCSTCDVAWWGQTCA
                     QSSVQDDTNCWPTTTDGAPEPSQAALYGWGFYSPGLECPEGHTTACTAIAGESSQWKV
                     QFLMEAEETFAGCCPTGFHCDNLNGQTCRKVATSTAFPTVSCQDGASNNFGFITVPNA
                     KVGSVNLYAPMIQIAWKSSDRPETSSSSSTTTAGSGTAPTTSNPNPGITPSANTTGDS
                     SSTLSTGAVAGIAVGAAALALLIFASAFFIFRRRRRHMNQTAGVTHPHQGGRVEHYDA
                     SAGTVVAELGQGHELVEMFVENRRPADGRGHGPVPVHGGVLPAPGYYNFPAGSGPNPV
                     EMPTERN"
     gene            <1699706..>1701364
                     /locus_tag="MYCTH_2120747"
                     /db_xref="GeneID:11513999"
     mRNA            join(<1699706..1700149,1700219..>1701364)
                     /locus_tag="MYCTH_2120747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665970.1"
                     /db_xref="GeneID:11513999"
     CDS             join(1699706..1700149,1700219..1701364)
                     /locus_tag="MYCTH_2120747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666018.1"
                     /db_xref="GeneID:11513999"
                     /db_xref="JGIDB:Spoth2_2120747"
                     /translation="MPGILLRNRLRSLESAAEEEGDFLLALQHQRAAESFRLQLWAQR
                     GSIEALVRHRFNLQRNDTCTIIPHELWIQGGFNLCVLVDIESRGLSRRLVFRCPLPHK
                     LAEKQYPGTIDEKIACEVAAYAWIQEHCPEIRIPHLYAFGFLNGSQFTHVNQRPWHVR
                     IYHTFRRWINRLFNYPLLSAYTHDASASAIGSAYMLLEYIGPETGQMLSATWAQHMND
                     HNRRSRLFQGMARIMLSLARLPQSHIGSLRFNPSDGTVTLTNRPLTCTTMIFENSGTP
                     RTIQPGQLYQSTDSFVSDMLTLHDNYFFHYAHAVRDEDDARERITIRTLLRAVTHHFI
                     LPERRNGPFLLQLTDFHQSNIIVDDDWNVTCMIDLEWICALPVEMLSVPYWLTDCGID
                     GIIDDHYTPFDEARQAFLAAMDAEAKNIRPGHDIPITRTMQNSWTSKAAWFWACIRSL
                     NAWLFVFEDHILPKYSANKDLISEVKQISTLWKEDIETVIRVKVEEEKGYQAELQSLF
                     ANCDGLPKPVGNDVTGATMLA"
     gene            <1704277..>1706076
                     /locus_tag="MYCTH_2120748"
                     /db_xref="GeneID:11514000"
     mRNA            join(<1704277..1704524,1704644..1704846,1704960..1705308,
                     1705384..1705656,1705719..>1706076)
                     /locus_tag="MYCTH_2120748"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665971.1"
                     /db_xref="GeneID:11514000"
     CDS             join(1704277..1704524,1704644..1704846,1704960..1705308,
                     1705384..1705656,1705719..1706076)
                     /locus_tag="MYCTH_2120748"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666019.1"
                     /db_xref="GeneID:11514000"
                     /db_xref="JGIDB:Spoth2_2120748"
                     /translation="MSSTDEKRVDDEANALEAATAPEEQTKPVSKLTRWYRSPLFNVI
                     IVGLISFTQPGIWNALNNTGAGGQQEPYLVNGSNALTFGIGVKKVLIIGTLGYAPYSA
                     SLYVNNRYGTEWFVLFGGVTCGIAASALWASEGAIALGYGKVKDRGKFAGIWLGLREL
                     GQLIGASIQLSMNVRSSSRGKVGYTTYLVLIALQCLGLPLALLASPPEKVIHSDGTRG
                     RVVAKNTTIKEEVRKTWNLLKRKQMFLLVPILIGFQWNSTYLGIYMTKYFSVRARTLG
                     SLVSGVSATFANIFWGWFYDLKRFSRPTLAKICWFFFVLGMLGTFGWQVSNEKLYGDS
                     NPRVTLDWENPGFGRGFASMVILRFLNESHYMFVYWIVGAFFDDIETLTLAVGLVRTF
                     ESVGSSIAFGIGASSVSPMVNLIIAFAMFGFTIPATSLVVFLVPERPVDLRKEESEAS
                     SVGESENVAPNEIAAKAVESSGSSNT"
     gene            1706755..1709909
                     /locus_tag="MYCTH_2140530"
                     /db_xref="GeneID:11514001"
     mRNA            join(1706755..1707127,1707228..1707324,1707406..1707784,
                     1708194..1709909)
                     /locus_tag="MYCTH_2140530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665972.1"
                     /db_xref="GeneID:11514001"
     CDS             join(1706842..1707127,1707228..1707324,1707406..1707784,
                     1708194..1709738)
                     /locus_tag="MYCTH_2140530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666020.1"
                     /db_xref="GeneID:11514001"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="JGIDB:Spoth2_2140530"
                     /translation="MAVCFTCRTALRRQIEGLRKLRQRRLHSTNKDSARTSRVERPQE
                     QIPTPNNVPTLNFWQRLGPLTRAAQAYARAQRKRPYVTQVCTSLFIYLCSDISAQSMG
                     GRDYDPTRTLRALLIGSISSIPSYHWFVWLSESFNYRSRLLSLATKVVVNQVCFTPVF
                     NTYFFGMQALLSGATLAETWERITKTVPVSCLNSCKLWPAVTAFSFAFLPLEYRPVFG
                     GVIAVGWQTYLSYLNRLAEGSIAARGEALEEPEMAKPLSAGLARLSSPKMAGPYLGAR
                     RSLAAALRPFSRSGSQLRFNNNNHVPRRPASTSSSSSASRAPSTARNVLVAGLLATVG
                     GVAYYYATDTRASIHQWLVPRLLRVIFPDAEDAHHAGTAALKTLYSLGLHPRERPSAL
                     EDGTDGAGAGGGNPLAVTVFGTTLANPIGISAGLDKDAEIPDPLFALGAGVVEVGGCT
                     PLPQEGNPRPRVFRIPAVDGLVNRYGLNSRGADAMAARLRERLRTLARTLSGGGGGGG
                     LTEQEVLDGALGEDVPVGSLRPGRLLCVQIAKNKKTDERDLDAVIRDHVYCVQRLAPY
                     ADVLVVNVSSPNTPGLRDLQAAEPLARLLGAVVDEAKKTPRKVKPRVMVKVSPDEDDD
                     TQMEGVVRAVWTSGVDGVIVGNTTKRRTGLVKEGVRLTAKEQKALLEEGGFSGPAMFE
                     RTLSLVGRYRKMLDRYSLGTPGVDDAFPPQKVIFATGGITTGEQALKVLNAGASVAMV
                     YTGLVYGGSGTITRIKKEMKEKLAIKES"
     gene            complement(<1710590..>1711911)
                     /locus_tag="MYCTH_2112799"
                     /db_xref="GeneID:11514002"
     mRNA            complement(join(<1710590..1710633,1710726..1710978,
                     1711095..1711155,1711278..1711510,1711628..1711660,
                     1711728..1711736,1711819..>1711911))
                     /locus_tag="MYCTH_2112799"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003666454.1"
                     /db_xref="GeneID:11514002"
     CDS             complement(join(1710590..1710633,1710726..1710978,
                     1711095..1711155,1711278..1711510,1711628..1711660,
                     1711728..1711736,1711819..1711911))
                     /locus_tag="MYCTH_2112799"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003666502.1"
                     /db_xref="GeneID:11514002"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_2112799"
                     /translation="MKTLAALVVSAALVAAHGYVDHATIGGKDYQFYQPYQDPYMGDN
                     KPDRVSRSIPGNGPVEDVNSIDLQCHAGAEPAKLHAPAAAGSTVTLYWTLWPDSHVGP
                     VITYMARCPDTGCQDWSPGTKPVWFKIKEGGREGTSNVWAATPLMTAPSAYTYTIPSC
                     LKSGYYLVRHEIIALHSAWQYPGAQFYPGCHQLQVTGGGSTVPSTNLVSFPGAYKGSD
                     PGITYDAYKAQPYTIPGPAVFTC"
     gene            complement(1712601..1715040)
                     /locus_tag="MYCTH_2310362"
                     /db_xref="GeneID:11506380"
     mRNA            complement(join(1712601..1713758,1713910..1715040))
                     /locus_tag="MYCTH_2310362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665973.1"
                     /db_xref="GeneID:11506380"
     CDS             complement(join(1712999..1713758,1713910..1715018))
                     /locus_tag="MYCTH_2310362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666021.1"
                     /db_xref="GeneID:11506380"
                     /db_xref="JGIDB:Spoth2_2310362"
                     /translation="MFGISYGITKLQPGDFITCYNPGRCGLAIVAEGGKVFWFVQERL
                     PRTYRLHEIPRYTDDDARDFIARHSDLIFLKGPDGLTLADFWEKTSSFRLVPIEEAKF
                     KLWHWGRIVCVGDSIHKSTPNLGVGANAAIESAAALANGIKRLADQWRATDGSLPNIR
                     DIEAMLAEYHRARVVRADAGVDSSGFLARSHNMHGLGRRLFVRFVMPHTTEFVPELMG
                     NAMIGAVKLDYLPLPMASLTGTKPFNPSQGDGKQESKLKRALFASPLLALAFVAAWVM
                     DPNSAGPWAAALRDSGVFELPSGDFVPILRSFYRLPAFDDFVALVNTFFFPSVYGTDP
                     VSRRQVLSFLTDGTVLLTIWIFESARRANLLTPIQWPHMYATLGQLLGIGVVSPAYCF
                     LHYVLSPIEKFSALDQRLTNTRTSFAALPVVLLTYLLPFYSMLAWPDLLTRQVLLYLW
                     QLYPLWAAAALFAGSRLFLRDTMATDKLSRPLRDLPVMRLYVGAAAALSAVVWWHTRL
                     GAGGLVHVFVPAGLPRSEHNLTRFTAEFLKWDEVFGFGSHLLWLAYLFWDLRSAGMLR
                     EGWLRVVGLGLLSLVLFGPGATLGLGWLFREHILATRRHKNALTPESVGRLHGSAF"
     gene            complement(<1718120..>1719582)
                     /locus_tag="MYCTH_2112801"
                     /db_xref="GeneID:11514003"
     mRNA            complement(join(<1718120..1718151,1718483..1718741,
                     1718895..1719347,1719535..>1719582))
                     /locus_tag="MYCTH_2112801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665974.1"
                     /db_xref="GeneID:11514003"
     CDS             complement(join(1718120..1718151,1718483..1718741,
                     1718895..1719347,1719535..1719582))
                     /locus_tag="MYCTH_2112801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666022.1"
                     /db_xref="GeneID:11514003"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="JGIDB:Spoth2_2112801"
                     /translation="MPQRQFDMIHDHIDTIDFHLRMRQPLQYTNFMAINHPSPVPHTQ
                     AERAALLAATAFRFKKSVDDGTVEFPSIMDTPVCRDPLRWLFNTYRRPGVGMDEMRKG
                     AGDYCVVFRRGRLFVPLQEKKEERGTTPASLDALRAAMEAILDHVQDEGTWAGILTSN
                     NQDSWARIRNELLAASPANAEYFQTIEDAAFAVHLDDSSPVGYAELAKQCKLGDGFNR
                     WHDKPLQFVVTANGNSGVIVEHSYLDGTTPEPLFDRAAEKLIQSA"
     gene            1722380..1723244
                     /locus_tag="MYCTH_2310363"
                     /db_xref="GeneID:11514004"
     mRNA            join(1722380..1722596,1722761..1723244)
                     /locus_tag="MYCTH_2310363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665975.1"
                     /db_xref="GeneID:11514004"
     CDS             join(1722570..1722596,1722761..1723102)
                     /locus_tag="MYCTH_2310363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666023.1"
                     /db_xref="GeneID:11514004"
                     /db_xref="JGIDB:Spoth2_2310363"
                     /translation="MGQKQSVAQSTFFCPTTGTEIDDPLGLCARCQANHDIIWQSVFV
                     CPNTGYRIEQPPSRPDRECPSCFQMHQPYSKRVYICPVTGATIPHPRDTGGRCQKCNR
                     THEDNSTPVSSKEAVSERSR"
     gene            complement(<1725124..>1727002)
                     /locus_tag="MYCTH_2120753"
                     /db_xref="GeneID:11514005"
     mRNA            complement(join(<1725124..1725309,1725404..1725824,
                     1726035..>1727002))
                     /locus_tag="MYCTH_2120753"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665976.1"
                     /db_xref="GeneID:11514005"
     CDS             complement(join(1725124..1725309,1725404..1725824,
                     1726035..1727002))
                     /locus_tag="MYCTH_2120753"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666024.1"
                     /db_xref="GeneID:11514005"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Spoth2_2120753"
                     /translation="MGVINHNADAPRPETLVTATLAFLEKHWPVLLVGGLVIRALYKR
                     YASPLRKYPGPFLASFSRLWKVLSTASGHTHLDHIALHRRYGPVVRIAPGEVSVSSPE
                     AARTLLSAGRRFFKTPFYGVFPPPENPDIFTETREDVHATKKRVANVPYSMAAMQQLS
                     PFIDDTVELLVRKIDEFIDKNPRGVFNLGDYLHYFAFDVLGEVAFSRSFGFLEQGKDV
                     DGAIKTIDNSQWYNGVVGQVPELDHFLRRNPLWQFVPWLSTKNALITRMALEEMARRQ
                     PFDKDNGGLLRTGDGRQDLMASLIQGHLKDPEKFGEGDVFAVAHGAIFAGSDSTASTM
                     QSFFWHILDAKPVYQGIVRELEEAVKEGVIPAEGNLTWNQAQKLPYLQACLKEAMRVR
                     PAVGLNITRLVPPEGAELDGHFFPGGTTVACNGWVLHRDKEIFGQDADDFRPERWLED
                     EERAKKMERYMFQFGGGSHLCIGRNLALLEINKVVPRLLRDFRIELAHPGRPLKVHAS
                     FFVVQSGLEVYISRKA"
     gene            complement(1728937..1730528)
                     /locus_tag="MYCTH_60661"
                     /db_xref="GeneID:11514006"
     mRNA            complement(join(1728937..1730127,1730281..1730528))
                     /locus_tag="MYCTH_60661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665977.1"
                     /db_xref="GeneID:11514006"
     CDS             complement(join(1729151..1730127,1730281..1730506))
                     /locus_tag="MYCTH_60661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666025.1"
                     /db_xref="GeneID:11514006"
                     /db_xref="JGIDB:Spoth2_60661"
                     /translation="MSNSTAVTKASDASVPVDPEQTLKACKALVSHIRKTAAAPRSDG
                     KQNLLADEESTIAETPIWLTLTTKKHIHDSHRLQPGKIILPNPLNTNEELSVCLITAD
                     PQRWYKNAVADEFPEDLQAKIGRVIDISHLRAKFKAYEAQRKLFSEHDVFLADDRIIN
                     RLPKALGKSFYKTTTKRPIPVVLMAQRPKVDGKRVPAPKGKKQKRDPAENVNARPVPE
                     IVAEVWRAIGAALVHLSPSTNTAIKVGYASWEPEKLAANINTVVRELVERFVPQKWQN
                     VRNFYVKGPETAALPIYQTDELWLDESKVVPEGQQPPSALPGRKQKAIAEKPNIGKKR
                     KSLDGESEPAQLEAPKEEKEEKEERPKKKAKKALPESNDERLDKEIAERKAKLKKQKK
                     AAASKADI"
     gene            complement(1730898..1733270)
                     /locus_tag="MYCTH_2096307"
                     /db_xref="GeneID:11514007"
     mRNA            complement(join(1730898..1731446,1731578..1733270))
                     /locus_tag="MYCTH_2096307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665978.1"
                     /db_xref="GeneID:11514007"
     CDS             complement(join(1731414..1731446,1731578..1733119))
                     /locus_tag="MYCTH_2096307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666026.1"
                     /db_xref="GeneID:11514007"
                     /db_xref="JGIDB:Spoth2_2096307"
                     /translation="MDSSPSSSKAPEPTLPTAAGVKRSAPSLLPAFEPLSSSPGLPRP
                     SKRHASSNAFLKYPTPAPTSSTGILSSSPPRLGSRPAPRRTQSTVSERAPLTSVPSVE
                     LNENGETLLMGRSSSSSHYQLSANRLISRVHVKARYIAATNPLEPNKIEIVCTGWNGL
                     KLHCQGQTWELAKGDSFTSETEGAEIMIDVQDARVMVRWPRRDKDQDALGHLSDSTWD
                     ESPRPRVARAGSELQGSPLRKTTRLASPESPTPANVSTSNASLDSLVPRGTEQDDAPV
                     EIYEDASADEKSPKPQKAATGASFATQAAESFSSDLSDPQSDAENEPNEENDPIVHSF
                     GPFASNVSGRLASFSTATPRVKPPVSRNPLADVLESSPLPPPSPLKPADANSSAAAAS
                     SIPSAPTPEALTGLSAEEVSTITNHMINQLAFSRLSSTPLSTILNNLPAAERKMVNKE
                     QLRIIIESTPCVGIIRRQGKDAAGKPLESEYYYTPELDTDEQRRLAVTDGLRKPSLRN
                     CRKQHKQYYWKRPKTP"
     gene            complement(<1735781..>1738048)
                     /locus_tag="MYCTH_2140533"
                     /db_xref="GeneID:11514008"
     mRNA            complement(join(<1735781..1736360,1736505..1736838,
                     1736945..1737035,1737181..1737242,1737328..1737662,
                     1737940..1737967,1738024..>1738048))
                     /locus_tag="MYCTH_2140533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665979.1"
                     /db_xref="GeneID:11514008"
     CDS             complement(join(1735781..1736360,1736505..1736838,
                     1736945..1737035,1737181..1737242,1737328..1737662,
                     1737940..1737967,1738024..1738048))
                     /locus_tag="MYCTH_2140533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666027.1"
                     /db_xref="GeneID:11514008"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_2140533"
                     /translation="MRWPWWLPRYQELSTENWSQTSWQKPSCVASPRSASEVQSIVAT
                     LGRKNVPFAVRSGGHSPAPFDANINTGVLISLGKLNHISYDKERQTAGIGPGARWGEV
                     YATLDPFNVTVVGGRVGDVGVGGLVLGGGLSYLSNLYGLACDNVLEYKVVLANGTLVT
                     ASSTSHPDLFWALKGGANNFGIVTQFTVATYPIKEAWGGLRTYSIEQMPQVLDALHQY
                     QTAEDKDPYANLFISIPITNATDYGILVTFVYLKPVEEPPAYAAFYNLTPTADATALT
                     TLNDLMTNFLQPEFPRYNWYTTSFRPTPSTYSGISNLLLTAPEVGKIQALTGGTLVAS
                     FQPIDASVGALSSPSSSSTTPNQPPPSSSSSSSSYAGRQPQGDWAGNALGLRAVPQTW
                     LALQLLWWEAGDDGAVEAAARSLHGRVARLSRAEGSFLDYVFMNDASWRQPVIAGYGP
                     ASLRRLRQVARRYDPDRVFVRLLRGGQKVPWEEE"
     gene            complement(1739135..1741209)
                     /locus_tag="MYCTH_2310379"
                     /db_xref="GeneID:11514009"
     mRNA            complement(join(1739135..1739786,1739908..1739984,
                     1740106..1740500,1740582..1740689,1740866..1741209))
                     /locus_tag="MYCTH_2310379"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665980.1"
                     /db_xref="GeneID:11514009"
     CDS             complement(join(1739338..1739786,1739908..1739984,
                     1740106..1740500,1740582..1740689,1740866..1741072))
                     /locus_tag="MYCTH_2310379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666028.1"
                     /db_xref="GeneID:11514009"
                     /db_xref="JGIDB:Spoth2_2310379"
                     /translation="MVNGTASNDPLAGLIPPPSELNDAHKVYGVAAGCIVMCIAASGM
                     VLWRLYLRVAARKFGLDDYATAFALLCYLTWSGLAIYINLHAGVGKPLWELTLGEIQL
                     WYKGIVACNFLYPVMSTSIRASLLIFYRRLFVNPATSLVYAWTINILLALQLVYLVVF
                     CSIPVLVCRKTSDAADPFTSAMYCDAWVYIDETIALYSVSLAFDLALLTLPVFPIASL
                     RMPAKKRAGVLLLFLLGFTASAAAAWKLGMYTWELNRLYDIDPRWYNYQMSRLVPPQF
                     DSYGVTFWVPSMLEPTLAMICASLPGLRPALGRIYEVLSSALGSTFGRSREQHNGAKI
                     QLGDSDQPMYDWATHTIGGSTQKLRGGNSSGTASRDGAPSKISHSELSSTGAGPDDEE
                     RGPYHLENGVITRHYRTAV"
     gene            1742708..1745780
                     /locus_tag="MYCTH_109870"
                     /db_xref="GeneID:11514010"
     mRNA            join(1742708..1743117,1743461..1743798,1743975..1744036,
                     1744220..1744310,1744380..1744716,1744853..1745058,
                     1745229..1745780)
                     /locus_tag="MYCTH_109870"
                     /product="FAD linked oxidase-like protein"
                     /transcript_id="XM_003665981.1"
                     /db_xref="GeneID:11514010"
     CDS             join(1742804..1743117,1743461..1743798,1743975..1744036,
                     1744220..1744310,1744380..1744716,1744853..1745058,
                     1745229..1745503)
                     /locus_tag="MYCTH_109870"
                     /codon_start=1
                     /product="FAD linked oxidase-like protein"
                     /protein_id="XP_003666029.1"
                     /db_xref="GeneID:11514010"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Spoth2_109870"
                     /translation="MATPERSLAEFIDSLQLPGQQAAELTAELQKDAELVSFLEARAH
                     SGQKSSSNSSTTTTATTTTTTTTTTPATTTGLSAACRVLQTALGSGKVVSADNETEVN
                     ATWSATTWQTPACAVLPDSAQGVATTLRTARFFGVPFAVRSGGHSPNPGHSSVASPGI
                     LIDLRRLDGIAVGPRAATVTVGPGQRWGAVIEALDPHKVTVIGGRNPTVGVGGLILGG
                     GYFHFSPQFGLAADNVKSFEVVLADGSIVKASACKNSDLFWALKGGGPNFGIVTSFEL
                     YTIPVHEVWVEGLAFSPAQVPEVFEAYAAFQKSTTPDIKATVSVVVSLDIVLVALLYT
                     EPAASRPQAFSPFDKLTPLSVILPPTNMTVLQFSQISAGTQPNTASRHDYRAASSKID
                     AQLYTDVYNIWLERATKVKEATGANQTFTIQTFSKNLVQQGIKKGGNPLGMPLEDFQC
                     WTTLMDWNEAADDAAVRSAAIETTEAWARLGAQRGLAVDYLYLNDASRDQNPLASYGP
                     ANVARLKAVAAKYDPDRVFQTLQNGGFLLRDV"
     gene            1746757..1748880
                     /locus_tag="MYCTH_2096317"
                     /db_xref="GeneID:11514011"
     mRNA            join(1746757..1747311,1747351..1747557,1747714..1747869,
                     1747978..1748880)
                     /locus_tag="MYCTH_2096317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665982.1"
                     /db_xref="GeneID:11514011"
     CDS             join(1747034..1747311,1747351..1747557,1747714..1747869,
                     1747978..1748473)
                     /locus_tag="MYCTH_2096317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666030.1"
                     /db_xref="GeneID:11514011"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="JGIDB:Spoth2_2096317"
                     /translation="MAPKTTSPGMTTRSSSSSSSSSKGNTKRKPVKPPNDALLAQQYG
                     GGHVGGWVDRLPASVIPYVQLARLSPPAGLLLIFFPHFFGILHAAIVLLSAAAAILRA
                     CAITLAGSFFSSNAAHAWNDLVDAPMDRQVARTRGRPVARGAISPLGAFLFAVSQALL
                     AAGRRGVLAACYALPNILAIIYYPYAKRHTHLAQVVLGFCLSYGVVMGSCAMGLIPVV
                     VHIPTVCLMGACLLWTVLYDTVYAHQDVEDDRKLGLKSTAVLLGDRTKPALWCVLGAM
                     LALLAVPGRAAGMAPPYYLFTLGGCLASLGTMVHRVDLKEPASCWWWFRYSFWLAGGS
                     IAAGLVSEYLIRAAPWAELCKPWLHLFPKLPLSLAAPDVESVTF"
     gene            1749650..1751323
                     /locus_tag="MYCTH_2316248"
                     /db_xref="GeneID:11514012"
     mRNA            join(1749650..1750627,1750801..1751323)
                     /locus_tag="MYCTH_2316248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665983.1"
                     /db_xref="GeneID:11514012"
     CDS             join(1749980..1750627,1750801..1751154)
                     /locus_tag="MYCTH_2316248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666031.1"
                     /db_xref="GeneID:11514012"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="JGIDB:Spoth2_2316248"
                     /translation="MPGTIIITGANGSLAIPAIEHILTKYPGYHLVLTVRNPSADADA
                     NTKRLRAVLDRHPGPANTASVRALDLADLSAVHAFADAVAAEVEAGTLPRIASIVCNA
                     YYWNLVEAPVQTRDGLETALQVNHVAHAALVLRLLASSFAPGGRIVFLGTNATDPGAN
                     PNEKYPPVLPDDLEDLARVPERVEPGDRAGTGFYRYAVSKLAVTMFAYALNRRLEKDP
                     DLNTVTAVTINPGNLADSRALQTNTPKSLSLAQKLVLKPLRPLLSLLDPLLRTAAAAG
                     VDVAELATGHAHPGKRGFYTLLKESKSSEESLKVDKQEAVWKKTLAWAKVTPKNDEW"
     gene            complement(1752262..1754288)
                     /locus_tag="MYCTH_2316249"
                     /db_xref="GeneID:11514013"
     mRNA            complement(join(1752262..1752885,1752975..1753687,
                     1753761..1753853,1754028..1754288))
                     /locus_tag="MYCTH_2316249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665984.1"
                     /db_xref="GeneID:11514013"
     CDS             complement(join(1752578..1752885,1752975..1753687,
                     1753761..1753853,1754028..1754224))
                     /locus_tag="MYCTH_2316249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666032.1"
                     /db_xref="GeneID:11514013"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2316249"
                     /translation="MLAFLDRGNIGNARIAGMAKDLALDTNRYNWLLNMFYITYVIAE
                     FSVLLWKVFPPHIVGSLVVFSWGLIATVQAGVQSWGGEMALRFLLGAFEAAYGPGIIY
                     LLSFFYLRHEIGFRCGIFASAAPLASTFAGALAYGITSGHSKLANWRLLFLVEGLPTV
                     LMSVIAFFFIPDSPEKARFVTTEERAIVRSRTVRQVGSVSSERIGGVKLKDVLSIFID
                     PKAWMCALMYFCGNVSYSSLPVFLPTILEDMGYTAINAQGLSAPPSFAAFLFALITTW
                     IADKTQQRCFVLFVTSAIGGVGYIILATVETVGVRYFATFLASAGVFSTIPNILALTL
                     NNQGNDTRRGMSIVLINLIGQCGPFLGTNVFPLEERPRYIKGMSICASFMFFSAILAL
                     SQRVLLMWENRKLDRKYGPVKKETEGKSESVAVENYGPNFRYVL"
     gene            complement(<1754310..1754854)
                     /locus_tag="MYCTH_2310391"
                     /db_xref="GeneID:11514014"
     mRNA            complement(<1754310..1754854)
                     /locus_tag="MYCTH_2310391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665985.1"
                     /db_xref="GeneID:11514014"
     CDS             complement(<1754396..1754583)
                     /locus_tag="MYCTH_2310391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666033.1"
                     /db_xref="GeneID:11514014"
                     /db_xref="JGIDB:Spoth2_2310391"
                     /translation="MSDEKPPPSDLEVGELAPQQTDSLHDGSPQQSPAAPNYTRRQEA
                     RVVMKLDWNLMTLFFALC"
     gene            1756095..>1757342
                     /locus_tag="MYCTH_74601"
                     /db_xref="GeneID:11514015"
     mRNA            join(1756095..1756365,1756565..1756687,1756852..>1757342)
                     /locus_tag="MYCTH_74601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665986.1"
                     /db_xref="GeneID:11514015"
     CDS             join(1756165..1756365,1756565..1756687,1756852..>1757342)
                     /locus_tag="MYCTH_74601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666034.1"
                     /db_xref="GeneID:11514015"
                     /db_xref="JGIDB:Spoth2_74601"
                     /translation="MSQPGEPLTPEQIAHFNDSRQSALWGCLTVFLVINNVAIAGRLW
                     ATWKTGSRQMPVRAEGISIVLSGVLLNVIIGNLMAATHYGLGLHYWTVNARDPHYPRN
                     LSKTFMHIWITMVLMSSFFACIKVTLLCFYKRLFLVSSSRLRIFWWANLIYVVLWFFG
                     GTGFYLFQCHPVQWYFLQHYERFNKPVPGGVTGQCDAQKVTNVAMPVIFSLISDLGLL
                     VLPIAAIWNLRLSKWKKIGLFAVFGIGLAACMLELARILNLLLDTDDKTDPSC"
     gene            complement(1758512..1759760)
                     /locus_tag="MYCTH_2310392"
                     /db_xref="GeneID:11514016"
     mRNA            complement(join(1758512..1758832,1758952..1759438,
                     1759590..1759760))
                     /locus_tag="MYCTH_2310392"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665987.1"
                     /db_xref="GeneID:11514016"
     CDS             complement(join(1758611..1758832,1758952..1759438,
                     1759590..1759651))
                     /locus_tag="MYCTH_2310392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666035.1"
                     /db_xref="GeneID:11514016"
                     /db_xref="JGIDB:Spoth2_2310392"
                     /translation="MAATTAINRRRDPYEGMVVTGFEGGITTRILAHPRRSFAFEVTF
                     DLAHPRLVALAGQRPPPAHFHPYQAEYVEVTAGRLIVELEGRRHLLTPRSGEFVIPRW
                     ANHRLYPPPPPPGKEGATARDDGRRRGEGGDEDGKTTRFLLSGEDTPRPFRLDAVFFE
                     NWYAYQDEVVLRGKKVDILQVMSTFDAGGSYLSLPWWVPFGRTISLVLGVVLGRWIAA
                     LLGYQPFYRQWTTDWDTAVEKMEQSLFQRRFADKTKTA"
     gene            complement(1761218..1762513)
                     /locus_tag="MYCTH_2310394"
                     /db_xref="GeneID:11514017"
     mRNA            complement(join(1761218..1762194,1762258..1762513))
                     /locus_tag="MYCTH_2310394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665988.1"
                     /db_xref="GeneID:11514017"
     CDS             complement(join(1761335..1762194,1762258..1762396))
                     /locus_tag="MYCTH_2310394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666036.1"
                     /db_xref="GeneID:11514017"
                     /db_xref="InterPro:IPR002472"
                     /db_xref="JGIDB:Spoth2_2310394"
                     /translation="MAIVKGVKLLVLGSLIATSIAKSLERRFESGDDDDDDTPLPLVI
                     WHGLGDTYESEGMRRVAEIAEEVNPGTLVYPIRVEENPSRDRYASFVGNLTDHVAKVC
                     ADIAAHPILSTAPAIDALGFSQGGQFLRAYVERCNKPPVRSLITFGSQHNGITAFRDC
                     KPTDWICRIAMAVLKGDAWTDTVQNKLVPAQYYRNPDEYEKYLEHSNFLADINNEREI
                     KNEEYKKNIAKLENFVMYMFEEDTTVIPKETAWFEDVNGTESTPLRARQLYTEDWLGL
                     RALDRKGGLKFRTAPGDHMQLSEELLKEAFGDFYGPLNLHRGRSDPRPANWRSDDL"
     gene            complement(<1763644..1765036)
                     /locus_tag="MYCTH_2310396"
                     /db_xref="GeneID:11514018"
     mRNA            complement(join(<1763644..1764436,1764548..1764716,
                     1764789..1764841,1764915..1765036))
                     /locus_tag="MYCTH_2310396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665989.1"
                     /db_xref="GeneID:11514018"
     CDS             complement(join(<1763793..1764436,1764548..1764669))
                     /locus_tag="MYCTH_2310396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666037.1"
                     /db_xref="GeneID:11514018"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2310396"
                     /translation="MAAMGMTTLTLDVTKEDSIKACHDEVSKLTGGKLDILVNNAGRT
                     HTHPATDLSIPDVRETFETNVFGVMAMCAAFSDLLIASKGLIINIASLAAVTPYVFGS
                     AYCATKGAVTAYSRTLRLELKPFGVRVMVAMTGTVRSQIASRTHRTLPEGSIYQRVRD
                     IFERRLTFSQNNRATMDTAQYARKLVAKALAPEWPLLLRAWFGRPDWFWAGGWAAVVW
                     LGHSLGEWITDFVMYRMMGLTTLEKVLREEERKKKKL"
     gene            complement(<1824457..>1825290)
                     /locus_tag="MYCTH_2069072"
                     /db_xref="GeneID:11514019"
     mRNA            complement(join(<1824457..1824546,1824659..1825014,
                     1825083..>1825290))
                     /locus_tag="MYCTH_2069072"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665990.1"
                     /db_xref="GeneID:11514019"
     CDS             complement(join(1824457..1824546,1824659..1825014,
                     1825083..1825290))
                     /locus_tag="MYCTH_2069072"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666038.1"
                     /db_xref="GeneID:11514019"
                     /db_xref="JGIDB:Spoth2_2069072"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            <1831331..1838519
                     /locus_tag="MYCTH_2135602"
                     /db_xref="GeneID:11514020"
     mRNA            join(<1831331..1831335,1837402..1837552,1837690..1837788,
                     1837924..1837976,1838039..1838110,1838162..1838519)
                     /locus_tag="MYCTH_2135602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665991.1"
                     /db_xref="GeneID:11514020"
     CDS             join(1831331..1831335,1837402..1837552,1837690..1837788,
                     1837924..1837976,1838039..1838110,1838162..1838249)
                     /locus_tag="MYCTH_2135602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666039.1"
                     /db_xref="GeneID:11514020"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="JGIDB:Spoth2_2135602"
                     /translation="MANNELGMIAAPDTKLIDRTRDGLKRSYDLKELGEDKRFLGFDV
                     IRDREARKKAYYMKDTGALNWVAYGTRPDIAYTVSRLAEANTPPWLTGCHHGTRPVAK
                     CTTEAEFANLAPAALSAHLWVARIFLNAYLTVMNPLNKARTRTIDIQYKWAIE"
     gene            complement(1839038..1840760)
                     /locus_tag="MYCTH_2310402"
                     /db_xref="GeneID:11514021"
     mRNA            complement(join(1839038..1839176,1839239..1840760))
                     /locus_tag="MYCTH_2310402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665992.1"
                     /db_xref="GeneID:11514021"
     CDS             complement(1839275..1840585)
                     /locus_tag="MYCTH_2310402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666040.1"
                     /db_xref="GeneID:11514021"
                     /db_xref="JGIDB:Spoth2_2310402"
                     /translation="MAQAGEQAAAGLARLPSELFDKILLDVDTVRDLARFIVTARFVY
                     RRFSIQRRAVLFCVLQNELGPVLADARFLLVFPYSDPRADKAAYIEWLRLMAFVYHEM
                     LRDGNARSSMPVRGSDALPSLKELTGLCHTLYKINFLADMYVTARLALFDLAGGAGTP
                     ATTPLSPLERRRLVRAFYRRQIMSNAWAATRRPHSGWSHEDMAAISNSSTHQGEQLGL
                     FGTLEPWELQHIDHVDFFVTRLCFTLVHYSPRTPDGAPAILPRQFDDLIAHQHHLVQY
                     LQTHRRLAEMAVHDLPTGREAARSAHLWDEYVNVYQMIPLKCAWQGAQAHDFANPIRD
                     KWQRDGLVVPYVGDGLDLVPYGWLDALRGRYFNQFGECLHTISWLPPWQSDRQSVQQR
                     KTLSLWTHAGFSLWDRKRVEALKELPMFEPVYTGWVFSRLVEES"
     gene            complement(1841342..1842291)
                     /locus_tag="MYCTH_2310404"
                     /db_xref="GeneID:11514022"
     mRNA            complement(1841342..1842291)
                     /locus_tag="MYCTH_2310404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665993.1"
                     /db_xref="GeneID:11514022"
     CDS             complement(1841364..1841705)
                     /locus_tag="MYCTH_2310404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666041.1"
                     /db_xref="GeneID:11514022"
                     /db_xref="JGIDB:Spoth2_2310404"
                     /translation="MTKCSQCPNDKTEGPGWVMKKPQCFSPGCVRGWKKCTSCTYVNG
                     YMVKCCGSCGSVSDGKPAGQKRCSACDGTGYSSQTPMKHACTQPHNQPASRLGSRPGS
                     SAGSRPPSHRH"
     gene            <1842316..>1842639
                     /locus_tag="MYCTH_2070109"
                     /db_xref="GeneID:11514023"
     mRNA            <1842316..>1842639
                     /locus_tag="MYCTH_2070109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665994.1"
                     /db_xref="GeneID:11514023"
     CDS             <1842316..1842639
                     /locus_tag="MYCTH_2070109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666042.1"
                     /db_xref="GeneID:11514023"
                     /db_xref="JGIDB:Spoth2_2070109"
                     /translation="PEGGTLGGGELTVPAAESYGLGPRSEQNPYSGELAATERALGSL
                     PTLRSSRIEISTRNKAAVLTLRQPRKQSGQHHICHIYESIRESTTQEREHSSLLAIPS
                     IRWRS"
     gene            complement(1843911..1846029)
                     /locus_tag="MYCTH_2310405"
                     /db_xref="GeneID:11514024"
     mRNA            complement(join(1843911..1845035,1845229..1846029))
                     /locus_tag="MYCTH_2310405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665995.1"
                     /db_xref="GeneID:11514024"
     CDS             complement(join(1844031..1845035,1845229..1845849))
                     /locus_tag="MYCTH_2310405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666043.1"
                     /db_xref="GeneID:11514024"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2310405"
                     /translation="MATSSHDSILLATRPGGSGPPAPAPSPAPAPALPPISRKKQAAV
                     LFSAFMTTALTIGYNQSFGVFQQYYLSPSQDVLIPSPASQVSPPPTALLAFVGTLCYG
                     LTWAGGIVVNPVIARLEHGSWASATSSTRLWRRRLLRLLTPRVITVSGVLVTSAGFVL
                     ASLSRSVWQLLITQGFLAGMGMSLLYFPLLAPAPEYFTNHRATALGFILAGGGAGGLV
                     LSPVIRALLSSIGGRWTLRLYALFNLLAGLPIAWTVPRSRFAVGRNTAAVSTPGHRLS
                     ESPERREEEEEGQQQRGFGTHVSRALASRPTFLLSAAAAFLQAAGAQLPIAFIPSYTA
                     ALGLGGDGGGSGGGGEEEGASTMGATLLAASSAVNAASRVVAGYAGDRLGRQNALVLT
                     LLLAAGSVYAFWLTSALLAVEEWGGGASSSLSSSSAAAWSSSAWSLWLAFVALYSFSV
                     GGYYALFPALVADVFGIRHYAAVNAFILFVRGLGTLFGSPVGGQLLGSAAEGARAYTS
                     VACWDGALLTAATLCCVGVRWADAKGKGWRWIA"
     gene            complement(1871624..1872682)
                     /locus_tag="MYCTH_2310406"
                     /db_xref="GeneID:11514025"
     mRNA            complement(join(1871624..1872401,1872465..1872682))
                     /locus_tag="MYCTH_2310406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665996.1"
                     /db_xref="GeneID:11514025"
     CDS             complement(join(1871739..1872401,1872465..1872635))
                     /locus_tag="MYCTH_2310406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666044.1"
                     /db_xref="GeneID:11514025"
                     /db_xref="JGIDB:Spoth2_2310406"
                     /translation="MEATDDIRVDHVPRAPSPARNSEIQLPRYRRHGEPERYRLSAAR
                     LAMAPREPPTKLVHFWFRTRYVSAHASQISDLHPHVLGLRICPSTVASFFTSATRLLP
                     AFAQPWIRAVFPEWFLPDRAVLKTQKPGEDQEIMKEYFDTEVEAYGRLSPLQDAIIPK
                     FYGLLRYNGTRAMLLEYLGGISLSAPEGATMTLEELSSLLQPCYRALHAFGVHQDDAN
                     LSNFRLVDGKLKVLDLESAVFHYSAAQKATFLASSVRHLAKHYLSMQAYYRHEGSLEA
                     A"
     gene            <1877605..>1879730
                     /locus_tag="MYCTH_2120773"
                     /db_xref="GeneID:11514026"
     mRNA            join(<1877605..1877640,1878198..>1879730)
                     /locus_tag="MYCTH_2120773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665997.1"
                     /db_xref="GeneID:11514026"
     CDS             join(1877605..1877640,1878198..1879730)
                     /locus_tag="MYCTH_2120773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666045.1"
                     /db_xref="GeneID:11514026"
                     /db_xref="JGIDB:Spoth2_2120773"
                     /translation="MGDLDEWVVLILPYLRPPCPTSWLLTTTWSFSQYPPFPTTGSAW
                     CDPPPWRTNIANAGFHYYSPAICPRGFVVGPSCGIITKERTDEGFPAIATGETAVYCV
                     PSGLTCTTELTDYRGGVRGFARDATALGALFTFGAAIQIRWVAADLTKLETHPLTPGL
                     RLATTGSQETTRGPVMGPTITIDPATLTTGEPGRQPAPDQGDTDTVLYTDANPSSPVS
                     LTLIYDDPEPTSSLGPASSAASGSGGGGLGSLDRPTSIVVIVLVTVIAGIALWIGAFL
                     LVRQQRKKAARRKGSRSTREGGDDETCLENGRRQRGPARPAGPAGSAKHARKPSGATK
                     SIGSPVSELDATGTPAIGSTPNPAELEGDLLIQPPERTTWVHQRLWLKSPALLQPPQS
                     SPRSLLSTRSTRRTIRESFGEKVNDPAAALGRLKIPNPLAIGRSSPTSASPSTRSFWR
                     MPRSLKTTTTTTTTTPPAGTTAAARRSAQLPKPSPRSAHSVSVRASRASTPGRGKPGW
                     REDGPSSTQSDATL"
     gene            1880213..1880657
                     /locus_tag="MYCTH_2310408"
                     /db_xref="GeneID:11514027"
     mRNA            1880213..1880657
                     /locus_tag="MYCTH_2310408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665998.1"
                     /db_xref="GeneID:11514027"
     CDS             1880317..1880631
                     /locus_tag="MYCTH_2310408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666046.1"
                     /db_xref="GeneID:11514027"
                     /db_xref="JGIDB:Spoth2_2310408"
                     /translation="MSTNTTTSSQPGDTVADLASSLMKQPSRHGTTADGAAGESSGDS
                     SSSSRSAALARGMSHTGSWEPVLDRRQSWDAQEYKHDLLKRQYMDGEGTAPGSMGGFS
                     EA"
     gene            complement(1881211..1885048)
                     /locus_tag="MYCTH_2310410"
                     /db_xref="GeneID:11514028"
     mRNA            complement(join(1881211..1882393,1882493..1884681,
                     1884817..1885048))
                     /locus_tag="MYCTH_2310410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003665999.1"
                     /db_xref="GeneID:11514028"
     CDS             complement(join(1881465..1882393,1882493..1884617))
                     /locus_tag="MYCTH_2310410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666047.1"
                     /db_xref="GeneID:11514028"
                     /db_xref="JGIDB:Spoth2_2310410"
                     /translation="MSLSIASTVARRGRQPKSIRPVALGSLGSATVSHGNRQQTRGYK
                     FGRLSSYLEPYIRHHSHRYREDFYRRRAWDNQSLAEYAKSTIQRVVHNYWSPECRGRF
                     GAGRYLNTDAAPKKTPDNPTGVRPGQNIEDAERGPLEHLLFGDAKSQSAKNTGRSGQE
                     DANSDYVIDPITNRKVPRKTVDTSYSTADRGAEIPVRTTMPYRSQFGSLRPPEVDKTR
                     TPVFSDSPTSGTQKLPFVNHYGTPHGTLLDTLNLEHKEVRWHRDDTIASATSMAASWS
                     RSSDVPEYPDLHRYTAVRYQEPDGKPADKQSAQKPADLAKYGPVRAHEPDGKYKAESA
                     APAKPEDLDKYGPVRAHEPDGKYKIESKAAVEPQELDNHGVIESHQAEAEANDRAESS
                     VSSEELGKYGAVRSHEPDGKYKLDSESPVNPEELAKYKAVRSHEPDGKYKLESESSVD
                     PAELKQYGAVRSHEPDGKYKLQSESSVDPEELRKYGAVRSHEPDGKYKLEAEGTSSVD
                     PEELAKYGAVRSHEPDGKYKDAAEYIETPDEAELAAYRKPVLAHEPDGLYAANHVQPE
                     YDAEELAKYQQPFFSHEPDGKYAASYVEPPRDEAELFKYGAFRSHEPDGKYAANYNEE
                     KPDPGELATYGPYRSHEPDGMYALRNNVSVSPAETQRYRAFRSHEPDGKYAPEAQAAR
                     EAQDLANHEAFTYEDAETRPLPRSEPKELRKYQAVLWSEPDGKPVETDGTGQTLVEDS
                     PIGDTAKQEQKPFRRKVQELMAQAAAESDALEADKQATQEANIKNNRDQKRRHLTGNY
                     VRDFPEEFSKSWATEIPQASSSPLSLEQKSSESTIQPALDRYNSKDSGDGRLSSSRKS
                     DPTSPVLYKVLVYDPTTECIRTAETASTVRESTAPLTPAEILLRISNPAKFFPHFGPL
                     QAQGFEMVSGSGDVLIFRKVRDAVPAAAEATSSTPHASAAAAAPIGEERTPPPAGIVG
                     RKGKRSLPKKVAMGAACLAGSAYSVGVVSEYFRNGGIDGTGPKGF"
     gene            <1887471..>1892495
                     /locus_tag="MYCTH_98107"
                     /db_xref="GeneID:11514029"
     mRNA            join(<1887471..1887689,1887777..1888336,1888385..1891080,
                     1891368..1892068,1892226..>1892495)
                     /locus_tag="MYCTH_98107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666000.1"
                     /db_xref="GeneID:11514029"
     CDS             join(1887471..1887689,1887777..1888336,1888385..1891080,
                     1891368..1892068,1892226..1892495)
                     /locus_tag="MYCTH_98107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666048.1"
                     /db_xref="GeneID:11514029"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_98107"
                     /translation="MFTGSKVAHGGGFGGFRSSSTSLSYLAPPPDFTGIPHEVVVAYK
                     NLTKKDSTTKEKALQDILGYVQTLGAEGRIELYPRLSVDDSARVRELSHQLLFHLLNL
                     AKKRMAKKLPAFVGPWLAGAFDRDKRVLKAAADALAAFLQTKEKEEAFWKAVQGRALE
                     FATEAIKETPDTLSDERATTKQDSDAKYYRVVGASLNLALNLMRKGDVGVLKDGLAGY
                     LEVDALWTMSTADDAFVRRAFYQFLDTLLTIRPDILEPRLQHSATDLLKVLISLTKRF
                     PQVWGTQKHPLQRLQQFVAQGSQGGAEEYWQSLDQLLQVLPKKTPSPEVVSTFLGFMR
                     KGIAERLETRTSRYRAFQTYARVFEVFLHDLPLTTSLLEENLSSVSRQYLHPTSESSL
                     PSPPRPEPLADAWMIVSRHSDDETCGAVKEEWHKLGTAFLSRMSNSLPEVSAGYQNSQ
                     TSIASEGERWFALAANVLSREGGEHTSLFSVIAETSTNVLRGALDLLTRRNFKPFGAA
                     AVIQSAFRHCPRLCAESNLLASLYPADQAEIYGTVVASPSLPYLVSGLNTLSEGSHGQ
                     FEKVWVSLVEAALRLPDRPSTISAIRVLIGIPSVATYSQSLTGLQSFSVSAWKEYADG
                     GSQAGLQDLCEATLSYDTLAEESLDAVVAGVISSLEAPETAGPALVALELVLKKKPEL
                     LSSKDDLHVRLVTILLALTELSEPRLSEKAKTLRQLLGAPPSGQNPVTRILEQHLSDA
                     NPSSLEVDTLVQQALSALNSGSVPADDIFPSSTVWMKELSPFLRRPPPPSLSLTSSMG
                     GAYFLVQGDPNAKPPRPRRDSSGRSVPARMALFTAKLLSSGVALSSLPPEFQLELVFL
                     LCLTEAIYEDQLSAAQTEGLWAQGSESEPDAREFLDLNSAAVRAVLQVCGDWKDWDMS
                     GNSLVERLINFMLHEAVGLSAAAFYAAKSLSSLFQLLVQTHGGPPANLESWLLKLGIM
                     KAAPNTSLATAAFLTGFGEALASSKVTANFCARLISELPGFDGVSDRFPRALPSLALL
                     NLCMDVYETGAVPIETRKQVLALQQLTRWTGAPEELGYQAAAETCKAISRLLPGTKDT
                     YGQYWEQAIEYCLWLWNKAAKDKHEERLSYIHASLKLMQALHAVDEPNDDLEEALASH
                     RDAETSALIALLAANLPDELLSLLLNAPNPEDYTDEDLAQFPVAIRSYLLAWHLVFDA
                     YSKASFRVRNDYTENLKSGKHLDPLLRFLADVLGHALGRALDLDKEGFTAEHIRSYSI
                     DLADSEPAERDMNWLLIHLFYLILKYIPGLFKMWYLDCASKQTKNAIQSWMERFFSPL
                     IISDALDEVVEWSSSQEAGDGDTEEIIVKVSKTSREITAGYPVDDDAATISLRVPTSY
                     PLDPVDVVSVKRVANCSLVDGLMAFRRNISLALKGQEECAICYSIIAQDKTIPDKKCG
                     TCNHFFHKVCLYKWFQNSGRNTCPLCRNGIDYLGSDTKRSRPEHE"
     gene            <1893574..1894949
                     /locus_tag="MYCTH_60632"
                     /db_xref="GeneID:11514030"
     mRNA            join(<1893574..1893596,1893651..1893788,1893870..1893967,
                     1894068..1894949)
                     /locus_tag="MYCTH_60632"
                     /product="D-amino acid oxidase-like protein"
                     /transcript_id="XM_003666001.1"
                     /db_xref="GeneID:11514030"
     CDS             join(1893574..1893596,1893651..1893788,1893870..1893967,
                     1894068..1894897)
                     /locus_tag="MYCTH_60632"
                     /codon_start=1
                     /product="D-amino acid oxidase-like protein"
                     /protein_id="XP_003666049.1"
                     /db_xref="GeneID:11514030"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_60632"
                     /translation="MPTIVVLGAGVSGLTCALLLAKQKGNTVTVVAKHMPGDYDIEYT
                     SPWAGANVLPMNLEKDSRWERRTWPEMRRLAAEVPEAGLHFQTARVLRRKVDVEAGLK
                     SALADGLFQLSPWYREVMDNFRELPASELPPGMHSGAEFTSVCINTAIYLPWLVGQCA
                     RHGVVFRRAVLKHISEAARMSHTGRRADVVVNASGLLACRLGGVMDAKVQPARGQIVL
                     VRNEAAGVMPTTSGCDDGDDEVVYVMQRAHGGGTILGGTYQKGNWEANPDPNVAVRIM
                     KRAVETHPELTGGKGIEALDIIRHGVGLRPWREGGVRLEKELIDGTWVVHNYGHAGWG
                     YQGSYGCAERVVELVDEIVGRTKCESKL"
     gene            1895163..1896801
                     /locus_tag="MYCTH_2310419"
                     /db_xref="GeneID:11514031"
     mRNA            join(1895163..1895362,1895433..1895677,1895764..1896801)
                     /locus_tag="MYCTH_2310419"
                     /product="glycosyltransferase family 58 protein"
                     /transcript_id="XM_003666002.1"
                     /db_xref="GeneID:11514031"
     CDS             join(1895170..1895362,1895433..1895677,1895764..1896666)
                     /locus_tag="MYCTH_2310419"
                     /note="CAZy_ID 268080"
                     /codon_start=1
                     /product="glycosyltransferase family 58 protein"
                     /protein_id="XP_003666050.1"
                     /db_xref="GeneID:11514031"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="JGIDB:Spoth2_2310419"
                     /translation="MTRMRSSPKTPTATMADQNRPIHIRATRLVFDILNGRHVLSKLI
                     PPLVFLADALLCALIIWKVPYTEIDWNAYMEQVAQILSGERDYTKIRGNTGPLVYPAA
                     HVYIYTGLYHLTDEGRNILTAQKLFGFLYMVTLAVVMACYWQAKVPPYVFPLLILSKR
                     LHSIFVLRCFNDCFATLFLWLAIFALQRRAWRTGALMYTLGLGVKMSLLLVLPAVGVV
                     LLLGAGFATSLRLAAVIGLVQVLIAVPFLSNNPWGYLGRAFELSRQFFFKWTVNWRFV
                     GEEVFLSKEFSLALLGLHVAVLAIFVTTRWLKPARKPVSQLIVPILLGKSPFTEEEQR
                     AVSRDVTPRFILTSILSANVVGLLFARSLHYQFYSYLAWMTPYLLWRSGVHPILQYAI
                     WTAQEWAWNVYPSTPISSGVVVGVLALTAALVWLGAREDWEPRRVLLKGEAAKR"
     gene            complement(1896803..1897265)
                     /locus_tag="MYCTH_2310421"
                     /db_xref="GeneID:11514032"
     mRNA            complement(1896803..1897265)
                     /locus_tag="MYCTH_2310421"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666003.1"
                     /db_xref="GeneID:11514032"
     CDS             complement(1896815..1897174)
                     /locus_tag="MYCTH_2310421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666051.1"
                     /db_xref="GeneID:11514032"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="JGIDB:Spoth2_2310421"
                     /translation="MGKPKRAVLAAAQESATPPDELTETQFVARVQKAEGNSLYTCEL
                     PNGKPVLVELEPKFRNTIFIRRGGYVLVDLASAAERSKASKVVGEIINIVREEKEWRK
                     QPYWHVLHACRMLPSRL"
     gene            1897282..1898881
                     /locus_tag="MYCTH_2310422"
                     /db_xref="GeneID:11514033"
     mRNA            join(1897282..1897740,1897811..1898374,1898470..1898618,
                     1898674..1898881)
                     /locus_tag="MYCTH_2310422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666004.1"
                     /db_xref="GeneID:11514033"
     CDS             join(1897884..1898374,1898470..1898618,1898674..1898807)
                     /locus_tag="MYCTH_2310422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666052.1"
                     /db_xref="GeneID:11514033"
                     /db_xref="JGIDB:Spoth2_2310422"
                     /translation="MGSTLPIALPALKTNPKFIFFTDFDGTITNQDSNDYMTDNLGFG
                     TELRKKGNQDVLYGRRDFRDSFQEMLDSVKTPFNECVDILRKNITLDPGFKSFFEWAR
                     ENNVPIVVLSGGMKPIIRALLAHLIGEEAVDSIQIVSNDVAPREGKSINEEGGWKIVF
                     HDDSGFGHDKSLEIRPYARLPAEERPVLFYAGDGVSDLSAAKETDLLFAKAGRDLVTY
                     CENEKVPFRTFHDFSDIHKTVKDIVEGKLTVAEAAVGRK"
     gene            1901436..1903269
                     /locus_tag="MYCTH_2310428"
                     /db_xref="GeneID:11514034"
     mRNA            1901436..1903269
                     /locus_tag="MYCTH_2310428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666005.1"
                     /db_xref="GeneID:11514034"
     CDS             1901575..1903143
                     /locus_tag="MYCTH_2310428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666053.1"
                     /db_xref="GeneID:11514034"
                     /db_xref="InterPro:IPR008839"
                     /db_xref="JGIDB:Spoth2_2310428"
                     /translation="MSAHTALRLAVRPLKRATLLDQIATTAAQKPLRQRPRSQLLLCL
                     CCSIAVGPESNPARTRFFSTAPPPPRNLPPSLESIVSRKPEPESTAAKDASPAASSSS
                     SPPSEPSDQPLQPDSEHSAPSSSSSSSSSSSSSSSSSSSSSSSSEPTASVQPSRPESK
                     EPPGDSAPPEPEPESRSQDSSLPSFTETHRHPLSARFSTFMDNLQGRVLTATQTINDL
                     TGYSAIEAIKKRNGELEREHAAAQQRLRAARHNYKSLTTHRAATQREVTALLARKDTW
                     TPADLERFTTLYRSDHELEAQVGAAAAELTEAEADEARLSGELNAGILKRYHEEQIWS
                     DRIRRQSTWGTWGLMGVNVVLFLVLQFVAEPWRRRRLVNGIAEREKGFMDEVRRELVE
                     LKAASQTAAAAATDAAAAAAALTAPAAGSGEGAAAAHASGAQGVGSAARDGPDVAVPV
                     EREDWRLPRKPWKEVLMDFWEDPELLREAVLDLTSDRRIDLRMRDASLIALQGAAAGA
                     TLAVVLAVSILRST"
     gene            complement(<1903949..>1907720)
                     /locus_tag="MYCTH_98099"
                     /db_xref="GeneID:11514035"
     mRNA            complement(join(<1903949..1904010,1904075..1904480,
                     1904537..1905855,1905922..1906899,1906963..1907226,
                     1907300..>1907720))
                     /locus_tag="MYCTH_98099"
                     /product="Serine/threonine protein kinase C-like protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003666453.1"
                     /db_xref="GeneID:11514035"
     CDS             complement(join(1903949..1904010,1904075..1904480,
                     1904537..1905855,1905922..1906899,1906963..1907226,
                     1907300..1907720))
                     /locus_tag="MYCTH_98099"
                     /note="Similar to Aspergillus nidulans pkcA"
                     /codon_start=1
                     /product="Serine/threonine protein kinase C-like protein"
                     /protein_id="XP_003666501.1"
                     /db_xref="GeneID:11514035"
                     /db_xref="InterPro:IPR000861"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_98099"
                     /translation="MNDDDKILDITKKIEREKALINAANLMRQQTNNEAVRSKLDTQM
                     REGRRNLEFFEERLRELQMRRLGQSVDNMSIGGSTLGSLRSTEQGTEEGGPPAPPPKD
                     GSSYAQYGQGDLMPPRGPFPGQPPHSGIPKARPNFTKLDLIKFDTPYLGPRIQLMLSQ
                     IQFKLNVEDQYLKGIEKMVQLYQMEGDKKSKADAAARRIESSQKIVLLKQALKRYEEL
                     HIDMDADSADDDSINVPNLRKPLTGQLSIRILAVKDVDHLPLGRFSRAPETFITIKVE
                     DNVVAKTRASRNDKWEAEFHNIFVDKANEVELTVYDKPGEHALPIGLLWVRISDIVEE
                     LRRKRIEAETSSTGWVSADRLGSAPRIPPPQFPMGAQSPQFAGPPTSPGQQPPSFTPQ
                     PPPVAPVVSQPIDAWFNLEPTGQIQLSLNFVKENKAPRPMDAGLNRKGAVRQRKEEVH
                     EMYGHKFVQRQFYNIMRCALCGDFLKYSAGMQCDDCKYTCHTKCYTSVVTKCISKSNA
                     ETDPDEEKINHRIPHRFQPFSNITANWCCHCGYMLPIGKKNSRKCIECNLTAHAQCVH
                     LVPDFCGMSMAVANQILEGIRSTKKTRQEKASSMSERNLRAGSKGTTGSSQSGASYAP
                     SSLSGQTVSPEATEAAKIMYNQTSSPQRAGAERPSTSSTTASAAAAAAMSPKQTPTPQ
                     QQAGQIPDFGPGHYGAPGGYGRPTQQEESQYGAVPQQQQTYAQPQQRKYNPADYANIG
                     VHPGQPPAQARPTQQPVVQQQYMQQQMYQPQQPQQTAMVPKPHPAPAQAEQQVPSASG
                     VPTPARKPLPSATDPGTGQRIGLDHFNFLAVLGKGNFGKVMLAETKRTRKLYAIKVLK
                     KEFIIENDEVESIKSEKRVFLIANRERHPFLTNLHACFQTETRVYFVMEYISGGDLML
                     HIQRGQFGTKRAQFYAAEVCLALKYFHENGVIYRDLKLDNILLTLDGHIKIADYGLCK
                     EDMWYGSTTSTFCGTPEFMAPEILLDKKYGRAVDWWAFGVLIYQMLLQQSPFRGEDED
                     EIYDAILADEPLYPIHMPRDSVSILQKLLTREPELRLGSGPTDAQEVMSQPFFRNINW
                     DDIFHKRVAPPFLPQIKSATDTSNFDSEFTSVTPVLTPVQSVLSQAMQEEFRGFSYTA
                     NFE"
     gene            complement(1908883..1911141)
                     /locus_tag="MYCTH_2310435"
                     /db_xref="GeneID:11506379"
     mRNA            complement(join(1908883..1909459,1909508..1910677,
                     1910754..1911141))
                     /locus_tag="MYCTH_2310435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666006.1"
                     /db_xref="GeneID:11506379"
     CDS             complement(join(1909414..1909459,1909508..1910677,
                     1910754..1910845))
                     /locus_tag="MYCTH_2310435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666054.1"
                     /db_xref="GeneID:11506379"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Spoth2_2310435"
                     /translation="MRSFVRALRPAVRRSQAVCAPRIRQPFAAQCARPLSTTAVRRDA
                     SLADVAPTPITHFSEVETAMAETVQKFANDVILPKVREMDEAEQMDPAIVEQLFEQGL
                     MGVEIPEEYGGAGMNFTAAIVGIEELARVDPSVSVMVDVHNTLVNTAVLKWGSEYLKK
                     KYLPRLATNTVGSFCLSEPVSGSDAFALATKATETENGFKINGSKMWITNSMEAEFFI
                     VFANLDPSKGYRGITAFIVDKGMKGFSIAKKEKKLGIKASSTCVLNFDDVEVPKENLL
                     GERGQGYKYAISLLNEGRIGIGAQMTGLALGAWENAVKYVWNDRKQFGQLVGEFQGMQ
                     HQIAQAYTEISAARALVYNAARKKEAGENFVMDAAMAKLYASQVAGRVSSLAVEWMGG
                     MGFVREGLAEKFFRDSKIGAIYEGTSNIQLNTIAKTLQKQYTA"
     gene            1911349..1912253
                     /locus_tag="MYCTH_2096341"
                     /db_xref="GeneID:11514036"
     mRNA            join(1911349..1911545,1911628..1911921,1912038..1912253)
                     /locus_tag="MYCTH_2096341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666007.1"
                     /db_xref="GeneID:11514036"
     CDS             join(1911408..1911545,1911628..1911921,1912038..1912112)
                     /locus_tag="MYCTH_2096341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666055.1"
                     /db_xref="GeneID:11514036"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="JGIDB:Spoth2_2096341"
                     /translation="MAATFLRNLVLRPALRPVTAAPASPLITRAFSSTPSQSATLNQV
                     LRGCRKPQRARHAVSPALSAIHAPALKGVCVKVGITKPKKPNSGERKTARVRLSTGKV
                     ITAYIPGEGHNIQQHSVVLVRGGRSQDCPGVRYHLVRGALDLGGVGNRMSSRSKYGTK
                     KPKKASVG"
     gene            complement(1912414..1914264)
                     /locus_tag="MYCTH_2310437"
                     /db_xref="GeneID:11514037"
     mRNA            complement(join(1912414..1912677,1912736..1913024,
                     1913094..1913939,1914013..1914264))
                     /locus_tag="MYCTH_2310437"
                     /product="glycosyltransferase family 15 protein"
                     /transcript_id="XM_003666008.1"
                     /db_xref="GeneID:11514037"
     CDS             complement(join(1912610..1912677,1912736..1913024,
                     1913094..1913939,1914013..1914063))
                     /locus_tag="MYCTH_2310437"
                     /note="CAZy_ID 267822"
                     /codon_start=1
                     /product="glycosyltransferase family 15 protein"
                     /protein_id="XP_003666056.1"
                     /db_xref="GeneID:11514037"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="JGIDB:Spoth2_2310437"
                     /translation="MAAGGVRYVRYIIVAFFILTVIYFVSNSADVTNLRTHIPDSKSP
                     SEGGTNSGTQDASPNDAKVKTTYDPAQFLMAMTPNDPGWDDLTSINKGPRMNATFVTL
                     ARNSDVWEIAKSIRQVEDRFNRRYNYDWVFLNDQPFDDTFKKVTTSLVSGKTYYGLIP
                     EEHWSFPDWIDQDKAARVRKEMKEKEIIYGDSISYRHMCRFESGFFFRQELMMNYDYY
                     WRVEPSVELFCDIHYDPFRFMHENNKKYSFTISLYEYPETIPTLWDSVKKFMKNHPEH
                     IASGNSMGFLSDDGGETYNRCHFWSNFEIGNLNWLRSKAYLDYFESLDKDGGFFYERW
                     GDAPVHSIAAALMLPKEEIHFFNDIAYYHVPFTHCPTGENLRTALKCHCKPSDNFDWK
                     GYSCTSRFFEINNMEKPEGWDKEGN"
     gene            1915928..1918898
                     /locus_tag="MYCTH_2310439"
                     /db_xref="GeneID:11514038"
     mRNA            join(1915928..1916009,1916198..1918510,1918562..1918898)
                     /locus_tag="MYCTH_2310439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666009.1"
                     /db_xref="GeneID:11514038"
     CDS             join(1916235..1918510,1918562..1918850)
                     /locus_tag="MYCTH_2310439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666057.1"
                     /db_xref="GeneID:11514038"
                     /db_xref="JGIDB:Spoth2_2310439"
                     /translation="MSFSGFDTSRHNTAAAGFSQAHNPFAGLSNREEEGDALEFEDTY
                     DGLGDQLEETGDAFNDDTFGDAADLSSGPAGKDFDFFGSTAKVANAIEEEHARFSRQQ
                     PAAKSSQPASQAPPHAALQSSSGLSSYSQYSQPAARKPARTGYEKYSSEPVAELQVDA
                     ALWGVAPKKQSQPASTASPAATSASTVPGRKVLSLEEVEAQMRAQAKKAAQQATPSPA
                     PPPAAIPSGPHAQAPPPMHYDQAYQYSHHAPPQLPPQPDHNRSDQTLSHGHGHPVTIL
                     QRPSSKQGASPQPAAQPPAHLRQQPPAPVQPTQILQNPNRLSGDAARLGMRQHPAPTI
                     PGYPSHPAHRHQGSFSRQPQLITHPSQLAQLSEEEKAAYLEQEAKRAKRNHKIFLMSR
                     DNGIMTPQDKSFVTRIQLQQLVAATGNPNEHGTDESLAEDFYYQVHSQIQGGQRQNPN
                     QPLNNFAQTYLFQTGSRQGGMRRQHRGPENHMQRMEQQVQRAVEAAKNKPKNKQLVIE
                     GSLGKISFSNAKTPKPLLNIKRTESTGDAHRPASAHKHAAPTGDRKSELRTIERVYTT
                     LMQMEDHDRNMPPPPANDADTEAIQKFVTWNSEAQILNKHLWESLRIHDHPDNGRVHP
                     FIALLSYSKGMKAMQRISRHLTHEQRTTILTLILVNLDSLEVVRNAQVTSESMQLNAA
                     MRENVELFSLAVMSTLFNILNELDLDLVAGMLGLVCTRNVDVIAKSRIGASMLTMILS
                     RAEIIKHGGGGSEQAWRSWDVTHTQFFDLIEPTLPHMFPGPVTASDDIYVWQLLAALG
                     IGASPEQQQRLVLAVKDRVMDTVALSKTLPQDLAAQRLQNVNLFMRSIGLDVELLQ"
     gene            complement(<1919354..>1920772)
                     /locus_tag="MYCTH_2120781"
                     /db_xref="GeneID:11514039"
     mRNA            complement(join(<1919354..1919533,1919591..1920156,
                     1920268..>1920772))
                     /locus_tag="MYCTH_2120781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666010.1"
                     /db_xref="GeneID:11514039"
     CDS             complement(join(1919354..1919533,1919591..1920156,
                     1920268..1920772))
                     /locus_tag="MYCTH_2120781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666058.1"
                     /db_xref="GeneID:11514039"
                     /db_xref="JGIDB:Spoth2_2120781"
                     /translation="MSSNRPPRAVASDDDDPIIANYSVFIKPPLPENRNLVVLQYVNK
                     TAQDPAQIRVPRISELRVKPKTGMYEVDVPIDTTEAYDRNKGIAWGTALQKSMEAKKG
                     GSLGLAGGFNIVATSTSARGRRGAGAGADDETPLTWAEAARQDKVLRTQTFGGGRSAE
                     EANTRHMIENLHLTPVSSVVHLRPVPHHIDAATEQERLARGGANSAGGSGGPGDKSGT
                     GAGAAGASAGRAIHMTIKSAMDADGGAATETMADRLRNVQTETWQRMEWVHDEAEMAW
                     EAYNECLLLRPGNGGGGAAAAAAAEGEAAEDKGKGKEVAGAAEAAAAAAAATSADESG
                     AADLVDKVPWLKTDWEEQELLRAGKETAVKMEEPAAAESRRQVGRTGGSANAASTAST
                     VAAASGARKTTRKGASRGTAMEID"
     gene            complement(1921080..1921153)
                     /locus_tag="MYCTH_t177"
                     /db_xref="GeneID:11514118"
     tRNA            complement(1921080..1921153)
                     /locus_tag="MYCTH_t177"
                     /product="tRNA-Val"
                     /note="Anticodon: AAC"
                     /anticodon=(pos:complement(1921117..1921119),aa:Val,
                     seq:aac)
                     /db_xref="GeneID:11514118"
     gene            1922843..1925091
                     /locus_tag="MYCTH_74573"
                     /db_xref="GeneID:11506394"
     mRNA            join(1922843..1923128,1923205..1923241,1923315..1923385,
                     1923475..1923731,1923834..1923950,1924092..1925091)
                     /locus_tag="MYCTH_74573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666011.1"
                     /db_xref="GeneID:11506394"
     CDS             join(1922922..1923128,1923205..1923241,1923315..1923385,
                     1923475..1923731,1923834..1923950,1924092..1924710)
                     /locus_tag="MYCTH_74573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666059.1"
                     /db_xref="GeneID:11506394"
                     /db_xref="JGIDB:Spoth2_74573"
                     /translation="MSSGTSGGPGGPPGPSTADLPHNSHGPNILAACFVTWTIALIFV
                     LLRFWTRTKIVRLLGPADWCIASSLVVAAGLCASYVVQVNLALGKHVWDVDLRTDYVP
                     MMQAWWFSLLLYIITLSLTKISICLLYLKIFTFESARRASWLVLFIVVITSLWAVAIT
                     LTYCIPLQATWDPTVVASFCQPQSAWWANTGIVIATDLIIFILPIPIVAPLNLPRRQK
                     LVVVGVFTIGFFVCIVSLVRLVILIQAKGSTDPDFTYTPAALSYLTALEVHTAIVVSC
                     AMTLRPLVDRFFPGLLAPAGGIGGGGGAGSGQSSTAGGVSMRGGGRHQQPPLTVGSRP
                     SRRNPLRSWTGTAHEDEAAAAAVVVLEDAAGGNEGTAEGGGQRGGQRGSEDRDLENGM
                     AQLPGGETTLAPHEASASPWLKSDASSERTEDMGVEAKARSLN"
     gene            complement(1926062..1927461)
                     /locus_tag="MYCTH_2316262"
                     /db_xref="GeneID:11514119"
     mRNA            complement(1926062..1927461)
                     /locus_tag="MYCTH_2316262"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666012.1"
                     /db_xref="GeneID:11514119"
     CDS             complement(1926347..1927294)
                     /locus_tag="MYCTH_2316262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666060.1"
                     /db_xref="GeneID:11514119"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="JGIDB:Spoth2_2316262"
                     /translation="MAVNLHPGTNGTNGTANDDFTVKAGLAQMLKGGVIMDVTSAAEA
                     RIAEEAGAVAVMALERIPSDIRKMGGVARMSNPKMIQEIQAAVTIPVMAKARIGHVVE
                     CQILEELGVDYIDESEVLTPADDKYHVQKSEFKIPFVCGCRNLGEALRRIKEGAAMIR
                     TKGEAGTGDIVEAVKHIRTVNAEIARAKAALAAEGDLGIAAMAREIGCDAALLKQTAE
                     LGRLPVVNFAAGGVATPADAALMMHLGCDGVFVGSGIFKDAETPEHAARRARAIVKAT
                     AQYKDKKALIEASIEHGEAMKGISNAGLKPEEKMAGRGW"
     gene            1928290..1929548
                     /locus_tag="MYCTH_2310453"
                     /db_xref="GeneID:11514120"
     mRNA            join(1928290..1928765,1928869..1929548)
                     /locus_tag="MYCTH_2310453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666013.1"
                     /db_xref="GeneID:11514120"
     CDS             join(1928512..1928765,1928869..1929409)
                     /locus_tag="MYCTH_2310453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666061.1"
                     /db_xref="GeneID:11514120"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="JGIDB:Spoth2_2310453"
                     /translation="MAKSSTITVGVLALQGGVVEHINLLRKASSHIQSPDALQFNFLQ
                     VRTSAELSQCDALIIPGGESTTMAIVARRLGLLDPLREFVKVQHKPVWGTCAGLIMLS
                     EQAAATKQGGQELVGGLDVRVLRNRYGTQLQSFVAELDLAFLGEGAAPFKAVFIRAPV
                     VERVIASEEKEQEQEEEGEAGSVASQGKGQGKGAPVEVLGVYRGQGKQEEAGEEGDIV
                     AVRQGNVFGTSFHPELTDDVRIHVWWLRQVVDATRHGSLPVVADGV"
     gene            complement(1929549..1931289)
                     /locus_tag="MYCTH_2310455"
                     /db_xref="GeneID:11514121"
     mRNA            complement(join(1929549..1930892,1931044..1931123,
                     1931208..1931289))
                     /locus_tag="MYCTH_2310455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666014.1"
                     /db_xref="GeneID:11514121"
     CDS             complement(1929688..1930824)
                     /locus_tag="MYCTH_2310455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666062.1"
                     /db_xref="GeneID:11514121"
                     /db_xref="JGIDB:Spoth2_2310455"
                     /translation="MKQKTPDPMTNPDSRWVEVRHALGRLLSYFIAIKVFIAARRLWP
                     RLFVDFEVTWIPSSEPLDDPPNIRRNAEGIIKRMTCDKSLLEAYHGYAAHLQSHKLDE
                     RIRKHVQSGKFTPIVHAEVNLLESVLASRADAERSGEGPLRFFHEAEFGAYIGTSKPT
                     CLLCRLYFDAHPAGVLCRESHGNLYHNWRAPDVRKADGSEPERLRREILEAMVKKVRK
                     ETEHAICQRSSFRKNHDSRNTPTNPLWGTTDIESQGRAENGIDRASRAGQIVRESASV
                     TSRRAIRASASESWSTAVGVEELTSTVGQISLDGRSTRVRNNDDSRETTPERPELSTP
                     TGQEKDDSRETTPVAPEPSTRTGQNKDDDDDDDDDDDNDGGARL"
     gene            1932904..1933644
                     /locus_tag="MYCTH_2310457"
                     /db_xref="GeneID:11514122"
     mRNA            join(1932904..1933032,1933098..1933644)
                     /locus_tag="MYCTH_2310457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666015.1"
                     /db_xref="GeneID:11514122"
     CDS             join(1933013..1933032,1933098..1933554)
                     /locus_tag="MYCTH_2310457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666063.1"
                     /db_xref="GeneID:11514122"
                     /db_xref="JGIDB:Spoth2_2310457"
                     /translation="MTQKVSSDSWASPRLPPDDGDWGSAEIGLPFPLGQETSLSSWPL
                     ISRQDGQCLASLVLPVIEETVDPQHLLVLPGSSGLELSFPPNDLAVGVPTPFSGGVQE
                     YSYQGVSEPPMFGFEAQGSPLNTNPEIATWSPAENSLPDANMLSVALPTVSHALDI"
     gene            1934071..1934730
                     /locus_tag="MYCTH_2310459"
                     /db_xref="GeneID:11514123"
     mRNA            1934071..1934730
                     /locus_tag="MYCTH_2310459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666016.1"
                     /db_xref="GeneID:11514123"
     CDS             1934120..1934353
                     /locus_tag="MYCTH_2310459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666064.1"
                     /db_xref="GeneID:11514123"
                     /db_xref="JGIDB:Spoth2_2310459"
                     /translation="MKKHGRQTCPYCHDSINAFHKALERHLRSHHSDLADVRANPKVW
                     KEEVLCEGCGRRMRADNRKRHLKTCKGMRYEQT"
     gene            complement(1935074..1936333)
                     /locus_tag="MYCTH_2310460"
                     /db_xref="GeneID:11514124"
     mRNA            complement(1935074..1936333)
                     /locus_tag="MYCTH_2310460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666017.1"
                     /db_xref="GeneID:11514124"
     CDS             complement(1935197..1936258)
                     /locus_tag="MYCTH_2310460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666065.1"
                     /db_xref="GeneID:11514124"
                     /db_xref="JGIDB:Spoth2_2310460"
                     /translation="MAQQGQHHVQMQQMQYTMHQLAPAQHPVPGHVQQPPMQQPPQQQ
                     IQAPMTSQPPQQQPQQPQQPQQPQQPQQPQQLQPPQQPQGQQQQGQQQQQQQQQQQQQ
                     QQPQRPSFQMALLPPPQDRLYNTWEDLREDVKAFAKSQGYAVVIVSSLNRDADGQYRR
                     YNLCCAKGGKNYTSHSKGLRNTRSAKTGCPMRMKAIQEKAYPYNDKWHVIVQCAEHNH
                     EPFTGGPGANAPSQFRKIEADGMRWLMIMHREAQCNLRQLTIGIRISFGDKYQYVKKS
                     DVRNMLAKIKREEEKKAAAAAAAQGLPTNAPYTLIPPSHLPPPPAPPAQPVERMPQLP
                     PEMQVPDPDMESDDDGDEL"
     gene            complement(1937179..1938917)
                     /locus_tag="MYCTH_2310461"
                     /db_xref="GeneID:11514125"
     mRNA            complement(1937179..1938917)
                     /locus_tag="MYCTH_2310461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666018.1"
                     /db_xref="GeneID:11514125"
     CDS             complement(1937190..1938713)
                     /locus_tag="MYCTH_2310461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666066.1"
                     /db_xref="GeneID:11514125"
                     /db_xref="JGIDB:Spoth2_2310461"
                     /translation="MLVIRFFWLQAVLATAQLVDSDGVLGGGGDSAPSSVEEQSPVGT
                     NSPGGILDGVVDKVGGAADKLLSPILDPIVGPTGLFGDDDDAATSTTPAETQDLPPVT
                     SVESSAADPEPTSELATEPTSEATNETTTQPTTREPAPTSQQQPPASSERPSPLPGTE
                     EQQQPTADPAPVPKPDISTVSEAPPSPTTSAAEAPAPSSSVAGVIRISQPVDSPAGTS
                     SAPVGQSPTRAPAPGPTSSRAASQPAASSPPPGDREPVSTLVTTSGTTFLSVFVPPTP
                     TGRLAVIGDTGEPLPTLDLSGQSPSSPEGDGSSDDKSPATAEDETAAGSGGSPTESGT
                     TGGTGGKGIESSSSSSSSSSDGLPLKTKIGIGVGAGAGSIAIAVTATLILWKIRMGRR
                     PASSSSSEDRERGASPTPQEKAKMDFESEHDVAFDFGFLRDRAAATAPPVNATGGGVA
                     TGAPGVGRKLTVVNKGEDEWLSTIDTPRQQQQQQFVAELDGGEVPGYYNRGAIGVGR"
     gene            1941065..1941155
                     /locus_tag="MYCTH_t169"
                     /db_xref="GeneID:11514126"
     tRNA            1941065..1941155
                     /locus_tag="MYCTH_t169"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:1941097..1941099,aa:Pro,seq:agg)
                     /db_xref="GeneID:11514126"
     gene            complement(1941504..1942508)
                     /locus_tag="MYCTH_2310462"
                     /db_xref="GeneID:11506386"
     mRNA            complement(join(1941504..1941860,1941979..1942083,
                     1942196..1942508))
                     /locus_tag="MYCTH_2310462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666019.1"
                     /db_xref="GeneID:11506386"
     CDS             complement(join(1941617..1941860,1941979..1942083,
                     1942196..1942218))
                     /locus_tag="MYCTH_2310462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666067.1"
                     /db_xref="GeneID:11506386"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Spoth2_2310462"
                     /translation="MTVHNIETVDQFKETIAKHPVVLLDAFATWCGPCKAIAPQIAKW
                     SEDPEFSDSIYFAKFDVDQLPDLAQELGIRAMPTFLVFKDGEKADSFTGAVPPQLLNL
                     IKKHNPKSSEAADKTEPPKAE"
     gene            complement(1942765..1944617)
                     /locus_tag="MYCTH_2310464"
                     /db_xref="GeneID:11514127"
     mRNA            complement(join(1942765..1943712,1943818..1944037,
                     1944112..1944617))
                     /locus_tag="MYCTH_2310464"
                     /product="carbohydrate-binding WSC domain protein"
                     /transcript_id="XM_003666020.1"
                     /db_xref="GeneID:11514127"
     CDS             complement(join(1943156..1943712,1943818..1944037,
                     1944112..1944399))
                     /locus_tag="MYCTH_2310464"
                     /codon_start=1
                     /product="carbohydrate-binding WSC domain protein"
                     /protein_id="XP_003666068.1"
                     /db_xref="GeneID:11514127"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Spoth2_2310464"
                     /translation="MAPSTIAALLVGAAVSSACTIPTEPLGNNITYPFRAQVQNASRP
                     EVHNKYMNLFEAGGGDRHLFIGPVGVPTYDLTLVAGVINHVPNGVRAVIGGEYSEIDH
                     TTKMFMTGRDDPRAIFQPTYACNPVTDGLQIELRFVTWQGQPEGGHICVRSSFDGSHE
                     FRYSPPGNRLIDVNRECIKVTLVVMPTTDLPPPGTSTTLSTSTTSARPTSTSSSTATS
                     TSTPTGLPTPAPFTDLTDLGFRFVGCAPEERWTDDGAFRTLPDATESSDDMTNQRCVA
                     FCAERGFRYAGTEWRRECWCGDEVAPTRRPATTLESLARCDDGYLCTGDPAQNCGGDA
                     WLSLYERCEEGEACENEVFT"
     gene            complement(1945385..1946807)
                     /locus_tag="MYCTH_2310466"
                     /db_xref="GeneID:11514128"
     mRNA            complement(1945385..1946807)
                     /locus_tag="MYCTH_2310466"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666021.1"
                     /db_xref="GeneID:11514128"
     CDS             complement(1945577..1946452)
                     /locus_tag="MYCTH_2310466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666069.1"
                     /db_xref="GeneID:11514128"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="JGIDB:Spoth2_2310466"
                     /translation="MAERAEDADDIPQPESAPPTTDQQQQQQHDSPPPKAPAKRNAFE
                     ELMAPKPKAPISQAPQFLAHKASQVIRGVWRGALIEYIEHPERFPDKVLRVTADTVLI
                     KDAFPKATVHLLLLPRSPAHYLVHPHDAFADPAFLAMMRGEAAVAAELAAAELARRLG
                     SFSASNRARDEAMSRGVGPDQLPPGRDYSRDIRVGTHAHPSMAHLHVHVISRDMRSEK
                     LKHRKHYNSFNTPFFVPLEDHPLAQDDVRRQTGYQNGNLAKDLVCWRCGKGFGNRFAE
                     LKRHLEDEFEKWRAE"
     gene            complement(1948210..1950894)
                     /locus_tag="MYCTH_2310467"
                     /db_xref="GeneID:11514129"
     mRNA            complement(1948210..1950894)
                     /locus_tag="MYCTH_2310467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666022.1"
                     /db_xref="GeneID:11514129"
     CDS             complement(1948432..1950789)
                     /locus_tag="MYCTH_2310467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666070.1"
                     /db_xref="GeneID:11514129"
                     /db_xref="JGIDB:Spoth2_2310467"
                     /translation="MPLWLFRRKSHRRRGRVSSIEDDGYGGKTPAAGLPPRSQTVPEM
                     AMTYDPSPPERQANKRQRTESNKLHRRARSYSFSPGREDAVGLEKQKSTRARRDGDTP
                     MRDAPTAMDIMPWRAPTLHGKRDGDHLPRKLSSKKRRKEDRQREAEIKAMSSFAPHRP
                     AAEDWMAGRPMRKESKKFRSGFGVSIKGPDVERYSRSSDISLPLPESIDSALSSDSDY
                     ISYEVSAFESLAPRPTLRYSTHARSGNYTQDGAGVVRRPSPQRTRLTESIPEEMLKAH
                     KRVDSLADELSAGDLRELMERDQRRRARKRQLEQKKLELKIARQAEKQRAAEAEAEKH
                     GRESPPNLSRGILGREDIGLGINPPSATITSSRLRNSDGLADNRNEAGDVGNILPTRE
                     NDRPEPLAAFHRVDSHSLQPLESLSEIKEDAPVLASTVSKASLRNTISRSKSPQESEA
                     RTEQSEQPSRGSSGNTAKGPRSWTSFFRWTNRTKRNSGGPSSFSNTSRDSMPTPPAPA
                     PPINPLPRRLTSGVPKRTTSRFREDLPELPMSPPASRLQSPEAAAVPSPIKVSTNVPP
                     PNGESCPSPPASRPRHDTPVSTRPSVEEMRETPSTFSRPDEPGVSPEPQSMSLASIDS
                     EGSWFAGGLAKKRKSSGIPEHGSGLRRSRYAPQELNGEQRPEIENPNDDMDITDDDYL
                     SRLTPSHGDRSAWNRKSTGEARPSSDWGEEDAHWGSVEGHLPTVVRSQAASRVKSREG
                     LLRSFGEEGEATSQQMDAEEHRDSSDDVTLQRATSIGHEEEHASH"
     gene            1954055..1955755
                     /locus_tag="MYCTH_2310469"
                     /db_xref="GeneID:11514130"
     mRNA            join(1954055..1955461,1955516..1955755)
                     /locus_tag="MYCTH_2310469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666023.1"
                     /db_xref="GeneID:11514130"
     CDS             join(1954211..1955461,1955516..1955629)
                     /locus_tag="MYCTH_2310469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666071.1"
                     /db_xref="GeneID:11514130"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="JGIDB:Spoth2_2310469"
                     /translation="MPAAQQQSRSRKKEEEAAYANMRLPDREIVGCINELGIPFTVAD
                     LQKPNPIQVQMIFEWFGELLMNKTRQTVDPAMRAAAEDICGDFGDSLMPPDTRNLMGF
                     FISLRQLMLDCGVHDFNFMDLYKPTHHRLVKIFSYVINFVRFRESQTSVIDEHCNRAE
                     STKARIEQLYAENQNLEAQLDEMRANRRQMEALVAEKTRRNEELKKKLLELRRTQEKV
                     AARLEEAKTKKGELAAELEEKTAAKLALKQESAKLRPYTLQSPSALQASLTELSNTLN
                     NDKAHIDSLDRRARALQTSSDSFAVVSSDVASCIKLLEEIAVELAKEEEDNAKNAKQR
                     DALTERGASVREVERTEALLQRQLAKWTERTETLRAQSQEKAQRAKEKMEELRAVHKT
                     LTEERSEKGKDIERRRVRIEQIEKKMLDLKENIENEVHAAHDEYLKLEAHIKLYITEM
                     EQAI"
     gene            complement(1955756..1957199)
                     /locus_tag="MYCTH_2310470"
                     /db_xref="GeneID:11514131"
     mRNA            complement(1955756..1957199)
                     /locus_tag="MYCTH_2310470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666024.1"
                     /db_xref="GeneID:11514131"
     CDS             complement(1955881..1956873)
                     /locus_tag="MYCTH_2310470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666072.1"
                     /db_xref="GeneID:11514131"
                     /db_xref="JGIDB:Spoth2_2310470"
                     /translation="MDDNYVHSHSTPLFLSPVLPSDLIQFIINRCRYPTTLIICGNRG
                     EFLSALTHNIFQEQQQQQQQRHGGGTLPLGEPHDATAQQATTAGPPPNLDPAPTGRPH
                     AVPPQPAADRPATPPSHAHANPTTTAPRKPHPLLTPHLAQLSTARHIRTVFVPTVSHL
                     RAFLSVFTVDSSLTSGKAPVAPPPPPPQPSPAARRALLVVYNLLGIHRNTSEWSVQGL
                     GTSCAALVEAGVREGLAVVVVEGPIGFGEGAGVADGRDGDEEVDHGDAGPRKGVSLGL
                     DGVLRESVPVLGGRGKRVGGELERRGGWAGKTVDVARVLGRWFQFREGEWMARG"
     gene            1957387..1960293
                     /locus_tag="MYCTH_2310471"
                     /db_xref="GeneID:11514132"
     mRNA            join(1957387..1957720,1957783..1960293)
                     /locus_tag="MYCTH_2310471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666025.1"
                     /db_xref="GeneID:11514132"
     CDS             1957786..1960032
                     /locus_tag="MYCTH_2310471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666073.1"
                     /db_xref="GeneID:11514132"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Spoth2_2310471"
                     /translation="MYRGQKTLPLFSSVVKNVASPNIEIKKLVYIYLIHHAEQEPDLA
                     LLSINTIQKSLSDTNPQVRALALRTMSGIRVPVISQIVSLAIRKGAGDMSPYVRRAAA
                     LAIPKCYRLDPSQLPQLLEYLSTLLGDKQYYVAGAAVTAFMTVCPDRIDLIHKHYRNL
                     VRMLVDMDEWSQLSTLRLMTVYARKCFPRRTRTVKNKERPAELQDFYGEASEAGPERE
                     QVTVLDPDLELLLKSIKPLLQSRNSGVVVAVARCYSAIGTPSYTKAAIGPLVALLRGA
                     QDIQQVALYNIVSICLSCPADFVKYATHFLVRATDTQPVWELKLEVLTLIFPHAPRHI
                     KSLILNELEHFSRGSDKLLVREAVRAIGRCAQADSATAPRCLRLLLSQITSLDGILAA
                     ESLTVIRHLIQQDPTAHVATVIRLAKNLDSATDPQARATIIWLVGEFSGLGGADNIAA
                     DVLRILLKDFASEPEIAKRQIVLLGAKVYLHYVNRQIEESQAGRPQFPQPQAEFDQGQ
                     EPFQPSPPATGSNRPKILEEDDHPIAKLWRYLLLLVRYDTSYDLRDRTRLYKSLLSVP
                     QLATLMLLAPKPAPQAPSPSETRRGYTLGSAALVLAGGGGVHGLRGYEDLPEWVEEGK
                     EPDPRLRDAEGADRYGEKRVVPAAEVLDAAAASRASPSSVGAESKAVKAANGIGEKSL
                     DDWLAEEESDEEDSGSVEGEEEEEEEEEDDDDDENEEEESDEESSDEEEDESEEESEE
                     NAKLIRPA"
     gene            complement(<1960734..>1960886)
                     /locus_tag="MYCTH_2068390"
                     /db_xref="GeneID:11514133"
     mRNA            complement(<1960734..>1960886)
                     /locus_tag="MYCTH_2068390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666026.1"
                     /db_xref="GeneID:11514133"
     CDS             complement(1960734..>1960886)
                     /locus_tag="MYCTH_2068390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666074.1"
                     /db_xref="GeneID:11514133"
                     /db_xref="JGIDB:Spoth2_2068390"
                     /translation="KTYNTGASPVVTDLSTNPAISSLTMGERTGSRIFYCLWSYVIVR
                     SIGSAF"
     gene            complement(<1961243..>1961443)
                     /locus_tag="MYCTH_38980"
                     /db_xref="GeneID:11514134"
     mRNA            complement(<1961243..>1961443)
                     /locus_tag="MYCTH_38980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666027.1"
                     /db_xref="GeneID:11514134"
     CDS             complement(1961243..>1961443)
                     /locus_tag="MYCTH_38980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666075.1"
                     /db_xref="GeneID:11514134"
                     /db_xref="JGIDB:Spoth2_38980"
                     /translation="VMQTEDVDVKRPTGAYGIDSLVAVELRNWFSRDARVEVPVFEIL
                     QASSLAGVAKAVARKSPLLKIS"
     gene            <1961581..>1961769
                     /locus_tag="MYCTH_98083"
                     /db_xref="GeneID:11514135"
     mRNA            <1961581..>1961769
                     /locus_tag="MYCTH_98083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666028.1"
                     /db_xref="GeneID:11514135"
     CDS             1961581..1961769
                     /locus_tag="MYCTH_98083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666076.1"
                     /db_xref="GeneID:11514135"
                     /db_xref="JGIDB:Spoth2_98083"
                     /translation="MAISNMASISSSLMSSMPSLTRFCGKERKLESFEDITAKAALKV
                     TKVSQTPFGLGWAGLFIE"
     gene            complement(1962464..1963135)
                     /locus_tag="MYCTH_2310474"
                     /db_xref="GeneID:11514136"
     mRNA            complement(1962464..1963135)
                     /locus_tag="MYCTH_2310474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666029.1"
                     /db_xref="GeneID:11514136"
     CDS             complement(1962604..1962789)
                     /locus_tag="MYCTH_2310474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666077.1"
                     /db_xref="GeneID:11514136"
                     /db_xref="JGIDB:Spoth2_2310474"
                     /translation="MSPTSSLVYSLLVPKPQPPPYNRLAKLTMTVEVETVALQPDKAT
                     PAPPSVGAGEGGRVKRG"
     gene            <2044212..>2044679
                     /locus_tag="MYCTH_2129970"
                     /db_xref="GeneID:11514137"
     mRNA            join(<2044212..2044293,2044423..>2044679)
                     /locus_tag="MYCTH_2129970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666030.1"
                     /db_xref="GeneID:11514137"
     CDS             join(2044212..2044293,2044423..2044679)
                     /locus_tag="MYCTH_2129970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666078.1"
                     /db_xref="GeneID:11514137"
                     /db_xref="JGIDB:Spoth2_2129970"
                     /translation="MVQNGGDFDLDIDMATDVTAEQLLTQLALETAKASRIKIEPPSK
                     YGGTKEDLVGFLINLRSYFWLNNDKFLDDKAKVLYAAIRLEGKVLRWFEPTWNDYLTE
                     EDEDDRDAFT"
     gene            complement(2085511..2088076)
                     /locus_tag="MYCTH_2310477"
                     /db_xref="GeneID:11514138"
     mRNA            complement(join(2085511..2085644,2085707..2088076))
                     /locus_tag="MYCTH_2310477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666031.1"
                     /db_xref="GeneID:11514138"
     CDS             complement(join(2085632..2085644,2085707..2087850))
                     /locus_tag="MYCTH_2310477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666079.1"
                     /db_xref="GeneID:11514138"
                     /db_xref="JGIDB:Spoth2_2310477"
                     /translation="MSRGLQRWQQHKEHGNNERRGSSRDKKKGPIVIHYPPPPPPLSH
                     IAPGAPYGPSAAPPFPPGAPPAPPPPPSQSYQQPNYPPNPYVGGYQPPPPPAQYGQYP
                     APPPPPPPSYTPQPQYGQPAYPPSYPQAPGYYPPGAAPPSAPPPPSYPPGTYPPHQSG
                     QPPPPPPSTPYPPHYPTPPPPGPYHFAPGQPPPYGPPAPTGHQYSPPPSWSSAHAGPS
                     PPSSRSANQTPLGSHRGRSLKSHGSKKSHQHREQNRHGHEKHGKGKSRNERRGHQASR
                     DEQQTKTDDSRSKPEGNEPKVQDNEEQAGEGSLEDTSGWDPRLKEEFKQAFPDIKTKP
                     ADPVGIPLPLEYTDEPTIPPAYNATCVKSEFFREDNQKDFGRSIREHPSWATLKNDPV
                     FRHYQGMVMRCFPGSEHEYPSYDPPDAPPSPSSIKMPPRFRFDRSAIRTKQDRPEGHP
                     ADNHDDHIRPQSPPDRRRRDSGRDWYDGDGRRPRKRSFDAGYDRDNGEPDPKRARRWS
                     LHRRDWSREDHGRANVARRRSPSPPRCNLEGDPWSPRAGDTNFRASNDRRYHEVHKTT
                     KYSPPRDERISYSDRRHDSGYQSGHSIEKDTARYQDGEWRRRSSDRSYQRRTSPSRGR
                     DRSRSRSRGRSQRRSHSRSHSRGRYRSLSRGHSRGRSRASTPSRSDRNRSESPLTALE
                     ADLLGLARDSSEPETKPVAKKPVKRVQVAAAFGRRW"
     gene            2089985..2091620
                     /locus_tag="MYCTH_2310483"
                     /db_xref="GeneID:11514139"
     mRNA            join(2089985..2090092,2090255..2090488,2090567..2090821,
                     2090903..2091620)
                     /locus_tag="MYCTH_2310483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666032.1"
                     /db_xref="GeneID:11514139"
     CDS             join(2090077..2090092,2090255..2090488,2090567..2090821,
                     2090903..2091366)
                     /locus_tag="MYCTH_2310483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666080.1"
                     /db_xref="GeneID:11514139"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2310483"
                     /translation="MPGLPSSVDLDECISRLYKKELLAESVIEAICAKTKELLMRESN
                     VVHVRAPVTVVGDIHGQFYDLIEIFKIGGWCPDTNYLFLGDYVDRGMFSVETISLLVC
                     LKLRYPNRVHLIRGNHESRGVTQSYGFYTECARKYGNANVWHYFTDMFDFLTLSVVIN
                     DQIFCVHGGLSPSIHSIDQIKIIDRFREIPHEGPMADLVWSDPDPERDEFSLSPRGAG
                     YTFGAQVVKKFLAVNNMNHILRAHQLCQEGFQVLYDDRLSTVWSAPNYCYRCGNMASV
                     LEVSDTGERFFNVFAAAPENDQVKDAQQSGGGEKGADGGALPDYFL"
     gene            complement(2091856..2093585)
                     /locus_tag="MYCTH_2310488"
                     /db_xref="GeneID:11514140"
     mRNA            complement(join(2091856..2092117,2092181..2092229,
                     2092289..2092614,2093315..2093585))
                     /locus_tag="MYCTH_2310488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666033.1"
                     /db_xref="GeneID:11514140"
     CDS             complement(join(2091987..2092117,2092181..2092229,
                     2092289..2092614,2093315..2093408))
                     /locus_tag="MYCTH_2310488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666081.1"
                     /db_xref="GeneID:11514140"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="JGIDB:Spoth2_2310488"
                     /translation="MTSADEDLMPESTSGYKLSQPKQSLAEYNKMDENDESLQRYKRS
                     LGLAEKDLSDPNDPRVCIIQSLTMESPGRDPVVIDLTAPGSLENLKKQPFKIKEGATF
                     TMSAQFKVQHEILSGLHYVQVIKRKGIRIPGGKTSEMIGSYAPNTEKQPIYTKKFAEE
                     TAPSGWAVRGRYDVSSSFVDDDKKTHLQFDWTFEIDKDW"
     gene            2094997..2097277
                     /locus_tag="MYCTH_2135627"
                     /db_xref="GeneID:11514141"
     mRNA            join(2094997..2095361,2095422..2096637,2096700..2097277)
                     /locus_tag="MYCTH_2135627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666034.1"
                     /db_xref="GeneID:11514141"
     CDS             join(2095298..2095361,2095422..2096637,2096700..2096745)
                     /locus_tag="MYCTH_2135627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666082.1"
                     /db_xref="GeneID:11514141"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="JGIDB:Spoth2_2135627"
                     /translation="MAPNRHLPERHNPLLLEDVPPHSELVARRRLGQTQLTARMVAGV
                     PAGDIHPSALGAFDYAHLRAPLPKGIVSGIFKSSPPSYFLMRRSEDGYVSATGMFKAT
                     FPYATQEEEEAERKYIKSLPSTSPEETAGNVWIPPEQALILAEEYQILPWIRALLDPA
                     DIATTTGADSGPPKKITAPPKFFSGQPTLAPPTPSTSRTSRSRRSASPAKSTASKRAI
                     ASPRKRRGASSQPSVVTDSLPSSTGDSVSPTLVNGETPNQSQLSTASTSKVAKVEEAP
                     EAELKIESIEKEPAVVLEPVEEGPKVKIHLDQDVKVDKEGDEVKHTKVELEVPLFGEL
                     PSPEDAAKMVADAKAMVEAAVKADNEASGASSSKGKRKADDIAQDEDGEGKEEGGAEP
                     PKSKKVKTEAELRKEKIRKRAYFGLTATVAVGAIGALVPILTPYVMNAL"
     gene            2097543..2099329
                     /locus_tag="MYCTH_2310492"
                     /db_xref="GeneID:11514142"
     mRNA            join(2097543..2097987,2098057..2098230,2098463..2099329)
                     /locus_tag="MYCTH_2310492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666035.1"
                     /db_xref="GeneID:11514142"
     CDS             join(2097877..2097987,2098057..2098230,2098463..2099218)
                     /locus_tag="MYCTH_2310492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666083.1"
                     /db_xref="GeneID:11514142"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="JGIDB:Spoth2_2310492"
                     /translation="MKPAVRLWKPVLRAQRRAFSSSARRLDNYAFIGLGQMGYQMARN
                     LQAKLPPSDTIRVFDINKSAADKLVQEMAAQQAGGAAPEVAHSAADAARDADTLITCL
                     PEPKHVKSTYDAIISAFQTEPKRDKSSQSKSRLFIDCSTIDPTSSREVANAVSSAFPN
                     GEGVFVDAPMSGGVVGATAGTLTFMLGAPQSLLGRVEPILLRMGKRVLHCGPQGAGLS
                     AKLANNYLLAIENIATAEAMNLGVKWGLDPKVLASVINVSTGRCWPSEVNNPVPGVVE
                     TAPAGRDYAGGFGIGLMRKDLRLAILAAKEAGAELPLASKASEVYEAAESDEKCKGRD
                     FSVVYRWLGGKE"
     gene            <2100277..>2101773
                     /locus_tag="MYCTH_37869"
                     /db_xref="GeneID:11514143"
     mRNA            join(<2100277..2100550,2100745..2101123,2101186..2101305,
                     2101367..2101441,2101512..>2101773)
                     /locus_tag="MYCTH_37869"
                     /product="RTA-like protein"
                     /transcript_id="XM_003666036.1"
                     /db_xref="GeneID:11514143"
     CDS             join(2100277..2100550,2100745..2101123,2101186..2101305,
                     2101367..2101441,2101512..2101773)
                     /locus_tag="MYCTH_37869"
                     /codon_start=1
                     /product="RTA-like protein"
                     /protein_id="XP_003666084.1"
                     /db_xref="GeneID:11514143"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="JGIDB:Spoth2_37869"
                     /translation="MDKVDPSMFPSDWDQEDIENAIANYYYSCTHVTPTCPVRATTLG
                     YYPNRGINIFFTIGYAAATVMTLALGLKKKTWSYTGFIAAGCALELAGYGARIPLTDN
                     PWNKNAFETQIVAIILAPTLICISIYLTLKHICLAFNPALSRVRPHKYPFIFVPLDVS
                     CLLVQAIGGSLAASAALSNYKLVQHGNRCIIAGIVLQVVVLSFFGVSAGDYFVRVKRW
                     IKSTEASPEAIALWQDKKLRTFVYAVTAAYSGILIRCIYRIAEMAGGWGNPIMQDEPS
                     FIVLEGFMVLIPCILLAVFAPGYLFPQMASRMSTPGRVRLFSKRESEKPPQPKVLAGQ
                     QQAVNGTETVLNQEQTKEQPISTSTTVEPKGAESV"
     gene            2102088..2103256
                     /locus_tag="MYCTH_2310501"
                     /db_xref="GeneID:11514144"
     mRNA            join(2102088..2102325,2102419..2103256)
                     /locus_tag="MYCTH_2310501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666037.1"
                     /db_xref="GeneID:11514144"
     CDS             join(2102324..2102325,2102419..2102998)
                     /locus_tag="MYCTH_2310501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666085.1"
                     /db_xref="GeneID:11514144"
                     /db_xref="JGIDB:Spoth2_2310501"
                     /translation="MFGCLSITTFFSFWKEKKNNTGDHRPKNEKQKEPAYTPITMTNQ
                     FDHPSPYPPLRGAVRPVSYAHQYYRVCPYGRRRRSHVPPPRSPRSRLPPQREGDEEEE
                     KPEKPTGNPSEKDYELQGVHGRDFQAEADAMKKTKEEEMVVEKEEEERKRQAMLAWMS
                     AESETEDSESESGEGTSKKKKGLVTFAAWVMEG"
     gene            2104748..2109616
                     /locus_tag="MYCTH_2310503"
                     /db_xref="GeneID:11514145"
     mRNA            2104748..2109616
                     /locus_tag="MYCTH_2310503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666038.1"
                     /db_xref="GeneID:11514145"
     CDS             2104980..2109563
                     /locus_tag="MYCTH_2310503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666086.1"
                     /db_xref="GeneID:11514145"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="JGIDB:Spoth2_2310503"
                     /translation="MVRVTEELALSPEHVTLYYASDPLLGHLPVLIFHGPSTTANYTH
                     NSSRIQVHIYSPAGYQSFPRITVSPNSPFYSVVAHLPREFQGDEVCRGLAFGLYKYFT
                     ELPEVVKNHLKNQYPITQARRPSSAPALFGEQHAADLAKAAVQAENTAEAIGILEYAL
                     RAQHLSGVDMDLVLPPGSIVPLENADFEDVADDEDDVFDPTLRQYGGYAPLVKLFGEP
                     VFLPTSKLRRAPSRPMSLKRNKSFSKNQKVELRMKMGELVDTEERYVLKLNELVKNVA
                     NDFREKAKERPAGSTSPCEEDLEKLFPKSADSILENNTAFMQELRRVMDETEEEAVKD
                     MEAPFPVTRLGSPNKVKDPTGAVAMAKVFLEWFPKFTDCYQDYIRASQNFPQLLNAFL
                     DKQSSFRQRVVQTGEQTIRSLLIEPVQRLPRYSLFIDQIVACLPMTHPALQPLLRARD
                     IITNICSMDEPLPDKPHLTNRLRAVVEHWPLDLEPQGRLILAADFLELAPPYVSVSHH
                     QDIQDRSGVFLLFSDCLVILQKRTSSGLTGRVFLREIDKPSPAGLLASMTNAAGGEGT
                     WEFAFAGWHSLADVRFTESSDGRLIWMSSTQEMKGAPPSSEHCGSRAMTSRCFLLQDH
                     YEGRVSKWSEDIIKARIEGRFSEKEREESTWTLRTVKMQDIGFGLYAAVFQEGAQQLI
                     EGRREPAPIRVVLDNDKGTKGAPVGHYGVEILVEAKTGDMQRISMSTLGLNGKKFTDD
                     VALEDFLPTLSRRIIQLLSTQFSVANLRLVPALVSYHTKILRTINVTPRTEKNTRSFL
                     SSSPVKMLSNLLVGSTASSSTTSVDNAGINGSRHKRTRSNSTRDVTVIAGSIKDRDIP
                     RLTVEEEPPENPLVRLEQTFTGFVANMQARKGYFVARTLLNRALADELQVNDLYNRLI
                     EFPFDLDAASELGTEVIFAAFEKFIRIAWREQIGPVMTMEHLEALQVRASKKVVGDFA
                     DFVRFIFSDMAPQNRRAFTAIIKLLADLLEGCGNDGDRGALTLAFAELLVYDGNAPDY
                     INLLDRLVEDCDRIFEKADARDPTGLLSSLSYESLITPSNRSQKSTTGSITSNTSSLR
                     RKFGFDTLLRQNSKTDTERSSVWRTLSKHSKTPSSENGSLSKASRSKSVDMGVNYTYT
                     PNRFRRPGSRDRPSVAGAFDDIGHRPGSSHRLETIGEPEGTESGSVKSIKKKRRSSLS
                     DLKSLMAATSLEDDAEVMPLQVNKQQTAEKFNSVPRPPSPSKIPIGPQSHVSTFRSSK
                     QKENTVDPFQPPVESAEENEKPVPQRTRARTMTISQIPTLKPPANPRIPVPPSPEPPT
                     RPSSSPGKPAGTSQKLRLQSPQKLRERLQTEKRAVEEVDASLRSELSRISEDMARVNS
                     ALPRSATADIRKLSVAVKALEDRVPQVLEELEERHALMQRDLEATLRATEAKVRAIDQ
                     LYKEATAENELLYEKFNSELGKIVKALKGKNREDKEELVARLKESSDEAARIKKENAR
                     LKREMVSLRALLKGATSAAGAGSGGTGSDGEGN"
     gene            complement(<2109940..>2111073)
                     /locus_tag="MYCTH_2068800"
                     /db_xref="GeneID:11514146"
     mRNA            complement(join(<2109940..2110152,2110276..>2111073))
                     /locus_tag="MYCTH_2068800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666039.1"
                     /db_xref="GeneID:11514146"
     CDS             complement(join(2109940..2110152,2110276..2111073))
                     /locus_tag="MYCTH_2068800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666087.1"
                     /db_xref="GeneID:11514146"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="JGIDB:Spoth2_2068800"
                     /translation="MPEPQPNAPGHEGNSLPLDHSHILLTSFNSFLTVAIHNILYYRN
                     IYPATTFLSTKAYNLPVHQNRHPKVCAWIRDAVDAVAAQLSTGHVSRIAIVIHSPYES
                     TAPPRPPRDSSPSGSEVFTPTPSTSSSSQPPAPIPPGSVLERWMIDTSRFPAWPSTSN
                     NNNNNNNNNPGSNGEATGPSAAETAKGMRDFARVLARDARSEDARERHLAPDLANPSF
                     GWPDLDEQLRGALRRMASVAEGMAPLPLEGCTFTVAVELAEEGRAPIGHPQVWIPSEP
                     NLQPKGRGREVAGQDIGGVRTRPIRSVEAGPLFFECWVEESKAKEALMRMTERGEGGS
                     QS"
     gene            2111547..2115101
                     /locus_tag="MYCTH_2310505"
                     /db_xref="GeneID:11514147"
     mRNA            join(2111547..2112043,2112096..2113785,2113854..2114425,
                     2114484..2114605,2114660..2115101)
                     /locus_tag="MYCTH_2310505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666040.1"
                     /db_xref="GeneID:11514147"
     CDS             join(2111709..2112043,2112096..2113785,2113854..2114425,
                     2114484..2114605,2114660..2115054)
                     /locus_tag="MYCTH_2310505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666088.1"
                     /db_xref="GeneID:11514147"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Spoth2_2310505"
                     /translation="MDEHLAQLLANTQDKNEGPRKQAELDLLHAQRNPEFPLSLARIG
                     VHTGAPVQIRQSALTYLRKFIEKNWAPDDAGSGPQIPIEDSTKDYLRNVILELVLNPE
                     DERKVKVAASYVVSKIATADFPHRWPNLLPSVLGVMPNGTDAQLHGALRILQDLVEES
                     LTDEQFFGVARDIVKACYDVALNENRKQNHRSLAVLVFRSCFDLMDIVKEDHKKEVKS
                     FAEQVLSGWLPFLEQVIKTPLPPVLENSGSQPENWYGPIALKDQAVKTLIKIRTVFPS
                     LLLPQSLALFTATWEELSRLVPSHQALFIDSDAQSRLEDIDGLPFTLDFLVLDELDFL
                     NQCIRAPPVQKQLEAEIKSRGAVHDTPWVLDLMNLLVSYSQVTQEEEGLWDIDVSLYL
                     ADETSVSSNYTARTACGDLVIKLGEWLNKAALEGLFAYTKTLFSGEGATWQKQEASLY
                     LFNSILNDFQDCDKTVPPEIANAYLELVTYAISRQDEPMLRARGYLVAGALAQVYQPA
                     LGLLDKAIEAITRDESELVQVASIKAVEGFIRGGAPADRQVPIVLAIQGFLEAKDLSD
                     LEDADDLLVTLLETLRTTISMDTRIAIQPDSKAVDLLFLIAKHGAANFHVTLIVCETF
                     EDIARTYKDNEGPLKDMGHPRLYAALCSKVLPSITGTFDVANLTQDDPLVTLAAELLS
                     LLVQYGSEPLPEGFVAATLPKLHHLLMTSSEGDILRPSSEAVKYILMHDHKQVFSWQD
                     ESGRSGLEVCLRVIDRLLGPNIEDTAASEIGGLAAELVEKAGHERLGPFLPQLLQAVA
                     TRLDTAQAAPFIQSLILVFARLSLVGAQDVVNFLSDIQIKGQVGLQVVLSKWLENSVN
                     FAGYDEIRQNVIALSKLYSLNDSRVAQTMVKGDLIIANTDRIMTRSRAKLNPDRYTII
                     PAPLKILKVLIEELVSASGMQAASNMAAAAATELAEEDEDGDGDNDGWEDEPDDTLDL
                     ALGSTKSDLMGWAEGGNNSRQRDDETQAYLIDFFMRADAENIADFRNWCGMLTDDEKR
                     KIKEAAQ"
     gene            complement(2115703..2117496)
                     /locus_tag="MYCTH_2310508"
                     /db_xref="GeneID:11514148"
     mRNA            complement(join(2115703..2116641,2116741..2117058,
                     2117168..2117496))
                     /locus_tag="MYCTH_2310508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666041.1"
                     /db_xref="GeneID:11514148"
     CDS             complement(join(2115965..2116641,2116741..2117058,
                     2117168..2117357))
                     /locus_tag="MYCTH_2310508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666089.1"
                     /db_xref="GeneID:11514148"
                     /db_xref="InterPro:IPR013886"
                     /db_xref="JGIDB:Spoth2_2310508"
                     /translation="MAPSDPLGPAAVLKSMADALPPHENNDTAADLKNPLDSIALFVH
                     ACMVNLGFRLLGFDEDHTIEEECARHAPNLPPQWNTSSGSHGFVYAHTQSAMRFVLHI
                     DRLGAKVEIRGLATGDERIARFDITANDYVSPSALPLRVSRSSEATQDNSDLVRKLKT
                     IFISEERIKDLASLLKITIIQRLLPALQKEGYTETLPARPTRASPPPRRPDEPSHLPP
                     PAAPHPYPAPDPLAAPPPHRPVPAGDFPPPGFEDEYEINRPPGRPWPGSAPAPGLGGF
                     GRVGHDDLYPAGLGPHDPITGSFTGGGIGPGGLRRPGGPGTGGMGGGMHPTFEDPLFR
                     APGGRGGQGEEDDTFGGQVPPGARWDPVGPGGQPRFGGGRGPRGGGGFGGFGGFGGGD
                     II"
     gene            complement(<2118112..>2119524)
                     /locus_tag="MYCTH_2070514"
                     /db_xref="GeneID:11514149"
     mRNA            complement(join(<2118112..2118412,2118637..2118934,
                     2119233..2119314,2119399..>2119524))
                     /locus_tag="MYCTH_2070514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666042.1"
                     /db_xref="GeneID:11514149"
     CDS             complement(join(2118112..2118412,2118637..2118934,
                     2119233..2119314,2119399..2119524))
                     /locus_tag="MYCTH_2070514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666090.1"
                     /db_xref="GeneID:11514149"
                     /db_xref="JGIDB:Spoth2_2070514"
                     /translation="MRDFHDRTAYEQTKTPAPARVIFQEFLKVLGRTEAEQPLIWYSR
                     SVHMRSVLAVPALSPSPVGLGGDQNTTEEEEGEGENKGEVESGEVIMLDDRLLEKISK
                     MPPTAGYAGDRDLVDVSVYLWDDEYTKEDRNALGLLQGAMRAAHLPPLEVVDCREVPS
                     VWEIVDEHTSSSRVLAGGSGNVSPSPSPSPSGSYEEFKLDRRRAPHTVGSAHLYIRRD
                     IVEAAERESIVPPYPVTFPHDYPYKHDNWYLDGLQRHGSGRVVKRSETDG"
     gene            2120824..2121808
                     /locus_tag="MYCTH_2310511"
                     /db_xref="GeneID:11514150"
     mRNA            join(2120824..2121036,2121126..2121523,2121596..2121808)
                     /locus_tag="MYCTH_2310511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666043.1"
                     /db_xref="GeneID:11514150"
     CDS             join(2120918..2121036,2121126..2121411)
                     /locus_tag="MYCTH_2310511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666091.1"
                     /db_xref="GeneID:11514150"
                     /db_xref="JGIDB:Spoth2_2310511"
                     /translation="MSTQETGNIPLSHAPDGTGYKLMELPPELLELLESQDPPTLTLH
                     PSPTAALLKTPSSTYSLRQKNTSNALILLAPSSASSGGESADDGRPPAAVGLNAIATL
                     HETIELVPEEGNTATPAPKARGKWHEKFGRGR"
     gene            complement(2122126..2125725)
                     /locus_tag="MYCTH_2310513"
                     /db_xref="GeneID:11514151"
     mRNA            complement(join(2122126..2122986,2123143..2123457,
                     2123506..2124365,2124447..2124803,2125300..2125725))
                     /locus_tag="MYCTH_2310513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666044.1"
                     /db_xref="GeneID:11514151"
     CDS             complement(join(2122295..2122986,2123143..2123457,
                     2123506..2124365,2124447..2124803,2125300..2125430))
                     /locus_tag="MYCTH_2310513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666092.1"
                     /db_xref="GeneID:11514151"
                     /db_xref="JGIDB:Spoth2_2310513"
                     /translation="MVYANEVVFSDSPTPLPSPSPLSLPQPDYFDDLVIDDYFPQFVP
                     ERSPAMSPILRPTPGPDAEQDGTSRCEEIVLDCFPDICPDYLKSQVSKHEGDSQSLIT
                     ELLDNLENGQSYPKRSNSLKRKRREDEDEDEEEKLRKKFEGGDPRLASNGPAYVSLYL
                     KTAKSLLKASFPERYVDDIESAFKANNQQLYTTYLLLDEASWNPEARPMRIKRVVSRQ
                     PHPEEALRTGNHEPAELDALEAFDAARAICAAKAQARKSKEAEERRKTQEEEENLQRA
                     RADGTVAECGCCYDELALNRMVHCDGENTHWFCRPCARKMAEHAIGLSKHRLGCMSVE
                     GCDGTFSKDQKELFLDDKLTTALELIEQEEVLRLAGIDGLEHCPFCRFAAEYPSVGEN
                     KEFRCENPECRLVSCRLCRRQTHIPKTCEEAAEERGISARRRIEEAMSAALIRKCNKC
                     GAAFIKENGCNKMRCTRAGCGNVQCYVCSKSCDYSHFDDRSRGGKRGNCPLFDDVEQR
                     HRNEVRAAEELARKQVASENPDLNEDLLKVNFSEQAEKDDERRRTTVNPAPPPFPFVQ
                     HNQPAVFAPWQPFAQVLTPQTNLAAPAGQAQAQQPRTQQGPAAQMAQAGALPFYVPNF
                     ANPVAQLGMLGVPVAPVATMAPANGAVPLVPNPEQNARRALSEGLKAAWEVYRRVTAH
                     TSTAANTGASGKYGTGIPTTGVSRALFGGLASPNASAQGPASQARYLAQPIIQPDQNT
                     QEQGIIHNAAGPLAQQFPWPFGGFDMAHGFQGGHPPPTRDQGGA"
     gene            complement(2126480..2129708)
                     /locus_tag="MYCTH_2310516"
                     /db_xref="GeneID:11514152"
     mRNA            complement(2126480..2129708)
                     /locus_tag="MYCTH_2310516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666045.1"
                     /db_xref="GeneID:11514152"
     CDS             complement(2126647..2129634)
                     /locus_tag="MYCTH_2310516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666093.1"
                     /db_xref="GeneID:11514152"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="JGIDB:Spoth2_2310516"
                     /translation="MPPYVPRKRIRDDTPPTQNESKPNQGRETKTAIAPPRKSTLFDD
                     LDASSTPRSSTRNGSSVLKIDDSEDDESPLSSLSDAEFEDIPAPKRHKVGAPNDKEDK
                     DEEEEDDDEDEDIEFEDVKTPHAALKDVPTPSGDLELTLIRDTRISLANALGKKGPSK
                     LERKIRIATHCVHVQFLLWHNAIRNSWLCDPIVQGILLSHLPPRLWAEVDRWKVASGL
                     EVPEESPRSGRIQQDVKGKGKAQLRKSRDWSEASQRLEKGAVDMSHGDPLFRLMKYLA
                     SWWKQRFRITAPGLRKWGYMSLERLDRLTKAFKQEGHDQERFGERIRNLDEFRICAQE
                     CAGSRDVGAQLFTALLRALGLEARLVANLQPLGFGWTKLEEADPEKEGFSFGQTAQKD
                     SEEVVRKGTAAPKPRSTRRAKSAVPTRKSRRNKQAEMEEPSDSELAVDNSDDDLAIEL
                     PQAPPKRGKVYDADLEFPHYWTEVLSPVTNKYLPVDPIVKSVIATNRELVESLEPRGG
                     KADKAKQAMAYVVGHSRDGTAKDVTIRYLKRQMLPGRTKGMRIPTEKVPVYNRHGKVK
                     RYDQFDWFKSVMRGYARGGPKHPVTEADQVEDASDLKPVKHEKKEVKDGEETLQYYKQ
                     SKEFVLARHLKREEALLPTAKPVKIFKNKGKAGEEEPVYLRKDVVQVKSAETWHKQGR
                     APKPGEQPLKRVPYRAATTNRQREIAEAEAATGEKVLQGLYSFDQTDWIIPPPIRDGI
                     IPKNEYGNIDLFVEHMCPQGAVHVPYRGALRVAKRLGIDFAEAVVDFEFGHRMAVPVI
                     QGIVIAEEHYDAVMEELAKDEAEKKRKEDEKRRKAALSMWRRFLMGLRIVERIKQDYG
                     QVEVSADAAGPGGGGEAKGEETRDVDAGTGLEDEDMGGGFLPEGYEDAEEKTTSLTSG
                     FFPVVDEEEGTGSEEGGLEIDHGEGAREPAAEPSTSVMSTRPKRKAVSKAQATRRRRR
                     PNIPSSSEEEQDEEIDSQSSDDE"
     gene            2129905..>2131053
                     /locus_tag="MYCTH_105197"
                     /db_xref="GeneID:11514153"
     mRNA            2129905..>2131053
                     /locus_tag="MYCTH_105197"
                     /product="zinc finger-like protein"
                     /transcript_id="XM_003666046.1"
                     /db_xref="GeneID:11514153"
     CDS             2130091..2131053
                     /locus_tag="MYCTH_105197"
                     /codon_start=1
                     /product="zinc finger-like protein"
                     /protein_id="XP_003666094.1"
                     /db_xref="GeneID:11514153"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="JGIDB:Spoth2_105197"
                     /translation="MASPNPNKSDETSYVQMSAAAVDSRGTDASLVGSHCQYSYCNQL
                     DFLPFRCQSCNKTFCLEHRTEDSHECTNPGAWAARRREQELARPSLGQGKPMRDPVGR
                     KKVCADDSCSAVIGTPLAPGVPCPGCNRDYCLKHRLREEHDCSSKTPIGARAAGAAQA
                     AAVAEGARSALERFRLWGQAKKQQAKMSLASTSSKPKVAQMVAVNNLKKTAKGDAKIA
                     PEKRIYLYVEAEAATARAKIPKGEFFYSQDWVVGKMLDAAARSLQVPNVNNQSSSEED
                     KLRVFHVEGGRLLDFNEKLGDVLQSGNTVVLLRGVGPPPDLIEA"
     gene            complement(2131230..2132696)
                     /locus_tag="MYCTH_2310518"
                     /db_xref="GeneID:11514154"
     mRNA            complement(join(2131230..2132081,2132155..2132696))
                     /locus_tag="MYCTH_2310518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666047.1"
                     /db_xref="GeneID:11514154"
     CDS             complement(join(2131406..2132081,2132155..2132384))
                     /locus_tag="MYCTH_2310518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666095.1"
                     /db_xref="GeneID:11514154"
                     /db_xref="JGIDB:Spoth2_2310518"
                     /translation="MWPFSSSSEKPTAPSSAQNESTASAQSQSAADHLKKADADIDPK
                     NLPEKQKLPPRLQRLLDKSAKEENLFDELVEGYVPPSTDSNVRYAAYAARFRTILLSA
                     HRYVAYTSDIGESFRPVAHPWLVRSAYGVSWAYILGDVSYEGYKAYLHNQRVLNPQLE
                     LTTRQQQILGLDDDGAAPRPAAPPGVIPPLEDYRTVMLQRGIFQSIASMGLPAFTIHS
                     VVKYSGRAMKDVKNAKLRTWAPIGLGLSVVPFLPAMFDKPVENAVEWAFHKGFETFGG
                     PQAVGNAPLIGREKRLSERPKEKRE"
     gene            2132842..2133661
                     /locus_tag="MYCTH_2310521"
                     /db_xref="GeneID:11514155"
     mRNA            join(2132842..2133008,2133140..2133264,2133324..2133661)
                     /locus_tag="MYCTH_2310521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666048.1"
                     /db_xref="GeneID:11514155"
     CDS             join(2132961..2133008,2133140..2133264,2133324..2133384)
                     /locus_tag="MYCTH_2310521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666096.1"
                     /db_xref="GeneID:11514155"
                     /db_xref="JGIDB:Spoth2_2310521"
                     /translation="MVQTYKIFGANVGSHYLAMGVLGTLFAGSYTAFGGGSKAQPASP
                     PINASSSDEADFIKKFVEEAQAGEKNSGGAAKH"
     gene            complement(2134438..2135903)
                     /locus_tag="MYCTH_2310525"
                     /db_xref="GeneID:11514156"
     mRNA            complement(join(2134438..2135648,2135728..2135903))
                     /locus_tag="MYCTH_2310525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666049.1"
                     /db_xref="GeneID:11514156"
     CDS             complement(join(2134574..2135648,2135728..2135729))
                     /locus_tag="MYCTH_2310525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666097.1"
                     /db_xref="GeneID:11514156"
                     /db_xref="JGIDB:Spoth2_2310525"
                     /translation="MAATFSPTPYQEGRLLDLQVCKSYSPNLPSRITATISRVISMTM
                     SVVLDVTFQTRQGPPVHRVLKLYDRRFGSCLREVRKDRAAPHTQENEAAFEAFVRRGM
                     MPGFLRHRKERNETETLPVRAREFLDEPNRTEGLAKYEAALWQDCIEHFECETKAYHR
                     LTDLQGTLVPRIHAHVSLLPTKLATIIPQEIAPYFEVRGILLERIDGYCLENLTLGPL
                     PQNLRTWQHIIQLAVDAAYEINKRGVIMEDCAPRNVVVDRQSQTPRIVDLAQCIFRDE
                     MVSEWYQWGWHEDEDWDPDVEYWEQVSTTNNPGAIGAVMANRVQRKTGVKLDFRYPDW
                     SGIIAKIRRRKEEAAAVERKTPRR"
     gene            2159618..2160389
                     /locus_tag="MYCTH_2310527"
                     /db_xref="GeneID:11514157"
     mRNA            join(2159618..2159641,2159721..2160389)
                     /locus_tag="MYCTH_2310527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666050.1"
                     /db_xref="GeneID:11514157"
     CDS             2159985..2160338
                     /locus_tag="MYCTH_2310527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666098.1"
                     /db_xref="GeneID:11514157"
                     /db_xref="JGIDB:Spoth2_2310527"
                     /translation="MAAEERVLRLRKQKRMWFEKMMRAIARGIDSVEELERVEREEAA
                     AAVAAEASGVTASSSTPSRLSADFGQLWDAVYPEVPLDPSLLADFGLVSGSSLSVGQG
                     SSGGTAEVSRGNSGS"
     gene            complement(2215614..>2216320)
                     /locus_tag="MYCTH_60726"
                     /db_xref="GeneID:11514158"
     mRNA            complement(join(2215614..2216044,2216185..>2216320))
                     /locus_tag="MYCTH_60726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666051.1"
                     /db_xref="GeneID:11514158"
     CDS             complement(join(2215971..2216044,2216185..2216320))
                     /locus_tag="MYCTH_60726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666099.1"
                     /db_xref="GeneID:11514158"
                     /db_xref="JGIDB:Spoth2_60726"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     THRILQEQRRIKDAKRRAELKLDKS"
     gene            complement(<2223651..>2224488)
                     /locus_tag="MYCTH_2069029"
                     /db_xref="GeneID:11514159"
     mRNA            complement(join(<2223651..2223740,2223853..2224208,
                     2224281..>2224488))
                     /locus_tag="MYCTH_2069029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666052.1"
                     /db_xref="GeneID:11514159"
     CDS             complement(join(2223651..2223740,2223853..2224208,
                     2224281..2224488))
                     /locus_tag="MYCTH_2069029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666100.1"
                     /db_xref="GeneID:11514159"
                     /db_xref="JGIDB:Spoth2_2069029"
                     /translation="MPIEKRKSHSARYRASLAQNIAENGFVVMPCSWCASQGLVCKMI
                     ARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERRAELELDESQRRLEEAQ
                     RELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVERQETPAMPSSQINDAV
                     DAVDWGAVFGSVPGFPLVDPDSAGGTVPNFFDVPFFLFVLCFDVRGNLGVLWCWFEK"
     gene            complement(<2230829..>2232424)
                     /locus_tag="MYCTH_2129999"
                     /db_xref="GeneID:11514160"
     mRNA            complement(join(<2230829..2230990,2231264..2231794,
                     2231912..2232088,2232140..2232331,2232374..>2232424))
                     /locus_tag="MYCTH_2129999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666053.1"
                     /db_xref="GeneID:11514160"
     CDS             complement(join(2230829..2230990,2231264..2231794,
                     2231912..2232088,2232140..2232331,2232374..2232424))
                     /locus_tag="MYCTH_2129999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666101.1"
                     /db_xref="GeneID:11514160"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2129999"
                     /translation="MVQNGGDFDLDIDMATDQRVQELDQRDKAAQARIKELENREKYS
                     QKLVNKAYAKIEALEGAKAKRIKVEPPGKYRGTKEDLFPDDKAKVLYVAIRLEGKALR
                     WFEPTWNDYLTEEDEDDRDTFTQAVFRSYDRFEEELRKLNDEALMQLFYNGLKEKVKD
                     ELYKYDRPETLDEYIAQAIRIDDRLYIREQQKRGRINGTTVKANDKKKRAYVSTSYRT
                     HPGAIDVDAAQKQDQKKTTKDKSNVTCYNYGKKGHYKQECRSPKKGWKPTPGKEITAI
                     DETTKDVIEVAATSYEDKGSDTDSLGYDGNGEDEQAPNSELSDEMKDEMRELQRIVET
                     IKGEQPVTYDGPDSYTEHLDGQQLSNDVRNLEYQFM"
     gene            complement(<2234728..>2235387)
                     /locus_tag="MYCTH_90104"
                     /db_xref="GeneID:11514161"
     mRNA            complement(join(<2234728..2235192,2235340..>2235387))
                     /locus_tag="MYCTH_90104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666054.1"
                     /db_xref="GeneID:11514161"
     CDS             complement(join(2234728..2235192,2235340..2235387))
                     /locus_tag="MYCTH_90104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666102.1"
                     /db_xref="GeneID:11514161"
                     /db_xref="JGIDB:Spoth2_90104"
                     /translation="MDGRQTETVRSSVVEEQQHQHQQHQQQQQQQQRPIVHDRATFAE
                     VAERLRGHIRVVHQEADLIESTVDDVLRDPNLEELREAAKRVRLTARFMGFELDRLMA
                     IHGRLERSQTVVPSRTVETTAAVALAAAATPADDAAAAASGSSGSAGSTGSDDDPADA
                     GDSSSGSASA"
     gene            2237217..2238688
                     /locus_tag="MYCTH_2310539"
                     /db_xref="GeneID:11514162"
     mRNA            join(2237217..2237610,2237692..2238688)
                     /locus_tag="MYCTH_2310539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666055.1"
                     /db_xref="GeneID:11514162"
     CDS             join(2237351..2237610,2237692..2238388)
                     /locus_tag="MYCTH_2310539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666103.1"
                     /db_xref="GeneID:11514162"
                     /db_xref="JGIDB:Spoth2_2310539"
                     /translation="MKDGGIGGLEASREPPPLQLDGVKSSSRLAAATRPIPTSTIAPE
                     PKAGSTQTEKWNTKNLALRLGADLISAASAAVMVAPIISIIDRSIMENASGRRSLAQS
                     IKSSIQALLRTPQRVVFSKPFALIFALYGGTYLTANSLDTATSTVRALPATHVSSGTA
                     KFAASSAANIGLCIYKDQVFVRLFGPPGAAPRPVALPSYALFALRDCMTIFASFNVPP
                     LLGPVLSRRVGDEVQRFVSGQTMAQFAAPATLQLVSTPVHLWGLDVYNRPGATSWRDR
                     WAVVRKNWAVSTAARICRIVPAFGVGGVVNYKVRRGLMERLV"
     gene            complement(2238690..2240954)
                     /locus_tag="MYCTH_2310541"
                     /db_xref="GeneID:11514163"
     mRNA            complement(join(2238690..2240453,2240531..2240666,
                     2240732..2240954))
                     /locus_tag="MYCTH_2310541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666056.1"
                     /db_xref="GeneID:11514163"
     CDS             complement(join(2238735..2240453,2240531..2240666,
                     2240732..2240835))
                     /locus_tag="MYCTH_2310541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666104.1"
                     /db_xref="GeneID:11514163"
                     /db_xref="InterPro:IPR007261"
                     /db_xref="JGIDB:Spoth2_2310541"
                     /translation="MFLKHIDLTGALRPTFVSDDEDLLFVQDNVGLYEGKFKLPNHQN
                     GQIYLTSHRICYVDKAEPRKHSVALDLKDVERFEFYGGFLKSSAKITLIPKPTKRASL
                     QPRSPVAAGAPSRSSTSSPAQQHDGSFRVSQADAAPASSATWVCTICSFSNPVPSNFD
                     PTTANVHTPLPPCLACGIKPSLTHILKAAISNATSRQPNSPALQTPLPVRPKSGADLS
                     LGPDLARDSSPQSSDPDASFQCPRCTFLNHPSLLSCEICGAALISHDLPPELAPQTRA
                     HTESPGPVLHAHSPLASGADNPESIKISFRGGGEKIFYERLKSSMTQRKWLLQGAPPI
                     PKAPRPGESSLDGPGTGSSTSAPATTTPTSQSRAKIGGIAGLEHHSQAVRKNNELVIG
                     SAFEDLEALMASAKEVVALAESFARQVKGASSAGENALLADSVNQLGLVATKDIVGSS
                     SGAGGSDSLYLSELARTLAEFLTDDRRGVLRKAGGIISLVDLWAMFNRARGGVELVSP
                     ADFEKAAALWERLGLPVRLRTFKSGVKVVQGRDRTDETTIKALLAWLKDLHEIPPERE
                     VPWDWRRFGRGVTARDAAERFGWSIGVAEEELEMAEERGVLCREEGIEGLKFWENFID
                     TGEGKSYKDPAKEQSDKLVKMLMEAGFL"
     gene            2241195..2243355
                     /locus_tag="MYCTH_2310543"
                     /db_xref="GeneID:11514164"
     mRNA            join(2241195..2241493,2241566..2242847,2242907..2243355)
                     /locus_tag="MYCTH_2310543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666057.1"
                     /db_xref="GeneID:11514164"
     CDS             join(2241421..2241493,2241566..2242847,2242907..2243120)
                     /locus_tag="MYCTH_2310543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666105.1"
                     /db_xref="GeneID:11514164"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="JGIDB:Spoth2_2310543"
                     /translation="MMPTWPAAPPSGAQPPAGYTASYSAPAYTAVPVRQSFGQSYSAP
                     QSSYPTAHTYGPPHSPSPSAANSATNVNTPSPAAQDQTKTKIDWPDSVRRYVQRAFIP
                     ANLDSSVSRAEMEVKLKETITQANEKGVMYTLDWDKMPLPQEMIREERARALLPLNSK
                     PQTQAPTQSTTTKKRKSWDLTDSETPNSPSATPPPWRSGAGRLEDRVSFSSDRRLTSE
                     ELPKSSKFNRADKRQKRQEGEYTTFREETPPPSDGPVVGTCQDLEKRYLRLTAAPKPS
                     QVRPPHILRQTLELLKKRWKKDQNYSYICDQFKSMRQDLTVQRIRDDFTVEVYEIHAR
                     IALEKGDLGEYNQCQSQLKGLYKLGLKGKANEFKAYRILYYIHTANRTELNNALADLT
                     AAEKKDKAIKHALDVRSALALGNYHRFFQLYNDTPNMGAYLMDMFVGRERLAALCNIC
                     KAYKPDVPLRFVTEELYFESDVEAAQFILNHDGQDLLEDRNGTIVFLTGKAGPRFEGA
                     RAEAFSRVDIKGQI"
     gene            2245811..2248354
                     /locus_tag="MYCTH_2310546"
                     /db_xref="GeneID:11514165"
     mRNA            join(2245811..2246053,2246354..2246452,2246566..2247303,
                     2247368..2248354)
                     /locus_tag="MYCTH_2310546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666058.1"
                     /db_xref="GeneID:11514165"
     CDS             join(2246048..2246053,2246354..2246452,2246566..2247303,
                     2247368..2248306)
                     /locus_tag="MYCTH_2310546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666106.1"
                     /db_xref="GeneID:11514165"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2310546"
                     /translation="MKALRIGRRSIKDEKGKPHISIPQKSAVAIVPPKKVIRALYDYT
                     AQSPQELSFSRGDFFHVIGRENDPDWYEACNPALPDARGLVPVSFFQALGRNERDSGQ
                     SQPDSAQSAKHPDHDSGYGEAPAAVTPSAPASQRNSKSSGKPGAMVYGVVVYDFHAER
                     GDELEAKAGEAIIVIAQSNPEWFVAKPIGRLGGPGLIPVSFVEIRDMATNTPVANPQE
                     AVRKAGIPKVEEWKKMAADYKNSSITLGKFETGTQAQPIEQGMERMSLQQSSGRVSQN
                     SGSNMQQQAQQGGYVTQQSPVQQTQPSLQNSQLPAPVSARIPRYCFAEDKYWFVIEAE
                     LEDGRTWELARYYEDFYDFQIALLTEFPVEAGTTGKKQRTLPYMPGPVNYVTDAITEG
                     RRHNLDAYVKNLLAQPPYISKCNLVRQFFAPREGDYEIDPSTLDEEYRLSAGSRPSSA
                     DSPANSASRQPSQQNLGGSGYGNLGGARQPGQQQQQQQPPMARQVSSLSQPSQSSLSP
                     GMQTAGSFMKVKLSYNGDIIAIKVPTDVTFESLYDKIVDRLKIPPGEEPQLSYKDEAT
                     GDKPPLMSNHDLDVALQRNEKLLLYVE"
     gene            complement(2249436..>2251145)
                     /locus_tag="MYCTH_74504"
                     /db_xref="GeneID:11514166"
     mRNA            complement(join(2249436..2250350,2250480..>2251145))
                     /locus_tag="MYCTH_74504"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666059.1"
                     /db_xref="GeneID:11514166"
     CDS             complement(join(2249760..2250350,2250480..2251145))
                     /locus_tag="MYCTH_74504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666107.1"
                     /db_xref="GeneID:11514166"
                     /db_xref="InterPro:IPR015175"
                     /db_xref="JGIDB:Spoth2_74504"
                     /translation="MSSAEIAPAVTTTTTTTTTTAQTPTPTPTPAKERHSLTLDQRRA
                     LRRWASSQPVRPSHKACIDWFQSQYNQTISQSTVSHSLSPKYARLDGDTQLSGSRLRF
                     GNWPDVERLVLLWHQTTVNSGRIPSNDELAEKAKSIFTQLPRYKDETPPEFSPGWIHR
                     FKKRYGLLIRRQRRHGSVQNAADDIPYLVDAVPRFMNVTPDVSPAAIREAVQRVVGVE
                     ASLAQHPGVHHPNGDTPMYNADEDPEVVLQNALHALQQEEADAEAQAAAEREARERSE
                     RGLPPPGSLAAGQAYAQQAVAAVNAISTPVSAARASVGPPPSAGNGGVAGAGAGAGAA
                     GAPGSTPSATAAGPRFIAPTPPPAASGSAVGAGSGGEDLTLTPIPSGGPVSVNDRPVR
                     CPFCLNQRMLRTIKEAVEHMSTHVIV"
     gene            complement(<2252469..>2252853)
                     /locus_tag="MYCTH_37941"
                     /db_xref="GeneID:11514167"
     mRNA            complement(join(<2252469..2252614,2252694..>2252853))
                     /locus_tag="MYCTH_37941"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666060.1"
                     /db_xref="GeneID:11514167"
     CDS             complement(join(2252469..2252614,2252694..2252853))
                     /locus_tag="MYCTH_37941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666108.1"
                     /db_xref="GeneID:11514167"
                     /db_xref="JGIDB:Spoth2_37941"
                     /translation="MTNSSSTTPQDSHVGPKSTGGKASAVQTPANSHLGQDKPGIFDE
                     QGAVGKQFTPEGALGGAAQKVGRPLDKEGVIGKQFTTEGSIGGTVQNMMGGASKKSN"
     gene            complement(2253123..2254722)
                     /locus_tag="MYCTH_2310547"
                     /db_xref="GeneID:11514168"
     mRNA            complement(join(2253123..2253684,2253785..2254722))
                     /locus_tag="MYCTH_2310547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666061.1"
                     /db_xref="GeneID:11514168"
     CDS             complement(join(2253371..2253684,2253785..2254367))
                     /locus_tag="MYCTH_2310547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666109.1"
                     /db_xref="GeneID:11514168"
                     /db_xref="JGIDB:Spoth2_2310547"
                     /translation="MKHLLSLPKQRDVKYNTHRRRKPFIEKGSRDVAAMIIQVTGDEV
                     LRKCKRCGQGKGPFEGCVVVAQAAHDRAKRRYPCCANCLFGGKKLQCTLAKSTRTRTS
                     LAASAAAQSPGVSAPSKEVNEAGFHGEPRTQQSTVDDGISTTPASPSLSDLSTATALA
                     SHGTFQCPHDMIEMEDWEIAPGRIRGTSIIAEPETIAFSKPYLSNTTSTPHAAVPVCD
                     DVGFRVDTVQPGDKLLLDAEADKTRLCSVAAGKVRVSIGGEPEFVLGPHGLFKVRAGA
                     ACTVRNELSFDAVLHTVVLGGY"
     gene            complement(2254772..2256908)
                     /locus_tag="MYCTH_2310549"
                     /db_xref="GeneID:11514169"
     mRNA            complement(join(2254772..2254946,2255009..2255405,
                     2255459..2255610,2255670..2256137,2256196..2256662,
                     2256758..2256908))
                     /locus_tag="MYCTH_2310549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666062.1"
                     /db_xref="GeneID:11514169"
     CDS             complement(join(2254786..2254946,2255009..2255405,
                     2255459..2255610,2255670..2256137,2256196..2256631))
                     /locus_tag="MYCTH_2310549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666110.1"
                     /db_xref="GeneID:11514169"
                     /db_xref="JGIDB:Spoth2_2310549"
                     /translation="MEDPANEASGSFGPSHKSPAALEAAFDSAATTRVDTNSTQQTVQ
                     NGLPKRVFKMKRTGFSTLPQNTTTRELSSSNAHPPATPGHLAEREPKAVQIISYLPSR
                     ISTTPVTGTSVTPSKAQSASSSARKTKYATDEERRKATSIALKQRWASGVMANVHKKR
                     LETIRRRKEAEALLGTPGIAKSSSSVVDLKQATKSSKSLTRLSWVPNSDARQAHEARE
                     RPVVSEQFSSNKRRLTAESATSSSHEDLDAQSENSTWLSISSVLDGDQAVEQPSDEDE
                     SKSRTNNDASFITMAASDRAYSKWRDERGSLIPTYGALIPEGYKFSTTTPGRPWICPV
                     RSCRKVFAKLRELGSHFNRGHRGAQLHDNEDGTLSERTTGRLRRPSSKLAAPFPAVVI
                     SRGPPDPAEAPAVEPSFPTLVPGKQLLGVQDASMLEGNDDIDLDTEGTTNTGDEANIG
                     SAIEESQEATPITTNGVPTNIAEAEPGRPYTMWPDENGELVPTYGSLLPAGYQLDNTI
                     PGRPWVCPVRTCRTSHCKRSDLGFHFMVQ"
     gene            complement(<2257911..>2258937)
                     /locus_tag="MYCTH_90096"
                     /db_xref="GeneID:11514170"
     mRNA            complement(join(<2257911..2258650,2258718..2258795,
                     2258853..>2258937))
                     /locus_tag="MYCTH_90096"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666063.1"
                     /db_xref="GeneID:11514170"
     CDS             complement(join(2257911..2258650,2258718..2258795,
                     2258853..2258937))
                     /locus_tag="MYCTH_90096"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666111.1"
                     /db_xref="GeneID:11514170"
                     /db_xref="JGIDB:Spoth2_90096"
                     /translation="MSSSTQPRWRRDAAAGAPVWRPGMIAFLHKKKECYPEAIEDLIS
                     TGHLPHGALGHPVIILQRPSMQSTHVLITTVSSYCAEENNGSPPWKQPRHRSKCPEDF
                     RSFLGSERVSNTYQPLRLHPGKQFPKPSASWVYIQSAFVVPVCVLGRFFRPPMPRGMM
                     LTMLPESLEDLRCHMAAKCKAWAECQERLLAAEAARLSLPAPLAAYTVPVPAAAAANP
                     SSPSTSDEEGEPAATVPAARRPDPPLATSTPGPRIRSFAATLRGSGAALAPTSASALA
                     VPWRRQGTSKHRDKPWKTRKNWRE"
     gene            complement(2259685..2260562)
                     /locus_tag="MYCTH_60517"
                     /db_xref="GeneID:11514171"
     mRNA            complement(join(2259685..2260106,2260228..2260562))
                     /locus_tag="MYCTH_60517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666064.1"
                     /db_xref="GeneID:11514171"
     CDS             complement(join(2259745..2260106,2260228..2260324))
                     /locus_tag="MYCTH_60517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666112.1"
                     /db_xref="GeneID:11514171"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="JGIDB:Spoth2_60517"
                     /translation="MASTEATLRSFFQASKYAVVGASTNTEKFGYKVFKWYVNHGLPA
                     TPINPSAPAINVDGKDYPTAASLSALQEAEGTAVSIITAPPVTKKTLEEAKDLGIQAV
                     FLQPGTFDDDVLANARENFATVLAGKGGAGSEGWCVLVDGERGLRAAGKL"
     gene            2261237..2262450
                     /locus_tag="MYCTH_2310551"
                     /db_xref="GeneID:11514172"
     mRNA            join(2261237..2261367,2261656..2261809,2261883..2262116,
                     2262171..2262450)
                     /locus_tag="MYCTH_2310551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666065.1"
                     /db_xref="GeneID:11514172"
     CDS             join(2261365..2261367,2261656..2261809,2261883..2262116,
                     2262171..2262199)
                     /locus_tag="MYCTH_2310551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666113.1"
                     /db_xref="GeneID:11514172"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Spoth2_2310551"
                     /translation="MASTNYKEAFSLFDTRGVGRVSLDKLGDLLRACGQNPTLAEIHE
                     LEKSVGGEFDFETFQRVLNRPGGFRDPGEPEEYCRGFQVFDKDMTGFIGVGQLKYILT
                     NLGEKMTEEEVDELLKAVDTSSGQVNYTELVRTILSN"
     gene            2263056..2265723
                     /locus_tag="MYCTH_2310556"
                     /db_xref="GeneID:11514173"
     mRNA            join(2263056..2263997,2264060..2265165,2265351..2265723)
                     /locus_tag="MYCTH_2310556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666066.1"
                     /db_xref="GeneID:11514173"
     CDS             join(2263206..2263997,2264060..2265165,2265351..2265621)
                     /locus_tag="MYCTH_2310556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666114.1"
                     /db_xref="GeneID:11514173"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="JGIDB:Spoth2_2310556"
                     /translation="MAKYANPPQPPPLFTGTKDSIVADSKSLCDRTRSLLDSLVANIK
                     PAENPAAATFDSVIRPQVEDENESSLSARILGFYQYVSADSALRDASTEADKILDEFA
                     IECSMREDVFRLVDAVYRNSGLAESLEKDKNRLIDEALAKSAGLDDVESARLLEKERK
                     SYIRNGLGLPEGPKRDRFKEIKKRLSQIQIEFQKNLNEENGGIWFTKEELDGVPQDVL
                     DTLEKGTGENEGKLRLTFKYPDLFPTLKFAKNPETRRRVFIANENKCNQNVPLFKEAI
                     LLRDEAARLLGYPDHASFRIEDKMAKTPKTVLDFLGDLKSRLAAGGVKEIEHLLELKK
                     KDHEARNLPFDGNYYLWDHRFYDRMMVEQEYSIDENAIAEYFPLKSTVAGMLRIFEEL
                     FGLVFVELTPEDRKRISPTGKGEDIAWHEDVIIFSVWNDESEGDGFVGYLYLDLHPRP
                     GKYGHAANFSLQPGFLKPDGTRRYPATALVCNFSKPTDKKPSLLKHDEVVTLFHELGH
                     GIHDLAGRTRYARYHGTSTVRDFVEAPSQMLENWCWTPSQLKSLSSHYETGQPIPDDL
                     IEKLIATKHVNDALFNLRQLHFGLFDMTVHTPETHEKLEKLDVSKLYNELRVEISQIK
                     GPEAQGEPSTWGNGQATFGHLIGGYDAGYYGYLSSQVYSTDMFYSVFKSNPMDPVQGR
                     RYRHTVLEKGGSQDEMLTLEQFLGRKPSTEAFYKELGLEN"
     gene            2266079..2266184
                     /locus_tag="MYCTH_t170"
                     /db_xref="GeneID:11514174"
     tRNA            2266079..2266184
                     /locus_tag="MYCTH_t170"
                     /product="tRNA-Ile"
                     /note="Anticodon: AAT"
                     /anticodon=(pos:2266113..2266115,aa:Ile,seq:aat)
                     /db_xref="GeneID:11514174"
     gene            complement(2266370..2268318)
                     /locus_tag="MYCTH_60509"
                     /db_xref="GeneID:11506387"
     mRNA            complement(join(2266370..2266729,2266795..2268318))
                     /locus_tag="MYCTH_60509"
                     /product="amino-acid permease"
                     /note="Has EST support"
                     /transcript_id="XM_003666067.1"
                     /db_xref="GeneID:11506387"
     CDS             complement(join(2266670..2266729,2266795..2268165))
                     /locus_tag="MYCTH_60509"
                     /codon_start=1
                     /product="amino-acid permease"
                     /protein_id="XP_003666115.1"
                     /db_xref="GeneID:11506387"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Spoth2_60509"
                     /translation="MASITPVSDTKTPEKKADMFDSPDPVSQSQSDDEVGEVRHAALG
                     DYEKQKAAEGEAHFHRLGWKRLTIVLIVTAVALGSLSLPGAFATLGMVAGVIITVGIG
                     LVALYASYVIGQMKLKYPDISHYTDVGRMMCGRFGYEFISVMFVLQLVFTTGSHVLTG
                     AIMFGNLSENGACTVVFTVVSGIILFLVAIPPSFAEMAILGYIDFASIIAAIFITIIA
                     TGVRAGDLPGGVGSVAWSAWPKEDLSLAEAFIAISNIVFAYSFALCQFSFMDEMHTPK
                     DYDKAVVTLGVFEIFLYTLTGALVYAFVGPDVQSPALLSAGPLVSKVAFGIAIPVIFI
                     SGSINTTVVARYIHGRVFRNSIIRYVNTPMGWATWIGLVAALTVLAWVIAGAVPFFSD
                     LLAICSSLFVSGFSFYFPAIMWFMFIKEGKWYERKNWALTAANAITFIVGIAVLGVGT
                     YSAIWDINHRYKTGMVSDPFSCAPLA"
     gene            complement(2269412..2270090)
                     /locus_tag="MYCTH_2310561"
                     /db_xref="GeneID:11514175"
     mRNA            complement(2269412..2270090)
                     /locus_tag="MYCTH_2310561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666068.1"
                     /db_xref="GeneID:11514175"
     CDS             complement(2269446..2269781)
                     /locus_tag="MYCTH_2310561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666116.1"
                     /db_xref="GeneID:11514175"
                     /db_xref="JGIDB:Spoth2_2310561"
                     /translation="MPESKPLLCFRVFFPFVFLSMVAFLAVYLFPAAFPARDLFTFSA
                     LLEMMKPVFVQVGQPMRWRLSTLVEMWSRCTRMLGGSPAFTEWMEPWSSQVQASNPAI
                     VRYVYRNYP"
     gene            2270307..2273511
                     /locus_tag="MYCTH_2310562"
                     /db_xref="GeneID:11514176"
     mRNA            join(2270307..2270704,2270760..2271053,2271110..2271219,
                     2271271..2273511)
                     /locus_tag="MYCTH_2310562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666069.1"
                     /db_xref="GeneID:11514176"
     CDS             join(2270573..2270704,2270760..2271053,2271110..2271219,
                     2271271..2273281)
                     /locus_tag="MYCTH_2310562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666117.1"
                     /db_xref="GeneID:11514176"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="JGIDB:Spoth2_2310562"
                     /translation="MEPTDRYFIFENRLDSFRVPQVVSSKGKAAKTLAWPHKTLSPVA
                     LAKAGFFYEPHLKSPDNVVCFLCEKSLDGWEENDNPVGEHLKHSPTCGWAIMAAIEAG
                     YGNYGKLHPLDPAMVEARKATFAGRWPYESKKGFKCKTKKLVEGGWKYTPSLEADDMT
                     TCAYCDLALEGWESDDNPFDEHYKRKPDCLFFALINQYPAPKKGRGRAARSSKPSRLS
                     VQSVATVATTVSDLTSTADISADHDDSVMTTASTMTQGGRKTAKGRKPVTGKGRKTKA
                     KKEEAVDILEDGGQELQQQSGARGHKRASDAMEDPSVVNAEAPASKKRATKARASMAV
                     NTSSIIDADMGDALPAKQPASRKRASASTAKTKRMTSRASITSQASTASLRAQMPDDD
                     ELERQLEADLERYNSDADGISVEQIPPPARGRPKKATTARKVSVQKKKKAEHDSRAML
                     DPTPMVPNDAEIEADFEAIQAGMEVEQIAAAGTLAVPKKGRKAGTRKVSRQISKVKEP
                     VPPSEPAEAEEVRALEQAQARDIDAPQPQPDVEMVPAEDPDVSTETVLTKPVAPPSNE
                     KRRRGRPSKKSTASQASVEDLAPRPSMEASGKVAATQPRESIPAPTDPPDAIFRKLAP
                     DSSLNSARSQLPASVPATTTTPQKSSKTLPAPPSSSSRLPQPPSTPRTRPSLSARSNN
                     QTTGTTRTRSSPQSSDAENQPPTSLQPAASVLPKRVVLAPLDTAVAQTPNRNSPSRRN
                     IISGLQSSHPWEPADLDLLFSSSPVRSPHDGEDDKENGHSGQRGVAKLLRKGAELTSP
                     EKRMTVEEWIYHNAGLAEQKLKRECEAMVAAFEAEGMRALKVLEGLVVEA"
     gene            complement(<2273960..>2274271)
                     /locus_tag="MYCTH_2069697"
                     /db_xref="GeneID:11514177"
     mRNA            complement(join(<2273960..2274002,2274144..>2274271))
                     /locus_tag="MYCTH_2069697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666070.1"
                     /db_xref="GeneID:11514177"
     CDS             complement(join(2273960..2274002,2274144..2274271))
                     /locus_tag="MYCTH_2069697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666118.1"
                     /db_xref="GeneID:11514177"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="JGIDB:Spoth2_2069697"
                     /translation="MGHKTRKGVLYVTSFFVPPLAVYLRRGTNADFGLNVLLTLLGWI
                     PGVLHAMYLVSK"
     gene            complement(2275364..2277660)
                     /locus_tag="MYCTH_2310565"
                     /db_xref="GeneID:11514178"
     mRNA            complement(join(2275364..2277349,2277422..2277660))
                     /locus_tag="MYCTH_2310565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666071.1"
                     /db_xref="GeneID:11514178"
     CDS             complement(join(2275745..2277349,2277422..2277454))
                     /locus_tag="MYCTH_2310565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666119.1"
                     /db_xref="GeneID:11514178"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="JGIDB:Spoth2_2310565"
                     /translation="MVRGRIPAAVLSRLAPRSRPLRLVFTPYVKASSAVQLGYPLVPA
                     RNYGTTRNDGAGGVHANEAQESARHDAAADSAAATARTDAKSAQGLAKEATTSSIAGS
                     SVVSDVQDWEYDPNMKVESFRDLPHANFGVNQHIPFDAEFKEVLKAIPWQFRAPIRYA
                     FAYGSGVFPQSKPSGKTATEEEIRSVHPKAPLAVQRAQDGTPKMIDFIFGVSHTQHWH
                     SLNMKQHRDHYSSLASLGSGAVSYVQDRLGAGVYFNPYVVVNGILIKYGVVQLNTLEK
                     DLTQWDTLYLAGRLHKPVKILRDDPKIRLANQMNLLSALRTALLLLPPNFTEEELYGT
                     IAGISYLGDPRMALPTENPRKVKNIVGNNMANFRRLYLPLIETLPNVAFNDPGVSAKD
                     WIWDETKNLRLAQDMDPVRRGNMVRRLPKAFRSRLYFQYQKKLAIPSEEFRKMMDESK
                     HEDSVAFKRREGGGFERRIAQDDPVELRNYIRTVIKQTIGWPATTQSLKGPLTSGFRR
                     TWRYLREKIDKYRQGRRAEKENAANGPESTSGSDGSA"
     gene            2278491..2281135
                     /locus_tag="MYCTH_2310567"
                     /db_xref="GeneID:11514179"
     mRNA            2278491..2281135
                     /locus_tag="MYCTH_2310567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666072.1"
                     /db_xref="GeneID:11514179"
     CDS             2278582..2280852
                     /locus_tag="MYCTH_2310567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666120.1"
                     /db_xref="GeneID:11514179"
                     /db_xref="InterPro:IPR008672"
                     /db_xref="JGIDB:Spoth2_2310567"
                     /translation="MTMMLNRQQIPSFRNSTTTQPSYNILTGEPNVPGGTMARPGSRQ
                     GSVSGPSPPRGRAATAASSLSRESSKENRPPADAEEYEAQRRRIEELKAEVGTLQYQI
                     SSYEQEKELARLQMENEMRDTKRRAEDDFKAKQAAEAERGKAQRQVEALQSELDELRA
                     EKERQKRDLEAKARDALEEARLLQEQLEELSAAKDEAARMAEREAIDLRAKLASLQRT
                     ANELEEENKAKDDALEKAQSQLAERDETIGRLEADVLRLKAQTGDAETIAVIRRELSD
                     QVIHIRNLEAKNREQGMELKHLRQVHKAVEIVEEEKRSLQRKLEAVEAIQQELDEERR
                     QRQRLEDERQSWAAYLQDEPGADGQNEFSSPEDVARALVAERLRSASLVEKLGELQPE
                     IADRDNIIKSLEDEKAELLDQVEKLRAAGGSGAGNDKARARLERQRALAQKEVEYLRA
                     QLKTFEMEDMTLQPESVDQQKVKRIQELEDLVDKYKAEVSTLHADLSSLESASTSPVQ
                     PVLLGSKRPREADDAESEHLGQLARKNRKLQSELSELQTAHRLLQKEHEVATSQLASA
                     QAQLQTRILSLRSNPTSDHEATKAATLAALKLENAELLAHIQRQPTLFATVPASQLAA
                     AQREIAEAKAETASAQKSARRLKEVWAAKSAEFKEAVFSTLGWTVTFIPGGKMRVESV
                     YYPSRTDEHENSIVFDGERGTMKVGGGPRSAFAQKIGDNIKFWVRERGCVPCFLAALT
                     LEFYEERTRAGGGVEG"
     gene            complement(<2281420..>2284341)
                     /locus_tag="MYCTH_74487"
                     /db_xref="GeneID:11514180"
     mRNA            complement(join(<2281420..2282150,2282213..2283238,
                     2283294..2283922,2283985..2284049,2284127..2284219,
                     2284294..>2284341))
                     /locus_tag="MYCTH_74487"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666073.1"
                     /db_xref="GeneID:11514180"
     CDS             complement(join(2281420..2282150,2282213..2283238,
                     2283294..2283922,2283985..2284049,2284127..2284219,
                     2284294..2284341))
                     /locus_tag="MYCTH_74487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666121.1"
                     /db_xref="GeneID:11514180"
                     /db_xref="JGIDB:Spoth2_74487"
                     /translation="MASVDDLSRSEYPAMLANLQPSQAVQVLSDRVKRIARANQEIAD
                     WLQQYVAGLRKLLVFKVPNAASELGIFQAPWDKILSSTDGIAASHQLFAQRIDKDVEQ
                     PLRNFQNRKEMQNMQTISANLSAMAKELEDATEKSEKLSKKGGKANAQKVDQAAARLE
                     SATQTWESQAPFIYETLQALDEQRINHLRDVLTQFETHEVDQATRTQAAAEEVLNVML
                     EVNTAQEIQNFVQRTVAGKPKVEKKSFTRQPTPVTPTAAPSSITGDDGSEHSGHRENN
                     PPESKLRSRIGTMLGRRRQSVHGGFGQLGSPPKSLGSFSRGLGSSHSQTLSPRASSHN
                     LTGSQHRLPSVVESPTGEQGRDSTAENEQAKLSHEGTNGDASGEGPKDTQPSQPSLLN
                     GTAEDIFDAPGTAPPSQQRGRGEPDKDADGFTIPPQMNDPISQAQREAAAEEGDHPFK
                     LNIKNEPIPEEDQDAKQAALSSVANALNMGMPTRRTGTVRGRREVRNTVYMPSLPTHD
                     ISPEHPFPVSPSLPTSATVPKPTPPATFTSETSRASDTQSIRSGTSFGGGSSYSGIAR
                     IKHPEMSGPVYGPGLHSSIIETVSAVFQNGEPSWVRVTGEVALSYVSDPEAPFADHET
                     IRLNNFSTLESIGPNRAVVANTANPDEFSVDLSHLTTTTPVFTYRVHADSDTALASQC
                     PITISPVWKPQADKLGLLLQYRLNPSCALPRPITLSNVVFIATYEGARASGVQTKPSG
                     THLKDKHIVYWRLGDVTLTEEWSKIICRIIGEQNAEPMPGKVEVRWEWTPPAHSASEG
                     GSGISVARLLPEEKGKGKAVEVEEEDPFADASSVPPSPDPTGQQGRAWADVPVVKRLV
                     SGKYESK"
     gene            2284843..2286628
                     /locus_tag="MYCTH_2140577"
                     /db_xref="GeneID:11514181"
     mRNA            join(2284843..2285143,2285202..2285283,2285343..2286407,
                     2286528..2286628)
                     /locus_tag="MYCTH_2140577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666074.1"
                     /db_xref="GeneID:11514181"
     CDS             join(2285079..2285143,2285202..2285283,2285343..2286407,
                     2286528..2286578)
                     /locus_tag="MYCTH_2140577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666122.1"
                     /db_xref="GeneID:11514181"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2140577"
                     /translation="MAESDWRSSLTATQRYDNIQNLMRVLAAAGITQSAFEIENEAYK
                     TAANREEYDAACNPPVSKAEDPESPVSQPDSAVVEHAGRESLPGITIGNYPNCHYIAS
                     GVTSEVYRADVHALKVVVETHNIEPHNPHREAKILSSLRDPDARSSLRDPNPPHIIPL
                     LETFRDPKTQNFVLVFPYAPFTLASLLSTHRPASSPLPDAVTRTIFTGLFRALSHLHS
                     RCIIHRDIKPSALLLTTPTPTDPSQVYLSDFSTAWHPTFSPGDNNTEPAHHKILDVGT
                     GPYRAPETLFGNRSYGPPVDLWAAGVTLAECFARRPPFESRPAHEDGNQLGLVLSIFQ
                     TLGTPTPETWPEAVGFRTPPFEMYRVFEGRVATEGWQAVVPGLPSGEGSWMELVQGLL
                     RFESAQRVTADEALKFPCMKEGGGDKSE"
     gene            complement(2286713..2290083)
                     /locus_tag="MYCTH_2096434"
                     /db_xref="GeneID:11514182"
     mRNA            complement(join(2286713..2287011,2287080..2287192,
                     2287291..2287355,2287415..2287466,2287527..2287597,
                     2287650..2287665,2287722..2287765,2287853..2287865,
                     2287933..2288005,2288075..2288088,2288145..2288208,
                     2288266..2288324,2288384..2288424,2288514..2288532,
                     2288620..2288750,2288812..2288854,2288908..2289383,
                     2289467..2289490,2289547..2289713,2289860..2289877,
                     2289948..2290083))
                     /locus_tag="MYCTH_2096434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666075.1"
                     /db_xref="GeneID:11514182"
     CDS             complement(join(2286951..2287011,2287080..2287192,
                     2287291..2287355,2287415..2287466,2287527..2287597,
                     2287650..2287665,2287722..2287765,2287853..2287865,
                     2287933..2288005,2288075..2288088,2288145..2288208,
                     2288266..2288324,2288384..2288424,2288514..2288532,
                     2288620..2288750,2288812..2288854,2288908..2289383,
                     2289467..2289490,2289547..2289713,2289860..2289877,
                     2289948..2290015))
                     /locus_tag="MYCTH_2096434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666123.1"
                     /db_xref="GeneID:11514182"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="JGIDB:Spoth2_2096434"
                     /translation="MAGEPGEAMAHSAFDTILVLDFGSQYTHLITRRLRELNVFSEML
                     PCTQKLSELKFKPKGIILSGGPYSVYEEGSPHVDPAVFDLNVPILGICYGMQELAYRL
                     NPENVIAGTHREYGHAMLKARSLDNHVDRLFEGIEESMRVWMSHGDKLAKLPEGFHTV
                     ATSDNSEYAAIGHETKPIYGLQFHPEVTHTQNGSKLLKNFAVNICGCKQEWTMQKFLD
                     EAIAQIRHTVGEKGQVLAAVSGGVDSTVAAKLMKEAIGSRFWAVLVNNGVMRLNECEQ
                     VQKDLSEALGINLTVVDASQQFLDGLKGIEDPEKKRKFIGGKFIDIFEEEAIKIEKAA
                     ASDPTKAGKIEFFMQGTLYPDVIESLSFKGPSATIKTHHNVGGLPARMANGQGLKLIE
                     PLRSLYKDEVRALGRALGIPEELVMRHPFPGPGIAVRILGEVTPEKVEIARQADHIFI
                     SEIRKAGIYDRISQAYAAVDPSRAVGVMGDKRVYGYIVVLRAVTTTDFMTAEAYNFPW
                     EFLQRVMNRIVNEVHGVCRVVYDITSKPPGTIELE"
     gene            complement(2290562..2291089)
                     /locus_tag="MYCTH_2310585"
                     /db_xref="GeneID:11514183"
     mRNA            complement(2290562..2291089)
                     /locus_tag="MYCTH_2310585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666076.1"
                     /db_xref="GeneID:11514183"
     CDS             complement(2290679..2290837)
                     /locus_tag="MYCTH_2310585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666124.1"
                     /db_xref="GeneID:11514183"
                     /db_xref="JGIDB:Spoth2_2310585"
                     /translation="MEARAERAAPPPFPRRLEELRQARLVPPSWLAWESPQIYPASLR
                     IPVRDGHH"
     gene            2291358..2293243
                     /locus_tag="MYCTH_2310586"
                     /db_xref="GeneID:11514184"
     mRNA            join(2291358..2291513,2291635..2292919,2293155..2293243)
                     /locus_tag="MYCTH_2310586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666077.1"
                     /db_xref="GeneID:11514184"
     CDS             join(2291460..2291513,2291635..2292919,2293155..2293159)
                     /locus_tag="MYCTH_2310586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666125.1"
                     /db_xref="GeneID:11514184"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2310586"
                     /translation="MKNRQKSRSGCQICKLRRLRCDETKPGCRNCAQKGFECPGYQQR
                     LQWSTKHERPTTTQTRGPPNFSQLVTAASESIVSTPATTAQRSGHGGARASPVVPVFD
                     GRTRPTTFLSPSTSASPSASGSYSSPSSSTASPPAHHEDSTVSAEAHARLAPVLNSVA
                     SNDNNAMTPTPKTEPGTPDEAEQASGLTMFQPAVDIPTFLIEHWFKSVCPSWSALDSP
                     ANPYRSLTAKLWHSSTPVFYALQSISAASLVERLPHVMRDTAQAAPRKADEAIQEELC
                     AFSTATRPKFPTELLLSLFCMSSSTCWLEASQLGQQYLRQARAVLKVLEGWTLDSESQ
                     ELLTFFKGCLIYEEMLRSVVSDGEDEIQHMLGWPEPAIRLPLVPANPHPWTGVSSEIL
                     RPFGKALALCRRSRNRWRLSGATTYRVLKGAMKDIEEAKKVEDNLFLAGVPQIIV"
     gene            2294627..2294955
                     /locus_tag="MYCTH_2310587"
                     /db_xref="GeneID:11514185"
     mRNA            2294627..2294955
                     /locus_tag="MYCTH_2310587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666078.1"
                     /db_xref="GeneID:11514185"
     CDS             2294653..2294874
                     /locus_tag="MYCTH_2310587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666126.1"
                     /db_xref="GeneID:11514185"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="JGIDB:Spoth2_2310587"
                     /translation="MGPIGQLQPLKLYSHKRGSNPWKVALTLEELDISYVSEYLEFDQ
                     TKTEPSLSLNPNGKLPTLRIPTVKWLFLS"
     gene            2294956..2295402
                     /locus_tag="MYCTH_2310588"
                     /db_xref="GeneID:11514186"
     mRNA            2294956..2295402
                     /locus_tag="MYCTH_2310588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666079.1"
                     /db_xref="GeneID:11514186"
     CDS             2295036..2295392
                     /locus_tag="MYCTH_2310588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666127.1"
                     /db_xref="GeneID:11514186"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="JGIDB:Spoth2_2310588"
                     /translation="MSAQGPACGHKVWLNRTYAANDLHAANEYFTKDIKRVISVLDSQ
                     LRRRKGPFLLGPNISYTDLTFVPHYLMLSLFVPGYDPAIEHPDFAAWLERLKSRPSVQ
                     KIVAVKEELGKRTISY"
     gene            <2295829..>2296466
                     /locus_tag="MYCTH_2112885"
                     /db_xref="GeneID:11514187"
     mRNA            join(<2295829..2295873,2295929..2296241,2296350..2296374,
                     2296421..>2296466)
                     /locus_tag="MYCTH_2112885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666080.1"
                     /db_xref="GeneID:11514187"
     CDS             join(2295829..2295873,2295929..2296241,2296350..2296374,
                     2296421..2296466)
                     /locus_tag="MYCTH_2112885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666128.1"
                     /db_xref="GeneID:11514187"
                     /db_xref="JGIDB:Spoth2_2112885"
                     /translation="MHRHGTRAEWFFKKNVKCGDKPCAACRSNNAKRIWRDDSVASAS
                     SSSTLSSPSRSRTSSLPLVLAADTVASDFSSALNPAEESNTSVSPNPPPTAHGVEAST
                     SNFLPSLAASSPTDPSTRKDGSAMRPKYLEINEKATFLTI"
     gene            <2298233..>2300365
                     /locus_tag="MYCTH_2130022"
                     /db_xref="GeneID:11514188"
     mRNA            <2298233..>2300365
                     /locus_tag="MYCTH_2130022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666081.1"
                     /db_xref="GeneID:11514188"
     CDS             2298233..2300365
                     /locus_tag="MYCTH_2130022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666129.1"
                     /db_xref="GeneID:11514188"
                     /db_xref="JGIDB:Spoth2_2130022"
                     /translation="MKKNDVPESYDDLDVSDMIRTGKLRSHIGRSSPEPVARNLKIEV
                     PLLLCGDDHTSTVQGTRVLALDDLSDAKELIESSDTLSGSDGPTGQLVALFQTSAASV
                     TRFAEQEKLRPLDATVRVTVPVMDFSIPVPEWEERIWEAKEMFQWVQKNLGIDWYNSF
                     KWPHNRAAEQRLAWVPLPHVRSKKLVLEQLEVNAASLEFFLDGDSDDESFTSANYVYK
                     EPGLAVLRSETNDDEGYLAPLQMSVQPLLGDSKNTGFVVKMTSPGEPAPTLLSNSPST
                     ASGTASTSADLTNLLNRRKRQIEEALLKRRPDAEQRWPLAADPEVSASDIIDPTLISS
                     TNVLRGFVSEYTDFGPLVDNFLEMHFPKKQKLTHSSYFTQQASTKSASQFKSDEAARL
                     MPPPPKPVPALAPTINRPETPPRIVISSAISPNLIQQLERLVPAIELIPRNYERHRTD
                     WCHSGTELPNLDEADIVVSPATGILVTTMVQLRQRAIPGGQLRESKTSITSVAAVVTK
                     TTTTTNFFHVLESVVVRHERVVVLVSEGNRHNETASPLSQSDARALAELQGFGAGLSV
                     ATAHVHVVYVGGGVETLAKWIAAVVCENYAREAAAVRELLLPVETSWEVFLRRAGMNV
                     FAAQVVLGKLKVPDGGPAIGGQGGQMFGLPLFVTMSREQRVELFAGALGGRRVLDRVS
                     DVIDGPWGKRAVNQLVVNSTMSSKWEAN"
     gene            complement(2300498..2302305)
                     /locus_tag="MYCTH_2310589"
                     /db_xref="GeneID:11514189"
     mRNA            complement(join(2300498..2302004,2302067..2302305))
                     /locus_tag="MYCTH_2310589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666082.1"
                     /db_xref="GeneID:11514189"
     CDS             complement(join(2300630..2302004,2302067..2302176))
                     /locus_tag="MYCTH_2310589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666130.1"
                     /db_xref="GeneID:11514189"
                     /db_xref="JGIDB:Spoth2_2310589"
                     /translation="MSSPKVRLVASTSNPNGSLPVRNEAHTHDSFFKSVQWSADGTTL
                     FTSSFSNRICTFVLPETLLEPRQSPAELTATSALALPEPTSAIAPCPYFALENPSTQV
                     LLTASTDHPIQLHHAFPPSSPSSTSSSHANDTYHNDDDDSQTTTPSTPASSSPAPPPP
                     PPTGRPRPIASFRLIKQETEAYLPIASLLWPAPGTHFIAGTANRIALFDVSRPDALSP
                     DPLLSIATIPSARHLAKGGGVGMRGMVSALAAQPVSSAVDDGGGGGAGWGWGWGLLAA
                     GTWTRNLGVYDLVRSGDCVATWSVEGAAKEAGIGGRGVMQTLWSPCGRYLLVNERAAT
                     GLLVYDLRGTHRLLGVLEGRDGTTNQRLSCDVFPGSERTGGFEVWAGTKDGAVVAWEG
                     VGNQEGAVQPTWTWKAHGSAVGATAMHMSGSVVATCSGAWTFVGGDSSDSSEESGSEA
                     STARRGSSKPRIAVKETSLKVWSLDSSFSSQSEEAVMDRGSAET"
     gene            2302516..2303956
                     /locus_tag="MYCTH_2310592"
                     /db_xref="GeneID:11514190"
     mRNA            join(2302516..2302751,2302806..2303063,2303122..2303956)
                     /locus_tag="MYCTH_2310592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666083.1"
                     /db_xref="GeneID:11514190"
     CDS             join(2302678..2302751,2302806..2303063,2303122..2303761)
                     /locus_tag="MYCTH_2310592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666131.1"
                     /db_xref="GeneID:11514190"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Spoth2_2310592"
                     /translation="MESLIAEDRCEELRDLSIVNLIVSIVIVIGMLISYLPQHVRIIK
                     RGTSEGISPYFVLLGTTSATSAFANILLLPKSRQDVACCKEIETFHCIAGLLGIAQLG
                     VQWICFTFIFVLFLVFFRYKSVDDTYDEEPDEDSPRWQTALLVASLTLLHGLAVIVIT
                     GILSTVAKEYLPAWANALGVMAALLAAVQYVPQIWTTYHLKHVGSLSIPMMCIQTPGG
                     FLFAASLFARLGWSGWSSWGIFVLTATMQGLLLCLAIYYEVKAHANSADAPKSPSQLP
                     HRSQQRVNGFDGDSRADLEGDGATDTTPLLQDGRNGDTRRDYDTHRG"
     gene            2303957..2305133
                     /locus_tag="MYCTH_2310595"
                     /db_xref="GeneID:11514191"
     mRNA            2303957..2305133
                     /locus_tag="MYCTH_2310595"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666084.1"
                     /db_xref="GeneID:11514191"
     CDS             2304818..2305054
                     /locus_tag="MYCTH_2310595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666132.1"
                     /db_xref="GeneID:11514191"
                     /db_xref="JGIDB:Spoth2_2310595"
                     /translation="MSSWELQDGQNVVVGRQNTAPCPNGNGTTIGTAQEFTVLCNTRL
                     AGDVLDRFEASSSWRQGTASRARGRTMTGIGNSP"
     gene            2305740..2307884
                     /locus_tag="MYCTH_2310597"
                     /db_xref="GeneID:11514192"
     mRNA            join(2305740..2306599,2306732..2307347,2307487..2307884)
                     /locus_tag="MYCTH_2310597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666085.1"
                     /db_xref="GeneID:11514192"
     CDS             join(2306110..2306599,2306732..2307347,2307487..2307667)
                     /locus_tag="MYCTH_2310597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666133.1"
                     /db_xref="GeneID:11514192"
                     /db_xref="JGIDB:Spoth2_2310597"
                     /translation="MAVTHVPVAAGHDEDSDHHELPSNAQQHPHPHSQPALHQHSLSN
                     ASTATVDIEAWTVAALESLSIAPVARGTGNALSIPLDGDALPGQSQRGSTPHNGAGGG
                     GTPSGMKLRGVAFDDGRGSAAPYGAPITPPRRPPSRRDSMRRRDALLKGKEGSRQRRR
                     WENDHLLHVPNVVPPLPSDWQICPTHRVLPPVPYQLAQYWDKGLRERAEAEKQRRRQK
                     QKRNTEQQQQQQPEVGFVPRDLRNTAKRTPAVKSWLRALEEPVRAFVVERGLAVPPGA
                     GAGAAAATTTTTTTTTTSARENKSGESESDTDSDDEEIVFVGRNARNARDGESWKKAQ
                     RNVAGQKQQQQQQVEEERGMVLEMEDDEGGGGAFKRWLTHSISDYYGLDSKSVMVGNP
                     ARRVVYVGVKQKQKQAALRQKPPNRPLLPPPLWEMF"
     gene            complement(2308141..2310493)
                     /locus_tag="MYCTH_2310599"
                     /db_xref="GeneID:11514193"
     mRNA            complement(join(2308141..2308924,2308996..2309185,
                     2309251..2309885,2310035..2310493))
                     /locus_tag="MYCTH_2310599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666086.1"
                     /db_xref="GeneID:11514193"
     CDS             complement(join(2308248..2308924,2308996..2309185,
                     2309251..2309799))
                     /locus_tag="MYCTH_2310599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666134.1"
                     /db_xref="GeneID:11514193"
                     /db_xref="JGIDB:Spoth2_2310599"
                     /translation="MKYGTALVALAGLSSAREINIYSRKLSKREVPQEHSHEATLRAT
                     NEALKLNNPLNIQDAVFALLGNAAAAQGAGDVTNLDCLQQIIADQAFTNAKAAGDLEL
                     MTQAILYRALERNTGSVGQASVLCNETATNPEIANIQQHQDPASPEAANNAAIELEVA
                     KSLASIGADPLLALQSATFPPGEIGDPTAKGNTCDDPDDPQGCIFTLNLLTPAVTEDE
                     ILAAVADITPGAGAGGDVDDGVDDGSDDACEVIVTPPANDTQVVAPPSNNTDGGNGAG
                     DSATGTVNIQTFTGSLGGVPPPVESTAGSDRPFSVNGATFTTANAALQRSCSIQKNAC
                     ANAANSGQLQGGVQQCEQQEAECRAANNLKRFRRSSPTRRQVNGLDFGTCGSPAIQFA
                     VGLDGRKEASFQNVNTADFNHGSAQAIRIIADFTCSRLQSSCKAPQETVQACQQASQA
                     AQAASGQAAADAFNSALGVSA"
     gene            complement(2311267..>2312452)
                     /locus_tag="MYCTH_2316294"
                     /db_xref="GeneID:11514194"
     mRNA            complement(join(2311267..2311647,2311719..2311869,
                     2311941..2312029,2312182..>2312452))
                     /locus_tag="MYCTH_2316294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666087.1"
                     /db_xref="GeneID:11514194"
     CDS             complement(join(2311466..2311647,2311719..2311869,
                     2311941..2312029,2312182..2312452))
                     /locus_tag="MYCTH_2316294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666135.1"
                     /db_xref="GeneID:11514194"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005806"
                     /db_xref="JGIDB:Spoth2_2316294"
                     /translation="MSRALARSATAAASSARLPITAVRAVSSTPALRDASSTFESPFK
                     GEPKNKVPDFSKYMAKGSSGSNALFSYFMVGSLGAISAAGAKSTIQEFLVNMSASADV
                     LAMAKVEVDLNAIPEGKNVIIKWRGKPVFIRHRTAAEIEEANSVNVASLRDPQADADR
                     VKKPEWLVMLGVCTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPT
                     YDITDDNKLVVG"
     gene            complement(2313400..2317152)
                     /locus_tag="MYCTH_2310607"
                     /db_xref="GeneID:11514195"
     mRNA            complement(join(2313400..2313751,2313823..2316886,
                     2317016..2317152))
                     /locus_tag="MYCTH_2310607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666088.1"
                     /db_xref="GeneID:11514195"
     CDS             complement(join(2313452..2313751,2313823..2316654))
                     /locus_tag="MYCTH_2310607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666136.1"
                     /db_xref="GeneID:11514195"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="JGIDB:Spoth2_2310607"
                     /translation="MRDSQSQDRCLVDPTGRFLAMHLWEGVLTMMRLGDRKNKMVLTW
                     MDQVRLSELFIRASTFLYTETGHPKIAFLYQSRADSGDAKLATYRMTADDRNTEASKF
                     NPERDREIDMDVPDSSASMLIPVRKVEEGVKRHNVRNVESAKAHIGGLVVVGETRLLY
                     IDEVTKVTVQSALKEASIFVAWAEYNAVNYFLADDYGNLHLLTLVTENADSVVVTSLD
                     VNWIGKTSRASHLVYLGNDLLFVGSHYGDSQLFRLDLQNEDPKALLQLVQTLHNIGPI
                     LDFAIMDMGNRGDEGQLGNEYSSGQARIVTCSGVHKDGSLRSVRSGVGLEDVGILADL
                     EHCRGLFSLKSYGAPKTDILAVSFLTETRVFKFDAQGDVEELESFAGLAFDQQTLLAT
                     DLQGGRLLQVTPAAATVLDTESGLTVASWKPGDQRSIINASANSKSLLLSVDGTELVS
                     LSISDDLQVVRTRDISKQDQIACIHVPAQPDNVGVVGFWSSGTVSIIDLHTLEPIHGE
                     SLRTSQDDASIPRDLALVQILPPGVSGPTLFVAMQDGNVVTFNITKDLALSGRKRVIL
                     GMRQARLHLLPQPDGIYSIFATTEHPSLIYGSEGRIVYSAVTAEEATYICPFDAQAFP
                     ECIALATDKQLKICHIDRERRTHVKPLAMNEMVRRIAYSPKEKVFGLGCIKRELVAGE
                     EVVQSSFKLVDEVIFDRVGRSFPLGAPSYTELVECVVRAELRDSYGNPAERFIVGTSF
                     LPDPDYGPGTDVRGRMLFFGVDADRNPYLILSHELKGACRCVAVMEDGTIVAGLTKTV
                     VVCRYEETSSTTGELTRLASYRPSSYPAEICVRGNTIAVADLMKSVSLVEYVPGDGTP
                     RLVERARHFGSVWATAVGFVREGSWLEADAQGNLMVLRRNVEGVTAEDRRRMEITSEM
                     NLGEMVNRIREVEVETTPGALVVPRAFLGTVEGGIYMFGTVAPHVQDLLLRFQGKLAD
                     VLKTAGDIPFRSYRAFRNAEREGDGPFRFLDGELLERFLDVDEATQEIICKGLGPSVE
                     DMRNMVEELRRMH"
     gene            complement(<2317643..2318600)
                     /locus_tag="MYCTH_2310609"
                     /db_xref="GeneID:11514274"
     mRNA            complement(join(<2317643..2317688,2317742..2318600))
                     /locus_tag="MYCTH_2310609"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666089.1"
                     /db_xref="GeneID:11514274"
     CDS             complement(<2317744..2318400)
                     /locus_tag="MYCTH_2310609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666137.1"
                     /db_xref="GeneID:11514274"
                     /db_xref="JGIDB:Spoth2_2310609"
                     /translation="MSDRSEATSAEDVAASFHLANRAGYNYVHLRQWELFEKSLANLW
                     TPDHPDGVSVELAVEKSSRLILSSDRVQSQPELSRERPHAQRGCRVLYIGRNLAVAPV
                     HHLTYGSGPKGSPRLIRQALASYLNSSFQPHRAVRHEDILVLSGVTSVIDSLAWSICD
                     EGEGIIIPQLTWPPYIVQEIWAKMLDDKSFTENFLMVNRQRLGDQYAFATRFLDEHGI
                     A"
     gene            <2320435..>2321188
                     /locus_tag="MYCTH_90076"
                     /db_xref="GeneID:11514275"
     mRNA            <2320435..>2321188
                     /locus_tag="MYCTH_90076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666090.1"
                     /db_xref="GeneID:11514275"
     CDS             2320435..>2321188
                     /locus_tag="MYCTH_90076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666138.1"
                     /db_xref="GeneID:11514275"
                     /db_xref="JGIDB:Spoth2_90076"
                     /translation="MANLPPRPVFTNLGDGTPAYNSRARGSNLPSGMNPGHSTNPRHF
                     HPYDRRLSTPTTQGSRFATIPPWRRNRIHHNSQPGFPTHQYTGQYSAPFSGGTAFASH
                     RVPVNINATRARQQQQGGRQSVPANYAVNEPMVPFSRSAVSSSSHPASCSSEATATTT
                     RGANGAAGSAPSPNLGAGETSPRSFSAINTVSHGAGSQPSWHGVSQTTSSTTLGGRPF
                     ASNNPPTCTSQTTPSKTTTTGTAATTTTTATTI"
     gene            <2321611..>2322361
                     /locus_tag="MYCTH_36460"
                     /db_xref="GeneID:11514276"
     mRNA            join(<2321611..2321758,2322099..>2322361)
                     /locus_tag="MYCTH_36460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666091.1"
                     /db_xref="GeneID:11514276"
     CDS             join(<2321611..2321758,2322099..>2322361)
                     /locus_tag="MYCTH_36460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666139.1"
                     /db_xref="GeneID:11514276"
                     /db_xref="JGIDB:Spoth2_36460"
                     /translation="GSVDMGVDTLWRLGRLQPGLGLGAGLVARLRGPMERFVKGLGKI
                     GGWTDYAIAATRGRVLDRIFAAAQQSLLKWTIGIGCRPCANLTCNTNRMAAINVFLLW
                     SGLYPPSRLLSKSISEMVSALQYITATDAELSAAA"
     gene            complement(2322788..2324018)
                     /locus_tag="MYCTH_2310610"
                     /db_xref="GeneID:11514277"
     mRNA            complement(join(2322788..2323592,2323693..2324018))
                     /locus_tag="MYCTH_2310610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666092.1"
                     /db_xref="GeneID:11514277"
     CDS             complement(join(2322942..2323592,2323693..2323776))
                     /locus_tag="MYCTH_2310610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666140.1"
                     /db_xref="GeneID:11514277"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="JGIDB:Spoth2_2310610"
                     /translation="MSDSPKILIVLTSHDKLGDTGKPTGWYLSELAHPYSVFASHGFT
                     ITLASPAGGPAPLDPSSIEAAAASSDAVSQSFLAEQRALWESTEPLASFVGRAAEFAA
                     VFFPGGHGPMFDLATDPTSQALVREFAAAGKVLAAVCHGPAALANVRTGGDDAGQAGE
                     FLLRGRRVTGFTNAEEAAVGLDRAVPFLLEDRLRELVGSEGAFEKADADWGEKVVVDG
                     KLITGQNPASATALAEAIVRAVLGSA"
     gene            complement(2325166..2327298)
                     /locus_tag="MYCTH_2310612"
                     /db_xref="GeneID:11514278"
     mRNA            complement(2325166..2327298)
                     /locus_tag="MYCTH_2310612"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666093.1"
                     /db_xref="GeneID:11514278"
     CDS             complement(2325301..2327130)
                     /locus_tag="MYCTH_2310612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666141.1"
                     /db_xref="GeneID:11514278"
                     /db_xref="JGIDB:Spoth2_2310612"
                     /translation="MRSDLFDCLPQSAALLLLSSILQLTDAHAVQRLPRKTPEPTITV
                     PYRALNVAPWPLHATPPPGGDTFANRRRQLDDTFNTVCGYINGDQNLPATCGQGSHCV
                     VDTDHNVVGCCPNGAPSCTAGVFTGCVDGNSGPQTEVNPYIYSCTGSDVCYMNVYEGG
                     FSQYGCGTASDLAATVQNSASGITAVLTRPTVSVSYTQGISTLSEPTTLGTPRSRTRS
                     STVRTSHSSSATSASSTSSESTSSTSEPAAPPATDKSYRTGAIIGGTIGGLAVLIALG
                     ALAFFLRRRNANIRQGPGLGGVRGKIISPPQPGKGTGFAALASDDADAFETGPAGSVL
                     NQPYPQQQQQQQQPQMTMHTTAAPTAAAPTAAAAAAAAAGAAASAPPTNRSLLPPIAT
                     SPPMPFQSEVSPVDRHDLDTPYAYSNSAVSASAAAASGLSAISVSPYPPSSSGGVSSA
                     DSGNSLPTSAMAAAAAAAGAAAYQHHQPYQNPGPTAYAGGSGVLMGMNPLLLNRGAER
                     HLESDQVPLTSGREVDDFSHGYHAALGRIGEEDEEGEEEQRRSRGYGGDQAPYRDHVG
                     ESAGDNAATGGTGSGDGVKTVLRGEARPLWQQNRRQSRNLMWM"
     gene            complement(2328945..2330779)
                     /locus_tag="MYCTH_74462"
                     /db_xref="GeneID:11514279"
     mRNA            complement(join(2328945..2329554,2329666..2329755,
                     2329823..2330779))
                     /locus_tag="MYCTH_74462"
                     /product="glycoside hydrolase family 5 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666094.1"
                     /db_xref="GeneID:11514279"
     CDS             complement(join(2329334..2329554,2329666..2329755,
                     2329823..2330624))
                     /locus_tag="MYCTH_74462"
                     /EC_number="3.2.1.78"
                     /note="CAZy_ID 267957"
                     /codon_start=1
                     /product="glycoside hydrolase family 5 protein"
                     /protein_id="XP_003666142.1"
                     /db_xref="GeneID:11514279"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="JGIDB:Spoth2_74462"
                     /translation="MKAIFALGTCLLSAAQCLPSARATASSGAEGTRFSIDGKTGYFA
                     GTNSYWIGFLTNNKDVDTTLDHIASSGLKILRVWGFNDVNSRPSPGTVWFQLLSSSGS
                     EINMGPDGLQRLDYVVQSAEKRGVKLIINFVNNWDDYGGMNAYVKAFGGTKEGWYTNA
                     RAQAQYKKYIQAVVSRYDKSDAVFAWEFANEPRCKGCSTDVIYKWATDISAYIRSLDP
                     SHMITLGDEGFGLPGDGTYPYQYSEGVDFVKNLKIKDLDFGTFHMYPDSWGVPYSFAN
                     GWIKSHADACKAANKPCLLEEYGAYASCDIQKPWQQTALSFAADGVSGDLFWRWGDQL
                     SYGLSPNDGNTVYYGSSLAQCLVTDHVKAINGSGAV"
     gene            2331544..2334461
                     /locus_tag="MYCTH_2310616"
                     /db_xref="GeneID:11514280"
     mRNA            join(2331544..2332060,2332132..2332900,2332958..2333009,
                     2333062..2333186,2333309..2334461)
                     /locus_tag="MYCTH_2310616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666095.1"
                     /db_xref="GeneID:11514280"
     CDS             join(2331774..2332060,2332132..2332900,2332958..2333009,
                     2333062..2333186,2333309..2334289)
                     /locus_tag="MYCTH_2310616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666143.1"
                     /db_xref="GeneID:11514280"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="JGIDB:Spoth2_2310616"
                     /translation="MPIRVKSRAQHAEALRTPSPTGMAHYSRYGAELPDISPDDSFRV
                     LVKKLSVYIAGVIQLPVTFEQLRTTSAGDGLRALVDHLGTNCTHPAIVNALLALKWHY
                     GAISEDKGLNEARANGCEIVAWRFLTHLSEREAVDYCLYEIPDPKDADASPSDEETAV
                     DEHSALLGQAWRGTANSARQAFAQPASLKRNMLLQSISRLTMSMTADDDDDEDEDDPT
                     AHFTNLNALEIAAIADAKRFLSQNVVQKIITGIWNGDIIFWDSLSVYSVKKPRFYKPA
                     TADPFSRLRVPKYLKSFEVIFFTSFLFLYYAVLMERDPTHITTLEIFLCLWLAAFAYD
                     ELSEWIDAGSIFYATDVWNIFDMAMIGIGITYFVLRIVGLETHNSRLVDLSFDILALE
                     ALFMVPRVFSILSLSPYWGTLIPCLKEMGKDFLKFMVLVVVIYVGFLTTFSLVGRDVF
                     SLKKMTGFLTRIFFGSSSVGFDIMYDIDPIFGPPLMTLFIMLSSILLTGSLTGMLSNS
                     FSRVITHAREEYLYVYSVYVLEASTSNRLTHFYPPFNLIALVIFRPLRLFLPSDHNFR
                     KARILLLKATHLPIVAVIEFYEWLRGRANKGTQYHAFRGPRYTTIGSPNPAATAKRFS
                     HQQRHKQSCASLRADASAAAAPNTLRPPLPLSNKTAPEMTATHPDMGASSSTEITPHQ
                     RQETAGEAEVGAMGAPSADVEARIADLSAKIERLTELVVALHANQSRRLTDVNVP"
     STS             2331822..2333429
                     /locus_tag="MYCTH_2310616"
                     /standard_name="ha2604"
                     /db_xref="UniSTS:515572"
     gene            complement(2334894..2338121)
                     /locus_tag="MYCTH_2310620"
                     /db_xref="GeneID:11514281"
     mRNA            complement(join(2334894..2336438,2336494..2336777,
                     2336828..2337397,2337461..2338121))
                     /locus_tag="MYCTH_2310620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666096.1"
                     /db_xref="GeneID:11514281"
     CDS             complement(join(2335159..2336438,2336494..2336777,
                     2336828..2337397,2337461..2338032))
                     /locus_tag="MYCTH_2310620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666144.1"
                     /db_xref="GeneID:11514281"
                     /db_xref="JGIDB:Spoth2_2310620"
                     /translation="MEPGARGRSPVARRVTPKLSSDTLYSLPYRPRKDAAHGRKTAAV
                     DIDGLDTGTAVSRRQDSEADPRKQPAAADALSLSGTTPPSSPTVTNFPAASKSMTPDS
                     AEAGRPQLVLTDSHGKVAAEAGDDAHFRKHNRGIGSIDSLLSSTTCVNTQSECSRTES
                     RLSREIRIEVKETDSGAPIVSHPKPKKQPSRVQLAPPSTTDRRGSVVNHSEGEGRMSE
                     DEESRLVNEISSWVLRNTFGKDVDDCAAPLLVWDCTYRYLRELWAATHEGNAGFIQTT
                     SGHGTPSPHYGGTSAPGGNDQQNSGYPGKGKRKADGGSDGGSGFGGRDKEEDDERDVS
                     PASQAYSSKGNITNFSCPYRKRNPLRFNVRDYYVCATHSFADMSQLKKHIRAHHPPVQ
                     RNAGPFLCPRCCQGFVSKNELDSHLRQLEVCRVSYDSGGADPEDGITQKIISSLEARS
                     LKAKIDNWVSLWKLLFPGDQVIPDPVFVPVMEVFDFITESRKFLDVLKDLLEIQYRHV
                     LEGASQLMDVDLKIKQGLERSTSSIYNWIETVVQDWEQKIAGTVSPFTSSAISQPATS
                     DSWASTPRLPPSPAPTPTVASGTAAASGILTGAESPSAPVTAAPRSTSARRRPNPQPK
                     RIKRPEILPKAPPPTQIPLPVQRARTPQSQSVLASNAFRPAPAVLPSQSIPMPPSTTQ
                     GLSPGPPYQTSWDNTPVTVAGAYSIPYTGAGDILQHQAAPTHFGSIHPHQLDVQPSYL
                     GPEQSETVSPDAMQHDADPSPQSAATMHANQISMSATPRSSLASLLWNRDENRDSSQT
                     LVEAHPPGRCHNMYCPSCNKTLPDDMSAQPSPVSIHPATGPLQQHNAFQTVGTGQGGG
                     PFQPSPGPGEIHSFGDQVEWYGGMHGVGGNGNMFGGGHHGPQEGY"
     gene            complement(2339211..2339326)
                     /locus_tag="MYCTH_t176"
                     /db_xref="GeneID:11514282"
     tRNA            complement(2339211..2339326)
                     /locus_tag="MYCTH_t176"
                     /product="tRNA-Leu"
                     /note="Anticodon: CAG"
                     /anticodon=(pos:complement(2339290..2339292),aa:Leu,
                     seq:cag)
                     /db_xref="GeneID:11514282"
     gene            complement(2344919..2346651)
                     /locus_tag="MYCTH_2310623"
                     /db_xref="GeneID:11506393"
     mRNA            complement(2344919..2346651)
                     /locus_tag="MYCTH_2310623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666097.1"
                     /db_xref="GeneID:11506393"
     CDS             complement(2345037..2346515)
                     /locus_tag="MYCTH_2310623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666145.1"
                     /db_xref="GeneID:11506393"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="JGIDB:Spoth2_2310623"
                     /translation="MKSIAFRGLRHLLWPWNGGGGGGSGSGSSSDGPRPLRPTAYLDG
                     LRGFAALMVYFHHHQLWAHATPEGDPVFQNAFGSHGEYHLATFFFIRNFFSGGHFAVA
                     IFFVISGYVLSAKPLSLIHAGEHVKLLDNLASAFFRRWFRLYIPVIVTTFVYVTSWHV
                     LGIYNAGQTPKKTLGEELWNWYVEFKNFSFLYKDGWLYMSANQHLWSISHEMRGSVII
                     FAACVALARATHKARLLCELALIFYFLYIVDGFSCALFMAGMLQCDLTLLARREGGGY
                     FPRWLRRLERHKTLIYYLLFVVGMYLGGVPSNTQEITELREEMGWHYLSYLKPQAVFD
                     FKWFYLFFAGNIMVACAARLGWLRRFLESAPCQFLGRVSYALYLVHGPVLHTVGDLIY
                     YAVGWSTGADIQVHGPGHGPVKHWESVLPLPKVGPLGLELSFLLPNLLIILPLTLWLA
                     TLVTRFVDEPSVRFPAWLYKRVLGGGEAEPKPVELAPLTRVE"
     gene            2347559..2349726
                     /locus_tag="MYCTH_2316301"
                     /db_xref="GeneID:11514283"
     mRNA            2347559..2349726
                     /locus_tag="MYCTH_2316301"
                     /product="glycosyltransferase family 32 protein"
                     /transcript_id="XM_003666098.1"
                     /db_xref="GeneID:11514283"
     CDS             2347843..2349261
                     /locus_tag="MYCTH_2316301"
                     /note="CAZy_ID 267769"
                     /codon_start=1
                     /product="glycosyltransferase family 32 protein"
                     /protein_id="XP_003666146.1"
                     /db_xref="GeneID:11514283"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="JGIDB:Spoth2_2316301"
                     /translation="MVAKLGSPLGKPSLAATTAQFRNCLPAQFRRVLPLYVAAICLVL
                     FVFNLNLFPSSVPISRPAVPAASVPQVRNEFPRKIWQTWKVNPLKFEERDLNTARTWL
                     AKNPDYRYEVLTDDNDMRYVEYHFGPNGFNRPDIVEFYRGLKAAIVKADLLRYMIMYA
                     EGGIYADIDVEALKPASKFIPARFDEKDIDMVVGVEIDEPDWKDHPILGPKSRSFCQW
                     TFMCKPQLPVMMRLIEQIMTWLNGVAKEQGVTIGEVNLDFDQIISGTGPSAFTEAIMA
                     EMEQNKEDPNLKIDWDLFHDLDESKVVSRVLVLTVEAFAAGQGHSHSGTHDSRAALVR
                     HHYHASNWPSRHPRYSHPAYGEVERCNWNPECVRTWDKNVEAFSKLSDEEKAKIIEQK
                     QKEKEEEEKKRKAEEEQRRKAEEEKKKKQKEEEKKKKEAEEAERKKKEEEEASKEKEK
                     EKAEGQQKEQEPEQQKKSGWFS"
     gene            complement(<2351254..>2352336)
                     /locus_tag="MYCTH_37947"
                     /db_xref="GeneID:11514284"
     mRNA            complement(<2351254..>2352336)
                     /locus_tag="MYCTH_37947"
                     /product="NADH:flavin oxidoreductase/NADH oxidase-like
                     protein"
                     /transcript_id="XM_003666099.1"
                     /db_xref="GeneID:11514284"
     CDS             complement(2351254..2352336)
                     /locus_tag="MYCTH_37947"
                     /codon_start=1
                     /product="NADH:flavin oxidoreductase/NADH oxidase-like
                     protein"
                     /protein_id="XP_003666147.1"
                     /db_xref="GeneID:11514284"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="JGIDB:Spoth2_37947"
                     /translation="MAPLTRYRASDEHVPIADLVATHYAQRAASLPGTLLVTEATLIS
                     PSAGGYDNVPGIYNADQVAAWRRVTDAVHAKGGYIFCQLWALGRTANPAVAAREGIRI
                     HSSSAVPLPVPLPGVENAPVPEALTVEEIKERVREYADAARRAVEAGFDGVEIHGANG
                     YLIDQFIQDTVNRRTDEYGGSVENRSRFALEVVRAVIDAVGAERTAIRLSPWSRFQGM
                     RMDDPVPQFSHLISKLNEFGLAYLHLVQARVSGNADVTPPEDETLDFALRLWDRPVLI
                     AGSLTPRDAKALVDKEYPDKDVITTFGRYYISTPDLPFRIKEGIDLNPYDRSTFYIPK
                     SPVGYIDQPFSKQFEALHGSQTVALN"
     gene            complement(2353679..2354666)
                     /locus_tag="MYCTH_2310626"
                     /db_xref="GeneID:11514285"
     mRNA            complement(2353679..2354666)
                     /locus_tag="MYCTH_2310626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666100.1"
                     /db_xref="GeneID:11514285"
     CDS             complement(2353781..2354515)
                     /locus_tag="MYCTH_2310626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666148.1"
                     /db_xref="GeneID:11514285"
                     /db_xref="JGIDB:Spoth2_2310626"
                     /translation="MMTRVSPATLVTHLITNRAGMPPWNTRINWVALAIDQWDLVCFT
                     MLPLTRAFVKKVYILGKRWTEVNGVSPITDPLFRNASLGLLKTLSKPKGDDQLMEASR
                     ILCYRKSNCVDGSEHTVFKNDLVSKYIPKEGEVDPRLIADISAYRDHDLAAAKLQFTK
                     KMPKKVTKERKGRRAMKREAAAAAAAAATEEAAAESGEQQCQNEKEESSSLSEGEEDA
                     PISERLMDLADRMNDVIANLQKSLNS"
     gene            complement(2356623..2358713)
                     /locus_tag="MYCTH_2310628"
                     /db_xref="GeneID:11514286"
     mRNA            complement(join(2356623..2357236,2357367..2357592,
                     2357668..2358713))
                     /locus_tag="MYCTH_2310628"
                     /product="glycosyltransferase family 69 protein"
                     /transcript_id="XM_003666101.1"
                     /db_xref="GeneID:11514286"
     CDS             complement(join(2356746..2357236,2357367..2357592,
                     2357668..2358243))
                     /locus_tag="MYCTH_2310628"
                     /note="CAZy_ID 267935"
                     /codon_start=1
                     /product="glycosyltransferase family 69 protein"
                     /protein_id="XP_003666149.1"
                     /db_xref="GeneID:11514286"
                     /db_xref="JGIDB:Spoth2_2310628"
                     /translation="MAARRTRLLPKIRSALQKLLFVYLVWTIIEAHRCYYRISRAERE
                     AIARTDLIEPTRVYIASLHWNNEDILRSEWNKAVLDLVKTFGANNVFVSVYESGSWDD
                     TKGALRELDKELETMGVARKIILDQETHKDLITQPPADEGWITIPDGTRMPRRIPYLS
                     KLRNLSLRPLLELAENGTTFDQVLFLGDVVFTVSDVLNLLKTNNGRYAAACSLDFSKP
                     PNFYDTFALRDARGHQYATQTWPYFRASQSRKAMINAKPVPVSSCWNGIVAMPASTFA
                     GIRGLRFRGIPDDLATSHLEASECCLIHADNPASRSRGVFVNPAVRVGYDRKAYDAVH
                     RNAPRRRDDDDDDDENGHSDTGGGGGGSWLSLSEVYFGLWKNRLARWLTTPWFEEQEV
                     RRRIERWARAGEGREEKGEFCVVDEMQIVVHNGWKHLR"
     gene            2364551..2365477
                     /locus_tag="MYCTH_2310631"
                     /db_xref="GeneID:11514287"
     mRNA            2364551..2365477
                     /locus_tag="MYCTH_2310631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666102.1"
                     /db_xref="GeneID:11514287"
     CDS             2364751..2365404
                     /locus_tag="MYCTH_2310631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666150.1"
                     /db_xref="GeneID:11514287"
                     /db_xref="JGIDB:Spoth2_2310631"
                     /translation="MDGPPPNIYIIGAQCTGKTTLVNHLRAHFANRNPVPDGGPPALI
                     SEVARTVLKAHHFTARDVRIPSRSLVLQRFILQAQAAAERDALESGGPRKRWFISDRS
                     GADPIAYSMRYVGHEAARALAKTEEWVELKERMRQSVVVICEAGKGVAGWLKDDGVRL
                     MPVDLEEWAGFHRTFCEFLDGEGVRYEVLTADISAHEERVDFVLKRWEECWRKRSRS"
     gene            2366471..2367843
                     /locus_tag="MYCTH_2310632"
                     /db_xref="GeneID:11514288"
     mRNA            join(2366471..2366853,2366920..2367843)
                     /locus_tag="MYCTH_2310632"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666103.1"
                     /db_xref="GeneID:11514288"
     CDS             join(2366624..2366853,2366920..2367496)
                     /locus_tag="MYCTH_2310632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666151.1"
                     /db_xref="GeneID:11514288"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="JGIDB:Spoth2_2310632"
                     /translation="MSPSALPTENGEIPVEVGVVPNPNPSITGRWTVDKVLETIPTGK
                     PAEGTSSPVGYFHILERLKTTKREGWRRFGINRGESISDHMYRMSMMSMLAPPSLAAR
                     LDLNKCMKMCLIHDMAESLVGDITPVDDVPKPEKSRREAETMDYITKRLLGNVDDGKV
                     GAEIRAIWQEYEDSKTLDSLYVHDIDKMELLVQMVEYEKRGKGKLDLGEFAYVQTKIV
                     LDEVKTWAEEIMKEREDFWAGQAHVHGEAGVAGGVPPEKMAKQDAYYSRE"
     gene            2368852..2371011
                     /locus_tag="MYCTH_74446"
                     /db_xref="GeneID:11514289"
     mRNA            join(2368852..2370114,2370328..2371011)
                     /locus_tag="MYCTH_74446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666104.1"
                     /db_xref="GeneID:11514289"
     CDS             join(2368969..2370114,2370328..2370705)
                     /locus_tag="MYCTH_74446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666152.1"
                     /db_xref="GeneID:11514289"
                     /db_xref="JGIDB:Spoth2_74446"
                     /translation="MSFAPRFQPNGGFNSNASTAPAQPLHADIFRPPTSPSASSCNLA
                     KSTGSVLSDISMSTARHAGTAKRKRTSTRESTPLDWHLNMEGAYDGREERRGEFRYTL
                     AGQISTTPAEPLGGAENGQLEDSVYSDVDYRRALGPRTMGAADSPPGQVAPSGTEGAP
                     SSGSWSLFSLQLIGNVVGKVWEFCKKGAFRGFQAGGGQKYNANGATVTETTGEPCAPE
                     PDASAEPVEESSMGEYAPSYSPETAQSAASAAYHDLSTPESTPLPAAKRRQVSANNDE
                     LRNWVVVDEPSRQPPKQFAAEVRAAASKPSGLVRPRTGYYAQTSVSSHRRITAPSPRF
                     TGGSGTLASRPSLRISHAGSPALTPREPASFASTRSSPVSCPTPSRIPLGGHRRKHSS
                     AAASATSATTTTGTARSRRQSILPRRSSDIEAVSSPRLDAEALQLAQEKLAAERDADA
                     KVDAFNAKLLSMIRQGREALGTKVEVEMDSELDMELDMEMNDGLGTGIRGGGWEDDD"
     gene            complement(<2371235..>2372125)
                     /locus_tag="MYCTH_2069839"
                     /db_xref="GeneID:11514290"
     mRNA            complement(join(<2371235..2371570,2371625..2371827,
                     2371897..>2372125))
                     /locus_tag="MYCTH_2069839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666105.1"
                     /db_xref="GeneID:11514290"
     CDS             complement(join(2371235..2371570,2371625..2371827,
                     2371897..2372125))
                     /locus_tag="MYCTH_2069839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666153.1"
                     /db_xref="GeneID:11514290"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="JGIDB:Spoth2_2069839"
                     /translation="MTSNIDDPIAEHGWTPVPLDADAIFQGKPYLHEPAPVLVKDIHF
                     PSDDPLVARAQEYAKEQLPLQTYNHSMRVFYWATAILHQQFPSHAKALSPSTLALACL
                     LHDIGTAPAFWTSTRLSFEFHGAITAINLLSSPPPSSTTSQAAEAVCEAIIRHQDLAL
                     GSVGVRAGTITLLGQVLQLATVYDNVGARAYAVHAATRDDVHRAFPRGGWEACFAGIV
                     RREIAAKPWAHSTHLGGPDGELIANAVEGNLLMKAYE"
     gene            2375987..2378765
                     /locus_tag="MYCTH_109821"
                     /db_xref="GeneID:11514291"
     mRNA            join(2375987..2376230,2376335..2376672,2376811..2377237,
                     2377339..2378237,2378314..2378765)
                     /locus_tag="MYCTH_109821"
                     /product="glycoside hydrolase family 75 protein"
                     /transcript_id="XM_003666106.1"
                     /db_xref="GeneID:11514291"
     CDS             join(2376068..2376230,2376335..2376672,2376811..2377237,
                     2377339..2377349)
                     /locus_tag="MYCTH_109821"
                     /note="CAZy_ID 267884"
                     /codon_start=1
                     /product="glycoside hydrolase family 75 protein"
                     /protein_id="XP_003666154.1"
                     /db_xref="GeneID:11514291"
                     /db_xref="InterPro:IPR009939"
                     /db_xref="JGIDB:Spoth2_109821"
                     /translation="MRNQVLLSALVGAAGVAARDVPSNVQSFYDSLKAKGACSNKLAT
                     GFYANDDGPNTFAYCGDHLSDYNVIYLKGSGSAFADMDIDCDGEQNGKGDDGRCGNSQ
                     DTQAITSFQDIVEGYKKGVKDLNAYVHPYVVFGNTGSKSGWKTFDPQKYGIKPLSVMA
                     VVCNNKLIYGVWGDENGDDGDKPMVGEASISLATACFGTSMTGNNGHDETDVLYIAFP
                     GDDAVPGADGANWGADSWQAFESSIEGLGNKLIQRIGGGDPGNGGGDDPGNGGDGFDD
                     CEWPGHCEGASCSTDDDCSDPWACINGKCGTDPALL"
     gene            complement(2381411..2386618)
                     /locus_tag="MYCTH_2310644"
                     /db_xref="GeneID:11514292"
     mRNA            complement(join(2381411..2382668,2382771..2385928,
                     2386003..2386618))
                     /locus_tag="MYCTH_2310644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666107.1"
                     /db_xref="GeneID:11514292"
     CDS             complement(join(2381826..2382668,2382771..2385928,
                     2386003..2386312))
                     /locus_tag="MYCTH_2310644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666155.1"
                     /db_xref="GeneID:11514292"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="JGIDB:Spoth2_2310644"
                     /translation="MNPVTPVRQIPGAFINTPAPGPNTVRRRLNFNEAAGAGTTGTMG
                     TAPEPITSTLGSGQQEIATGMLPPPQARDDLPPVVKAAQVINQTLQLDESYPDIDSYC
                     RPGASSDYDIQYADSSWAPFHKTSTYPIPDQVFSRLNQGAVSTRIGLFASINYAWAAI
                     DDSLFLWDYTHPDPELIGYEDATHTITAVALVPPKPGVFVDTITHILVVATTTEITLL
                     GVSATPTPSGSRSVTLYQTKMSVHRGSSDVSLIVGTASGRIFLGGDTDTDVYELFYQQ
                     EERWFSSRCGKINHTHQGWASVVPSLPLAGLPFGQRQQEGLIALVVDDTRNLLYSLSN
                     RSTIRTYHMETPEKLTKVIEKDKTSCLRDFAHMADSSPLFTDRTNIVSLSPIPATEAS
                     KLHLMALTDTGCRLFFSATSSASYTIGGSTSLAPQSMQLQFVKFPPKEPGVRPRTVPG
                     QSSEGQLDKTSRALDPSALGVRFAPGYFFDVVRKHSSSDILFVSAPDTGKIKATTPAS
                     ALKYYEQGTWVDLENGSRILEIGLTTAPFSASKQPLGFGNELAVQFDSAPSEFAVLTN
                     TGVHIVRRRRLVDIFANAIRTCSGEEGLEREMRKFLNQYGRVETISAALAVACGQGSD
                     LRAGTGRAPDQKTENLARMAFVEYGGQPRIAESDGKQLVSESVRLSSRHDALALYLTR
                     LVRTVWKSRVIETKAEAKGSLAVSSTVPAAKLIMIQENIERLRNFLEANKSTIQGLAG
                     PSDRLFSRQEEIANQKEHQALHGLRKLMESVSEGISFVLMLFDERVSDIYARLDPASQ
                     QQFRDLTYEQLFSQTPGKELAKVLVKAIVNRNIASGANVETVADALRRRCGSFCSPDD
                     VVTFKAQEQLQRASEQVNNPNVLRTLLGESLRLFEQVAGSLTHSNLQSAVEQYTQLNY
                     FAGAIQLCLTVAQQKDRGNTALTWVNDGKPANDSRKKAYDERKACYALIHEVLDKLEV
                     AFAGEPEVVDGRPTLAATKRNEAYTVVNDSSDEVFHFDLYEWYIEKNWTDRLLAVDSP
                     HVVTYLQRLAETDYQHAELLCRFYTHRSRFFEAAQVQAALAKSDLNIGIKDRITLLSR
                     AKGNASVNTIGISRQQQQLLNHEVTELLEIAHIQDDLLERLRADTRISPDKLPDIEEA
                     LDGPIKSVTELYNEYADQAAYFDLCLLIYHAADYHNPRVITDTWLRLIEQTSYETEQR
                     QAHWQLAQAGQPLPEGVPPITGEPPLPYESVSQQIQLIAHRTSLDSLVFPVDTLLPEV
                     CKYAVNNGQDASIGADPCWPVLLFLNLGVPHALVVQVLENMFDAQEAPFTGRRRKMVV
                     QWIAVAVEAWVREVERRAAGAAASGGSFGASSSVGASGGGAPGGDGVIGVWVSELLAR
                     ADECLAQIAPAPASARTAGQVSAEAEETLELRRLVKGLKRSVDAILGGEGLLGGSLFR
                     "
     gene            complement(2386765..2388127)
                     /locus_tag="MYCTH_2310645"
                     /db_xref="GeneID:11514293"
     mRNA            complement(join(2386765..2387803,2387863..2388127))
                     /locus_tag="MYCTH_2310645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666108.1"
                     /db_xref="GeneID:11514293"
     CDS             complement(join(2386946..2387803,2387863..2388036))
                     /locus_tag="MYCTH_2310645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666156.1"
                     /db_xref="GeneID:11514293"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2310645"
                     /translation="MASNFDLQETLERAVDLWESLPKAAHWALAGIGAIYVARGVLSF
                     VQLFLTCFVLSGTNLRKYGKKGTWAVVTGASDGLGKEFAHQLAAKGFNLVLVSRTQSK
                     LDALARELTLRWSGFQAKTLAMDYSKDDDADYERLAELISGLDVGILINNVGQSHSIP
                     VPFLETSRDELQNIVTINCLGTLKTTQIVAPILTKRKRGLILTMGSFAGYMPTPYLAT
                     YSGSKSFLQHWSSSLAAELKPQGVDVEFVISYLVTTAMSKIRRTSLLIPSPKPFVRSV
                     LGKVGLGWTEKFTNTYTPWWSHAIFKWAIENTVGATSGITVWFNRRMHLDIRARALRK
                     AEREAKKKL"
     gene            <2388396..>2388981
                     /locus_tag="MYCTH_2120853"
                     /db_xref="GeneID:11514294"
     mRNA            join(<2388396..2388461,2388526..>2388981)
                     /locus_tag="MYCTH_2120853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666109.1"
                     /db_xref="GeneID:11514294"
     CDS             join(2388396..2388461,2388526..2388981)
                     /locus_tag="MYCTH_2120853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666157.1"
                     /db_xref="GeneID:11514294"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="JGIDB:Spoth2_2120853"
                     /translation="MDKLQQFLPSAEKGYLPYYLFVVSLVSVGNSLQNYATLHYTRRL
                     YNGRFVTNHSLPPASDRFNPEDSIAKVKPASSTGKDSEKAKDQVSPLAARLFGIYTFV
                     AGIIRFYASYQIENPAMYQLALWTHVIAALHFTSEMFVYKTMRFSGPQAFPFLAAYGG
                     ATWLILQYNHYVR"
     gene            complement(<2389116..>2390442)
                     /locus_tag="MYCTH_2120854"
                     /db_xref="GeneID:11514295"
     mRNA            complement(join(<2389116..2389339,2389394..2390174,
                     2390238..2390289,2390342..>2390442))
                     /locus_tag="MYCTH_2120854"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666110.1"
                     /db_xref="GeneID:11514295"
     CDS             complement(join(2389116..2389339,2389394..2390174,
                     2390238..2390289,2390342..2390442))
                     /locus_tag="MYCTH_2120854"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666158.1"
                     /db_xref="GeneID:11514295"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="JGIDB:Spoth2_2120854"
                     /translation="MPDQVLDDISHRRYNPLTGSWLLVSPHRTKRPWQGQQEAPSKNI
                     LPEYDPKCYLCPGNQRAQGDRNPHYKNTFTFINDYSAVKEQQQDYNPDTEKDDIASLL
                     LQAQPVTGRCYVLTFSPRHDITLADMTAAEILPVIQTWTRIYGSHLSATHPLKARADE
                     ILSAIPVNPDGEVDPPKNQLRYMQIFENKGAAMGCSNPHPHCQVWTTSTMPEEPGKEL
                     VQMAKYRADNGRHLLADYVKLEMKKQERVVWQNESFLVVCPWWAVWPFEVIIIAKRHV
                     RALVDLTDDERLQFAEAVQEVTRRYDNLFETSFPYSSGIHQAPLDCTEEEAETSWFHM
                     HFYPPLLRSATVRKFLVGYELMAEPQRDITPEQAAARLRSCGGVLYRKLLN"
     gene            2391211..2393563
                     /locus_tag="MYCTH_109817"
                     /db_xref="GeneID:11514296"
     mRNA            join(2391211..2391538,2391611..2393563)
                     /locus_tag="MYCTH_109817"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666111.1"
                     /db_xref="GeneID:11514296"
     CDS             join(2391446..2391538,2391611..2393086)
                     /locus_tag="MYCTH_109817"
                     /note="Zinc finger present in ADA2a putative
                     transcriptional adaptor, and related proteins. The ZZ
                     motif coordinates two zinc ions and most likely
                     participates in ligand binding or molecular scaffolding.
                     pfam04433, SWIRM, SWIRM domain is a small alpha-helical
                     domain of about 85 amino acid residues found in
                     chromosomal proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666159.1"
                     /db_xref="GeneID:11514296"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_109817"
                     /translation="MGVIRKKIAARGGEGGVKYVCDVCSADITSTVRIRCAHSACNDY
                     DLCVQCFSKGASSNAHQPATHPYRVIEQNSFPIFDREWGADEELLLLEGAEIYGLGSW
                     ADIADHIGGYRDKDEVRDHYLKVYIESSRFPLPERCSPYDMELANEISREEFQARKKR
                     RIEERREAAKNAPALQPKTKPTASVPACHEIQGYMPGRLEFETEYANEAEEAVQLMQF
                     DPGDGINPRTGELEPEMELKLTVMDIYNCRLTQRAERKKVIFEHNLLEYRENTKMEKK
                     RSKEERDLLNKAKPFARMMNRTDFEQFCQGLVDELNLRQAIAQLQEWRSLKIGDLRSG
                     EKYEQEKALRIQKSIPLGSMDRERLATNQRNKQQPPPEPPSGAALLVAPELPFRSTTT
                     NGASTGEGANGVKTESNGNVNGGSVVVANGAPPTRQKYVPQPIPGVQPLQLTQDNAPD
                     LHLLTPEEVKLCETLRLQPKPYLMIKEQILKEALKGNGSLKKKQAKEICRLDSQKGGR
                     IFDFMVNAGWVVKA"
     gene            2393379..2395285
                     /locus_tag="MYCTH_2310650"
                     /db_xref="GeneID:11514297"
     mRNA            join(2393379..2393676,2394038..2394683,2394861..2394960,
                     2395040..2395285)
                     /locus_tag="MYCTH_2310650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666112.1"
                     /db_xref="GeneID:11514297"
     CDS             join(2393634..2393676,2394038..2394683,2394861..2394960,
                     2395040..2395108)
                     /locus_tag="MYCTH_2310650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666160.1"
                     /db_xref="GeneID:11514297"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2310650"
                     /translation="MPDNTVYLITGANRGIGLAVTTLLLSRPHTTVIATSRNPSASLD
                     PASFPEGKIHPTSRLIPVLLDDGDDPARAADPARASRTLAARLRDEHGVTALDVVIAN
                     AGGSTCAGNVLTTDPDVMGRDFRVNAAGTARLFQAVWPLLESGEETKENKKKDEEEEE
                     GGKGEEGGPAGWEKKKFIYISSTLGSIGILERESMPGIAYGMSKAAANWFVRKVSVEL
                     KGKLVAGVLHPGWVQTALGQILADAVGRKEPPMTVEQSAKCVVEQIDNWTPDKSGQFL
                     SYDGKPLPW"
     gene            2397383..2400293
                     /locus_tag="MYCTH_2310652"
                     /db_xref="GeneID:11514298"
     mRNA            join(2397383..2398443,2398506..2400293)
                     /locus_tag="MYCTH_2310652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666113.1"
                     /db_xref="GeneID:11514298"
     CDS             join(2397667..2398443,2398506..2400170)
                     /locus_tag="MYCTH_2310652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666161.1"
                     /db_xref="GeneID:11514298"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="JGIDB:Spoth2_2310652"
                     /translation="MESAAQALSHVHDLYVRSGGIAPSGTQRPPAFKAIGIGLAVGSG
                     AFIGTSFVLKKVGLLKANEKYNEVAGEGYGYLKNFYWWAGMILMILGEGLNFAAYAFT
                     DAILVTPLGALSVVITTILSAIFLKERLSLVGKVACFLCIVGSVVIVMNAPESSSVSN
                     IQEMQGFVIHPAFLTYAGVIIVGSAIAAFWLGPKYGSKNMLVYISICSWIGGLSVVAT
                     QGLGAAIVAQASGTPQFNQWFLYVLLVFVIGTLLTEIIFLNKALNIFNAALVTPTYYV
                     YFTTTTIISSAVLFRGFKGTPTSIVTMVNGFLTICAGVVLLQLSKSAKDVPDAAVFSG
                     DLDQIHTIAEQEQPETEPKADAIRGTAAIVRRLSSARQKMELDELKRMHEEKLQESLA
                     PVTENGAPQYEWDGIRRRRTTTFSTHRSRTGTPGSTHLAPPTPHPPLGWSHFPTEEEL
                     AEANRPISPALSSIVGTIRTRARSVLLPGHPDFRPKTPDANKVQSPMHPVQLTSVAVA
                     GSKPATSTDDYDTPPGTASSSARRIQFGGLPTRNISDASKEEDASSVPPTPPPHATAR
                     RQFSFQSMFRRHQHDSRTTSSRDGAPADRHRPGSSRPTSSRHGISSRGYSSPHVHGAT
                     EEETLGLVQGDSNASGTDELSVPALRRYAGDDDDGDDNNDHLDHNNNHGREYHSDKDD
                     DDDDDDDDDEDDGGYARKGYRGDGDRAGASRLYGHSITRGYTAAPRRTSVPRSWRRDE
                     EHDMIGLGLGVDEKRAGEVRQEKEEKRGRSRKRGGTRDAGLDDRSRSAGEEEDKPPPP
                     PPHGGTYRGKPGAFI"
     gene            complement(2401591..2402781)
                     /locus_tag="MYCTH_2310653"
                     /db_xref="GeneID:11514299"
     mRNA            complement(2401591..2402781)
                     /locus_tag="MYCTH_2310653"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666114.1"
                     /db_xref="GeneID:11514299"
     CDS             complement(2401676..2402431)
                     /locus_tag="MYCTH_2310653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666162.1"
                     /db_xref="GeneID:11514299"
                     /db_xref="JGIDB:Spoth2_2310653"
                     /translation="MARLKLGQWDSAVADCTACLRLSPDSIKAHYSLSQAHLALRAYD
                     DALLHARTAHALGAKAADKSLGTLTAHVLRCKKEAWDAAERRRVREDADLEAEVLRLL
                     ERERDAAVREVGRQQQEEDGGEDGNGGDGGGGGEEARKEVAAEWDAKIARMREVFEKA
                     RPASEKRRTVPDWAIDDISFCVMVDPVIVSGRSLVTGVDFSSFVVSLSLSLSLSLWVD
                     HWLTRVALIRQNPASPTSARRLSSTCAATPMTR"
     gene            2404106..2405428
                     /locus_tag="MYCTH_2310655"
                     /db_xref="GeneID:11514300"
     mRNA            join(2404106..2404554,2404652..2405428)
                     /locus_tag="MYCTH_2310655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666115.1"
                     /db_xref="GeneID:11514300"
     CDS             join(2404553..2404554,2404652..2405303)
                     /locus_tag="MYCTH_2310655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666163.1"
                     /db_xref="GeneID:11514300"
                     /db_xref="JGIDB:Spoth2_2310655"
                     /translation="MYLEALPSLYGNTTFILTATRTAGEFLTRYGADGARHPFRSLEL
                     CIRLPNLLTEIYYPPAHSSSKGDEGPPAIFAGGARPMLSVTNNPWQHLCDALVALPAL
                     QELRVWLDSSDLRPWHKRVSETRFFRRLADVRGLDKARFVLGLPELPERRGPDSHALQ
                     GQYLEGDKLDDVPFTVQRGPRPNNWQNHLHNILSLGAAALTLPTPGTAPVHPNPVHP"
     gene            complement(2405676..>2407661)
                     /locus_tag="MYCTH_105157"
                     /db_xref="GeneID:11514301"
     mRNA            complement(join(2405676..2406328,2406423..>2407661))
                     /locus_tag="MYCTH_105157"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666116.1"
                     /db_xref="GeneID:11514301"
     CDS             complement(join(2405984..2406328,2406423..2407661))
                     /locus_tag="MYCTH_105157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666164.1"
                     /db_xref="GeneID:11514301"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="JGIDB:Spoth2_105157"
                     /translation="MAAREFWDVVKHEVRDMLVPGLAKRMEGGSPGGSPGSNRVRGDD
                     SSAPTNLPSMITAPPSVSVLATESLALASSSPTTTSTTTPTTTSKVVMQTTTAPAEPS
                     ESETEGMSIAAKAGIVIGALGGILVVFVLGWLVLNARRKKLARRRQQIEDDEKINGPF
                     ADSAAIQPTPNKSPRLSLRPVTQLLPTFTTPQAERRQSRGIALTLNPVSNPSLARPTG
                     GSAWERPTLRSTMASPSGDSNRADTSAGLHPNPFHDNNRVPDEPVSPVSSLSSVDQRV
                     GVATTTDSVPEPVSPILGDDEEEEEENQRRQQSGASNLTRKASVRQDLPKPLDLTKAS
                     SQLHAVPPSPAGTEYSMHSIAPGQSPGPSASAAAIAAAGGPAHSTVHRVQLDFKPTLH
                     DEMELRAGQLVRLLHEYDDGWALCIRLDRSEQGVVPRTCLSTRPVKPRPPQGPGAPPA
                     GGGGGNQRRGPPVNPPHQHHNSGSNNNNNANRGAPRAGPNPAGSPPQQGWRGHGPQTG
                     HGPGGFDGRDVSPPPGQAY"
     gene            complement(2410034..2412404)
                     /locus_tag="MYCTH_2310659"
                     /db_xref="GeneID:11514302"
     mRNA            complement(2410034..2412404)
                     /locus_tag="MYCTH_2310659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666117.1"
                     /db_xref="GeneID:11514302"
     CDS             complement(2410192..2412288)
                     /locus_tag="MYCTH_2310659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666165.1"
                     /db_xref="GeneID:11514302"
                     /db_xref="InterPro:IPR008696"
                     /db_xref="JGIDB:Spoth2_2310659"
                     /translation="MAETPFQIPGLGQAKPNEKLPVENFAPDLIAAAASIMGEDKVTV
                     GATNGHAQWERKEQEAKQEEATKTSTSAREGADSMELNITDTSAMGASQDQKQDVKMH
                     DQEPKTAEGQAPDHDMKNGDDASTPDVTHALEAALDGMLSNIRASARPAQNQDGVAVI
                     QEQQQESSDAQQEDEEAEAEWEVDSSPYESSSDSSSSDSDSDDDSEDGEGYPLLGIEE
                     TARLLMAADGDGDADGDGSGKSKGAGAALRTKNEMPEEVLPKPDVTITPEMKIERLGN
                     IEFIVETTVVIKSQTPGEVQVLDTGSVLCREDRTVIGALAEVLGNVRSPMYTVGFRTL
                     DEIKELELATGMPIYYSVQHANYVFTQPLKEAKGTDASNLHDEELPPEEMEFSDDEKE
                     AEYKRAQKQKRRGAKAGRGGREQGTANGQTQPPNPATSSSLNYDEDEDGPYKPLSRPP
                     GYGQGGPPSLPSLPPKPEAGFSPPRGGRDQGHRGAHRGGRGDFRGRIQRGGSHRGGDR
                     RHGSRGGGGGGGYQQFGHDGAASPQTGFPSVPPPSQAPHVPPPPFGAKPAAPSGQWPA
                     PHAPYAPPPVSYSPPAQPQVPIPHHQPPTSNFNFNYQAWNQNQGQQYQYPQAASHHQP
                     PPPQQPAAPTYAPPYVPPQAPTWQSAGTAPPVPPAAGAYNPTFYAGYQQPPQAQQGQQ
                     YWPQQQHGAYGQGPSQ"
     gene            2412766..2415230
                     /locus_tag="MYCTH_2310660"
                     /db_xref="GeneID:11514303"
     mRNA            join(2412766..2412955,2413033..2413714,2413775..2415230)
                     /locus_tag="MYCTH_2310660"
                     /product="glycosyltransferase family 22 protein"
                     /transcript_id="XM_003666118.1"
                     /db_xref="GeneID:11514303"
     CDS             join(2412864..2412955,2413033..2413714,2413775..2414842)
                     /locus_tag="MYCTH_2310660"
                     /note="CAZy_ID 267848"
                     /codon_start=1
                     /product="glycosyltransferase family 22 protein"
                     /protein_id="XP_003666166.1"
                     /db_xref="GeneID:11514303"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="JGIDB:Spoth2_2310660"
                     /translation="MATTQAAPQVPAPKKQKKEFVHPSAKHARKKAIQNAFAIEPISA
                     FYIFLGANIIAALFAPIQDCDETFNYWEPTHYLSHGYGLQTWEYSPDYAIRSWLYIAI
                     HALGANIRRLLPRSSKVAEFYFLRYLLAFGCALCQTLMWKAVCLALNPRVGLFFIAAL
                     VFSPGNFHSSTAYLPSSFAMYMGMLGAAAFMNWRGGLKTSQGMFWFALGGVLGWPFAI
                     ALCAPFVLEEVFFAMLSDKERFFESFIRLARGVVATLLLVAFDTAINTFFYRKFEIVT
                     WNIIKYNVFSSTGGPDLYGTEPWTFYFKNLALNFNVWFVLALLSLPLFLLQKLVSRRS
                     AGESFQSGLRTLVFLSPFYLWLGIFTLQPHKEERFMYPAYPFLALNAALALHTLLALL
                     GNAGPKTLIGRIPAKVKLAVVALGLLASVNVGLARVWGLYTGYHAPLDLYAPLATTGG
                     PGDTVCFGKDWYRFPTSFFLPRDMRAKFVRSEFRGLLPGEFSEARTGFGFWSGTWLPT
                     SGLNDRNEEDPGKYADLRTCVFLVDTQFPERRAAAAAAGEPLSLPPNEPDYAQDVERW
                     EEVRCLPFLDAERTHFLARALWLPDWEIVPERLRRKWGRHCLLKRRK"
     gene            complement(<2415338..>2417631)
                     /locus_tag="MYCTH_2112920"
                     /db_xref="GeneID:11514304"
     mRNA            complement(join(<2415338..2415385,2415618..2415902,
                     2416089..2416273,2416438..2416513,2416656..2416738,
                     2416843..2417285,2417357..>2417631))
                     /locus_tag="MYCTH_2112920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666119.1"
                     /db_xref="GeneID:11514304"
     CDS             complement(join(2415338..2415385,2415618..2415902,
                     2416089..2416273,2416438..2416513,2416656..2416738,
                     2416843..2417285,2417357..2417631))
                     /locus_tag="MYCTH_2112920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666167.1"
                     /db_xref="GeneID:11514304"
                     /db_xref="JGIDB:Spoth2_2112920"
                     /translation="MKRKRPVELMDLPKEVLSMIVKDAETPLDDSTPLDQNNYGGVKA
                     LSQVNRTFRAICLQTSLKHVRIWNSEDSLARRLREIYDHGQHILSNSTSISIRSIGYT
                     LDAARHYRTRAPEKTDFIRDFGLVLSAMPKLREVRLVSENGRHGIEPVLRKFFNAKKL
                     VFPEVKSLYIRTAGPVARIYRCFPNLEAINFNLHGNTGKVPSSPLSQDFKILKEPIFQ
                     SLRTLAIYKSAGSGWTGDDISAVVKNFPNVERLFLQGCLGGDVSHMFRFLPHKTGELF
                     APHRNLRYLALTDEPYLHITKNHRLVRKLEPFIPYARWEAVAKKFFAVLPDLVELCMI
                     RQTDFSGLVLRPIRHAVPDADDGGPRGVPVEVVRRYADESPRRRLNFPPARWNGDMCV
                     WWPAWGPVPTEDDFGMPDEPDGAVQLIGRHNGVHFRNVAEGLPVVLYTEMILDHCETG
                     PWDVEWLRVIRNQR"
     gene            complement(2418803..2420148)
                     /locus_tag="MYCTH_2310662"
                     /db_xref="GeneID:11514305"
     mRNA            complement(join(2418803..2419451,2419565..2420148))
                     /locus_tag="MYCTH_2310662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666120.1"
                     /db_xref="GeneID:11514305"
     CDS             complement(join(2419223..2419451,2419565..2419932))
                     /locus_tag="MYCTH_2310662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666168.1"
                     /db_xref="GeneID:11514305"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2310662"
                     /translation="MPHPESKKRIAAAKDDGVSPEDGGDATIVDNGSPSPSGSERRRR
                     RPTFTTLPPEIHLLIAEQLIYPDALSLKHTNRYFYQLVDTGVELKVEWLMERRMLHLE
                     CPSHHRCDLGSDLRFCRGSVKLLMERRREHIECESRPGLGCLIYGTSTCPQARKLKTR
                     AKKWMRLHAVDQTRWAMFLVWLIPLLIGWVWMVGVMVF"
     gene            2421043..2423847
                     /locus_tag="MYCTH_2310664"
                     /db_xref="GeneID:11514306"
     mRNA            join(2421043..2421806,2421865..2423847)
                     /locus_tag="MYCTH_2310664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666121.1"
                     /db_xref="GeneID:11514306"
     CDS             join(2421299..2421806,2421865..2423636)
                     /locus_tag="MYCTH_2310664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666169.1"
                     /db_xref="GeneID:11514306"
                     /db_xref="JGIDB:Spoth2_2310664"
                     /translation="MAGFVSDSGSEYGYDLTASDEERLFAIADRLSGLSPQLRPAPAG
                     PAPQVNHASTTPARNAIASGQCQSAPEPDPDISFAIEETIAAITDDDLSFDISELQDD
                     VDAGRGQGSAHVQGRRRRSRDSTPESSHWKLAPSVSDGHGHLASFISGTKPRSMPTLL
                     PDPEVRYPDLSRALSEVQDAPPLEQAKDEESKDEESVEDNRSPLLRFRTFPMKPFSVS
                     DLAAGSWCELQYFYTLTRLPGGKKTRTTAMKRGTKVHEKLERELFQPVKVEITKKEDN
                     FGLKIWNMIQGLRVLRDQGYTREFEVWGMVEGHLVCGVIDSLGYENPDEELQDEVISS
                     RGSSQTMRNSQPYELSTPGDHEIFITDVKTRNSVTPPPQSQVRVSLIQLFLYHRFMSD
                     MASDRLDYMRVFARFGLNPDEPFSDSFMAQIGAIHDEVFAEEESDVESASNLGHDTDT
                     IDGGDDRGSNSDFVSASSNPSQHSSAEPTTQPTLKYRTLSTLLPLLKRELALTFPRGA
                     SDLGKIVAVEYRYRGRDSVPRNQTVIPTTATVDLDGLDPDETDPFPPDADADADAAAD
                     AETSRQQQQQQQQQQDQQQQRHRRQQQVPEPERGSVICTHTFFVEPETLDLFLAETMR
                     WWKGERPPRGVPLEEAGFKCRSCEFVDDCEWRRDLDREARRRAAKRRSEREAAARAVG
                     EVGPGGGKEEVKAEMASGIDAGLDGGDVEDGGGAAVTGREERRRRRGRPRKTERRKVE
                     DENTQGMKGGGRPARLSTA"
     gene            complement(2423848..2426139)
                     /locus_tag="MYCTH_2310667"
                     /db_xref="GeneID:11514307"
     mRNA            complement(join(2423848..2425242,2425295..2425359,
                     2425429..2426139))
                     /locus_tag="MYCTH_2310667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666122.1"
                     /db_xref="GeneID:11514307"
     CDS             complement(join(2424059..2425242,2425295..2425359,
                     2425429..2425850))
                     /locus_tag="MYCTH_2310667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666170.1"
                     /db_xref="GeneID:11514307"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="JGIDB:Spoth2_2310667"
                     /translation="MEDAKEQSKSAQKKAEKQAKAAAAKAEKAAKQASLPVVGGKKSD
                     EIIGITVSKAENFPQWYQEVVLKAEMIEYYTEISGFFIMRPATMYIWNTIRKWFQERI
                     EAMGVDETSFPMFLSQKSLEKEKDHVEGFAPELAWVTKAGDKDLDVPVAVRPTSEAVM
                     YPYYSKWIRSHRDLPFRLNQWNSVVRWEAKQTTPFLRAREFLWQEGHTAHLTEKQAGE
                     EVLQILELYAGIYEQLLAVPVVRGRKTEAEKFAGGYYTTTVEGYIPSNGRGIQGATSH
                     CLGQNFSKMFDITVEDPNEKGKHIHVWQNSWGLSTRVIGVMVMIHGDDKGLVLPPRIA
                     KIQSILIPVGLTAKMSAEDKEKHLKHLDEIYQTLKKAGVRAEVDLRDGYTPAWKFNDW
                     ELKGVPLRIEFGPKDAAKDVVSYARRDTGEKGTIPIAELTTKVPEMLETIQQDMYNRA
                     EAAYREHRLKITKWEEVVPALDAKNVVIIPHCLVPECEEKIKELTAGRSDDAAENVPE
                     GQKAPSMGMKSLCIPFEQPEGLVKGETKCLNPECGRLAEQWCMFGRSY"
     gene            2426143..2428226
                     /locus_tag="MYCTH_2310671"
                     /db_xref="GeneID:11514308"
     mRNA            join(2426143..2426399,2426478..2426563,2426619..2428226)
                     /locus_tag="MYCTH_2310671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666123.1"
                     /db_xref="GeneID:11514308"
     CDS             join(2426312..2426399,2426478..2426563,2426619..2428145)
                     /locus_tag="MYCTH_2310671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666171.1"
                     /db_xref="GeneID:11514308"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2310671"
                     /translation="MASMFAQSGNGTLFLGGQKVSGADIRDQNVMATQMIANVVKSSF
                     GPSGLDKMMVDDIGDVTVTNDGATILSLLDVEHPAGKILVDLAQQQDKEVGDGTTSVV
                     LIAAELLRRGNELMKNRIHPTTIITGYRLALREAVKYMNEHVSIKVENLGRESLLNIA
                     KTSMSSKIIGADSDFFANMVVDAMQAVRTTNNKNEVKYPVKAVNILKAHGKGAAESIL
                     VKGYALNCTVASQAMPTRIQDAKIACLDMNLQKERMKLGVQITVDDPDQLEQIRAREA
                     GMVIERIEMILKAGANVILTTKGIDDLCLKLFVERGAMAVRRCKKEDLRRIAKATGAT
                     LLSTLSDLNGDEKFEPSYLGHAEEVVQERISDDECILVKGTKAHSSASIILRGPNDFQ
                     LDEMERSVHDSLCAVKRTLESGSIVPGGGAVETALHIYLEEFAGTVGSREQLAIGEFA
                     QSLLVIPKTLAVNAAKDASELVAQLRSRHALSQRIQEGEANEDEKTVARKKAYKNYGL
                     DLVKGKVVDEIKAGVVEPSISKIRQLKSAVEACISIMRIDTLIKLDPEPQPEDDGHDH
                     "
     gene            2428840..2430453
                     /locus_tag="MYCTH_2310672"
                     /db_xref="GeneID:11514309"
     mRNA            2428840..2430453
                     /locus_tag="MYCTH_2310672"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666124.1"
                     /db_xref="GeneID:11514309"
     CDS             2429236..2430405
                     /locus_tag="MYCTH_2310672"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666172.1"
                     /db_xref="GeneID:11514309"
                     /db_xref="JGIDB:Spoth2_2310672"
                     /translation="MGSNDLTPPPSFPLDSLPDADSPLLVLTHPTRAERVATIKHTYR
                     NWGYALTEADYIAREEYLTTVPLARNGGITHWILTVASLPPDGRPILSSCESLRKRAV
                     CSRDGEPPTEGVAHGIASVFTEPAYRGRGYASRMMREVGEKLRGWQAPVPPGRSLFSV
                     LYSDIGKSFYARHGWPAFESSHVSFRPVAGAAGETEQVATAIGYHELAELCAADEKLL
                     RADLTRRRDGKTHVAILPELDAMLWHLMREDFMTKSIFGKTPAVRGAVTGKPGQRIWA
                     VWMRGYYGGLKRKEGNVLHVLRVVVEDPDQPDEELVGGFRSIVQIAQHEAAEWQTQDV
                     QIWNPTPKLKGLVEKCGIESEFVVREKHSIASLRWYGDEPVSEVDWVANEKYAWC"
     gene            2432407..2434135
                     /locus_tag="MYCTH_2310676"
                     /db_xref="GeneID:11514310"
     mRNA            2432407..2434135
                     /locus_tag="MYCTH_2310676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666125.1"
                     /db_xref="GeneID:11514310"
     CDS             2432550..2433911
                     /locus_tag="MYCTH_2310676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666173.1"
                     /db_xref="GeneID:11514310"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="JGIDB:Spoth2_2310676"
                     /translation="MTPGIIQSLQHLHEELRHYRAPAVVHPTVESVKPNKSLFSWFGS
                     SKKKTPIGAIPDNLPRGLYLYGDVGCGKTMLMDLFYDTLPQTVRSKTRIHFHNFMQGV
                     HQRLHKMKLQYGTDVDCVPFVAAEIAEQGNVLCFDEFQCTDVADAMILRRLLESLMSH
                     GVVLVTTSNRHPDELYKNGIQRESFIPAIQLLKNRLHVINLNSNTDYRKIPRPPSGVY
                     HTPLDAHAASHAEKWFRFLGDPDSPDPHPETQRVWGRDIVVPRVSGRCAWFTFDELIG
                     RPTSAADYLELMRSYDAFIVTEVPGMTFRQRDLARRFITFVDAVYESHAKLVLTTAVP
                     LQELFVSRAEMRESLLARRRERERQGGDGKADEELDEAAVEDAMSHMMDDLESNVEQL
                     AKSNLFSGDEEAFAFARALSRLSQMGSKEWVERGMGLESKGGKEEHDSWAKTRSRQME
                     DSM"
     gene            complement(2434086..2435878)
                     /locus_tag="MYCTH_2310678"
                     /db_xref="GeneID:11514311"
     mRNA            complement(join(2434086..2434530,2434632..2435177,
                     2435235..2435435,2435510..2435878))
                     /locus_tag="MYCTH_2310678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666126.1"
                     /db_xref="GeneID:11514311"
     CDS             complement(join(2434261..2434530,2434632..2435177,
                     2435235..2435435,2435510..2435713))
                     /locus_tag="MYCTH_2310678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666174.1"
                     /db_xref="GeneID:11514311"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="JGIDB:Spoth2_2310678"
                     /translation="MKISGASLLALLLPAVSGRFVEPGEPDRVLLYPDGVPQPSESSE
                     KYHIELAPGETRWVTEEEKWELRRQGRRFFDITDHPGLGTLRARDTFKKRSVFPKAPK
                     LQDEVNPLLANLSKTEMKDHLTTFTSFHTRYYKSDYGRQSSEWLLGQVRQTIKEAGAE
                     DYVHAEHFKHPWGQHSIIATIPGKTNSTVVIGAHQDSINLWLPSILAAPGADDDGSGT
                     VTILEAFRVLLQSEDVVKGNHQNTLEFHWYSAEEGGLLGSQAIFSAYEKEGRDVKAML
                     QQDMTGFVARTLDAGKPESVGVIVDYVDPDLTQFIKVIIDEYCDIPYVETECGYACSD
                     HASASKAGYPSAFVIESAFEYSDNHIHSTEDLIKYLSFDHMLQHARMTLAFAYELAFT
                     DFDSLEGPDHSDAL"
     gene            2437055..2439663
                     /locus_tag="MYCTH_2310682"
                     /db_xref="GeneID:11514312"
     mRNA            join(2437055..2437519,2437588..2437694,2437760..2438975,
                     2439081..2439663)
                     /locus_tag="MYCTH_2310682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666127.1"
                     /db_xref="GeneID:11514312"
     CDS             join(2437226..2437519,2437588..2437694,2437760..2438975,
                     2439081..2439563)
                     /locus_tag="MYCTH_2310682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666175.1"
                     /db_xref="GeneID:11514312"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="JGIDB:Spoth2_2310682"
                     /translation="MTKHQQAIQPQISEQIVRLCTSSESVSSLLARDATLSPGDAWEK
                     LYGHRATRSAAKSKQEVGDGNDKSSWELTEHDRLKRAAECGKWGPTRPSDLFLAIYHD
                     ALSTLNEDPRRAMVSPSLMGSYGTVPLTIISVLPDIVRHMSNVIVQAQKEVYLATNYW
                     QNSVASRYITNAIRELDCRAGARGAKIVFKILYDRGSPRQLYKPHYIVCEREATSQNV
                     NLPHPDEIPNIDMEIMNFHTPLMGTFHAKYMLVDRRIALLQSNNIQDNDNLEMMVRLE
                     GPIVDSLYDMVLISWNKRLNPPLPCQSGPAEATGHGGLKVWPAGGAGEPATGAGAGES
                     AVHFVEEGVNLNGTAGHQSKSSPQMSTPERDGIGEAGRTVSTFPTQSVGHEPSALPAH
                     TADDPHYDDDITGEVARAQSFLAPKPRRTHMQAVTELLNHTVNQGLPGDPNAPGCAPE
                     NFMTPYIPHQTHIPYPMALVNRAPYGPPTHSSVSTPQNAAWLSALRYARDSVYIISPT
                     LNASPLIPAIIEACERGVDVYCYVCLSYNDAGELLPRQGGHNEKVAAALHASPSLSPA
                     GRRHLHYHWYVAKDRTAPVSQARRQRSSHVKLLIADGRVAIQGNGNQDTQSWFHSEEV
                     NVLIDSPALCASWLDALQRNQNTALFGAVNRKDGVWRDAEGRQADGAIGPDAGGVFGW
                     VKGVKGAVERLRGTGGF"
     gene            2440125..2441221
                     /locus_tag="MYCTH_2310684"
                     /db_xref="GeneID:11514313"
     mRNA            2440125..2441221
                     /locus_tag="MYCTH_2310684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666128.1"
                     /db_xref="GeneID:11514313"
     CDS             2440388..2441164
                     /locus_tag="MYCTH_2310684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666176.1"
                     /db_xref="GeneID:11514313"
                     /db_xref="JGIDB:Spoth2_2310684"
                     /translation="MSFPDEPAKHSAWEGRDTSYYAAPAAPCVGRGSDERPLVPTSPA
                     APVLASDYAYVPAVRSTKRLPPRPAQDCFKESEDDGGGRTEATPLSCTPAPHSERGNR
                     RPPPDRYRYYYHTFPDPAAANNSCKDSTEGAAPGQGPCYFETLLDLSDYYLDSDSYPE
                     PTKHERELETLATESGLADRKRRRGWWWRVHQAGVVVSWVLLVVVWMSVAIAVSWRVK
                     GGSELVSGGWDGNNRDGVGEWAPCTAARPRFCRLVVGAET"
     gene            complement(2441222..2443454)
                     /locus_tag="MYCTH_2310685"
                     /db_xref="GeneID:11514314"
     mRNA            complement(2441222..2443454)
                     /locus_tag="MYCTH_2310685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666129.1"
                     /db_xref="GeneID:11514314"
     CDS             complement(2441280..2443409)
                     /locus_tag="MYCTH_2310685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666177.1"
                     /db_xref="GeneID:11514314"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="JGIDB:Spoth2_2310685"
                     /translation="MAKNKTTKRESAPVTKITDPRFANFETDPRYKLPSKKTLKTKID
                     KRFSRVLKDADFVATAKVDRYGRKLKTDTKKKALQRLYEEEEEDEHDPGEDAQVEDDD
                     IVRRELEKADAKYDPARGGGFSSSESDSDSDEDSESEAEPEAEDEEEETRPGIHLRRE
                     KQQVEEGEVTNRFAVVNMDWDHVKSVDLLALFSSFVPPGGRIEKVSIYPSEFGKERMQ
                     REELEGPPKEIFKKSKESDDEDDDEDDSASDSESDDDDDGTGDSDEEVKKELLKEGDD
                     QDFDSDALRTYQLERLRYYYAVVVCSDKNTAHKIYEATDGSEYLSSSNFLDLRFVPDD
                     VTFDDEPRDECDSVPAGYQPVEFTTDALQHSKVKLTWDMHPEEASRKESIKKAFSGSR
                     ADIAENDLRAYLASDSESDDGEGDDVPAEERGEDGAPLSKKEIARRKMRAALGLSDEP
                     APKSSNSGPVGEMQITFTPALSEKPKKDEAEETTIEKYKRKERERKERKRAMALAKRE
                     GIDPNAVQKPQAEGGEEDLGFDDPFFTAEPVKPSKSALRKEERLKKRAAREKEEAENA
                     AQKAQLELLMADENGGGAHLDHFDMKEIARAEKLKGKKKKKGKKVAENNGGLQEDFKM
                     DVEDSRFKAVFENHEFAIDPSNPKFKATQGMKKLLEEGRKKRKAGPEDSPNGKRDQRD
                     SKKAKADGDQELSTLVESVKKKVKAKR"
     gene            <2445963..>2447501
                     /locus_tag="MYCTH_74402"
                     /db_xref="GeneID:11514315"
     mRNA            <2445963..>2447501
                     /locus_tag="MYCTH_74402"
                     /product="tubulin-tyrosine ligase-like protein"
                     /transcript_id="XM_003666130.1"
                     /db_xref="GeneID:11514315"
     CDS             2445963..2447501
                     /locus_tag="MYCTH_74402"
                     /codon_start=1
                     /product="tubulin-tyrosine ligase-like protein"
                     /protein_id="XP_003666178.1"
                     /db_xref="GeneID:11514315"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="JGIDB:Spoth2_74402"
                     /translation="MHAFINPSAPWLKEHIKAFVRQHVPDVVLVDDVGDLPEGGVDAL
                     FQFCDGCSLTGHFAAANAAKRSLINAYPNSDALARKDHLAALVGYWTAKRPESILRKH
                     YPHTVPLTLDYAEYVDDALMAADDLSLLSSLEQNEAREPKDREWWILKPALVDSGMGI
                     RLFSTVQELASHLELVENETDDEEEEDDDDDDDDDNDEEDEEEAEAEKDGDEQVGTTK
                     ADMTEEQSPTLTSPGLQSLDALFTVTSPTAPPPPLVVDKSKNKNKSKSKRPRYVFKEG
                     GRIPSAQMRAFAAQRYLAAVPTLGGGRKWHIRAYALAVGRLRVYVAREMLVLLAAEPY
                     VGPWVGERPNMRAALTNSAMRDEDDLAAGRTMRAFWDLGEEEEEEEEEARRADWKTDV
                     FEQVCGITAELFRAAAHTMADKFVTVDKAFEVFGLDFLLDTSGNAWLLEVNETPAFYD
                     NPVAGPVALRVLEAVVYTAMEHMGRARVGDDPRHAEVKGRLVEVLDETAKLGKSNITE
                     IIPE"
     gene            complement(<2448019..>2449251)
                     /locus_tag="MYCTH_98003"
                     /db_xref="GeneID:11514316"
     mRNA            complement(join(<2448019..2448038,2448147..>2449251))
                     /locus_tag="MYCTH_98003"
                     /product="glycoside hydrolase family 62 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666131.1"
                     /db_xref="GeneID:11514316"
     CDS             complement(join(2448019..2448038,2448147..2449251))
                     /locus_tag="MYCTH_98003"
                     /note="CAZy_ID 267819"
                     /codon_start=1
                     /product="glycoside hydrolase family 62 protein"
                     /protein_id="XP_003666179.1"
                     /db_xref="GeneID:11514316"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR005193"
                     /db_xref="JGIDB:Spoth2_98003"
                     /translation="MRLTKTDLSVALLASALPATQAACSLPSSYRWTSTGALAQPKSG
                     WANLKDFTHVPYNGKHLVYGSYYSNAYGSMNFGLFSDWSEMGSASQNQMSQAAVAPTL
                     FYFSPKNIWVLAYQWGATPFSYRTSTDPTNPNGWSAPQPLFSGSISDSDTGPIDQTLI
                     GDDKNMYLFFAGDNGKIYRASMPLGNFPGNFGSAATVVLSGARYDLFEAVQVYTVVGQ
                     SSPTYLMIVESIGARGRYFRSYTASRLDGAWTAQAASESQPFAGAANSGASWTSDISH
                     GDLIRIDANHTMPVDPCRLQLLYQGRSGDSADYNSLPYRPGLLTLQGASSGGGDNGGG
                     GGGVTVPRYGQCGGQGYTGPTTCESPYTCKYQNDWYSQCL"
     gene            complement(<2449713..>2450422)
                     /locus_tag="MYCTH_90035"
                     /db_xref="GeneID:11514317"
     mRNA            complement(join(<2449713..2450015,2450048..>2450422))
                     /locus_tag="MYCTH_90035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666132.1"
                     /db_xref="GeneID:11514317"
     CDS             complement(join(2449713..2450015,2450048..2450422))
                     /locus_tag="MYCTH_90035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666180.1"
                     /db_xref="GeneID:11514317"
                     /db_xref="JGIDB:Spoth2_90035"
                     /translation="MGDEFEMLSCVNELSRLILEPIVLNPLPAEAKFKLNNQRLLTNR
                     GNLQKFRVNSRHHSRELAAAVLSLERIYIQMSVSENLHTACDCSVPLANTSPDSAWPG
                     TPSRLSGRRPSRRPGLAVVNPARCRPLELAKQRSARACSAFSLSLALLWCNLGQPKGP
                     LFCDWHGPAPVETRPHRGGSCLVDTVPLPELIHPFPPFKKERRPAFNLPQVRTIWQDA
                     NVMAEHR"
     gene            2450436..2450934
                     /locus_tag="MYCTH_2310691"
                     /db_xref="GeneID:11514318"
     mRNA            2450436..2450934
                     /locus_tag="MYCTH_2310691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666133.1"
                     /db_xref="GeneID:11514318"
     CDS             2450584..2450745
                     /locus_tag="MYCTH_2310691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666181.1"
                     /db_xref="GeneID:11514318"
                     /db_xref="JGIDB:Spoth2_2310691"
                     /translation="MPCTARRFFFFFFFFFFFFFLAQCGWVKGNFISHALSERRSTEL
                     QKNLQVRRT"
     gene            <2453278..>2454311
                     /locus_tag="MYCTH_98002"
                     /db_xref="GeneID:11514319"
     mRNA            join(<2453278..2453625,2453704..2453791,2453863..>2454311)
                     /locus_tag="MYCTH_98002"
                     /product="methyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666134.1"
                     /db_xref="GeneID:11514319"
     CDS             join(2453278..2453625,2453704..2453791,2453863..2454311)
                     /locus_tag="MYCTH_98002"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003666182.1"
                     /db_xref="GeneID:11514319"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_98002"
                     /translation="MAARTKELHKFFNEIKSHGTTELFLDNARRVSAPLAARLLKQMG
                     LGEHTSTPFKLFENACGVGVVAPLLQQLIKPDVLKSSSILCGDFSEQVVEVARQRNES
                     EGWVNTEVRKIDGQRTGLDDGAFTHVATSIGFHVIPDSEAALNEAIRILQPGGILGLT
                     TWHREAGWVTEIKEAVKEFPFEAPIDVPMQTTAWGNWSDVNWLRKTLEEKGLQDVKVD
                     VYAFLSRCDGPDHFIQQFGSLLDALLMGSWPEEVRQAHPKEEVLQLIKEHVTKKYGGQ
                     GWDLSWVAAVATGRVPYP"
     gene            <2455322..2455910
                     /locus_tag="MYCTH_2316317"
                     /db_xref="GeneID:11514320"
     mRNA            <2455322..2455910
                     /locus_tag="MYCTH_2316317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666135.1"
                     /db_xref="GeneID:11514320"
     CDS             2455325..2455813
                     /locus_tag="MYCTH_2316317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666183.1"
                     /db_xref="GeneID:11514320"
                     /db_xref="JGIDB:Spoth2_2316317"
                     /translation="MRIAGAKVTGKRKVRWVCFRGGEARHHRRPPVDEAVLRQAKAEG
                     RRKPTTDRASKKCGCLFKFEVVETARDSDVWVLHYPNEEHKVHNHGPSDTTSDPRARK
                     LPGFMAAEVDRWLREGWLVSKIQEELRSRGFTNVLNTDLYNRKRLLKKDGGREGGNRG
                     GG"
     gene            complement(<2456305..>2457496)
                     /locus_tag="MYCTH_37469"
                     /db_xref="GeneID:11514321"
     mRNA            complement(join(<2456305..2456453,2456780..2457092,
                     2457310..2457380,2457457..>2457496))
                     /locus_tag="MYCTH_37469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666136.1"
                     /db_xref="GeneID:11514321"
     CDS             complement(join(2456305..2456453,2456780..2457092,
                     2457310..2457380,2457457..2457496))
                     /locus_tag="MYCTH_37469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666184.1"
                     /db_xref="GeneID:11514321"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Spoth2_37469"
                     /translation="MYCAIDGYVYDLGRYLHSHPGGAQMLYQYAGRDATDELRSEDPD
                     FYSDLAPYAGADSTDALKAAKAPHALVRLFSRDDLVCAKIVRGTKKPIAPPELRRHCR
                     IPSADERRREPRDCDTDWRVWVAVPEVDGSEKHMVYDVTSREGQVQSEKHGRKQGHGR
                     RDVAGSKRRVGAVDNSNSEIISKPKRFRTG"
     gene            complement(<2460409..>2461021)
                     /locus_tag="MYCTH_98000"
                     /db_xref="GeneID:11514322"
     mRNA            complement(join(<2460409..2460423,2460494..>2461021))
                     /locus_tag="MYCTH_98000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666137.1"
                     /db_xref="GeneID:11514322"
     CDS             complement(join(2460409..2460423,2460494..2461021))
                     /locus_tag="MYCTH_98000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666185.1"
                     /db_xref="GeneID:11514322"
                     /db_xref="JGIDB:Spoth2_98000"
                     /translation="MTSQIFSTASQTSQPPRSPWLRKYGGEMRNVLNITGDTVAHSGF
                     APLFPSLHPTYFAEESTVFEQLPPYPIPPGHELDMLFSTEASQIMLNGGLTTWEMGVL
                     REHLAGGRPGGHRQMDPVTPYYLDAGPGVRVDEGGWHPVFAKSKWYDFRLPIVDGKLV
                     REALPGINVSDVWSVDMAHG"
     gene            complement(<2461779..>2462321)
                     /locus_tag="MYCTH_2112936"
                     /db_xref="GeneID:11514323"
     mRNA            complement(<2461779..>2462321)
                     /locus_tag="MYCTH_2112936"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666138.1"
                     /db_xref="GeneID:11514323"
     CDS             complement(2461779..2462321)
                     /locus_tag="MYCTH_2112936"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666186.1"
                     /db_xref="GeneID:11514323"
                     /db_xref="JGIDB:Spoth2_2112936"
                     /translation="MSESGSPPPDFESKRLNENAAADTTIETPRASVSTCRYKSSSPV
                     QSAPGSDRKPHPNAVLRDVDDHHQQNLGNPSSMMAPSGEPDDVHDKSESVPADDFETT
                     SARPISVTSSVYAHTIENGRRYQHFRNGCYPIPNNEEELNREDMKHAMMLELCDGALF
                     YTPIGDNVHKILDVGTGTDK"
     gene            2463788..2465817
                     /locus_tag="MYCTH_2310696"
                     /db_xref="GeneID:11514324"
     mRNA            join(2463788..2464332,2464420..2464627,2464701..2465817)
                     /locus_tag="MYCTH_2310696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666139.1"
                     /db_xref="GeneID:11514324"
     CDS             join(2464103..2464332,2464420..2464627,2464701..2465594)
                     /locus_tag="MYCTH_2310696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666187.1"
                     /db_xref="GeneID:11514324"
                     /db_xref="JGIDB:Spoth2_2310696"
                     /translation="MAPHAADPPTPAGQETGPSDSNPIGPPSGLSAIPSRYNSEQGLR
                     QSMKQIGYDEAREDGYRLKGVQLIDSVRQSLQLPVKTFDTAATYYHKFRVRFPSNEYN
                     YEDVALASLFVACKAEDTIKKSKEILCAAHNLRQPHDHKTPDDKIFEAPSRFTVGLER
                     HILETVGFDFRVQYPQKLLIKMVRKMFPREEQGTMEEGKRFLRVAYNMSIDLYKTFAP
                     IKQATFTLVLAILELTALLLDTNPANTREFRDASAWHSHRPCVLETILDLLDLYTQFP
                     KSTKIGTQFALQKLMDVKIDINNLIAREKYQRYHEWCDRCAPDVLDTRSVTPGSATSP
                     ATNPSLSGNSSKRKRAPNEGTQRFVFDADEARKEKEVVSRYFNDEYEEHEVEVEEPIR
                     ESEPRHPGRTNHSYRSHGHSQGDYGWPGHHHRSNRHGHPSDRHRSRRGHGY"
     gene            complement(<2466487..>2467699)
                     /locus_tag="MYCTH_2130079"
                     /db_xref="GeneID:11514325"
     mRNA            complement(join(<2466487..2467101,2467187..>2467699))
                     /locus_tag="MYCTH_2130079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666140.1"
                     /db_xref="GeneID:11514325"
     CDS             complement(join(2466487..2467101,2467187..2467699))
                     /locus_tag="MYCTH_2130079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666188.1"
                     /db_xref="GeneID:11514325"
                     /db_xref="JGIDB:Spoth2_2130079"
                     /translation="METVPTIGHKRSRSAADSESNLQEATSAARETTRNAPRVLLVHL
                     SALLSCNDAMIRVIPAILADILPANDIPSFTDEDALRAFSKSPILQHILQELGVRPLS
                     YDESVRLQQVYWRIFYGLGAPLITLAPGAGELLDATKRHGQIALAVVAHNTAEAAKVL
                     ADAGVGHLVDTILPALPAETYASENPDPRAFWSHWGQFVMPWFTAYCDKASGETDQKP
                     GADAAGAAANGSTTTPMTDTPIPSDNTNNDASDEAGSRAEARNLVPERALLVSSVLAD
                     LSAAKASSGIQTCWFRRIDAADPLVTGSASGSFDLVIGGLDELRAHLFGEVDGRGGDH
                     SSSGPATRCKEEEEREKNQKKEEEDVEDVREQEKDEMMGDC"
     gene            complement(2468309..>2471776)
                     /locus_tag="MYCTH_2140615"
                     /db_xref="GeneID:11514326"
     mRNA            complement(join(2468309..2468625,2468757..2469957,
                     2470045..2470087,2470929..2471086,2471146..2471253,
                     2471344..2471384,2471486..>2471776))
                     /locus_tag="MYCTH_2140615"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666141.1"
                     /db_xref="GeneID:11514326"
     CDS             complement(join(2468431..2468625,2468757..2469957,
                     2470045..2470087,2470929..2471086,2471146..2471253,
                     2471344..2471384,2471486..2471776))
                     /locus_tag="MYCTH_2140615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666189.1"
                     /db_xref="GeneID:11514326"
                     /db_xref="JGIDB:Spoth2_2140615"
                     /translation="MYNPQKERLLKVGLLVAIGIINVSVFCIWVPTRLQISQTFIRIN
                     NTWDRMEKAIFAVIDMSLNVYFIKSKLVASGLKQYGIVWKYNVFMVFISISLDILVIG
                     LMSLPDDAVPTPPTFLAKLNIEMNMVEMLGKVVKQSTKRNTPLPTAKDSIMSPGGGAG
                     GSGEGGSAGGGQRHELNMDILNNPNLGANDSGASTSGTQVTRPRSSTKDPLDDDGPLA
                     SPLSPDRVQRTLSIRSHPRSSGPGSPMMPRSPAQSPAPTGKRIISGAPSPRQGPKDFS
                     YLLRPEIYHPLTPLAVPPPFRNPRNPPEADTPIPDLLAQGYFRAAAIAAAQTLTSGAL
                     DPTDHARIFDLFYIRLACLTLVDATPLAAQEVKALGDLHSAFYYCSSPATQSKDGGGG
                     GNSSITGGETTPGTTAASAPPPPPSSSSPPEHVVPWPLRLLAVRLQALGFGDPRRAVM
                     SYYELAREARARLGAARARHDHSASEVWRERLADLGVRVAGALVEMDDLAGALVHLGT
                     LAPRRGGGGGGGNLKKGMVAVRMALLWLQLGDVDAARACVGANADGGGDGDGDGVEER
                     VVSALCDVADGEYEAAVEKWRALREQVDDEMVGVNLAVCLLYVGKMQEGRELLEQLVD
                     SGRSSHTLLFNLSTMYELCTDRSRALKARLAEKVAAVGDRTGGWEKTNADFKLQ"
     gene            <2486684..>2491244
                     /locus_tag="MYCTH_2069363"
                     /db_xref="GeneID:11514327"
     mRNA            join(<2486684..2486760,2491160..>2491244)
                     /locus_tag="MYCTH_2069363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666142.1"
                     /db_xref="GeneID:11514327"
     CDS             join(<2486684..2486760,2491160..2491244)
                     /locus_tag="MYCTH_2069363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666190.1"
                     /db_xref="GeneID:11514327"
                     /db_xref="JGIDB:Spoth2_2069363"
                     /translation="KMAFRTPYSYYEYLIMLFRLTNALATLFNEFYIVCLDNILIFLP
                     NYKTYIKYI"
     gene            complement(<2530038..>2531138)
                     /locus_tag="MYCTH_2112941"
                     /db_xref="GeneID:11514328"
     mRNA            complement(join(<2530038..2530082,2530134..2530158,
                     2530268..2530352,2530451..2530500,2530552..2530606,
                     2530717..2530939,2531085..>2531138))
                     /locus_tag="MYCTH_2112941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666143.1"
                     /db_xref="GeneID:11514328"
     CDS             complement(join(2530038..2530082,2530134..2530158,
                     2530268..2530352,2530451..2530500,2530552..2530606,
                     2530717..2530939,2531085..2531138))
                     /locus_tag="MYCTH_2112941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666191.1"
                     /db_xref="GeneID:11514328"
                     /db_xref="JGIDB:Spoth2_2112941"
                     /translation="MVRRNRDTADLLDAPGSELPYEGLYTVHYTELRALLPSSSKGPT
                     AVHHGPIISVTRSRSAFFQRAAVLPMVDMHCFGIRTSSDSRDRGDRQEGSNRTPGASQ
                     DSDAAQPLLVRSSMHFFVCQYPKLYLILFRFRCGGMFVESDRTVLREAPRWCIRAAYR
                     CREQAKNLSGPDVGKVPN"
     gene            2532517..2533924
                     /locus_tag="MYCTH_2310703"
                     /db_xref="GeneID:11514329"
     mRNA            join(2532517..2532648,2532719..2533924)
                     /locus_tag="MYCTH_2310703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666144.1"
                     /db_xref="GeneID:11514329"
     CDS             2532883..2533455
                     /locus_tag="MYCTH_2310703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666192.1"
                     /db_xref="GeneID:11514329"
                     /db_xref="JGIDB:Spoth2_2310703"
                     /translation="MTRALVTLLAAAAAIQQAVAAPIAQNGAEGAAKEKRQGSDLPPF
                     PTGGFPPFPTGGFPPIPTGGFPPIPTGGFPPVPTGDFPPIPTGLIPGLPPANPEEAPD
                     KEKRQGSDLPPFPTGGFPPFPTGGFPPFPTGGFPPVPTGGFPPFPTGGFPPFPTGGFP
                     PVPTGGFPPVPTGPAPGWPPKPPAEPPVKA"
     gene            2535178..2536138
                     /locus_tag="MYCTH_60397"
                     /db_xref="GeneID:11514330"
     mRNA            join(2535178..2535411,2535600..2536138)
                     /locus_tag="MYCTH_60397"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666145.1"
                     /db_xref="GeneID:11514330"
     CDS             join(2535302..2535411,2535600..2535870)
                     /locus_tag="MYCTH_60397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666193.1"
                     /db_xref="GeneID:11514330"
                     /db_xref="JGIDB:Spoth2_60397"
                     /translation="MDRQQPSRLLSTSARVHPPYLPYLHNASRTRAKSLKWLPPLAAA
                     VVVTAGYAVSTYRGEIAGQATSSSSSSSTSAEHHTSALSPEQAEAEQLRRREAAMADA
                     YGDRSSLEELERAVAVYEAQRGAR"
     gene            complement(2536491..>2538312)
                     /locus_tag="MYCTH_2310708"
                     /db_xref="GeneID:11514331"
     mRNA            complement(join(2536491..2537698,2537752..>2538312))
                     /locus_tag="MYCTH_2310708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666146.1"
                     /db_xref="GeneID:11514331"
     CDS             complement(join(2536718..2537698,2537752..2538312))
                     /locus_tag="MYCTH_2310708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666194.1"
                     /db_xref="GeneID:11514331"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="JGIDB:Spoth2_2310708"
                     /translation="MHDKALPHRNFCGLSSVSNVNWSPSFIQNKPNTIKPSSSGITIT
                     MAKRRSKKRTHVGANNPATVNGHANPKDPKSMVIRIGASEVGTSVSQLATDVRRVMEP
                     GTASRLKERKANRLRDYVTMCGPLGVTHLLLFSRSQSGNTNLRLAIAPRGPTFHFRVE
                     KYSLTKDVRRAQRHPKGGGKEYITPPLLVMNNFTSPSSDAHTKVPRHLESLTTTAFQS
                     LFPPINPQTTPLKSIRRVLLLNREQSEDGTFVINFRHYAITTKAVGLSKPLRRLNAAE
                     KMLKSKKGKKGGVPNLGNLRDISEFMIGGENGEGYMTDGTSGSEPDTDAEVEVMETTT
                     KRVHSGKARAAEQNSDDEEGGANDNVERRAVKLVELGPRMRLRMTKVEEGMCAGKVMW
                     HEYVHKTKEEIQELEKRWEQRKKEKEARKKQQKENIEKKRKAKEGKKNAAGDKDGRDD
                     DDKMDVDEYDSDLYEDENGFDSEGLEGDAEEQVNAAMEEKGEWEDEEAEIAEGKSSKT
                     KSLKR"
     gene            2538402..2541790
                     /locus_tag="MYCTH_2096529"
                     /db_xref="GeneID:11514332"
     mRNA            join(2538402..2538646,2538702..2539108,2539177..2539215,
                     2539281..2539859,2539940..2541790)
                     /locus_tag="MYCTH_2096529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666147.1"
                     /db_xref="GeneID:11514332"
     CDS             join(2538437..2538646,2538702..2539108,2539177..2539215,
                     2539281..2539859,2539940..2540186)
                     /locus_tag="MYCTH_2096529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666195.1"
                     /db_xref="GeneID:11514332"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2096529"
                     /translation="MSTKRRKISHENGAVKETSVEAPKAKSKTEPIPKSNEPSHDAGS
                     DAESATVDNASREGNGKSVVKTFRDLGIVDSLCDACERLGYKNPTPIQQEAIPLALQN
                     RDIIGIAETGSGKTAAFALPILQALLDKPQPLFALVLAPTRELAAQIAQAFEALGSLI
                     SLRCALILGGLDMVQQAIALGKKPHVVVATPGRLLDHLEKTKGFSLRNLKFLVMDEAD
                     RLLDMDFGPILEKILKFLPRERRTFLFSATMSSKVESLQRASLRDPLKVSISSSKYQT
                     VSTLVQNYIFIPHMHKDTYLIYLCNEFAGQTIIIFTRTVLETQRIAILLRTLGMGAIP
                     LHGGLSQSARLGALNKFRAKSRDILVATDVAARGLDIPNVDCVLNFDLPQDSKTYVHR
                     VGRTARAGKSGHAISFVTQYDLEIWLRIEAALGTKLTEYATEKDEVMVFKPRVEEAQR
                     HAKNEMKQLLEDRGKKGSVLKGGKGRKRGAPASSRDDMDAEEG"
     gene            complement(2543946..2545856)
                     /locus_tag="MYCTH_2310716"
                     /db_xref="GeneID:11514333"
     mRNA            complement(2543946..2545856)
                     /locus_tag="MYCTH_2310716"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666148.1"
                     /db_xref="GeneID:11514333"
     CDS             complement(2544273..2545544)
                     /locus_tag="MYCTH_2310716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666196.1"
                     /db_xref="GeneID:11514333"
                     /db_xref="JGIDB:Spoth2_2310716"
                     /translation="MLRKKDVFTVITPIPGFIPRQLAIDILHSHPEVITLNPLVIGHR
                     PIPAPQNAETDEYYSTWYEITERIQFVPGIGRIGASVIKFNGCFHDMPWGLQTHIYAP
                     MQVDLRNTYRIAGNQPGVEPPEIPEIGLRALGAPPDGLYLREDIEIRCNVTVMSFVKS
                     QLKKAGGEMVRRMIKKAELLDTGLLQAMIEDGKLRTINPADRSSQLRSPLPSPTSLRY
                     SSSVSGSPPPGSPPVPYRVPRIQSAHGGYQRPESAAGSRGDAYSIQSAPQELPADVES
                     PPAQAPVEMPGDFYHRPPKPQQDRQSPPQTFGLSPPHSDRESFVNSAQHRSTSPSRPV
                     GGQWTTPGSRPALPSPGLPSPGLDNSSYPAPLTTHRETEEEHEDDTQAPRRASQPPQS
                     VPYNPADYAKAPQGQPRYGHGQLGQRYSYQQ"
     gene            2546717..2548781
                     /locus_tag="MYCTH_113239"
                     /db_xref="GeneID:11514334"
     mRNA            join(2546717..2546865,2546921..2548373,2548433..2548781)
                     /locus_tag="MYCTH_113239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666149.1"
                     /db_xref="GeneID:11514334"
     CDS             join(2546775..2546865,2546921..2548026)
                     /locus_tag="MYCTH_113239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666197.1"
                     /db_xref="GeneID:11514334"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="JGIDB:Spoth2_113239"
                     /translation="MLKMALASTPTTRPDGQPEQAVAVVCIGMAGAGKTTFMQRINAH
                     LHAKKEPPYVVNLDPAVTYSPYQSNIDIRDSVNYKKVMEEYNLGPNGGIMTSLNLFTT
                     KVDQVIGLLEKRAAPDPENPNRKPVKHILVDTPGQIEAFVWSASGSILLDSIASSFPT
                     VLAYIVDTPRASSTSTFMSNMLYACSILYKTKLPMIVVFNKTDVKDASFAKEWMTDYE
                     AFQQALDNDQRGNAFGGEEGSGSGSGYMGSLLNSMSLMLEEFYCHLNVVSVSSLNGTG
                     IDEFFEAVKEKADEFRRDYQPELDRLRAEKEENKRKQREKELEKMMKGMSMGDAPSSS
                     AVGDIKADDDEMEPLSSDEDSDEIDDEQDAEGLQARYEAAMLHQENSVTADASFAKYL
                     HSQRGQ"
     gene            <2549258..>2549914
                     /locus_tag="MYCTH_37799"
                     /db_xref="GeneID:11514335"
     mRNA            <2549258..>2549914
                     /locus_tag="MYCTH_37799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666150.1"
                     /db_xref="GeneID:11514335"
     CDS             2549258..2549914
                     /locus_tag="MYCTH_37799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666198.1"
                     /db_xref="GeneID:11514335"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="JGIDB:Spoth2_37799"
                     /translation="MAPAPKDHYASSLPPVPSSGFDPGTSRGAQTAVESVADCPFCHI
                     ASVFSPYDPADPPPSSSPLLNPELTGPQPATFIILSTPHLVAFLDIMPLSIGHVLLCP
                     RAHRPKLTDVSPTESAELGRYLRILSAAVVEATGVGDWNVVQNNGAAAAQVVAHMHFH
                     VIPRPELRDRRSERFTATMFGRGQRDELDEDEAVELAEKVRSAVAEIVRKDEEGFAKL
                     "
     gene            complement(<2550203..2551400)
                     /locus_tag="MYCTH_113236"
                     /db_xref="GeneID:11514336"
     mRNA            complement(join(<2550203..2550592,2550651..2551134,
                     2551205..2551400))
                     /locus_tag="MYCTH_113236"
                     /product="Aldo/keto reductase-like protein"
                     /transcript_id="XM_003666151.1"
                     /db_xref="GeneID:11514336"
     CDS             complement(join(2550203..2550592,2550651..2551134,
                     2551205..2551227))
                     /locus_tag="MYCTH_113236"
                     /codon_start=1
                     /product="Aldo/keto reductase-like protein"
                     /protein_id="XP_003666199.1"
                     /db_xref="GeneID:11514336"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_113236"
                     /translation="MAQTKITSKTFKLNTGAEIPAIGLGTWQSKPGEVGRAVEAALRA
                     GYRHIDTAFAYGNEKEVGEGIRASGVPREEIFLTTKLDNPWHKRAPEALKRSLENLGV
                     DYLDLYLMHWPSSTDPDDPKKHYPDWDFVDTWREMQKLMETGKIRNLGVSNFGIKNLE
                     RLLNDPSCKIVPAVNQIELHPGNPSPKLVAYCAEKGIHCTGYSPLGSSDSPLYKNETI
                     AAIAQAKNRTVQQVLLLWGLKKGWSVLPKSVNPDRIKANFDLDGWDLTDEEMAKIDAI
                     PDRFKVCGDAWLPIKVFFGDDE"
     gene            complement(2583421..2586294)
                     /locus_tag="MYCTH_74373"
                     /db_xref="GeneID:11514337"
     mRNA            complement(join(2583421..2584191,2584265..2585268,
                     2585339..2585619,2585676..2585806,2585868..2585994,
                     2586063..2586294))
                     /locus_tag="MYCTH_74373"
                     /product="uncharacterized protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003666152.1"
                     /db_xref="GeneID:11514337"
     CDS             complement(join(2583649..2584191,2584265..2585268,
                     2585339..2585619,2585676..2585806,2585868..2585994,
                     2586063..2586085))
                     /locus_tag="MYCTH_74373"
                     /note="Contains conserved domain ChAPs[pfam09295], ChAPs
                     (Chs5p-Arf1p-binding proteins) are required for the export
                     of specialized cargo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666200.1"
                     /db_xref="GeneID:11514337"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="JGIDB:Spoth2_74373"
                     /translation="MVAPAVPELTEEVLHEAIDARTESLVSLRELGPPDLVHLVKQPL
                     RSGGKPTGVYHHVTGVDASSSASLAAYINTLAYKEFGPSATSKTLEGTYCCYNAFSRV
                     DMRVHAPFPGSVESYCIDERGEKRKATDELWLETYVCSVLRAYSYADDGTGDTIRKIV
                     GVRRFNPVTNTETEHRFLSAAEHLFFRGWQLGSDSIVQVPNVVSNHLTSGLLKYFHTT
                     GRYASGINLFEKLRTQNVEVASLLAKVLFMGNEEVQGIRVLHEALKQAPMDYVMLDTQ
                     AEFLLKKAQTAATPEQKEERLRMALGCADRSTIAAPSEFRTWARLAEVYVAMEDWENA
                     LTALNSCPMFTYQDKDAPVLPEPRDIHLPTLPETRLDEIDSEPESRYSEQVDPSLLNL
                     RAAAYKGTFKHAYNILTEMTAKIGWDQMLKIRSNVFVMEDEYREKQESTSYPKNRNAS
                     TDALRGTPDPTANGDASDAADEGEKEANGSGEEKEGDGGSATQTLSPNGRAEDIERPS
                     SAMDPDEVKKGDECSPKDDHFSRLNNKRLCERWLDSLFMVLYEDLRVYTIWRTQMAQY
                     RAQSIQYKKSAEEWEILGSLAERLQHVDEAVEAYRACLAQRFSPKALAGILKVFEKTK
                     GSTRDTVAATIRLVTWQYRWYSEFSPELLHTVRMLIEDEGAVKIRSIIQATNLPQNVL
                     DLTHHYAALCATFRSSGTDG"
     gene            <2586692..2593134
                     /locus_tag="MYCTH_74371"
                     /db_xref="GeneID:11514338"
     mRNA            join(<2586692..2586853,2586911..2592265,2592344..2593134)
                     /locus_tag="MYCTH_74371"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666153.1"
                     /db_xref="GeneID:11514338"
     CDS             join(2586692..2586853,2586911..2592265,2592344..2592886)
                     /locus_tag="MYCTH_74371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666201.1"
                     /db_xref="GeneID:11514338"
                     /db_xref="JGIDB:Spoth2_74371"
                     /translation="MILRRLRQDGDYLPSPCCCLSFANPFFSQAAFTAINVEPEENVS
                     EEIDTTKDLQVDDALKLFQNALKLHAQGPQYFDKAADAYDALFDSEIFKYPESKTDYE
                     RFEAGQDVALATESAFAQGLPPLGADIDGIGSSLPQALYLSYKNHGQFVIDRIKYRTR
                     KSGSRKETLLDDPVVEAEAHRALDDFCAALDRDPSDAELWRKAARVAAFLRSARISRY
                     SLEAAIELDDDPAVEEVEPPSLAEGFAGEQLKNQLQVLGDDMALSHPIMKPFLDRELP
                     PYLARFTDPMPFLPDPTITLAVQQPRGKESEAPRVTISLSSLSWSELGTAIVRFVAEE
                     GHSGQAIAIQLPDTGNEEDVQMEVDMPEQPRESSPHSISPQEAVKQEEAAAEQPGGEQ
                     IAKEPTSAALESSAPVDEQPAKDRSAPSSSRKRSQSAAGIPDANEEETADVKRSKRTR
                     RRDTAAEEAMDSATFLANQLQPLQAADQNLFQTTKNLLENLGVTDQVTLGRIAEVLDS
                     CAADDRIGKIQKQATVDLRDSITHFDEDTGAVLLSKRELPQSSLSVFLEHARSGSQRA
                     QEAPAFDDSRGLKFFVERANSGWNTVHDISYEYVNALAKLYTGYKWSDQLKTAVADVI
                     SQLEGSIYDRFIHDLNLCQKDGDGEELSDLSTLAQMLFELYLDIYDHTMDPNSTAESA
                     SPDAQGRVARWMDISTEMVRRRNPEPDDAVALRLLWAAVSSTTLAKDTPRDHVLNCWH
                     SLRDFLARSGATEIGLPNSSVMPEISVAAAEREISKLTTMDFFLGLFQDGEGSPVSVI
                     ESLEPVLNPESVYISVPSISDRKGANNEASSAKQPRQPITQCASQELMDLWKFLKSSN
                     TELRLLLWSRLGEAYGKIRYTTKQFSCFLRSIETIISDLEGDDYIHSPDEPRKTQFMA
                     LLKALDDLIIQSLHLALNDNSSFDIIDDDHLRSSMSALAKISCMLHVAAMYEDEIRLG
                     MRPAPSSSSTLRSFLNKLQEMQVRTWSLQYTMLKVGLNQHAELFPRPENDLADYLAAV
                     HQVLGLRKCCKSSNKIFLKMMRVELLKQKNIDNWEDYLGQVLYDLHGLKLGVGIWEVQ
                     DHGCEPENLEKRQALQLVERVTMLANRMSMKDLLKSDLKTTIERMQQAIGSAKSSPQM
                     AHNLRNYSEYLKSPIHPLHLYQALTGSVDLDAVTINTPESAPAKQGWFFLLGMIALTK
                     FKGVDLNRRQTPGATDDLRIGATFLRLQLQYTPDRWDAWFRLAECFDYELDESVLWTA
                     DKMNKERAELVKFQRNAIHSYIMALSHSYAWASDPAILTSLEDDEEALYDMYHEFGMR
                     MYSSSREPFAMEPFQHADQKRFFIEAEGAGTYKKILHNEMTDYQVWKFAAHLFRKAMA
                     GKPKDWKNPYMIAKCLWKMYQKPVEELDEKNRLHRPTVKTIVNALEKTVEVTSSLPKP
                     RHGQDPILEPHYKIVSVIHKLVTRGDLEIQEAARILQRQPYAPDRGKEVPIENAEDWE
                     AYVIRCLRYLRDKDKSNWQHRIVMRHARLLFDENSDPGGSGSYLAAKAAFYVLRENMF
                     TKTMVMNVWKCDAERPGRHHVYTERYIRYMVRLLDVMNDRVSLEAVLRRIRKKGADFY
                     HFNELWQYCVLTYIKLLRQTFEITPAEEDAFKTLSQEEFDVVGEKITEWSTTPAAENH
                     RALTAMKEAVELKKLNANLMKASPIDDLITDCYSIIYQHFKSDLPDPNQQESQPAEGT
                     EPKAETDLKPSNLLHALVTRDKDNKDKSPSVLGSLRAGSEQPDRERSERPSLAGDQPP
                     RAAASGRVGGGIRRPNILRKAEQAVQAVLRAAEAPPKSAGGTAAAGGASGAGTGAEES
                     GEEGEGEGEDGDQDAEMKGAADGGEGAKTAGRGTVAGEQESDVSSPPGSVHDSADDES
                     ELSDVPADDEDDTPPLLFPNLRRSADNTGTGKEADEESTEDGADEEGGEEDEPEDEHG
                     AESGEEDQEEATHEGDNETEEELEPEGEGDEEGAEPTPAVPEVKDVDAPAEEEEEEEE
                     RGA"
     gene            2593464..2594745
                     /locus_tag="MYCTH_2316331"
                     /db_xref="GeneID:11514339"
     mRNA            join(2593464..2593761,2593860..2594745)
                     /locus_tag="MYCTH_2316331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666154.1"
                     /db_xref="GeneID:11514339"
     CDS             join(2593732..2593761,2593860..2594375)
                     /locus_tag="MYCTH_2316331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666202.1"
                     /db_xref="GeneID:11514339"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Spoth2_2316331"
                     /translation="MASSNKRIAKELAECTGSPPPGISITVPDESDLHTWHVILEGPE
                     NTVYAGGRFGLVVSLPPDYPFRAPTITFATRIYHPNVTNDSLGNICLGPLKPENWKPS
                     TRLAGVLEAVRHLLVEPQPDDPLEARIADEYRADRAEFDKNARTYVQRYAKGPVKFDS
                     ATPTTSAKPAEEKKAGSGGSS"
     gene            complement(2595285..2599003)
                     /locus_tag="MYCTH_2310733"
                     /db_xref="GeneID:11514340"
     mRNA            complement(2595285..2599003)
                     /locus_tag="MYCTH_2310733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666155.1"
                     /db_xref="GeneID:11514340"
     CDS             complement(2595562..2598771)
                     /locus_tag="MYCTH_2310733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666203.1"
                     /db_xref="GeneID:11514340"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_2310733"
                     /translation="MLDDYAPADGAADGGALSPFVEQHHGSPNARRGGPGPHAHPPPR
                     FQSRHQQHWPGFRPWRRHGDADAADALRHHAQYQPFRMQKTPPPGNSGPRRPVLELRS
                     DAHVPPDLISPRSDSFFYSSRPARPCPSPTPTISHFPPNNRTRAEPTPTPTQRPPPRS
                     VFPGLSSNPFIPESPESEETSPVETRRFPLLTRQHEHVARSDRDSSMGSPNESRQGTP
                     TEPNSVVVVENFSRPRKTSVRSQQSDGALSWHMAAHRLYTDPPQLDQPPPQTSGSHPP
                     AGIHRVPNPSTPSRQPSESSSRTASTFSSSIPPRLSHEPLDISPKSDPSRLPTPAVVA
                     PTPTSPRSPQAQHNHNGPNPHLREVPPWLMTGDEARSSFRSQLTSSTAQGTLFTASGT
                     DRNSVTEQSIINGYARRSWRATSVDDGLSLEDVMGMYERGFNDSDIESVRRSMRFPDD
                     DDIPETDPDMDMPEMGGSRPPSSHSGASELREKMLEAMNDSLPIPRAVPIPESGHPIA
                     RQSRTRHSLLPNSLPDSVGLGLASEHASRREKAGSDTMEKHDSAKLLDNDGDAGLSKE
                     IGIQSPTPSSPTSPAQAQPPTADLPSPNSVTPVVTAPLPQEPPEDPDSRDRYGFRKAS
                     ANVSRQEYDAWDKTYTEYLARRRKKWIAFLKDNSLMTDRPNRFPPRSAKTKRFIRKGI
                     PPDWRGAAWFYYAGGPAILSKHRGVYDQLVQRAGLDQDNAGPPSRPSELKPVIVEDIE
                     KDLYRTFPDNVRFKPPPPPPGTCQPGQSQPQPEPEIITSLRRVLHAFAIYNPRIGYCQ
                     SLNFLAGLLLLFVETEEQAFWLLNVITRVYLPGTHEMSLEGSKVDLGVLMVALKESMP
                     GVWKQIGGDEFEAGKKNKGRRGQKSGHGANSGSVSDPNRLPAITLCMTAWFMSCFIGT
                     LPIETTLRVWDVFFYEGSRTLFRIALTIFKLGEREIKAVKDPMEMFGVVQTFPRRIVD
                     CNMLLETCYKRRNGIAHLSQELVEEKRKERREGIRRWKAEQEAAASEHSSPQPTTKQR
                     LGTDALGLDLATDPEDVRRKTPLFGRRKDREQVRAAEVV"
     gene            2601930..2603212
                     /locus_tag="MYCTH_109795"
                     /db_xref="GeneID:11514341"
     mRNA            join(2601930..2602093,2602330..2602451,2602601..2603212)
                     /locus_tag="MYCTH_109795"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666156.1"
                     /db_xref="GeneID:11514341"
     CDS             join(2602017..2602093,2602330..2602451,2602601..2602923)
                     /locus_tag="MYCTH_109795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666204.1"
                     /db_xref="GeneID:11514341"
                     /db_xref="JGIDB:Spoth2_109795"
                     /translation="MSGRKRKQDEEEELVSLPSDEEEEEEYVEDEEDEEEADDDEEDE
                     DFDEEAEGEDGDEEEDEENAAPEQAPPKKKLKTAAADEASLENGTAANGDGEDEEAEG
                     EEEEEVDEEEEEEEEVGEENGEEEEAEGEEEEEGGEDETDKVPAKAVGKVAAAAGEEA
                     ESKAAAAGGDEED"
     gene            complement(2604028..2605580)
                     /locus_tag="MYCTH_2310736"
                     /db_xref="GeneID:11514342"
     mRNA            complement(2604028..2605580)
                     /locus_tag="MYCTH_2310736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666157.1"
                     /db_xref="GeneID:11514342"
     CDS             complement(2604117..2605376)
                     /locus_tag="MYCTH_2310736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666205.1"
                     /db_xref="GeneID:11514342"
                     /db_xref="JGIDB:Spoth2_2310736"
                     /translation="MTGDDASANGSRAAQSNPGAETRDSQHAEAQSQPQHGRQQETKT
                     QPSSPPSSRPLPPSHQESLKPWLPLPPPHAVYPASLPVDQLHDHVETERLESPIWWHK
                     TKLGLLLLSLMVCAVIFGIGIALGFRIASYDSSDLGYGAVDYEFGLSGGGAGLAIVVT
                     TLEFLKTLFSRRNEGLHPGTLVAAHLIIWLVVLAAVVYTSFLNAYYRLNDQTTTFQHV
                     LLAFDCILLLIHFVLFVDACVMTNRLNRASRGTVVVRVPIQAGAGYQGVPYPVYGYPS
                     LFVPPQASTQPGQQPVPLMTQVPPQTAEGIGPAPPQPAALYTGYYAPAPQEQSARQLP
                     GDQVLVQGYYAQFPAPATATATAAGPSRNSRGSPPSALAKSSGSRQSQRQAEAETQSG
                     QQTESAAPSEGLQAQSRPGGPGSEKTL"
     gene            complement(2606076..2607012)
                     /locus_tag="MYCTH_2310737"
                     /db_xref="GeneID:11514343"
     mRNA            complement(join(2606076..2606277,2606336..2606437,
                     2606518..2606732,2606813..2607012))
                     /locus_tag="MYCTH_2310737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666158.1"
                     /db_xref="GeneID:11514343"
     CDS             complement(join(2606157..2606277,2606336..2606437,
                     2606518..2606732,2606813..2606893))
                     /locus_tag="MYCTH_2310737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666206.1"
                     /db_xref="GeneID:11514343"
                     /db_xref="InterPro:IPR011056"
                     /db_xref="JGIDB:Spoth2_2310737"
                     /translation="MLSSLGNPRQAAAQLMNFGLILSSAFMMWKGLSVITDSPSPIVV
                     VLSGSMEPAFQRGDLLLLWNRNLMSETNVGEVVVYNVKGKDIPIVHRVVRKFGTGPDA
                     KLLTKGDNNAADDTELYARGQDYLNRKDIVGSVVGYVPFVGYVTIMLSEHPWLKTVML
                     GIMGLVVVLQRE"
     gene            2608999..2611544
                     /locus_tag="MYCTH_2316337"
                     /db_xref="GeneID:11514344"
     mRNA            2608999..2611544
                     /locus_tag="MYCTH_2316337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666159.1"
                     /db_xref="GeneID:11514344"
     CDS             2609283..2610272
                     /locus_tag="MYCTH_2316337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666207.1"
                     /db_xref="GeneID:11514344"
                     /db_xref="JGIDB:Spoth2_2316337"
                     /translation="MFKRSFRSRDASVSHREAASAAMDSQHRVDKSTRLTRKGTSRDP
                     QKVSRLQRSLKDEESSRLRPEQARLADKSLAPSPIVTLVVGRDARLFAAHENVLCQAP
                     FFEKVLRSTYVDAQNKRIMLPDEEPEVFSAVLEYLYKGDYYPRLLHNKQRNTWELEDS
                     LPRRDTPQTSPTVHESPKSGGGRAGQTPQTPSAVEATVYLSSIGQHLLRDTVIYCTAE
                     RYGLEELKKLALRKQGLQSGIDVGTILRSAQYCYANTPDSDSRLRAHYLALIIRCRKT
                     FKRSGTMQAEMEKCGSDVYGEGSGKLFFDLFVAMCNHLDDVIEASNARTPKTI"
     gene            complement(<2611607..>2612465)
                     /locus_tag="MYCTH_2112958"
                     /db_xref="GeneID:11514345"
     mRNA            complement(join(<2611607..2612241,2612381..>2612465))
                     /locus_tag="MYCTH_2112958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666160.1"
                     /db_xref="GeneID:11514345"
     CDS             complement(join(2611607..2612241,2612381..2612465))
                     /locus_tag="MYCTH_2112958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666208.1"
                     /db_xref="GeneID:11514345"
                     /db_xref="JGIDB:Spoth2_2112958"
                     /translation="MAPTNTFTITADPGTDIWRKPPTTDVFNAPIALPPAGATPLRHS
                     GPLTSFLSARLSLNFTPQEQYDQGGILLSFRQRRKDDDDDDNNNNNNRASSSTAAAPP
                     PKWIKSGIEFYNGRPRLSTVSCDNWADWSVADLLPAEASGQSRSETGMGTGAETGWTT
                     IAIEKDKDGNGTGVWVYRVLEDGNGGETKVPLREICWVFGQERLEDREVEVHAMAARP
                     EKKAKGGLTVEFGDLKVRWAK"
     gene            2613179..2616348
                     /locus_tag="MYCTH_2310743"
                     /db_xref="GeneID:11514346"
     mRNA            2613179..2616348
                     /locus_tag="MYCTH_2310743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666161.1"
                     /db_xref="GeneID:11514346"
     CDS             2613533..2616091
                     /locus_tag="MYCTH_2310743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666209.1"
                     /db_xref="GeneID:11514346"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="JGIDB:Spoth2_2310743"
                     /translation="MSSAPTIRAGGPPGKAKPKRKPNSVRRIMEQEQRVREKSVALAS
                     SAGAPAAKPATSGAVCNNPECDKSDVRDGACQNCGRVVWESNIVAEVTFGESANGAAV
                     VHGSYLAADQGSVRPTAPGLAFRRVAGAGASEARERSLREARQLMNQFAHQLQIAPHV
                     AEKAFQVYKFASNSNFIQGRRKNTVAAVCIYAVCRKEDNNKVMLIDLADIIKTDVFLL
                     GRSYKDLLNALPDMKDGTKPIIIEDLIFRFASKLEFLHDTNKVALSAIRIAQRMRHDN
                     ITHGRRPAGICGAALIMAARAHNYRRTVREVVYIAKVTMATLQERMEEFANVPSAQMT
                     VRDFHEAKSLPEASHDPPFVYKQSKEWQEKHGKRSKKRKAGSISRDSSHPVTAPEQDN
                     PEKRQRTEAAQPEVDSVPIDPALRDQSASSAATETPAPGVDGDGFAVPYRRPTQEDLS
                     IANAATAEVDGQLENLANEFGDPEDEEGSEEVDPSSEIAMAAAQGIQIPGMENMKIKQ
                     RGAAGNGARTAAAGAGRSRKKPTLPIDEEWELDENNLEKEVQGHLEDPAMIGASALVR
                     QDIEQRREQEERAQARRSLPPQPEAQRDSSAPPERAETNQQTDSAPINPWVTPRSKVS
                     DDPIVHEDEFKDDPEVMFCKLPEKDVLLKEMIWANHNKDYMRKVQQKIFEAKVSQNNP
                     PKPKRSRARKPRIGEGQATPAGSATEAAQNMLRTRAISTKLDYSRMGNLFEFSKSGPG
                     STYGGASSVGSRSALPSSAGSDAGSDATGDDGARATTPATTAPTDPATARERVAKALA
                     PPEEDEQEQEEEEEEEEEEEAGGFDEEEAFQDDNYGEEDFDPFGDHNGEEDYEE"
     gene            <2631461..>2631808
                     /locus_tag="MYCTH_2130105"
                     /db_xref="GeneID:11514347"
     mRNA            <2631461..>2631808
                     /locus_tag="MYCTH_2130105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666162.1"
                     /db_xref="GeneID:11514347"
     CDS             2631461..2631808
                     /locus_tag="MYCTH_2130105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666210.1"
                     /db_xref="GeneID:11514347"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2130105"
                     /translation="MNGTTVKANDKKKRAYVSTSYGTHPGAMDVDAAQKQDQKKTTKD
                     KSNVTYYNCGKKGHYKRECRSPKKGWKPTPGKEIAAIDETTKDVIEVAATSYEDKGSD
                     TDSLGHDGNGEDE"
     gene            complement(2636501..2637305)
                     /locus_tag="MYCTH_105130"
                     /db_xref="GeneID:11514348"
     mRNA            complement(join(2636501..2636836,2637001..2637305))
                     /locus_tag="MYCTH_105130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666163.1"
                     /db_xref="GeneID:11514348"
     CDS             complement(join(2636678..2636836,2637001..2637207))
                     /locus_tag="MYCTH_105130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666211.1"
                     /db_xref="GeneID:11514348"
                     /db_xref="JGIDB:Spoth2_105130"
                     /translation="MPIEKRKSHSTRYRASLAQNIAKNGFVVMPCSWCASQGLVCKMI
                     ARISVAKPAFVEVVFTMALAYRFLPRELSEKLARLRRLRQQKEFLVEKGADMVARGLS
                     TLDELEEVERQETPAIPSS"
     gene            2661456..2662006
                     /locus_tag="MYCTH_60350"
                     /db_xref="GeneID:11514349"
     mRNA            join(2661456..2661667,2661722..2662006)
                     /locus_tag="MYCTH_60350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666164.1"
                     /db_xref="GeneID:11514349"
     CDS             join(2661540..2661667,2661722..2661779)
                     /locus_tag="MYCTH_60350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666212.1"
                     /db_xref="GeneID:11514349"
                     /db_xref="JGIDB:Spoth2_60350"
                     /translation="MPCSWCVSQGLVCKMIARTKRYEAYIRRGCSCDSSSIPLSSYKF
                     SRSSVVSRMLNVIPNLS"
     gene            2681811..2683205
                     /locus_tag="MYCTH_109790"
                     /db_xref="GeneID:11514350"
     mRNA            join(2681811..2682613,2682785..2683205)
                     /locus_tag="MYCTH_109790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666165.1"
                     /db_xref="GeneID:11514350"
     CDS             2681930..2682568
                     /locus_tag="MYCTH_109790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666213.1"
                     /db_xref="GeneID:11514350"
                     /db_xref="JGIDB:Spoth2_109790"
                     /translation="MMATISTRTTTATTTTTTTEAKTTFTMTSYMPAVTADATPQPAK
                     STLLPPTSIPPPSEFLAHLPQEAVSSPTALRFPAAWRCGTCANLHSVLALLAGPTTTT
                     AAAGAGHSGRRRGEEEDEDDDDDDEGKEGSHHRHRNDHHHHHHNRQLCPCGRPALQAV
                     YDQFGELYLFWRDDPAVSDLSVPRMAEEARWRVRTAGADGWFGGWSASGRLL"
     gene            complement(2683598..2685715)
                     /locus_tag="MYCTH_105128"
                     /db_xref="GeneID:11514351"
     mRNA            complement(join(2683598..2685007,2685129..2685715))
                     /locus_tag="MYCTH_105128"
                     /product="carbohydrate esterase family 3 protein"
                     /transcript_id="XM_003666166.1"
                     /db_xref="GeneID:11514351"
     CDS             complement(join(2684139..2685007,2685129..2685162))
                     /locus_tag="MYCTH_105128"
                     /note="CAZy_ID 268081"
                     /codon_start=1
                     /product="carbohydrate esterase family 3 protein"
                     /protein_id="XP_003666214.1"
                     /db_xref="GeneID:11514351"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Spoth2_105128"
                     /translation="MFGLTLNTLIMALASPLAVQGVPIDTTGIAARASAPLGNGVPLR
                     IMPLGASITFGLKSSDGNGYRAALRDMIVNPPADSYGGGGGGAGQGAARRDEMFKSVR
                     GKSTARVSSGPNKVNMVGSRKAGTMVDNDVEGWSGYRIEQVHDKAMAAESAPKYKPNV
                     VLVNAGTNDAAQNFQVATAGERMEAMLRDLWAVSPRAVVVLSTLLVNQDEATERNVVA
                     INKQLRALVARLRDEEKKKIVLAEMHGRRGPRLADLADGTHPTDEGYRKMANIWYASL
                     RVASDRGWLQAPEPVPGVPDDGAA"
     gene            complement(2687634..2687724)
                     /locus_tag="MYCTH_t175"
                     /db_xref="GeneID:11514430"
     tRNA            complement(2687634..2687724)
                     /locus_tag="MYCTH_t175"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:complement(2687689..2687691),aa:Glu,
                     seq:ctc)
                     /db_xref="GeneID:11514430"
     gene            complement(2688260..2693115)
                     /locus_tag="MYCTH_2083946"
                     /db_xref="GeneID:11506392"
     mRNA            complement(join(2688260..2688939,2689433..2693115))
                     /locus_tag="MYCTH_2083946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666167.1"
                     /db_xref="GeneID:11506392"
     CDS             complement(join(2688435..2688939,2689433..2693082))
                     /locus_tag="MYCTH_2083946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666215.1"
                     /db_xref="GeneID:11506392"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="JGIDB:Spoth2_2083946"
                     /translation="MKQFEHRNLRVGAGPPAATTTTKGNFAGNARQWYHRLVVGLILR
                     RKTLPPSRDGRRIPLRPDREEPLIDERRGYPYISNSIRTSRYTVYDFFPKQLFFQFTR
                     LANFYFLCVGIPQTIPGISTTGNFTTILPLLFFVLLTIAKEGYDDWRRHRLDKIENAK
                     PTTVLRRAGSSIGTSQGWRPWFCGRPTNKLGVFEQQSETGQISPLGLQWQTIKWQDLR
                     VGDVVKLSRDEDVPADIVLLHAEGEGGLAYVETMALDGETNLKSKRVCAALEGCDSVE
                     GICNCDAVFVVEDPNPDLYRFDGRVTVGEETLPLTLTEVVYRGCTIRNTASVIGMVIN
                     TGEETKIRRNANRHPSAKKPALESTANMIVLALVVYLVALVAGLSGGYAIWQHTYERV
                     AWYLRDVPVPYSHIIMGYAIQFNNVIPLALYVSLEIVKICQMLLLNSDIEMYDQASDT
                     AARCNTNTILENLGQVGYLFSDKTGTLTENVMRFRKMSVAGTTWLHQMDLVQGDGSKK
                     LGEPQQVGCEMLGVTLEHGDDTPSGAEVSRFLSLPTPNEDASICRSSSQLRSTLRPDH
                     IQPNLTTSDLLEYIRIRPNSPFSQRAIQYILVMALCHTCLPESKDGKVDFQAASPDEL
                     ALVRAAQDLGFLVTQRTTQSVTLRISTGDGHTERTYRILDVIEFSSKRKRMSIIVRCP
                     DGRIWLLTKGADSVILPRLRLANLATQKAKEVRQSLEFEHQLLRKSEAQEPRNSFGGR
                     PSLTIRRSLALSRHGSLVASSSVRPDKSRSKSFDLRRLDPQTNVLSRPLLDARTVSFD
                     GRRTTRRDASEPQATPTKFAFLEDPSLSDDATIFTRCFRQIDEFATEGLRTLLFAHRF
                     LTEQEYNGWKKLYHDAETSLVDRQDRIEAVGEMIEQSLDLIGASGIEDQLQPGVPETI
                     ERLRRANIKIWMLTGDKRETAINIAHSARICRPGSDVFVLDATKGDLDGQILTIMEDL
                     QIQAETNPSNLPGHTVVVIDGHTLAALEEPAAAAAKSSFYRLIRTIDSVICCRASPSQ
                     KALLVRTVRNFSSSASIAPPAAAAGKGRGGTPLLHDLVARLRRRLLPFPSASAGPLTL
                     AIGDGANDLAMLSEAHVGVGISGREGLQAARVADYAVAQFRFLGRLLLVHGRWNYART
                     ARFVLATFWKEMLFYLPTALYQRLAGYTGTSLYESWSLTALNTLFTSLCVIVPGVWEQ
                     DLAAETLLAVPELILDTHYKTGIVIGSFFITVGGWWIWQVFLAGVYAPGVWPYAVKDG
                     FFSSFGPDPAWWAALFGALGVLACIELAYKSVKRNLIVAGLWKFGWKWLRWSTWKAAF
                     SRGAAAWTEEGTRASLEEWDVELWQVMEQDPAIRETLRRMSRLGFAEENEGPESAWRG
                     DGSEPV"
     gene            2694546..2697758
                     /locus_tag="MYCTH_2310754"
                     /db_xref="GeneID:11514431"
     mRNA            join(2694546..2694857,2695000..2697220,2697317..2697463,
                     2697527..2697758)
                     /locus_tag="MYCTH_2310754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666168.1"
                     /db_xref="GeneID:11514431"
     CDS             join(2694724..2694857,2695000..2697220,2697317..2697463,
                     2697527..2697691)
                     /locus_tag="MYCTH_2310754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666216.1"
                     /db_xref="GeneID:11514431"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="JGIDB:Spoth2_2310754"
                     /translation="MSTPAPPEDQARLLEDALIAVRQQTTLMRRCLDTPGKLMDALKC
                     CSTLVSELRTSSLGPKQYYELYMAVFDALRYLSVHLRENHPVNHLADLYELVQYAGNI
                     IPRLYLMITVGTAYMSIEGAPVKELMKDMMDMSRGVQHPVRGLFLRYYLSGQARDYLP
                     TGDSDGPEGNLQDSINFILTNFVEMNKLWVRLQHQGHSREREQRTQERRELQLLVGSN
                     IVRLSQLVDLQTYKDGILGPLLEQVVQCRDVLAQEYLLEVITQVFPDEYHLHTLDQFL
                     GAVSRLNPHVNVKAIVIGLMDRLSDYAERESQNESEEDREKMEQEALANLLEKFRLSS
                     STAAQSSSAPPAEDSGAGAPKNGVNAENESVSPTETLNADEQTSSVAETDATAVNGEE
                     KLPAARRRGIPENVPLYEIFFGQVKNLVQAQHLPIQDTIALCVSLANLALNIYPERLE
                     YVDQILEYAHSKVREHAKSADLHSQPAQQSLLALLQSPLRRYVSIFTALSLPTYVPLF
                     HAQTYPTRRAVAGEVARTLLKNQTLISTPAHLENVLEVLKVLIKEGSQPPAGYPGVVQ
                     TRARPIETDETMEEQGWLARLVHLVHSDNNDTQFRLLQMLRKAYNEGNERIRTTTPPV
                     VTAGLKLARRFKAREHYDDNWSSQSSALFKFLHSAVSTLYTRVNGSGAAELSLRLFCS
                     CGQVADMTGFEEVAYEFFAQAFTVYEEAISDSRAQFQAVCVIASALHRTRNFGKENYD
                     TLITKCAQHASKLLRKPDQCRAVYLASHLWWATPIAANGETEETELYRDGKRVLECLQ
                     RALRVADSCMETATSIELFVEILDRYVYYFDQKNESVTTKYLNGLIELIHSNLAGNQQ
                     DSISIEASRKHFMQTLDMIRSKEYEGVVLTPK"
     gene            complement(<2698491..>2701395)
                     /locus_tag="MYCTH_97974"
                     /db_xref="GeneID:11514432"
     mRNA            complement(join(<2698491..2698673,2698810..>2701395))
                     /locus_tag="MYCTH_97974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666169.1"
                     /db_xref="GeneID:11514432"
     CDS             complement(join(2698491..2698673,2698810..2701395))
                     /locus_tag="MYCTH_97974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666217.1"
                     /db_xref="GeneID:11514432"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="JGIDB:Spoth2_97974"
                     /translation="MAPNHDQRYDPVPPIPTYEEAIASGSAWHRDVAESPVDHARHTT
                     EAEAEGQSLLTNSRHAFESTTPNQPPAHGRRPRGYRPPTVETDDESSLFSSSSDSDSD
                     DEREADQVRREMQELEIDDSDVHGRNQSSWGKRIGLSLPPWRWKWRWRLPTLRRPAAA
                     GGSGNGNGSGSGSDDTGRAPEAEQTSGSSWFARARPLSFPKFGSTALFLLVGRTLAIL
                     IVMGFLYLLFASDLWSDMARRMGSQMFDPESIRIYVQSNVDPRKIREHLQHFTSYAHL
                     AGTAGDFALMEDTEMLFTKYGLEDVKRDVYQVYLNYPTAQGRAVEIWEEGGKMVWAAK
                     LEEEEVGGRSAGRQTFAFHGHSRSGDVQGRLIYANYGSKEDFQALSDRGINTTGTIVL
                     VRHYGPQEDLAFKVKAAEEAGAAGCITFTDPSDNGFVKGTEAPKGRFMPADGVQRGSV
                     SLTNWVVGDPLTPSWESKENMPRMKVDQTQGLAKIPSIPLAWRDAQGLLQRLQGCGHL
                     VPKPWVGGVPDVGEWWTGNGSSPIVRLRNEQDEVERQPIWNVYGRIVGIEQGEKKVIV
                     GNHRDSWAFGAADPHSGTAIMMEIIRVLGDVVARGWRPLRTIEFASWDGSEYNLIGST
                     EYVEHNEEALRRDALAYINLGKAVSGRTFRAAGSPVFRKLLLQVLNRVGDPHYNATLR
                     ERWDERKGKIEGLGVDSDYVAFQDIVGTSSLDLHFDGDRFPHHSSYENFEWMDNVGDP
                     GFIYHTLLGQVLGLLILELADRPVMPFDMPAYADNLLRWVNGLKSWAEKQPGAADKQI
                     SFWALELAAKDVAKSVGEFVKWESSWETRVLSASGWEPSNLGRERCDYNARMAQFESD
                     LLDLAGMPHRTQFKHVVFGPQVWPGDPEAYFPSIRDAIKSGNATLAQLTVDRVAGILK
                     QAGDNLLK"
     gene            complement(2822463..2823610)
                     /locus_tag="MYCTH_2310757"
                     /db_xref="GeneID:11514433"
     mRNA            complement(2822463..2823610)
                     /locus_tag="MYCTH_2310757"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666170.1"
                     /db_xref="GeneID:11514433"
     CDS             complement(2822536..2823438)
                     /locus_tag="MYCTH_2310757"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666218.1"
                     /db_xref="GeneID:11514433"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="JGIDB:Spoth2_2310757"
                     /translation="MASSGETWSLTEHLLATEEHLYKSATQHPFLLAGAEGRLPKDIL
                     SRWLANDRLYIHSYIRAAGQLLASIDLPKQVPGSQEAFETRLADWLIEALVAVRKEER
                     FFLDVADRYGLGIEPAVPLPPASADAQDAAPHGREVPGLVQYESIFSSVGRLPGSSST
                     TTTTTTAAAAATAAAAATSQPAILPWLEGALTFWGTERCYLDAWSWARNKAEERRSSG
                     EQAGKEDADGGALRKEFIPNWSSPEFAHFVDKLARLIDEAVAKVLEEKEGDAREQTKQ
                     EILGRVEGKWQTLLEAEKQFWPDL"
     gene            <2823556..>2825728
                     /locus_tag="MYCTH_2130123"
                     /db_xref="GeneID:11514434"
     mRNA            join(<2823556..2823805,2824860..2825068,2825266..2825579,
                     2825653..>2825728)
                     /locus_tag="MYCTH_2130123"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666171.1"
                     /db_xref="GeneID:11514434"
     CDS             join(2823556..2823805,2824860..2825068,2825266..2825579,
                     2825653..2825728)
                     /locus_tag="MYCTH_2130123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666219.1"
                     /db_xref="GeneID:11514434"
                     /db_xref="JGIDB:Spoth2_2130123"
                     /translation="MNYYDEPIPNLSVLPTSSRGAAGLEMQHSGRATTVSGTPEPNVT
                     REPNGPVRRPPLHVVPVHLRPGRSGFLVGRALGTANAHKWPEERAMVRTVNSAYSVIE
                     VWRRLVAAADFNVLRVERAALRRNDQAQEASRLVLKWEQEGEKREGPAYSIIGSSYEK
                     VEATVADIIVILTALYQRADDIPATPLTRVSVHHAILQLGTGGFRLGYLEDTLCKQFT
                     ISIVRDPDDPTRVKPIVTYRIDRNKIKEAEKTVKYRKNTSVAHSTTLVPFPLLDSASL
                     VIARAI"
     gene            2826031..2826882
                     /locus_tag="MYCTH_2310758"
                     /db_xref="GeneID:11514435"
     mRNA            2826031..2826882
                     /locus_tag="MYCTH_2310758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666172.1"
                     /db_xref="GeneID:11514435"
     CDS             2826064..2826516
                     /locus_tag="MYCTH_2310758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666220.1"
                     /db_xref="GeneID:11514435"
                     /db_xref="JGIDB:Spoth2_2310758"
                     /translation="MGYSGPVFENDYQTAVVRANLAAIAFGPKAVRRDETLFNDLRNM
                     TLTRDEGAPIKVSEAQIAKFRERKDIAKLRDEIQHTTDKLEKSRLRGQISSILETCKR
                     LQLEQDRQAYFKEADRLRLQGLEPTPTPGMGGPGIAAPVAACLSRWRP"
     gene            2826883..2828123
                     /locus_tag="MYCTH_2310759"
                     /db_xref="GeneID:11514436"
     mRNA            2826883..2828123
                     /locus_tag="MYCTH_2310759"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666173.1"
                     /db_xref="GeneID:11514436"
     CDS             2827249..2827776
                     /locus_tag="MYCTH_2310759"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666221.1"
                     /db_xref="GeneID:11514436"
                     /db_xref="JGIDB:Spoth2_2310759"
                     /translation="MPAGEMKGTYDFEDLLRHGVEKHLLGQSAADVAGRKRKRDGDMD
                     GEYIVPAAKRTKGGGNGKCPAPAARRTESDGDRECPAPAKRTRAARHNVAYKKEPSPV
                     PIYDADNDLCVDVIICASTVDEQQPCHLTKNHVGSSAALDLDFLGHVDPALLPPWRPA
                     NAAHHTAAVFSDHQT"
     gene            <2828416..>2829500
                     /locus_tag="MYCTH_89999"
                     /db_xref="GeneID:11514437"
     mRNA            join(<2828416..2828764,2828815..>2829500)
                     /locus_tag="MYCTH_89999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666174.1"
                     /db_xref="GeneID:11514437"
     CDS             join(2828416..2828764,2828815..2829500)
                     /locus_tag="MYCTH_89999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666222.1"
                     /db_xref="GeneID:11514437"
                     /db_xref="JGIDB:Spoth2_89999"
                     /translation="MSLGAVRVPLDSLEFPDRRQISFKVRERLGRVFRNLSKAGATEV
                     RIPCTVEEGKFRQILARLGLSADQLRGTRGRGQRDLPLLTGVTLSCLYGDYLVAAAKG
                     NKETSLSVHLFSADLLDLLLELISAFSYEPQRSDGELYQKIVESYRRDEVIYALYMGS
                     LTGPKERNIKMLLRPKNLPIVEALNSLFDIPAMIEQLRLGNIYKWLALHIDEQIINYL
                     NHISIVWKEKICQGKKTIMQSLDINSIRIVQFRMPTVCSGDADTIKRLFDNGTLFPRV
                     TDSSDRDMLRRNVLSLDIVIPSFETFQENMHYVGLVAKILIRHVVDELPLYKSSRKRG
                     LTIFEVLSGS"
     gene            <2830026..>2830672
                     /locus_tag="MYCTH_2130127"
                     /db_xref="GeneID:11514438"
     mRNA            join(<2830026..2830553,2830619..>2830672)
                     /locus_tag="MYCTH_2130127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666175.1"
                     /db_xref="GeneID:11514438"
     CDS             join(2830026..2830553,2830619..2830672)
                     /locus_tag="MYCTH_2130127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666223.1"
                     /db_xref="GeneID:11514438"
                     /db_xref="JGIDB:Spoth2_2130127"
                     /translation="MGLDAENEQEDGARVAPRTTGDKIRPRSYHFRSATKAGHKMAAS
                     VTTKAPRQDATGIPRREAARSIIGQQAIKKAGGRSGAASVSNPFAKFLVHATPDREAA
                     QGAEATAIRPTGSSASEPSHEVASQHVQTLRSEPLGSPRDKSLSAATSFGREAARSVF
                     VVKPPIVKPPIVKPPMPDTAHYDDTRSRIQPRH"
     gene            complement(2831709..2832284)
                     /locus_tag="MYCTH_2310760"
                     /db_xref="GeneID:11514439"
     mRNA            complement(join(2831709..2831858,2831908..2832284))
                     /locus_tag="MYCTH_2310760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666176.1"
                     /db_xref="GeneID:11514439"
     CDS             complement(join(2831770..2831858,2831908..2832130))
                     /locus_tag="MYCTH_2310760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666224.1"
                     /db_xref="GeneID:11514439"
                     /db_xref="JGIDB:Spoth2_2310760"
                     /translation="MTHPIIVIANFLTTIKSIWELSRTVREKRAAKTLKTQTESTLVL
                     LQRVYRKGLLLEREFDCLFERLMRAEAYNDVAALWKIRAHVQAILTMESGRRAQRRVE
                     R"
     gene            2833828..2835234
                     /locus_tag="MYCTH_2310762"
                     /db_xref="GeneID:11514440"
     mRNA            join(2833828..2834121,2834206..2834505,2834671..2835234)
                     /locus_tag="MYCTH_2310762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666177.1"
                     /db_xref="GeneID:11514440"
     CDS             join(2833996..2834121,2834206..2834505,2834671..2835168)
                     /locus_tag="MYCTH_2310762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666225.1"
                     /db_xref="GeneID:11514440"
                     /db_xref="JGIDB:Spoth2_2310762"
                     /translation="MYIDLRDFHETFFSNVLNLETALQTFFKSCLEGSNPLFDNGWNC
                     YSASARKRRPLAQPNKPITGSVGKRKLDIGFVDDPKAGKDSRCHWSQILVPGELKSNP
                     AADRPSEARLDLGTYAREVFAAQGTRRFVLGFTLCGSLMRIKRDGRTERLILDELMRP
                     VRCIAGRATTCGKAYREEDLYSPLVVKDSWQYPERDEEGELLLEATSKGAVHVARYYH
                     YETVQVQNADDDVRNNVRKGLDVTEATNYRLHRSRLSLSRSAPGISRAGRSSSIAGAK
                     RSSTQTDALLPPTKRPCLTSPIKAGSDTPPN"
     gene            2835235..2835847
                     /locus_tag="MYCTH_2310763"
                     /db_xref="GeneID:11514441"
     mRNA            2835235..2835847
                     /locus_tag="MYCTH_2310763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666178.1"
                     /db_xref="GeneID:11514441"
     CDS             2835328..2835627
                     /locus_tag="MYCTH_2310763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666226.1"
                     /db_xref="GeneID:11514441"
                     /db_xref="JGIDB:Spoth2_2310763"
                     /translation="MVSKDNRGFLIDLDLAIKEQRISASGAKGKTGTRAFMAIGALLG
                     EQHSFMHDLESFFWVLFWICIHCNGPGKGRVVAEFDKWNYADTKELATLKKRAGI"
     gene            <2838730..>2842358
                     /locus_tag="MYCTH_2130131"
                     /db_xref="GeneID:11514442"
     mRNA            join(<2838730..2838988,2842075..>2842358)
                     /locus_tag="MYCTH_2130131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666179.1"
                     /db_xref="GeneID:11514442"
     CDS             join(2838730..2838988,2842075..2842358)
                     /locus_tag="MYCTH_2130131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666227.1"
                     /db_xref="GeneID:11514442"
                     /db_xref="JGIDB:Spoth2_2130131"
                     /translation="MDMDKPTETIAFDFDPMDIDKPTVAAPIDFDPMDIDEPTAAAAV
                     DFDPMEIDGPAELNTDRTRSGKNAFGCHSESINHQDTKGCPTSPDLDKVEVYSLEQIA
                     RDYPPLSSDESSSDGIDEDSGGSSGNGSGDGMDEDSGSGDGSGDCMDEDSSGGSGDSS
                     GDGPSPGLVSDSTSITTRLT"
     gene            complement(<2844733..>2846286)
                     /locus_tag="MYCTH_2130132"
                     /db_xref="GeneID:11514443"
     mRNA            complement(join(<2844733..2844980,2845998..>2846286))
                     /locus_tag="MYCTH_2130132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666180.1"
                     /db_xref="GeneID:11514443"
     CDS             complement(join(2844733..2844980,2845998..2846286))
                     /locus_tag="MYCTH_2130132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666228.1"
                     /db_xref="GeneID:11514443"
                     /db_xref="JGIDB:Spoth2_2130132"
                     /translation="MATDFKKVLIPLAAAHPNRLLPNLPILKLPSSSISKTPLQSPSL
                     PSLYNVGGAQRSDTKMPQNGLIEISSDNKSDESNKLSLGSWHKFKSESGASTGDARLP
                     GGRAEQGVGSPFVASQGQGSGASVAAAALHAILDRLNARLDHDKFVEGSSEAMSNNDR
                     MLADVGLSLQPSIQPSAS"
     gene            complement(<2848832..>2851098)
                     /locus_tag="MYCTH_2130133"
                     /db_xref="GeneID:11514444"
     mRNA            complement(join(<2848832..2849170,2849411..2849494,
                     2849549..2849627,2849693..2850712,2850917..>2851098))
                     /locus_tag="MYCTH_2130133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666181.1"
                     /db_xref="GeneID:11514444"
     CDS             complement(join(2848832..2849170,2849411..2849494,
                     2849549..2849627,2849693..2850712,2850917..2851098))
                     /locus_tag="MYCTH_2130133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666229.1"
                     /db_xref="GeneID:11514444"
                     /db_xref="JGIDB:Spoth2_2130133"
                     /translation="MWPIVYWQSAPTFDIFRHVHVSVAVATIIVVSIIVICVIARVGK
                     SDAHPRQASWNRSLWALSVSKPHHQSYTPPAGTPAPAPSPADPEPAELIKEPETRPIS
                     QEQLVSEVKGIYAGLVVIESKCIEVVKNQTSQNDASGKLINNQSSQTGPLTKLNNDQW
                     QALIALYRTLLHEHHDFLLASQHPSASPALRRLAAKYAMPARMWRHGIHDFLELLRHR
                     LPASLDHMRTFIDTAYSMMALLYEMVPAFEDTWMECLGDLARYHMAIEDDDVRNREVW
                     RAVSRHWYSRASDKAPTTGHLYHHLAILAQPNAQQQLYYYTKSLCVKTPFLSARESIM
                     SLFEPIMSPISNPQQTWLPRVELHYVRTHGILFTGKQEERLQESMDQFLKSIGDHIAL
                     SLYRWLEPGYHIGISNICALLGYGDESNPIAQALKTPAAPSRSVSASEQFRNTRKLFN
                     ATYDAEEEEKKKNEGAEAGESRPGPPKRRPLPEDFALRGFPFVEKYFPDEWFEENIDY
                     DDKYVKVALTDVESKTEERKERVLWLGCRIAEMEGKWLRFDKEKWQFGVNSEYEVDLD
                     L"
     gene            complement(<2858123..>2860919)
                     /locus_tag="MYCTH_2130134"
                     /db_xref="GeneID:11514445"
     mRNA            complement(join(<2858123..2858312,2858368..2859695,
                     2859795..2860451,2860524..2860837,2860895..>2860919))
                     /locus_tag="MYCTH_2130134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666182.1"
                     /db_xref="GeneID:11514445"
     CDS             complement(join(2858123..2858312,2858368..2859695,
                     2859795..2860451,2860524..2860837,2860895..2860919))
                     /locus_tag="MYCTH_2130134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666230.1"
                     /db_xref="GeneID:11514445"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Spoth2_2130134"
                     /translation="MNALLNTGILLFLAFNISTGAYAIITSRTEEELVIQAVKGSDGN
                     PLPVTKRRQKKNARERDDDCGNRGFLWSCLTGVVALTFVADGAAVTLHAMMSSRSSGL
                     DDAWRCGEERIVYIVGCGFFYLYIFITVLERERNPGIVHLIVWVLGLAGESVISVASI
                     LVMTSKQHTTLAYPPEKGIEIWDLVDLSIPGIRVFLLVCIICHYAAVVMRRVEAHRLE
                     AYRLEANETSPLLNGSQDHYGSASSPDDQRRTQQDNETAFYRPEKLPHKSWLEYCRGY
                     SVFFPYLWPSKSARLQIVVLVCFVLAILERIVNILVPTQLGVVTDVFKTKKGDAVWHT
                     YRALITAAFEHVHSLSLDFHLGKRTGEVLSALNKGASINQFLEQVTFQVVPMLADLLV
                     AIIYLHSRFGALYALFVSIITFYYLHLTMRIAATRADQRRDMVNADREEEAVKNDSIM
                     SYETVKYYNAERREFGRYGDAVKKFQGAESKVTYGINYMNMCQSAVFMCGLLVALLTC
                     GYQVSRGDRSVGDFVLLVTYLTQLQGPLNLFSTFYRTVQSAMISGERLLELFKIQPSV
                     VDKPGVKSLLKCSGHIKWNRVSFAYNNRGLVLNNVSFECKPGTTTAFVGESGGGKSTI
                     LRLMFRYYDYQGSIEIDGNDVKGLTIDSVRRFIGVVPQDPTLFNETLMYNLKYARPNA
                     TDKEVYDACRAAAIHDRIMGFPDGYNTMVGERGVRLSGGEKQRVALARTILKGPKIIM
                     LDEATSALDGETEQRIQDELISGKLGQGRTRLIIAHRLSTITHADQIIVLHDGFVVER
                     GTHPELLALKGRYASMWQKHCRAERAAEQVSGGQEMQWR"
     gene            <2862406..>2862672
                     /locus_tag="MYCTH_2070048"
                     /db_xref="GeneID:11514446"
     mRNA            join(<2862406..2862547,2862602..>2862672)
                     /locus_tag="MYCTH_2070048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666183.1"
                     /db_xref="GeneID:11514446"
     CDS             join(2862406..2862547,2862602..2862672)
                     /locus_tag="MYCTH_2070048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666231.1"
                     /db_xref="GeneID:11514446"
                     /db_xref="JGIDB:Spoth2_2070048"
                     /translation="MCNYTQREYSCGHFRWIASEWCRDYTITHKRCQPNVTHFKYRAE
                     ERCGDCKPKEYPPWENLIKRPNQPVS"
     gene            complement(<2866379..>2867108)
                     /locus_tag="MYCTH_89991"
                     /db_xref="GeneID:11514447"
     mRNA            complement(join(<2866379..2866904,2866954..>2867108))
                     /locus_tag="MYCTH_89991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666184.1"
                     /db_xref="GeneID:11514447"
     CDS             complement(join(2866379..2866904,2866954..2867108))
                     /locus_tag="MYCTH_89991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666232.1"
                     /db_xref="GeneID:11514447"
                     /db_xref="JGIDB:Spoth2_89991"
                     /translation="MSVDRPPPHITRIFEAFRSLFRRCCRVEQHALDDALFRNCRHVD
                     QDALDDFLNEESRRQYFMHSSEKEILLFLCGAAKCCKQPRKRLDYVNLLLTHQLDKWL
                     IQSMRVEMDPASAMLRLSALISLEQLACTVDEDAQKPAMGWLHRFVELMEHGTDLYGP
                     QATHCNYYKTYRHMGCALFRAINSEEFGFIHPLFREDPLCCARGVGCGSFLDEEYWVR
                     RVVEKENY"
     gene            2869456..2870496
                     /locus_tag="MYCTH_2310765"
                     /db_xref="GeneID:11514448"
     mRNA            2869456..2870496
                     /locus_tag="MYCTH_2310765"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666185.1"
                     /db_xref="GeneID:11514448"
     CDS             2869498..2870472
                     /locus_tag="MYCTH_2310765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666233.1"
                     /db_xref="GeneID:11514448"
                     /db_xref="JGIDB:Spoth2_2310765"
                     /translation="MDGPVAEDDPVAEDGPNLADAILDQSTGMTLRPRVLPSYRGAAS
                     SNTVSRRRARVALVKPTEIPRDCCPGVPPWLRLTLSNSHLFDGNAANQLLPFLPQLCR
                     KHLQFYAKQARDTAFARNANMVGLPDTSNKAASYTDTGPPSRRRRASLSDVFPPKRLR
                     FDTSGVFLRTPRVAGDRPVHDRIANNAYQIRALAELEQSRPLPGSHGDETNQLLRKLL
                     NKAQHPNSSEALFCTSIEAARIVETQCSGDALIITEDQQPFVWGKDAGRPIEQFFRRF
                     RISSLSVSVQVPSRPSIEESFEVHELREVKERFLRRESISDPWNVLDL"
     gene            2870498..2871291
                     /locus_tag="MYCTH_2310767"
                     /db_xref="GeneID:11514449"
     mRNA            join(2870498..2871112,2871166..2871291)
                     /locus_tag="MYCTH_2310767"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666186.1"
                     /db_xref="GeneID:11514449"
     CDS             2870590..2870799
                     /locus_tag="MYCTH_2310767"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666234.1"
                     /db_xref="GeneID:11514449"
                     /db_xref="JGIDB:Spoth2_2310767"
                     /translation="MEWREWKAVDKWALVSEGGNHTAPHMDSHGYATWITVQEGSIGF
                     GWMACPTKEEREAWMAEPDRYTEGP"
     gene            <2873561..>2874375
                     /locus_tag="MYCTH_2120908"
                     /db_xref="GeneID:11514450"
     mRNA            join(<2873561..2873845,2873932..2874058,2874104..>2874375)
                     /locus_tag="MYCTH_2120908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666187.1"
                     /db_xref="GeneID:11514450"
     CDS             join(2873561..2873845,2873932..2874058,2874104..2874375)
                     /locus_tag="MYCTH_2120908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666235.1"
                     /db_xref="GeneID:11514450"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_2120908"
                     /translation="MQWQVSYDGKLLLCPKEQFRRVLDIGTGTGFWAMDFANEHPEAD
                     VIGLDISRGILPIYMPPNYEFQIDDVKEQWTWSQKFDFIHGRMLGGYFRDFPGGWLEV
                     KDINLMPRCDDGTLPRDSNLFAWAHELAEAAGRMGPGFTNVEVVKHKWPMNQWAKDVK
                     QNELGRLSQSFFADELETISGALLVHGLNLSHEEVAVRCTLVRREFNDPQIHAYFPVF
                     TAFGMKPQR"
     gene            <2876990..>2878937
                     /locus_tag="MYCTH_2130137"
                     /db_xref="GeneID:11514451"
     mRNA            join(<2876990..2876999,2877865..>2878937)
                     /locus_tag="MYCTH_2130137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666188.1"
                     /db_xref="GeneID:11514451"
     CDS             join(2876990..2876999,2877865..2878937)
                     /locus_tag="MYCTH_2130137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666236.1"
                     /db_xref="GeneID:11514451"
                     /db_xref="JGIDB:Spoth2_2130137"
                     /translation="MTGNTPESRRYADAAFLALVRELSFLNTLDTADALQILSQSPYG
                     SLGAVRHLTIYDGAWPRAASQGEWKRHPLILSRKWDPGAAQLAYRRYEQFLRQEASRT
                     FGTDVQLFRTVLTHFPSLRELTLSHVHAWEMSYLNYAHFRNLMDSIWVIPSLETFVAK
                     AMSRLLPVLGTCSRLQRLNVEGLLDARDLEPGRYDNIRHLCLNSVLAGEGLEGSIAKF
                     LNSFPGLTALTIRTFLHGPIYYQRLPLNQICWFDLQFYEILGAWVPENELFDFTERHP
                     LKRLTLKKVKFTRQILESFFSRVRELKPRPNIVCQGVQPSRNSQGGLMGSVESQSLLD
                     SFLAHAEFPWPFSDPNEDIPMFSLLP"
     gene            2881717..2882157
                     /locus_tag="MYCTH_2310768"
                     /db_xref="GeneID:11514452"
     mRNA            join(2881717..2881876,2881935..2882157)
                     /locus_tag="MYCTH_2310768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666189.1"
                     /db_xref="GeneID:11514452"
     CDS             join(2881808..2881876,2881935..2882147)
                     /locus_tag="MYCTH_2310768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666237.1"
                     /db_xref="GeneID:11514452"
                     /db_xref="JGIDB:Spoth2_2310768"
                     /translation="MDVRSKTDTEILDIVKEEIGKDLTDEERSKLQFRMDTDSTKSYI
                     AAVIEFGVSGAVIMNGKIEIGHGSPKELYFTSRVIKMSRNPQMHYIHKE"
     gene            complement(<2885285..>2885982)
                     /locus_tag="MYCTH_2130140"
                     /db_xref="GeneID:11514453"
     mRNA            complement(join(<2885285..2885484,2885658..>2885982))
                     /locus_tag="MYCTH_2130140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666190.1"
                     /db_xref="GeneID:11514453"
     CDS             complement(join(2885285..2885484,2885658..2885982))
                     /locus_tag="MYCTH_2130140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666238.1"
                     /db_xref="GeneID:11514453"
                     /db_xref="JGIDB:Spoth2_2130140"
                     /translation="MVVGTCRRSPSLLQLTRTAALYLGRDHTLLVPSALFGQRSRLPP
                     AELYLVQTHGILFSRKQEEGLGVIDNPVSSSRQSGAPRTSSNPQKVPVPVLGTPAKQD
                     PGQILLDPILRAFAKPNLGWWQPPALLVSREPSPALAVLRPDNYQMPLSTEEAWSTPP
                     TISLQHSRRQTWQG"
     gene            2889403..2890365
                     /locus_tag="MYCTH_2310772"
                     /db_xref="GeneID:11514454"
     mRNA            join(2889403..2889680,2889735..2890365)
                     /locus_tag="MYCTH_2310772"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666191.1"
                     /db_xref="GeneID:11514454"
     CDS             join(2889501..2889680,2889735..2890100)
                     /locus_tag="MYCTH_2310772"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666239.1"
                     /db_xref="GeneID:11514454"
                     /db_xref="JGIDB:Spoth2_2310772"
                     /translation="MYLIRATQDFRGLTQRVCLRNEELTEERKGLWAMSLGDIQQRED
                     IKRVAIAFYKDKDRDKQGSIEQEAKSYGKTIRLWRAVGLLCLEGVLLTDGRVCVVIVV
                     SPPQPSGDTGAVAGGSPSAGLRTTYKVVVSKVDREEKVTLELEYGDMLRLDEDKKMEA
                     TSGGIAFIVMMYDVVSESQDH"
     gene            complement(<2890334..>2891922)
                     /locus_tag="MYCTH_89984"
                     /db_xref="GeneID:11514455"
     mRNA            complement(join(<2890334..2890523,2890578..2890940,
                     2890996..2891158,2891205..2891782,2891816..>2891922))
                     /locus_tag="MYCTH_89984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666192.1"
                     /db_xref="GeneID:11514455"
     CDS             complement(join(2890334..2890523,2890578..2890940,
                     2890996..2891158,2891205..2891782,2891816..2891922))
                     /locus_tag="MYCTH_89984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666240.1"
                     /db_xref="GeneID:11514455"
                     /db_xref="JGIDB:Spoth2_89984"
                     /translation="MPGLKIEIWDPTSEYKPSQAKPSQAKPSQAKPSQLALPVSEEEW
                     CQRRQDTKLSTADDVLHTVDCLVEGSLDPLNNDKHSSVEKSTSLDAAGDQNPGDALGD
                     ALSSSAEQAAALVAAGDQNPGDALGDALSSSAEQAAALVAKAECSRCIAQFFSLVFMA
                     ECQVALVTGCPKTSVYYVIRKFVEATGGTFDGERVPAMLLWTTLWILQEQQRHVRRGL
                     MHRGIEIFFSGGKSLWFYHACPRTPKENARFTNKFPTCKVPDEIHASLPLWVPFIVGI
                     RNISRWSYTTICDALKVNLWSREDYFQKWRERYRSRTLVSCHLEVDCSESQLLGPKRR
                     RHHARKRKRSAEPESRTLRPDSIEETQFRATSACQHREPAVSRHDKCLTIRASSALER
                     EAETAPQTSQGHPTATVHSESGSGSGQAVSASLPESDVGVDSWHILLAVAAAQAGGNA
                     FTGEETAGAIAEHESD"
     gene            <2892808..>2894352
                     /locus_tag="MYCTH_2135707"
                     /db_xref="GeneID:11514456"
     mRNA            join(<2892808..2893101,2893155..2893290,2894231..>2894352)
                     /locus_tag="MYCTH_2135707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666193.1"
                     /db_xref="GeneID:11514456"
     CDS             join(2892808..2893101,2893155..2893290,2894231..>2894352)
                     /locus_tag="MYCTH_2135707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666241.1"
                     /db_xref="GeneID:11514456"
                     /db_xref="JGIDB:Spoth2_2135707"
                     /translation="MQDFLNLISFSSGVCFFVFRIAVILLSRRHSNHRRTKTGISVRP
                     PVYTARPKTFDFVWIFHHIAVFVPDAVLFFIGRSLGYPFGNIAAALRVYGSLSATHWV
                     RLWPQSRVWALWLYIAAAVIFLAGLIGAVFLPTDSHRTAATSRPHDPASPLPSRNPKT
                     ITGNVFGVTLTRSDTRIFAVTAGS"
     gene            2894532..2895726
                     /locus_tag="MYCTH_2310773"
                     /db_xref="GeneID:11514457"
     mRNA            join(2894532..2894612,2894671..2895107,2895175..2895726)
                     /locus_tag="MYCTH_2310773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666194.1"
                     /db_xref="GeneID:11514457"
     CDS             join(2894873..2895107,2895175..2895311)
                     /locus_tag="MYCTH_2310773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666242.1"
                     /db_xref="GeneID:11514457"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2310773"
                     /translation="MVPLSIAEALPVDPALATVGGCASPVLRPVPVRGVMPQPAMNSP
                     AAVSAVRVLRKNVSCPACGKTGLRATSLKRHLRTHSGDRPYKCDLCHNTFTRSDTRNW
                     HFQRCSVRHGNPTGASHAPHP"
     gene            <2895786..>2896508
                     /locus_tag="MYCTH_2120909"
                     /db_xref="GeneID:11514458"
     mRNA            join(<2895786..2895830,2895873..2896131,2896184..2896347,
                     2896473..>2896508)
                     /locus_tag="MYCTH_2120909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666195.1"
                     /db_xref="GeneID:11514458"
     CDS             join(2895786..2895830,2895873..2896131,2896184..2896347,
                     2896473..2896508)
                     /locus_tag="MYCTH_2120909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666243.1"
                     /db_xref="GeneID:11514458"
                     /db_xref="JGIDB:Spoth2_2120909"
                     /translation="MCHGHPRHHSCSHQSTGYQTPYPNVSFAVSQPLIASCPLANCDF
                     RSAGGGEWTCCKCGGRNTSGWCSNMSRKPEWEKNPVTNEWEWIERCDHGCCRSCGKAG
                     PANTSELDESGHPTGRLPSHRPGAPNSRSGFTPPAAEAVIQTSLPGSGREAENEAHRD
                     SSTPSRK"
     gene            complement(<2897359..>2899651)
                     /locus_tag="MYCTH_89981"
                     /db_xref="GeneID:11514459"
     mRNA            complement(join(<2897359..2898313,2898369..2898523,
                     2898612..2898712,2898967..2899318,2899493..>2899651))
                     /locus_tag="MYCTH_89981"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666196.1"
                     /db_xref="GeneID:11514459"
     CDS             complement(join(2897359..2898313,2898369..2898523,
                     2898612..2898712,2898967..2899318,2899493..2899651))
                     /locus_tag="MYCTH_89981"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666244.1"
                     /db_xref="GeneID:11514459"
                     /db_xref="JGIDB:Spoth2_89981"
                     /translation="MDLTEKWKRHLRQSSRVPKDTNTSPTPSSRREGSRSRSVSPPKR
                     SKARLAANPSSSTSARGAAPPSAADDDTIELIKQPETRPILQEQLVAEVKGIYAGLVI
                     VESKCIEVDNNQSSQNDPANRLNNDQWQALIALHRTLLHEHHDFFLASQHPSASPALR
                     RLAAKYAMPARFRQGPNHGASLSPLGHPRSPERIVAALLLFEVAARLPPTELNFVKTH
                     GILFSGKQQDKLDASMEAVFQSLDNHIGRSARRWIESGYHMAISNICAITGYSDNNNP
                     ITAALKAFSSLRPSDAANDTRAQPMEEAPAAQSVSSENDTKDTTVSTSTQLSNALRLF
                     TGTYDIICRRFGDNNILPFLHVTLVFVYYLTFCPDAMAHVAPHFPWKLTASMLNTLLN
                     GSSPSSSSPSTAAAAPVSNVSQAAGLAQLVESKQFPGSKKGVSATAEGGEKGDSTALA
                     GPSVGAGRRKRPLPDDYAIRGFPWVEKYFPDGWFVTEDRIDDDDKYFEVPSMLEERKE
                     RVVWLGCRIAESEDGKWLRFDNEAKRFGVSPEYDVELELEMGGQVTAAPGESVDYGEL
                     PDAGVTA"
     gene            <2902486..>2903521
                     /locus_tag="MYCTH_2112984"
                     /db_xref="GeneID:11514460"
     mRNA            join(<2902486..2902851,2903011..2903056,2903088..2903275,
                     2903483..>2903521)
                     /locus_tag="MYCTH_2112984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666197.1"
                     /db_xref="GeneID:11514460"
     CDS             join(2902486..2902851,2903011..2903056,2903088..2903275,
                     2903483..2903521)
                     /locus_tag="MYCTH_2112984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666245.1"
                     /db_xref="GeneID:11514460"
                     /db_xref="JGIDB:Spoth2_2112984"
                     /translation="MQRPLDLAWRLRIGALASTLFLSVFSVAAVILLRRRSNHEGARM
                     GISAFSVVYTACPKAFDFLWVLYVSVVVVISITLFTAGLIYTNNSALAEGADVFWIQR
                     RGDLLGNVTSAFLVYRNLSEARDRKWQLRSEWLGIDVKLYPRSRDDFDFRCKGSGSTA
                     CLVPESSSDSSLPRECGGGRVNGCGDYGPGRTMRRSGAENTADVRGRALRRD"
     gene            2905482..2906399
                     /locus_tag="MYCTH_2310778"
                     /db_xref="GeneID:11514461"
     mRNA            join(2905482..2906113,2906176..2906399)
                     /locus_tag="MYCTH_2310778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666198.1"
                     /db_xref="GeneID:11514461"
     CDS             join(2905617..2906113,2906176..2906254)
                     /locus_tag="MYCTH_2310778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666246.1"
                     /db_xref="GeneID:11514461"
                     /db_xref="JGIDB:Spoth2_2310778"
                     /translation="MINIASLLERGNPNGSSMCPAQQPPSASFPAAAAVTVAPNGPPP
                     APFAVAAGPSPLGVIGGAGASRQSVSVAPGSAEPQAAGSDLQPRSTTGKRSVPPRTAE
                     PPAKKQSKWSGEEDARLIQLRGRNIKQKGVSTHLLGRSSVSCRPERHNEWSEEHKNTL
                     ARLYEKLKHEMWTKLAQELGVPWRAAEAMHW"
     gene            complement(<2909455..>2910814)
                     /locus_tag="MYCTH_2120910"
                     /db_xref="GeneID:11514462"
     mRNA            complement(join(<2909455..2909616,2909759..2909896,
                     2909939..2910457,2910623..>2910814))
                     /locus_tag="MYCTH_2120910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666199.1"
                     /db_xref="GeneID:11514462"
     CDS             complement(join(2909455..2909616,2909759..2909896,
                     2909939..2910457,2910623..2910814))
                     /locus_tag="MYCTH_2120910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666247.1"
                     /db_xref="GeneID:11514462"
                     /db_xref="JGIDB:Spoth2_2120910"
                     /translation="MEDEIARLRQALEYERRLREEAESRASEEQRRRKKAEEVAEKSR
                     PLRLEPYLEACHTLNLAIEVHQLDYVLSLITPINSEHGLRYYERDTVKNVVQKLVDAV
                     YENPVLRASIGLRRTITFESHTNLGTMDSSPSEHPERTPLSAGSAGEPALATSAAVRK
                     RRRIARGKGNRADQFCIYKTSDGAKVPAIAIEYKAPYKLSREELVIGLVSEIQPERDV
                     INKDGDGFAFAAKRLATAIYGYVCTGEAFVFLHIPDDLAMVYYHLYIPNQDVLNDDKN
                     RLHRTAVTNVMLPHTNPSVGAASNARLFELVRIAPRPTLKAILEMMMTKKVPLLLRVQ
                     IG"
     gene            <2914228..>2914434
                     /locus_tag="MYCTH_2069148"
                     /db_xref="GeneID:11514463"
     mRNA            <2914228..>2914434
                     /locus_tag="MYCTH_2069148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666200.1"
                     /db_xref="GeneID:11514463"
     CDS             <2914228..2914434
                     /locus_tag="MYCTH_2069148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666248.1"
                     /db_xref="GeneID:11514463"
                     /db_xref="JGIDB:Spoth2_2069148"
                     /translation="GAIIPKFYGLLRYNGTRAILLEYLGGISLSAPEGVTITLEELSS
                     LLQLYYQAFYAFDVHQDNANLSNF"
     gene            complement(<2917897..>2920044)
                     /locus_tag="MYCTH_89976"
                     /db_xref="GeneID:11514464"
     mRNA            complement(join(<2917897..2918050,2918209..2918875,
                     2918918..2919287,2919595..2919944,2919993..>2920044))
                     /locus_tag="MYCTH_89976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666201.1"
                     /db_xref="GeneID:11514464"
     CDS             complement(join(2917897..2918050,2918209..2918875,
                     2918918..2919287,2919595..2919944,2919993..2920044))
                     /locus_tag="MYCTH_89976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666249.1"
                     /db_xref="GeneID:11514464"
                     /db_xref="JGIDB:Spoth2_89976"
                     /translation="MYDNNMSFLEHQGCFPKGSDCYDLESASESENKSGIRRVPRQLC
                     TLRFYESDDDRPGPHSGADSACSSPPEAPDDRDQTKLGPLDGGENRFSKAHGINPALF
                     DVYISAQKGASSPPPGITLPALLKLVDADRIGHATARRQYQGSDATADVEAATADVET
                     ATADVETATADVEAATADVEAATADVEAATADVEPATADIAAALLRITKAHTLFETRL
                     EILGTKIVLLEERIPGSYQVAPNLADENRTLASLLTSDPNEFDASRDMASSDLSTPPL
                     LVDCDIADVEAQTASSRMEEPETASAADADQGTTPIDLPSRRPPSPGPRTPLLSVPMP
                     SQERAPQAPQTQDEPDQSATTQDQDETPPVQDEPFPTPGQTAVHAQDEHIETPTAQEF
                     RSFASLYTRLSREHEPRGFVLIKVPSDVLGSCSRPTEPRITTSWRQALRWRSGLVASV
                     EYEEVRHNPPLKWHIAGPGQDETVGLEQSGFSVCTEHRVSWSRTLAYWLHQPGVSLSL
                     KREVKNQSHKAFPNIGNPLIFF"
     gene            complement(2921141..2921920)
                     /locus_tag="MYCTH_2310780"
                     /db_xref="GeneID:11514465"
     mRNA            complement(2921141..2921920)
                     /locus_tag="MYCTH_2310780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666202.1"
                     /db_xref="GeneID:11514465"
     CDS             complement(2921308..2921823)
                     /locus_tag="MYCTH_2310780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666250.1"
                     /db_xref="GeneID:11514465"
                     /db_xref="JGIDB:Spoth2_2310780"
                     /translation="MVNQDMVSEEEKEMARYVIEVHNLANKGIKGRGKGCKVKRVTLL
                     HPPQQHSLPASSPISITTASNTSTIHSAAPYPMSPLPHGLPNMHTPPQHLPMAMEHDH
                     QAIYGLNNLATYSIAGPPPHTVFGGPVAISTHGVLYAPYSILDSEQLRYASSVDGSTL
                     VMDLPFGDRMH"
     gene            complement(<2922061..>2922374)
                     /locus_tag="MYCTH_27592"
                     /db_xref="GeneID:11514466"
     mRNA            complement(join(<2922061..2922123,2922182..2922229,
                     2922279..>2922374))
                     /locus_tag="MYCTH_27592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666203.1"
                     /db_xref="GeneID:11514466"
     CDS             complement(join(<2922061..2922123,2922182..2922229,
                     2922279..>2922374))
                     /locus_tag="MYCTH_27592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666251.1"
                     /db_xref="GeneID:11514466"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_27592"
                     /translation="QKVFYCDVCSKPFAQKNNLATHQRSHTGESPYACPYCPRRFTQS
                     ANLRSHINRHTGEIPYKCPQCPKRF"
     gene            complement(<2924704..>2925675)
                     /locus_tag="MYCTH_2112989"
                     /db_xref="GeneID:11514467"
     mRNA            complement(join(<2924704..2924923,2925278..2925414,
                     2925464..2925532,2925583..2925630,2925673..>2925675))
                     /locus_tag="MYCTH_2112989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666204.1"
                     /db_xref="GeneID:11514467"
     CDS             complement(join(2924704..2924923,2925278..2925414,
                     2925464..2925532,2925583..2925630,2925673..2925675))
                     /locus_tag="MYCTH_2112989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666252.1"
                     /db_xref="GeneID:11514467"
                     /db_xref="JGIDB:Spoth2_2112989"
                     /translation="MTDAPEPLWGDSTNVATDNESTVTNQVSGDSDTDSVLGDLDGQS
                     IYTLPSDIPVVEEEGRKYYNPDKYPLPNDEQEQERLDMLHEQHLEPGGYFEVKDILLT
                     PKCDDRSLKGDSHLLTWARLLAEAADKMGRPINLASWYREMLVEAGFTNVEVVKQK"
     gene            <2928807..>2928965
                     /locus_tag="MYCTH_37027"
                     /db_xref="GeneID:11514468"
     mRNA            <2928807..>2928965
                     /locus_tag="MYCTH_37027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666205.1"
                     /db_xref="GeneID:11514468"
     CDS             <2928807..>2928965
                     /locus_tag="MYCTH_37027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666253.1"
                     /db_xref="GeneID:11514468"
                     /db_xref="JGIDB:Spoth2_37027"
                     /translation="QREYPCGHFRWTALNWCESYKGGQKRCEPNVIDFEERPGVCGEC
                     KEKKWEDWE"
     gene            complement(2929977..>2930874)
                     /locus_tag="MYCTH_2316343"
                     /db_xref="GeneID:11514469"
     mRNA            complement(join(2929977..2930214,2930282..2930652,
                     2930797..>2930874))
                     /locus_tag="MYCTH_2316343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666206.1"
                     /db_xref="GeneID:11514469"
     CDS             complement(join(2930169..2930214,2930282..>2930652))
                     /locus_tag="MYCTH_2316343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666254.1"
                     /db_xref="GeneID:11514469"
                     /db_xref="JGIDB:Spoth2_2316343"
                     /translation="PGQTLTSQLGSTESRGRHPGAVGPSAGQCSNVPPDQPVSAPRPS
                     QLSGTSVQPLDNADTTHPIEGFSELIRYTVLSTYSSERLVEKIQHINGNIRFEHRSDW
                     YRTSWIGGLFRIAMTKKTAEENAAISETFFRDCESS"
     gene            2931097..2931671
                     /locus_tag="MYCTH_2310782"
                     /db_xref="GeneID:11514470"
     mRNA            2931097..2931671
                     /locus_tag="MYCTH_2310782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666207.1"
                     /db_xref="GeneID:11514470"
     CDS             2931197..2931352
                     /locus_tag="MYCTH_2310782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666255.1"
                     /db_xref="GeneID:11514470"
                     /db_xref="JGIDB:Spoth2_2310782"
                     /translation="MSAPIGKQAGVGSAELCKRCRGHPSRDRVMTAGRRPAGEQAGIG
                     SEPCKAR"
     gene            <2934276..>2935928
                     /locus_tag="MYCTH_2112991"
                     /db_xref="GeneID:11514471"
     mRNA            join(<2934276..2934511,2934557..2934599,2934630..2935097,
                     2935161..>2935928)
                     /locus_tag="MYCTH_2112991"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666208.1"
                     /db_xref="GeneID:11514471"
     CDS             join(2934276..2934511,2934557..2934599,2934630..2935097,
                     2935161..2935928)
                     /locus_tag="MYCTH_2112991"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666256.1"
                     /db_xref="GeneID:11514471"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="JGIDB:Spoth2_2112991"
                     /translation="MDLGNLTQGALPASAANTRHEANNSTTSWLPHLPDDVLETLTLL
                     LGPQFNLLLKLLMVLYNIVGGHFGFDPTYPLSAFGFHSLARQYFMASIELIKWFASQP
                     SLVNSRSLTAETVSNSVWDDKDGTGLITKRVSSDGSNAYLNFLTQKTKAAPRFTPALG
                     THGFWFRGRYFRLHRKQESLYDANRPFGIPQYKDKEIIFLSCFGRSPEPLKELLKHCK
                     EQFYITHQAKTTIRRPAPEAIRKGRRNNWQQVLSDINEYLHPATLRWYANRSIPLRRG
                     YLFYGPPGTGKTLFSFALAGVFGLDIYVISLLDPSLTEEDLLALFTSLPRRCVVLLED
                     IDTAGLKRTDDPNADEKSSENWKVSDLARELKRHQRGDASENKGISLSGLLNAIDGVA
                     SHEGRVLIMTTNKPETLDEALIRPSRIDIQIGFTNATQEQARELFVRMYKPDSTDDPN
                     PFPPVPTPTAPNLNTLAEKFARQIPPGVFSPAELQGFMIKRKGKPKKAADDVGR"
     gene            2938480..2939336
                     /locus_tag="MYCTH_2310784"
                     /db_xref="GeneID:11514472"
     mRNA            2938480..2939336
                     /locus_tag="MYCTH_2310784"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666209.1"
                     /db_xref="GeneID:11514472"
     CDS             2938711..2939262
                     /locus_tag="MYCTH_2310784"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666257.1"
                     /db_xref="GeneID:11514472"
                     /db_xref="JGIDB:Spoth2_2310784"
                     /translation="MIRHDPKWATFNNAYINEKITFHLQNAFLEEPTEDSLLKMLSHI
                     GHMRDPRARKDMVPNEVWEMMPPNPEIEALKAERNHLKGGRYRIRGIENEERIRKLGT
                     LIATKEAQRRKRIRQGYRADYFYNRPTWDIERQASEDEDEEEEEYLEPIVDLQIPERA
                     QLAEILCSQPDDLSGIELRELRI"
     gene            <2940696..>2941701
                     /locus_tag="MYCTH_97963"
                     /db_xref="GeneID:11514473"
     mRNA            join(<2940696..2940770,2940813..2940887,2940967..2941173,
                     2941225..2941484,2941524..>2941701)
                     /locus_tag="MYCTH_97963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666210.1"
                     /db_xref="GeneID:11514473"
     CDS             join(2940696..2940770,2940813..2940887,2940967..2941173,
                     2941225..2941484,2941524..2941701)
                     /locus_tag="MYCTH_97963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666258.1"
                     /db_xref="GeneID:11514473"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_97963"
                     /translation="MPDEAATLVISLDANDAAYSADKSNLSEGAFRVVYTGTKILGEI
                     PVVIKFLKDEYRTYQVITDRGKTQVDSILRVYSFGPIFFHNVLVIDHLRPSLESIFAE
                     REGRFTVKTVVILAKRILGVVERVYAKGIVYRDLKPDNFVLGRPGTLTANIVHLIDFG
                     IANRYKDLKTELHIPYREGTPLLGTAKYISIYIYLRREQSRRDDLELLWQGIKAPKKE
                     KNDRIKQKKQEITIEDICTGFPVEFSECLWYVRHLDFDDEPDYVYL"
     gene            <2942533..>2943985
                     /locus_tag="MYCTH_97962"
                     /db_xref="GeneID:11514474"
     mRNA            join(<2942533..2942606,2942706..2943092,2943144..2943426,
                     2943656..>2943985)
                     /locus_tag="MYCTH_97962"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003666211.1"
                     /db_xref="GeneID:11514474"
     CDS             join(2942533..2942606,2942706..2943092,2943144..2943426,
                     2943656..2943985)
                     /locus_tag="MYCTH_97962"
                     /note="CAZy_ID 268082"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003666259.1"
                     /db_xref="GeneID:11514474"
                     /db_xref="JGIDB:Spoth2_97962"
                     /translation="MASMILRLDFLRSTEFWAFFHTLLWLHRYLRLLAHCVSHWRYKS
                     IIPNLEKPRYTSEDVTVVIPTIHNHPENLRPSLESILACNPAKLVLVTTWNKHQALSR
                     VATSLQMPNHTSPVAIEVLYVDKANKRLQVCEALKGGHVKTAITVIADDDVEMGGVGT
                     CQRVKRVVCGGAATRIFNWLGAAYIERRNFEISATHNIDGGTSCMSGRTGAYRTEILK
                     SYDFLRSFKNEKWGRCRLNADDDNFITRWLCTYALHIATFTSLAFVVDLLLLFTCWWC
                     TEDWQPRNRRILLGAEVAFMFGFTKVVKLAGLLRRNPRDIIFLPVSILFGYFHGLIKL
                     YALCTLKEVNHHRAPRARPTHKP"
     gene            <2945038..>2946464
                     /locus_tag="MYCTH_2130157"
                     /db_xref="GeneID:11514475"
     mRNA            join(<2945038..2945049,2945229..2945361,2945418..2945541,
                     2945927..2946067,2946242..>2946464)
                     /locus_tag="MYCTH_2130157"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666212.1"
                     /db_xref="GeneID:11514475"
     CDS             join(2945038..2945049,2945229..2945361,2945418..2945541,
                     2945927..2946067,2946242..2946464)
                     /locus_tag="MYCTH_2130157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666260.1"
                     /db_xref="GeneID:11514475"
                     /db_xref="InterPro:IPR011700"
                     /db_xref="JGIDB:Spoth2_2130157"
                     /translation="MWRQPPTLWAVDERVRSKLRGRKGPSAVVITMCGKPAPARPCQS
                     PSGERRICASPSLSALLAVSSDSDGHHILLPTPANSHLKKRPQPLHGPSPLETLPQSY
                     NSGSASGPVEPSPTSGLAWSVSHRSLSHGLPPLQHRGKEIVVPVDVRRGSKAADDKRR
                     GNAAALARFRKRKKERERSQQEELQKLENANRELESRNKELAKRCQELEA"
     gene            <2946533..>2946952
                     /locus_tag="MYCTH_2130158"
                     /db_xref="GeneID:11514476"
     mRNA            <2946533..>2946952
                     /locus_tag="MYCTH_2130158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666213.1"
                     /db_xref="GeneID:11514476"
     CDS             2946533..2946952
                     /locus_tag="MYCTH_2130158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666261.1"
                     /db_xref="GeneID:11514476"
                     /db_xref="JGIDB:Spoth2_2130158"
                     /translation="MGRARANKPYLEERRSAVCAEQEYVARSAAASAASPPPFTIPTP
                     STSVSTSACQRALLLAPAPELLCRYVYAEPPARLRRTDSELQLPTSSYSLITPTPLPP
                     TTSAVPPPPLPAASFVIPPSPYVAPPTAKWATTTAAI"
     gene            complement(<2947515..>2948507)
                     /locus_tag="MYCTH_89967"
                     /db_xref="GeneID:11514477"
     mRNA            complement(<2947515..>2948507)
                     /locus_tag="MYCTH_89967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666214.1"
                     /db_xref="GeneID:11514477"
     CDS             complement(2947515..2948507)
                     /locus_tag="MYCTH_89967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666262.1"
                     /db_xref="GeneID:11514477"
                     /db_xref="JGIDB:Spoth2_89967"
                     /translation="MPEQRSTVTTLAAPGSLADIIRREPRLFVLPPYWTYNHSRVLGA
                     RFWEQPAITRPFLEQKLSVPPKPSEMAKALILNLDTLLSWDTLPERALEAMEHVMATF
                     FPATLHKPQTDARLKLYFGERVFNKAVYVSSLWTSSSTDGSASTILSASVLAYVPRER
                     LRSKLVAPADADRDPHIVATLLAMAQAHFYKETSLTPPVFTPAPLFQRPVAHTNADTP
                     FYDVTGQIITHQGEGESANFVVYTAVVIATFLRRFMFPYEGPDSKDSKSGMDISVRKV
                     KVFPILGLRERLVRALLPELVEPYSIYFWGPLVERSRKRKRAGSGSFEEERSVA"
     gene            complement(<2950649..>2952199)
                     /locus_tag="MYCTH_97961"
                     /db_xref="GeneID:11514478"
     mRNA            complement(join(<2950649..2951195,2951229..2951458,
                     2951513..2951624,2951724..2951893,2952170..>2952199))
                     /locus_tag="MYCTH_97961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666215.1"
                     /db_xref="GeneID:11514478"
     CDS             complement(join(2950649..2951195,2951229..2951458,
                     2951513..2951624,2951724..2951893,2952170..2952199))
                     /locus_tag="MYCTH_97961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666263.1"
                     /db_xref="GeneID:11514478"
                     /db_xref="InterPro:IPR012979"
                     /db_xref="JGIDB:Spoth2_97961"
                     /translation="MILVQPQAGERKSAATIAKPVVKQSAKVPVKAQINETRTSVSTG
                     LIPKPLSKHSADTVDIEEESASYQDAADADAVMQDGGEASDGEPTLLTFGDLVRGNST
                     VDIQQRPSAPISATSLGTILNQALRTDDADLLESCLQTTNVKVIENTINRIDSSLAGI
                     LLSKLSARMHRRPGRAFGLMRALVSQLDLVARLGELSRVLEERSRGLSSLLALKGKLD
                     ILYTQMKYRKSIKAAGSSQSRLGEEEESSKEEEEDADEPRIVYVEGQESLGKGALTNR
                     TAAGGVVDDDNDFPAGTAVISDSEEESEEEFKGDIEEELADAESLDKDKVDYDDVEED
                     EEEEESEDKEAQPPAKVRRTSAKISKRK"
     gene            complement(<2953087..>2953410)
                     /locus_tag="MYCTH_26863"
                     /db_xref="GeneID:11514479"
     mRNA            complement(<2953087..>2953410)
                     /locus_tag="MYCTH_26863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666216.1"
                     /db_xref="GeneID:11514479"
     CDS             complement(<2953087..>2953410)
                     /locus_tag="MYCTH_26863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666264.1"
                     /db_xref="GeneID:11514479"
                     /db_xref="JGIDB:Spoth2_26863"
                     /translation="VLDPIQAYGIGGPAIISGCDAPVGWQVALGIPVGEVVLRGQDDE
                     WGDSPAKGIDSLDYRCPFPVARLGQLCLTTAIRGRNYHAREDDAHHKPSLVEVIDIII
                     HNAVLG"
     gene            <2961683..>2962928
                     /locus_tag="MYCTH_2130162"
                     /db_xref="GeneID:11514480"
     mRNA            join(<2961683..2961701,2961850..2961989,2962221..2962377,
                     2962495..>2962928)
                     /locus_tag="MYCTH_2130162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666217.1"
                     /db_xref="GeneID:11514480"
     CDS             join(2961683..2961701,2961850..2961989,2962221..2962377,
                     2962495..2962928)
                     /locus_tag="MYCTH_2130162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666265.1"
                     /db_xref="GeneID:11514480"
                     /db_xref="JGIDB:Spoth2_2130162"
                     /translation="MRQRQPSYRTYTLDHSHRWEHLAADMDDRPRAGATKRPMPALCL
                     ATAHKIDEDDLVARSAEHGNAEVPTQVLAAHVEPPAGGGPGMGDDGLGDGVASGRYDI
                     GSAAETSSVADINDADNTTVLEREGGDHTTTEASPAAKTSDAGNNIMSERESEDLATA
                     GTSLAASISNAVDATMSEKAGEDNAMTEMSPTAKASGMDNTIIFEREGTGYRQSDGCP
                     ECFRDEPFATRRAVPMQNGEPAPVREPRPGW"
     gene            <2963921..>2964559
                     /locus_tag="MYCTH_2130164"
                     /db_xref="GeneID:11514481"
     mRNA            <2963921..>2964559
                     /locus_tag="MYCTH_2130164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666218.1"
                     /db_xref="GeneID:11514481"
     CDS             2963921..2964559
                     /locus_tag="MYCTH_2130164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666266.1"
                     /db_xref="GeneID:11514481"
                     /db_xref="JGIDB:Spoth2_2130164"
                     /translation="MIDNDVLALNKYDSHPELRKLKPWSPAMFTASSFSILNYPTDIF
                     DLVRDGTIRVHIADLTGLSARTVHLSDGTQLDADALCCVTGWKHMPPVEFLPEGGLVL
                     VDRRGVPRGRPARGDDAERTASSSGDSSSSSEAGEDRGRAEPITTSVVAAADDNDPAY
                     VAIAAGVEAMGLNQNDDDDSGRVGSEMEVDGSAHRFKRVEMWARGCVGEVVL"
     gene            <2982050..>2982217
                     /locus_tag="MYCTH_38597"
                     /db_xref="GeneID:11514482"
     mRNA            <2982050..>2982217
                     /locus_tag="MYCTH_38597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666219.1"
                     /db_xref="GeneID:11514482"
     CDS             <2982050..2982217
                     /locus_tag="MYCTH_38597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666267.1"
                     /db_xref="GeneID:11514482"
                     /db_xref="JGIDB:Spoth2_38597"
                     /translation="YPDNILIFSKTIDKYRKYIKAMLGTLYIYKLSINKGKSEFYIRK
                     TVFLGYKISLR"
     gene            <2987130..>2988256
                     /locus_tag="MYCTH_2047322"
                     /db_xref="GeneID:11514483"
     mRNA            join(<2987130..2987267,2987321..2987448,2987504..2987603,
                     2987660..2987795,2987843..2988051,2988143..>2988256)
                     /locus_tag="MYCTH_2047322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666220.1"
                     /db_xref="GeneID:11514483"
     CDS             join(2987130..2987267,2987321..2987448,2987504..2987603,
                     2987660..2987795,2987843..2988051,2988143..>2988256)
                     /locus_tag="MYCTH_2047322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666268.1"
                     /db_xref="GeneID:11514483"
                     /db_xref="JGIDB:Spoth2_2047322"
                     /translation="MDSFVREAFSLLGIGLFVIGLRLYVRISSAGLKHLHADDYLMIL
                     AAVAYSVETYLAYSVGAFWKGLANNGMTDKQRYLLDPDSEEYQWRVSGSKTQLAGWST
                     YTFLLWVIKAAMCSFYLRLTEGLGFEKRIYAGFVLIFATWLAVLLSILLGCQPFQKNW
                     QIYPDPGNACQPAISKIDIFVTVVLNVVTDIYLMSIPLPLLWKSSLRSLKKAGLMLLF
                     SGGIFVTAAGVLRCVLIIADPVNGAQKAGSWAVRETFVAVVTSNLPMISSLIARCFR"
     gene            2989161..2990162
                     /locus_tag="MYCTH_2310786"
                     /db_xref="GeneID:11514484"
     mRNA            join(2989161..2989263,2989322..2989398,2989470..2989609,
                     2989708..2990005,2990075..2990162)
                     /locus_tag="MYCTH_2310786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666221.1"
                     /db_xref="GeneID:11514484"
     CDS             join(2989254..2989263,2989322..2989398,2989470..2989609,
                     2989708..2990005,2990075..2990140)
                     /locus_tag="MYCTH_2310786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666269.1"
                     /db_xref="GeneID:11514484"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="JGIDB:Spoth2_2310786"
                     /translation="MAPTRDPRPLVISGPSGVGKGTLYNLLFQRHPDTFTLSVSHTTR
                     RPRPGEQDGVHYHFVTKEQFLELKAQNGFLENAQFGDNFYGTSKATIEEQTAKGRTVV
                     LDIEVEGVKQIRASGFPARYVFIAPPSEEELERRLRGRGTETEESILKRLKQAKVELE
                     YSKVPGIHDKIIVNDDLERAYKELEEFVFAEPNASA"
     gene            2990428..2992696
                     /locus_tag="MYCTH_2310790"
                     /db_xref="GeneID:11514485"
     mRNA            join(2990428..2990993,2991092..2992696)
                     /locus_tag="MYCTH_2310790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666222.1"
                     /db_xref="GeneID:11514485"
     CDS             join(2990789..2990993,2991092..2992560)
                     /locus_tag="MYCTH_2310790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666270.1"
                     /db_xref="GeneID:11514485"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2310790"
                     /translation="MPIIGAKEEHVDPRLTRIAQADKKPWYKKPNLRFLYLILVPTGL
                     GVEWTSGFDSSMMNSLQAVQSWVDYFNNPTSGRLGLLNAMYSLGALMAIPFIPTVSHF
                     LGRRRTILLASVIMCMGAGLQAGARNSDMFLASRWVLGFGIPFAIVNASSLIGELSYA
                     KERPIMTSLFNASWFVGAIVAAGTTYGTFQMESTWSWRLPSLLQLVPSFFQITFMYWC
                     PESPRWLISKDRGDEAFAILQKYHSEGADGDEFVRLEYAQIQSTIALEKEAASSFVWA
                     DVVRDPPMRRRFTIAAIVGFFTQWSGNGLLSFYMKQILALVNITDNRTVQKIILSNTC
                     WGFINAVPLALIAPRFRRRVMFLTCTIGTAVVYTVWTIASARAEIDPSAATAIPVLVF
                     IFVYSPYVSSFPSSFSSFEDLHKMHKCLLTQLPCRFYNLGWNALAYTYMVEIFPFRQR
                     SKGIAVEQLTVRFAVFFNTYVNPIALKNIGWKYYIIYCVWILVEIATVYLLFPETHNR
                     TLEELSFIFEGKAVQEKMQQNVDKVLEVELDAVKRRSSKDGVATAEERA"
     gene            complement(2992655..2994047)
                     /locus_tag="MYCTH_2310794"
                     /db_xref="GeneID:11514486"
     mRNA            complement(2992655..2994047)
                     /locus_tag="MYCTH_2310794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666223.1"
                     /db_xref="GeneID:11514486"
     CDS             complement(2992833..2993561)
                     /locus_tag="MYCTH_2310794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666271.1"
                     /db_xref="GeneID:11514486"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="JGIDB:Spoth2_2310794"
                     /translation="MFPNAKPSPPSSPPFACPQGQGQDHNQPGSSGSTEEPRWQGISR
                     ARPEWPVPTIQNVVATASLECRLDLQAIAQHARNVEYNRRKFHALVMRIREPRTTTLV
                     FASGRMVVTGAKSAGLARLAARRHARAIQKCGFPTRLADFRVQNFVGSAACGFLVRLE
                     RISHRYWQSARHEPELFPGLVYTMVRPSLKCLVFTTGKVVLTGAKKREDVFEAFANLY
                     PLLLEAKVEQRGAPPMPQGDDGSS"
     gene            <2994468..>2995955
                     /locus_tag="MYCTH_89959"
                     /db_xref="GeneID:11514487"
     mRNA            <2994468..>2995955
                     /locus_tag="MYCTH_89959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666224.1"
                     /db_xref="GeneID:11514487"
     CDS             2994468..2995955
                     /locus_tag="MYCTH_89959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666272.1"
                     /db_xref="GeneID:11514487"
                     /db_xref="JGIDB:Spoth2_89959"
                     /translation="MPSVLSLFRHSRDMPRPVQAGDDGQRTVAKKRRSRFSMVIPGSS
                     SRTARKSAPFDSALEPLEWKGAAMAADVPELPSFPLYQHFASTRHLSDSHQRRQRYYE
                     KSEPRGDRRLSRAATVSDFHSLRPQSELIPRKSDVTTLSTNAPPACDRAVELARLYRS
                     ILPDFRTICEEEEEKEEDEEKKKGETRENEGGRREREAGGYGGQRPKNGSLGAASTQG
                     VTEKERDRRKDGGLCPETHAGEPPHRPAGGCSSLTAGASKTSAVKHHKFPDGAAQRHQ
                     HHRPSDPNTPGQSKHAWPLPIRPLPPSSSPQTTATPETTEAGLVRETENEHDDRSILS
                     QHSTVGLQICTELLVDRLIRALGLQRRHERGGHAGPSSHGRVDEGFKVIGEKEMEREE
                     GDGTEHRESSSKQLEMLLLIEAYEGLLGCCRRETAATAATMTTKTESVEAGAGGNNAA
                     QPGADRSSSSSSSSRPVAEAVPILEHWLETLHALYEATFEERGEA"
     gene            complement(<2996497..>2997365)
                     /locus_tag="MYCTH_89958"
                     /db_xref="GeneID:11514488"
     mRNA            complement(join(<2996497..2996636,2996810..2996920,
                     2997003..2997106,2997211..>2997365))
                     /locus_tag="MYCTH_89958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666225.1"
                     /db_xref="GeneID:11514488"
     CDS             complement(join(2996497..2996636,2996810..2996920,
                     2997003..2997106,2997211..2997365))
                     /locus_tag="MYCTH_89958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666273.1"
                     /db_xref="GeneID:11514488"
                     /db_xref="InterPro:IPR000772"
                     /db_xref="JGIDB:Spoth2_89958"
                     /translation="MMLRTSAVFLALAAMGLAQAPEGYSTVYITSKVNTKFVIVPKER
                     TAGTTTIVKTANNTPEQQWYLKTGSTKIQLADSTLCVDGGPQDNWRDMGKIYVNECAD
                     TESQNWFVMDDGRIALEASNQQQCVDLVFMRAVENNDVGLFSCAGLGNTGAADAGINW
                     PLVNVTVTA"
     gene            complement(<2998831..>2999394)
                     /locus_tag="MYCTH_2130172"
                     /db_xref="GeneID:11514489"
     mRNA            complement(<2998831..>2999394)
                     /locus_tag="MYCTH_2130172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666226.1"
                     /db_xref="GeneID:11514489"
     CDS             complement(2998831..2999394)
                     /locus_tag="MYCTH_2130172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666274.1"
                     /db_xref="GeneID:11514489"
                     /db_xref="JGIDB:Spoth2_2130172"
                     /translation="MLDGLRSPWVSTGGRPWPVLLLDHRLDFPPVLVGFVVRVVLGPQ
                     PVAEPEVELLGGIERPEAGPRPGDTLRASRREPPTQLLDPAFRGWRKRSELLEHGNRS
                     CRKMPSRSSSDNVFYALERDTPRIRSMTMIALFLWTKAQCTRGDGNGCLAGRESHGCG
                     LYEVCKRPDLDDRIPGDRGRKSRSNYP"
     gene            complement(2999516..3001680)
                     /locus_tag="MYCTH_2316346"
                     /db_xref="GeneID:11514490"
     mRNA            complement(join(2999516..2999948,3000011..3000142,
                     3000197..3000485,3000555..3000738,3000810..3000978,
                     3001050..3001213,3001276..3001368,3001429..3001464,
                     3001526..3001680))
                     /locus_tag="MYCTH_2316346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666227.1"
                     /db_xref="GeneID:11514490"
     CDS             complement(join(2999930..2999948,3000011..3000142,
                     3000197..3000485,3000555..3000738,3000810..3000978,
                     3001050..3001213,3001276..3001368,3001429..3001464,
                     3001526..3001528))
                     /locus_tag="MYCTH_2316346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666275.1"
                     /db_xref="GeneID:11514490"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="JGIDB:Spoth2_2316346"
                     /translation="MATSEAAISRTEILEKYTSLDQRGIVIAEYVWIDSEGNTRSKTR
                     TLEPREDGKPWDVDTLPIWNFDGSSTGQAPGDNSDVYLRPCAVYPDPFRKGNNILVLT
                     ECWNHDGTPNKYNYRHECAKLMQAHADAEPWFGLEQEYTLLDLNDRPYGWPQNGFPAP
                     QGPYYCGVGAGKVVQRDIVESHLRACIYAGIKISGTNAEVSKSQWEFQVGPCVGISMG
                     DDLWMARYILARVAEDFGVKVSLHPKLIPGDWNGAGLHSNFSTKEMRQEGGMKAIEAA
                     IKKLEGRHAEHIAVYGEDNEKRLTGRHETGAIDSFTYGVANRGASIRIPREVAAKGYG
                     YFEDRRPASNADPYRVTGILMETIYGPV"
     gene            complement(3005315..3006669)
                     /locus_tag="MYCTH_2310800"
                     /db_xref="GeneID:11514491"
     mRNA            complement(3005315..3006669)
                     /locus_tag="MYCTH_2310800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666228.1"
                     /db_xref="GeneID:11514491"
     CDS             complement(3005426..3006289)
                     /locus_tag="MYCTH_2310800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666276.1"
                     /db_xref="GeneID:11514491"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="JGIDB:Spoth2_2310800"
                     /translation="MSTTAAPARDLPVITIPPSPPHPHTHTIIFLHGRGDNIKSFSRA
                     LRKWHSSRGTTLFDTFPTLRWVFPQAPMRQVASTANLPRPHIFPQWFDLWTAQDFSER
                     EEVQVEGLRESVPLIRDMIAREAAQLGGRWDRVILAGISMGGATSVHTLFNLDIPAEG
                     GGRLAALLAFCARCPFAGRSLQGMREVLALPGSPPAGENGVLRRTPVLLEHSADDPLV
                     LIDNGRRLRDTLKGFGAQVEWREYITGGHWFQEPEGIDDAIEFLQKFVFGPNAGEQTR
                     AAADSVAMDLS"
     gene            complement(3006670..3008639)
                     /locus_tag="MYCTH_2310803"
                     /db_xref="GeneID:11514492"
     mRNA            complement(join(3006670..3007626,3007690..3008275,
                     3008330..3008639))
                     /locus_tag="MYCTH_2310803"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666229.1"
                     /db_xref="GeneID:11514492"
     CDS             complement(join(3006775..3007626,3007690..3008275,
                     3008330..3008571))
                     /locus_tag="MYCTH_2310803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666277.1"
                     /db_xref="GeneID:11514492"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="JGIDB:Spoth2_2310803"
                     /translation="MDPDLKRYSVIMLDEAHERTIATDVLFALLKKTVKKRPDLKVIV
                     TSATLDAEKFSEYFNSCPIFTIPGRTYPVEILYSREPESDYLDAALTTVMQIHLSEPM
                     GDILVFLTGQEEIDTACEILYERMKALGPGVPELIILPVYSALPSEMQSRIFEPAPPG
                     SRKVVVATNIAETSITIDYIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAG
                     RAGRTGPGKCFRLYTEAAFQSEMLPTTIPEIQRQNLSHTILMLKAMGINDLLRFDFMD
                     PPPVNTMLTALEELYALGALDDEGLLTRQGRKMADFPMEPSLSKVLIASVEKGCSEEM
                     VTIVSMLNLLQIFYRPKEKQAQADQKKAKFHDPSGDHLTLLNVYTAWKNSGYANAWCF
                     ENFIQARSMRRAKDVREQIVKIMERHRHPIISCGRDTDKIRQSLCAGFFRNAARKDPQ
                     EGYKTLTEGTPVYLHPSSALFGKQAEWVIYHTLVLTTREYMHFTTAIEPKWLVDAAPT
                     FFKIAPTDRLSKRKRAERIQPLYNKYANEGDWRLSSQRRAGRTGGGGGTWG"
     gene            3011013..3012164
                     /locus_tag="MYCTH_60316"
                     /db_xref="GeneID:11514493"
     mRNA            join(3011013..3011146,3011231..3011298,3011406..3012164)
                     /locus_tag="MYCTH_60316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666230.1"
                     /db_xref="GeneID:11514493"
     CDS             join(3011089..3011146,3011231..3011298,3011406..3011795)
                     /locus_tag="MYCTH_60316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666278.1"
                     /db_xref="GeneID:11514493"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="JGIDB:Spoth2_60316"
                     /translation="MCSTDIFLGLLAVIFPPVAVWVKRGLCSADSIINILLCVLGYIP
                     GLLHAWYIIAKYPEPPYDYEYQSIPHDPEHGRIYVFVHNGGHGQPQTQGYQPQEPAHA
                     QAPKPQGHMNYGTTGAAAAPQFQPPHQHQPQEQGTASAAGTAAGPSDAGAPPPSYAQV
                     VAGDYKVQTHD"
     gene            complement(<3012490..>3014027)
                     /locus_tag="MYCTH_2070352"
                     /db_xref="GeneID:11514494"
     mRNA            complement(join(<3012490..3013357,3013410..3013794,
                     3013868..>3014027))
                     /locus_tag="MYCTH_2070352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666231.1"
                     /db_xref="GeneID:11514494"
     CDS             complement(join(3012490..3013357,3013410..3013794,
                     3013868..3014027))
                     /locus_tag="MYCTH_2070352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666279.1"
                     /db_xref="GeneID:11514494"
                     /db_xref="JGIDB:Spoth2_2070352"
                     /translation="MGRSQRNAPTDEQSRLEGTQDVTVEADASQDGKKKKKNKKRSAG
                     AKKRGTGFEEFYCDPPMTPAEYNEERDVIYPPHRPFVDRIEECIQRYRARRRLNSDRE
                     YLFSRYLLLGGIDASVRQFQSTRTIGDDILEDATKNSIREMTADDVIQRGGDGNRNPR
                     FYNPNYPEHWDVDFTGVAAGFVSEHLPALTGPETDQFFMGVDVVLNFLKYVDLHDVCP
                     EYADDIKNAQRVCLRALEEIPATTKLLQLLPGQFNAALRVLYVSQDDGSSGVDNYFEK
                     ALPDPKQAKVSHAATISILMGADRFPTNSEWFVTDTAEFTFEVLAIKLPTDAIRAKYK
                     AINQHLTGYSDIQPCGTIIARPVIVRDGWDNTMAATIPPEADKESEFILEEDILRLLV
                     VGMKLTIGVCTLNVGLKFIKYVTQVRPSFYVFLPQELMFHFKEPVPNDRPAKSIYDCE
                     DEADGDAPAGGYNDGGDVES"
     gene            3015418..3017241
                     /locus_tag="MYCTH_2310810"
                     /db_xref="GeneID:11514495"
     mRNA            join(3015418..3015756,3015816..3017241)
                     /locus_tag="MYCTH_2310810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666232.1"
                     /db_xref="GeneID:11514495"
     CDS             join(3015689..3015756,3015816..3016995)
                     /locus_tag="MYCTH_2310810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666280.1"
                     /db_xref="GeneID:11514495"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="JGIDB:Spoth2_2310810"
                     /translation="MAASRELPNHADLQPYNHAVAGHDGTLSDIDGELFIKPCVQQEI
                     DFYEKTFRDHPEFASVMPLFFGTLSLNDATDINSLNEQLPAVSDHISQGLKEEAVKMA
                     KEAAAEAAAEIADEPVDIAWKPNKNRKIATNKSVVLQNTAHGFKKPNILDAKLGRRLW
                     ADDAPLEKRRRFDEISRLTTNGSHGFRIAGMRVYKGSDNPEELDANGFKVYNKDYGRF
                     QVNKDNIVQEMAKFIFNDRAGIDRELGRAVAQAFLEDLKRVEEVLANSETRMYSASLL
                     FTFEGDGEALRAAIEENNALVDKANALEEDDGIIVRGRKELDAGKLNGIMVSQQDMGT
                     VDINAVSGAIEGDVKVVELMGNVASDGEDDDDDDGFSTLPRIYSLKLIDFAHAEWVPG
                     QGPDENSLLGVRSLIKIFEELAQ"
     gene            3017387..3019545
                     /locus_tag="MYCTH_2310812"
                     /db_xref="GeneID:11514496"
     mRNA            join(3017387..3017681,3017782..3018673,3018734..3019000,
                     3019067..3019545)
                     /locus_tag="MYCTH_2310812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666233.1"
                     /db_xref="GeneID:11514496"
     CDS             join(3017646..3017681,3017782..3018673,3018734..3019000,
                     3019067..3019329)
                     /locus_tag="MYCTH_2310812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666281.1"
                     /db_xref="GeneID:11514496"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="JGIDB:Spoth2_2310812"
                     /translation="MSIPGLGQIPPQQPATPTTRTITLRPFWEWRFEVPRSSASQAGA
                     TVRLTSGTAERDGTELALNHTYTFPRNTKSKLLTYTGATLEVSGECVDRVAQYNTPED
                     SPQLPVLNLHFALQELRGAAAANNNNNNHNHIINHSTGGNNDKHGDGGGSKPPGPRVM
                     ICGEKDSGKTTMARTLAALATRVGGQPLVASVDPREGMLALPGTVSAAVFGTIMDVED
                     PAAGFGVSGTPSSGPSAVPVKLPMVYYFGRERVDEDVRLWKQLVGKLGSSVKAKLEAD
                     EVVREAGLVLDTPAASVAKGDLEVLEHLVKEFDVNIVVVLGSPGIHGELQRRLESQKT
                     VYGESITLISLEKSDGVAGRDKDSMKFTFDAAIKEYFFGDAKRTLSPFTQSVSFDDVT
                     IFKSPDDPYNDQAILERADISAEMSHWTLAVMNASPSDPPEAIQQAAVIGFVAIADVD
                     EDRRRLKILSPVSGRLGNRPMVWGRWPEPYINLLG"
     gene            complement(<3019861..>3020290)
                     /locus_tag="MYCTH_2130178"
                     /db_xref="GeneID:11514497"
     mRNA            complement(join(<3019861..3020126,3020176..>3020290))
                     /locus_tag="MYCTH_2130178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666234.1"
                     /db_xref="GeneID:11514497"
     CDS             complement(join(3019861..3020126,3020176..3020290))
                     /locus_tag="MYCTH_2130178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666282.1"
                     /db_xref="GeneID:11514497"
                     /db_xref="JGIDB:Spoth2_2130178"
                     /translation="MLLAVCGLFQIDRIAARLDVVHFANGSRPTTERKQGGLGNQVIT
                     RAGQRFAFVGSILWISYISSWVSYQLSSSQTLKLNLIFGVPIFSAPACGYWPGLNLCA
                     AAETVLKHKKMRDAPQANASPLLA"
     gene            3020861..3023368
                     /locus_tag="MYCTH_2310816"
                     /db_xref="GeneID:11514498"
     mRNA            join(3020861..3021305,3021415..3023368)
                     /locus_tag="MYCTH_2310816"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666235.1"
                     /db_xref="GeneID:11514498"
     CDS             join(3021106..3021305,3021415..3023182)
                     /locus_tag="MYCTH_2310816"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666283.1"
                     /db_xref="GeneID:11514498"
                     /db_xref="JGIDB:Spoth2_2310816"
                     /translation="MTVPRWISLGMGLRYLLDETTSFETLSVVTRHHASTDGESRMIR
                     TLLILSLTFASISVMSTLFALYWLILLLIKGDFVKSTVLLVYAIVSFARGNVRPSSAF
                     CQVSGFALAVGIEASDVAVLLIALHSAMYILRPRSGLYPYRHFAYLAFYLFPIVAACL
                     TFIAGNGYGDMGPYCYLRTDRRWARLALSWVPRYAICAAIVLIYLFIYFYIRRRMGDF
                     GRRHSEATQPRFPSESAGAISMPRLRYNGLLPSSSCSRPTSTTDTISAVKDQLRPPSS
                     IGPARSVSARTSAEAPRRGPVKWNWTVFAHDQLPESSRPSADDTYDPTSPNSPGHLLI
                     PPSPAYSHRRNTIPSDHVLSGSYPGGSSSSSNNNNNNSNSNSRRVSLPPSLPQHTDDA
                     RAEVDVDTSDSSPMLPVPAASLPPPSSSRFTASITPADPDPGPAPDPDPIPSKQLNNK
                     RTLRQLRALFVYPLAYIVVWLFPFVSHVMGYDDDSTRYRGQGTPHWLFVVSTISLGVQ
                     GAVDCTLFLLRETPWRHVSAGAKGGFWAALGRRWSWNLRRATWWCGRGWGWKGSSADG
                     VGRTREEMLVDGRLARERREEEVAVERERRRGAAMGLEGPGGGVGRGRRRRRREWWDV
                     YAERDGILDGNDGLDDTDDGEGQVEVPQEIG"
     gene            complement(3023393..3024770)
                     /locus_tag="MYCTH_2310819"
                     /db_xref="GeneID:11514499"
     mRNA            complement(join(3023393..3023894,3024071..3024548,
                     3024704..3024770))
                     /locus_tag="MYCTH_2310819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666236.1"
                     /db_xref="GeneID:11514499"
     CDS             complement(join(3023604..3023894,3024071..3024529))
                     /locus_tag="MYCTH_2310819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666284.1"
                     /db_xref="GeneID:11514499"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="JGIDB:Spoth2_2310819"
                     /translation="MPLRLAILEADTPVPAANERYKGYLGVFRHLFARAVAPAALESV
                     LTLTGHDVVHNPSSAYPDLDEVDAILITGSKYNAFDNDDWIVTLVEYVRKALLRQDRP
                     VKVVGVCFGHQIVARALGALVARNDKGWEVSVVETTLTEKGKELFGGRETLKIQQMHR
                     DQVFGVPPGAELLASTEKCGNQGFIIPGRVITVQGHPEFTEDIMDELLELRHQSGLFT
                     DELYQSGKTRNGDHHDGVFVAQVFVKFLQGQ"
     gene            3025255..3026871
                     /locus_tag="MYCTH_2310821"
                     /db_xref="GeneID:11514500"
     mRNA            join(3025255..3025475,3025543..3026871)
                     /locus_tag="MYCTH_2310821"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666237.1"
                     /db_xref="GeneID:11514500"
     CDS             join(3025358..3025475,3025543..3026717)
                     /locus_tag="MYCTH_2310821"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666285.1"
                     /db_xref="GeneID:11514500"
                     /db_xref="JGIDB:Spoth2_2310821"
                     /translation="MAPTRASLKGFLATAKKALVSPPTQRPNPLTLVVGNESADLDSI
                     CSALLLAYFRTHTPPHALHIPVSNLPRADLALRPELNAVLGPAGLKPDDLITLTDLPR
                     DGLRPEDTRWLLVDHNVLTGDLAKSFSSRVVGCIDHHEDEGAVPHDFPSDQPRIIEKC
                     GSCMSLVLEHCKFTWDALSNLPCEGEAEGGSSTPAAECDAHLARVALAPILIDTANLT
                     SKDKTTDRDVRAAELAESKLLPGLRTLSSSPSPPSSSSEPYDRQTYHDTLAALKEQIV
                     GLSYRDVLRKDYKRWTEGPLALGVSTVVHGFEYVFARVGDQSREAFLAALKDWAREEE
                     QKLDVVAVMTVSRPGGMFTRELLVWGLNEKGVEAVGRFQKKFGGTLGLETWRGGELDG
                     GGEGEAEWRLCWRQKGVSHSRKQVAPMLREAMRESARL"
     gene            complement(3027364..3028520)
                     /locus_tag="MYCTH_2310822"
                     /db_xref="GeneID:11514501"
     mRNA            complement(3027364..3028520)
                     /locus_tag="MYCTH_2310822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666238.1"
                     /db_xref="GeneID:11514501"
     CDS             complement(3027456..3028430)
                     /locus_tag="MYCTH_2310822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666286.1"
                     /db_xref="GeneID:11514501"
                     /db_xref="JGIDB:Spoth2_2310822"
                     /translation="MANPSLLRVGRCSSCIFSALRPIIARSAGAGPQARVSLAISETR
                     RLAPLTAAPFSTLRPTPRLLGSPSIEERVEKQPGHDKQGNGPSSDSSNSDVPWYLQVE
                     PPRHPTLVSEPAPLPEIPDNSPKLMEPLLKYVADELGMDNLSLLDLRAIDPPPALGPG
                     LLMVLGTARSERHLHVSADRLVRWLRGRGVTAKADGLLGRNELKIKLRRLARKAKLLG
                     NSGVMRGGDDGISTGWVCVNLGLVGGSHKEVQILDEKGRPTGFGVPQTGNTIVVQLLT
                     ESRRRDLDLEGLWTGMLQQSLEKLAGSSTKPAPKTAQPASETPPASSS"
     gene            3028759..3033570
                     /locus_tag="MYCTH_2310823"
                     /db_xref="GeneID:11514502"
     mRNA            3028759..3033570
                     /locus_tag="MYCTH_2310823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666239.1"
                     /db_xref="GeneID:11514502"
     CDS             3029100..3033308
                     /locus_tag="MYCTH_2310823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666287.1"
                     /db_xref="GeneID:11514502"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="JGIDB:Spoth2_2310823"
                     /translation="MLVRPGAARQTLPVRHLLASTPLRHSTRGAAVNSLPNVSESRRI
                     LTTGSDARPWKKKSYRALVGFERNLATALEDHRFGDDVPFEGLSTGLASQYQPQKSQP
                     PLHMLRPFNVNSTLVLAEPKPYPPKQRLNPMGIPGDLEEMLSVFEACVQVGRLDRAAL
                     VLKRFERMKTLEPHQAVDLHNRYLQGRVAQLMNEPSKEKAEEVHKWFELHIRGARLPF
                     TPITIAYMLKTTLLTSEGSTRAARIDRYMSMMPHQNANEPLDLGNVLSDEDLETIAEV
                     CPAYYIPEDASGAAEAEALEEDESTHLEDTETQDAQRKASSGTPEVRETPQKGMGLKS
                     LKTALSLLSELPEGLDIASLPLSQRREVQARLERDCVDAAIARWREENEQLMSMGLNT
                     QLSTPSLNSKLYDWHQALEARLIQEQAKVEASLSAPRKSREDMERCVYGPHLLQSPAN
                     RLAAVAILSALSSLAMHGADKGIPVSNMVQQLAKIAEEDIRAQAIAKNLPKSKPRKQK
                     SARQLMRLHDAAPTATTKSSPTATASPASQPATNSEPSEFASRWPIAIKAKFGAVILG
                     ALMDTAKIVVEREHPETKEKVTQVQPAFTHTVQLKKGRRVGVIQPNRSLIELMKREPR
                     GEALARHLPMVVEPEPWSKFDKGGFITSPSPLVRLKNHEKDQRIYAEAAIERGDMEQM
                     MRGLDVLGKTAWKINRPVFDVMLEAWNTGEEFANLPALDPKIPIPPEPDSTDDPMKRR
                     LWLRAVKAAENEKSGLHSVRCFMNFQLEIARAFRDQTFYFPHNIDFRGRAYPIPTYLN
                     HMGADNMRGLLLFAKGRPLGKSGLAWLKVHLSNVYGFDKASLKEREEFADRNLENIFD
                     SADNPLTGKRWWLQAEDPWQCLATCFELKAALSSPDPTAYVSHLPVHQDGTCNGLQHY
                     AALGGDTWGAQQVNLLPGDRPADVYSAVAELVQKQVTEDLANGNEFAQAMDGKITRKV
                     VKQTVMTNVYGVTFVGAKKQVQKQLDSLYPDIEKETGLSSGVLASYIAAKVFMALSTM
                     FRGAHDIQNWLGEIGGRVCRAVTPEQLDRIAEASGEKVGSGEESKSTKKKAKASSKAG
                     DEDLASHFRNTLVWTTPLRMPVVQPYRKSGTRLISTCLQDLVLTNVDRDDPVNRRKQL
                     QAFPPNFIHSLDASHMMLSALECDAIGLTFAAVHDSFWTHAADVDAMNRVIRDAFIRI
                     HQEDVIGRLKSEFEARYRGSIYRAKIDSSTEVAKKIIDWRKKSRMGAKDELLLERRRQ
                     ILLRSLDPEEVRQGKEMVTPASIFESMATPDMVANDVDPEEMLSVGAEDEDGDGHDGE
                     PIEREDVRNKVTEGLKNFAAHLKELHGTNYFVMEMNKPKRKKERSGSKPSQVELWLPL
                     TFPAIPKKGDFDVTQLKDSKYFFS"
     gene            complement(3034566..3036350)
                     /locus_tag="MYCTH_2310824"
                     /db_xref="GeneID:11514503"
     mRNA            complement(3034566..3036350)
                     /locus_tag="MYCTH_2310824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666240.1"
                     /db_xref="GeneID:11514503"
     CDS             complement(3034768..3036000)
                     /locus_tag="MYCTH_2310824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666288.1"
                     /db_xref="GeneID:11514503"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="JGIDB:Spoth2_2310824"
                     /translation="MAALDAQKYTPTEESEIQAWLDKAASIKAGASDALLDSLNADLA
                     TRTTAIGTKPSKADVALYESLAPLVKSWTPEQRTGQNGRPNIVRLVDFVQNSPLFGLN
                     VADADKVQVDAEEILYVKPPVDAKAEKERLKKEKAAAAAAAAGGVGADGDNKTLVDRT
                     KEAAGVVADEAAEVKDKAAAAVAGEAGAAAKKQKKEKKERAPKQPAAPAAPAVLSPCL
                     IDLRVGHILKAIKHPEADSLYVSSIAMGDAPGTDDTSEYEGQVVRTVCSGLNGLVPLE
                     EMQGRKVVVVCNLKPVKMRGIKSAAMVLAASPRVKEGEADDHKGPVELVNPPADAKAG
                     ERVFFEGWEGEPEKVLNPKKKIWETFQPGFTTTDDLEVAFDAGVVEALEGRTGLGRLV
                     TASGGVCKVVSLKGAQVR"
     gene            3036520..3039589
                     /locus_tag="MYCTH_2310825"
                     /db_xref="GeneID:11514504"
     mRNA            join(3036520..3037275,3037332..3038648,3038705..3039589)
                     /locus_tag="MYCTH_2310825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666241.1"
                     /db_xref="GeneID:11514504"
     CDS             join(3036759..3037275,3037332..3038648,3038705..3039558)
                     /locus_tag="MYCTH_2310825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666289.1"
                     /db_xref="GeneID:11514504"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Spoth2_2310825"
                     /translation="MPYISSPDGGSVSPISQLPTSAPSSPPPQSPTRPAKDASKMSYT
                     KMREEQVLAAEEEKARKENLKAEERRRKKWKKRVLSKEEREAKAKDLDRLLAQSAAFS
                     SILTNKTKVLGRVGTSLDGKALGEHDLTMAKQPKCLVGGTMRDYQLEGLTWMYEICIQ
                     GMSGILADEMGLGKTVQTISLIALLREQENYLGPHLIVAPLSTLSNWLDEFHQWVPSI
                     PVVMYHGTPQQRNEIFKTKIMRHIHGGRPTEKFPVVCTSYEMVLKDRAALSKINWEFI
                     IIDEGHRMKNFDSKLFRELKSFTSATRLLITGTPLQNNLKELWSLLNFLLPKIFRDWE
                     AFESWFDFSDLEDEEGTEEFIADKTKQELVKKMHIVLQPLLLRRVKADVAKYLPKKRE
                     YVLYAPMTKEQTDLYNVINDKNIDTRAYLEHKVVERLTAATNSKASSPTLSPRSTRSS
                     SVKREPEAESESVTTRSKPAAAKPKDVIPPAKNAFSLMMGKARPQGRPPKASPPNQQA
                     PAEPSPKQTRRAAKRKSPPEAESPAPKSAKSSRQSTPQSTRGRSRKTRQSYKEDDSDD
                     DLLDDDEFEAKLAKKLADEDAEAAEVAEEVLDEEEFERAHTLEIAKREIANKKLGNPL
                     LQLRLVCNSPHNFYNPWASDSGVPIDESIVTASGKMLLLDRLLPALFERGHKVLIFSQ
                     FKTQLDILEDYCAELRKWRVCRIDGGVAQEDRRAQIREFNTDPDIKIFLLSTRAGGQG
                     INLASADTVILFDSDWNPQQDLQAQDRAHRIGQTRPVIVYRLATKGTVEEELLMSADA
                     KRRLEKLVIKKGGFRTMGQKIDMREDLDRETLKALLLKDGQVYNLSGGEQVLSDEDLK
                     VLCDRSDEAYERAAVGQGNAAGYTVIETGAHGIRTAGAA"
     gene            complement(3039589..3040940)
                     /locus_tag="MYCTH_2310827"
                     /db_xref="GeneID:11514505"
     mRNA            complement(3039589..3040940)
                     /locus_tag="MYCTH_2310827"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666242.1"
                     /db_xref="GeneID:11514505"
     CDS             complement(3039620..3040540)
                     /locus_tag="MYCTH_2310827"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666290.1"
                     /db_xref="GeneID:11514505"
                     /db_xref="JGIDB:Spoth2_2310827"
                     /translation="MHSDYLDHYHRHHHHRYHQYYASAHRHHHNGGNNNSNPPQNQGA
                     TTTAAAAAAAGAARTNLQLALLGSVAAAVLRRPDLALLLLHGLARPLVRAAAAAAGGA
                     RDPHPHLRLAGLLPSWLVPEALRPLRHGLPPSSPFRAALHALRWEVRRNREALCWAGW
                     AFAGLLLASSAGLVPAAAARAVVGWAVPLLRAAAELYGHLLLTCLGVTWAVTAVRVAG
                     DVLLFAVWLVLQTARELVVQWAGFVRRRWAVIFAGLACWGLWEWLSNLDYDVLWVEAA
                     HWFLLTCAELVYLSGDVVRDMAKSIEFDFV"
     gene            complement(3042748..3043355)
                     /locus_tag="MYCTH_2310829"
                     /db_xref="GeneID:11514506"
     mRNA            complement(3042748..3043355)
                     /locus_tag="MYCTH_2310829"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666243.1"
                     /db_xref="GeneID:11514506"
     CDS             complement(3042774..3043280)
                     /locus_tag="MYCTH_2310829"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666291.1"
                     /db_xref="GeneID:11514506"
                     /db_xref="JGIDB:Spoth2_2310829"
                     /translation="MASAVNARVLVLFLAVCRLLPGTRAACYYPSGLLAPNDTPCRDD
                     TPHATCCGQGYACLSNGICQATGEELKKPGASEFVRGSCTDKTWRSSNCPLFCINEEY
                     DYLDGGTGIAKCENTSNDLYVCIDGQESSCEEGINVLYFPGMCVCVSVCVCTVVLCCL
                     VLSCAESE"
     gene            3044237..3046350
                     /locus_tag="MYCTH_2310830"
                     /db_xref="GeneID:11514507"
     mRNA            3044237..3046350
                     /locus_tag="MYCTH_2310830"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003666244.1"
                     /db_xref="GeneID:11514507"
     CDS             3044390..3046195
                     /locus_tag="MYCTH_2310830"
                     /note="CAZy_ID 267792"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003666292.1"
                     /db_xref="GeneID:11514507"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Spoth2_2310830"
                     /translation="MLSVRRRGFFALFPAAAILLLFLVTYLREGVVTVPKLSGRLGGL
                     PSGDEEPTFWARLPVHYPPSHIRPLPTGKPVRYPRVQAATFPVEKDPDARARRRERRA
                     IVRDVFHKAWLSYRELAWGADELAPLSGGTKNPFGGWGATLVDALDTLWIMNLRPEFD
                     EAVARAATINFTSTDLPELNVFETNIRYLGGFLSAYDLSGDGRLLRKAVEVGDMLYKA
                     FDTPNRMPIARWDLHAAARGAEQVAGKALLAEVATLSMEFTRLSMLTGDPKWFDAVQR
                     VADAMAAQQDSTALPGLWPLEVDGKTAVFNSGSVFALGAMADSAYEYLPKMAALTGGR
                     LPVYRRMYEKAVDAAVKHNIFRPLTPADEDILIAGNAHAKEHGIELEPQGQHLACFWG
                     GMMALAARLFGRDEDMEPARKLVEGCIWTYRAFPHGVMAEAFTMAPCPAGAVAGDDEC
                     RWDEAAWKREVLRRAGKDPDAAGSDAEADAIIKKDRLPEGFTSISDRAYVLRPEAIES
                     IFVLYRVTGREDLPEAAWDMFTAIDRVTSTELANAAVRDVTTPETPEQKDSMESFWLA
                     ETLKYFYLIFSDPELISLDEYVFNTEAHPFLRPLK"
     gene            complement(3046351..3047747)
                     /locus_tag="MYCTH_2310831"
                     /db_xref="GeneID:11514586"
     mRNA            complement(join(3046351..3047304,3047476..3047747))
                     /locus_tag="MYCTH_2310831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666245.1"
                     /db_xref="GeneID:11514586"
     CDS             complement(join(3046507..3047304,3047476..3047589))
                     /locus_tag="MYCTH_2310831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666293.1"
                     /db_xref="GeneID:11514586"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="JGIDB:Spoth2_2310831"
                     /translation="MALPLPPGLTHAEVAFLAEMELVTVVPRQRLDSIDLLSGKTPPL
                     RPPHRADLPLWLALLLKKQRRANILPPAWLHPDSLRSILLHETKVDPDAFSPPPPPPA
                     RADPARPGMVVPRRPQQQQQHQQRQAGRGGGGDLTLSAPFVASCTADAPAGYLPYHWL
                     EVAEALLAHAGDDVAAALGGSGGGGGGSGGGTTTTATTTSSSSSASTSSAAGEVRGLL
                     RDLVEVRAAKMRSSAARLEGFGGGLMSLRGVGAMELAESRGFVLGVVDGVRKLGATTE
                     AARREEEEEERMGEGLGEGESDEEMGI"
     gene            complement(3050031..3051516)
                     /locus_tag="MYCTH_2310832"
                     /db_xref="GeneID:11514587"
     mRNA            complement(3050031..3051516)
                     /locus_tag="MYCTH_2310832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666246.1"
                     /db_xref="GeneID:11514587"
     CDS             complement(3050275..3051210)
                     /locus_tag="MYCTH_2310832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666294.1"
                     /db_xref="GeneID:11514587"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Spoth2_2310832"
                     /translation="MAPPSTSSLSSLPPPPPVPNVQLSLPSPHVLLVTLDRPRALNAI
                     PAAQNQAMAALWAWYDAQPQLRCAVLTGGDGRAFCAGADLREWDQRHTADDENNNNNN
                     NNENNTASDRQAVDKAWEAARARELWTREGFGGLSNRAGKKPVIAAVNGLCLGGGMEM
                     VVNCDLVVADGARARFGLPEVGKGVVAVAGALPRLVRTMGRQRAAEMALLGRIGYTAE
                     QMRDWGIVNFVVGEGKAVQEAVKIAEEIANNSPDAVIASREGLRLGWEPLGPQLGTEV
                     LEKGVYGRIDGGENMKEGLRSFVEKRKPVWKDSKL"
     gene            complement(3051687..3054292)
                     /locus_tag="MYCTH_2310833"
                     /db_xref="GeneID:11514588"
     mRNA            complement(3051687..3054292)
                     /locus_tag="MYCTH_2310833"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666247.1"
                     /db_xref="GeneID:11514588"
     CDS             complement(3052083..3054230)
                     /locus_tag="MYCTH_2310833"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666295.1"
                     /db_xref="GeneID:11514588"
                     /db_xref="JGIDB:Spoth2_2310833"
                     /translation="MSSAPGMAPPPGVQPPNSATQANRPSGLPASFQPPPNLPNINFN
                     APVIRLGASMPPAKTGSSISSDRKDSHTPTSGRPGLGADRADQSRGQTRESMQSLIPP
                     TAEERLRTIFVHKIPEGVGGEAGIQQLLSTVGRLRRWDSGQSHLSEHKGALFGFAQYE
                     DPESLAAAVELLKDIEVPVKKQSPTENPPADDDDKFEGIDKEKLKVEVDPSTVKYLES
                     WKETRPSDDSALEARINEAGTALKQFVRDLFYPRVTSGRDAEGDTAMANGSNGLGENV
                     EVINIPLAPEDELADIPAEMRATVAAEIAAFRERSNKRDLERLRKEEEFEEMERQRNG
                     APRKSRLDSPPPSNSNMVPLAPRGAPNAPAGPKGQSRGVEFVNGGTTNGQRFPDDDDT
                     DADDEELYNRELAKQRAEDEKLYLEAERKWVNRERQRAAALDRERERERSETEGFARR
                     REEQLERDKNWDDDREASRKSHLYYRDHGQWIRERTAFRAAEAARDEMDRRAEEEERR
                     RAEAEMEHARDMADSFLERQAAEMERQPAAPAAPQRVTISFGAAAQKAAQRTAAPRRT
                     VAEVEGLLDDEEQDQTTKRQLVPIKFEPITDTKAMSEEDIQNAVRALAHEIPVDREGL
                     WAWDVKWDYLEESVIREKLRPFVEKKVVEYLGVQEQFLVDVVEEHLRKHQKPAELVET
                     LSEALDEDAEDMVKKLWRMVIFFTESEKRGLPA"
     gene            3054894..3056120
                     /locus_tag="MYCTH_2310836"
                     /db_xref="GeneID:11514589"
     mRNA            join(3054894..3054986,3055065..3056120)
                     /locus_tag="MYCTH_2310836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666248.1"
                     /db_xref="GeneID:11514589"
     CDS             3055069..3055950
                     /locus_tag="MYCTH_2310836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666296.1"
                     /db_xref="GeneID:11514589"
                     /db_xref="JGIDB:Spoth2_2310836"
                     /translation="MEFRQVVSVCRSAAAAATRPSLASTRPFPSSVLIQRHQFSTNNK
                     QQSEAAAAAAAVQQPPSETPVNPRSPAYRVAQLQASLSQNPSSSSSLPPRPPIRKNNM
                     LEGSQKSWAAPQARSGGGNSSSGGASLFRNTTLTGRAPTSSSSSSSSSAGTGDLFNLP
                     TQITSDMERATGAGGSKSDGSTGTTGTTETMSTWSEDEFLPKHYDVSEPELRLRPSTG
                     RTIQIKGNVDLARGFRLLHRAVSQNKIKAHVRLTRFHERPALKRKRLKRERWQERFRQ
                     GFRATINRVMELKAQGW"
     gene            complement(3056121..3058907)
                     /locus_tag="MYCTH_2310837"
                     /db_xref="GeneID:11514590"
     mRNA            complement(3056121..3058907)
                     /locus_tag="MYCTH_2310837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666249.1"
                     /db_xref="GeneID:11514590"
     CDS             complement(3056291..3058684)
                     /locus_tag="MYCTH_2310837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666297.1"
                     /db_xref="GeneID:11514590"
                     /db_xref="JGIDB:Spoth2_2310837"
                     /translation="MAQPNGASSLSRAKSTRASANIGKPSQSASRGNAPGAVPSTTTS
                     HQTTSPTARSHVSLFLANLRLLNLDQHPDWPDINALTFSTKDLAQGQKKRIQSVEWAL
                     YHLFRLWDPDEARNKLQPFFPPLDQVQSLNLRAALLRGLEQAKKNGVLGRDAVVRKTM
                     LDECKGERLEEVLAVFSSAVLKKVVAEQQLNGGGHPALAQTLALENRGYSGDRTELVA
                     LVIAHKASLRRMLDEKNTDRARFREFSDWLALKEETVARKREEAEAAKRSGRKKVVTD
                     EEKREVWGIVRNNWAGNERWMEALLYGDSKSHKDGVLATPYDRVWRRVQEGRLAELEG
                     TSAGLLERLEHRVQGQQARLEKWQGFRQRLFGKTGSEAATKGQKQEPKHKGIDLGFRE
                     HESLRLDRLSPRKLPRPSPKQLDSHYEALIEGLRSDLSKIGSTAPAIPAFFRRPPPLE
                     RPEPPTEDAEPESEVISDISELEEARPPPRPSPSRREPIKVSEEPAFEPVLRKAKTFD
                     DEHGFFEDEPLIPSRLQRSATVQPQSPSARRRQSQDSPTKSPERRFSSAPKATRRPSS
                     PPPPAPSPPRVVTPSPEPPPSPEQAVSPTQQLADQILAAVSAASPSPVKKPRHRLSLA
                     ERTRLSMARVTSHANLRVPEADEDGFDEAGGEAVPEADNGNRGALDRAPRPVVSSVAE
                     PSTAEREAGGYEDLVARTRRSLAGSEAARQKAQLERRRSLKRGMQSGGGAPSTPAAAG
                     RRSNYFRAVSEEEGNSTLQLAEELLNGGRENDYEAVFMSRPKLKTSPIGTPVREFWD"
     gene            3060570..3062635
                     /locus_tag="MYCTH_60294"
                     /db_xref="GeneID:11514591"
     mRNA            join(3060570..3061479,3061574..3062023,3062128..3062635)
                     /locus_tag="MYCTH_60294"
                     /product="glycoside hydrolase family 72 protein"
                     /note="Has EST support. RNA-Seq"
                     /transcript_id="XM_003666250.1"
                     /db_xref="GeneID:11514591"
     CDS             join(3060784..3061479,3061574..3062023,3062128..3062364)
                     /locus_tag="MYCTH_60294"
                     /note="CAZy_ID 267945"
                     /codon_start=1
                     /product="glycoside hydrolase family 72 protein"
                     /protein_id="XP_003666298.1"
                     /db_xref="GeneID:11514591"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="JGIDB:Spoth2_60294"
                     /translation="MRTAALLSAVGAATAVHGNPTATVRSKPRATELEPITVTGNAFF
                     KGNERFYIRGIDYQPGGAAANVDPLADPDICLKDIAKFKKLGVNVIRVYSTDNSLDHD
                     ECMNALADAGIYVVLDANNPLYSINREDPHGSYNTPYLQSVFATIDAFAKYSNTMAFF
                     SGNEVIHDLLNTTRTAPYVKATDRDMRRYIKARGYRKIPVGYSAADVTTNRMQTAHYF
                     NCGSDEERSDFFAFNDYSWCSTDFVTSGWNKKVEDFKGYGIPLFLSEYGCIDNPRDFG
                     EIESLMHRNMTGVYSGGLLYEYSMEPNNYGIVKIKGGQDNGGADQTGEREELPEFSAF
                     AAALKKWPAPTDDGGYTKTSKASECPTKDAHWDVESSVLPDTPEGALKFFEEGAGKGP
                     GLKGPGSQWAVDQASTSSGGKSSSGTSEDGESSSSSAAIRGSVPALDKAPFVISGVVL
                     LFTLVGAAAF"
     gene            complement(3122643..3124582)
                     /locus_tag="MYCTH_2310857"
                     /db_xref="GeneID:11514592"
     mRNA            complement(join(3122643..3123653,3123714..3124582))
                     /locus_tag="MYCTH_2310857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666251.1"
                     /db_xref="GeneID:11514592"
     CDS             complement(join(3122943..3123653,3123714..3124421))
                     /locus_tag="MYCTH_2310857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666299.1"
                     /db_xref="GeneID:11514592"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2310857"
                     /translation="MADDYRRGRLDPPRNNAEDLRYPPPEGEDRRRLPPVGPDGAALP
                     PISSYPTSGPSYQADPRYPDRSYTADPRYQSDPRSWQPEPPASNGYPPPPDARYPPQT
                     DARYPPQPDARYPPPIPPQHPRQFDDRRPYEDRRQYDDRRQYDDRRQYDDQRMYDDQR
                     QYGDRRPYPDPYYDAQQQPPARAGGYGPDYYRYPPPAPYSYGMPPPPPPPPPPPSQQQ
                     SAPRQRTSIACRYCRKRKIRCSGYAHTTNGKCANCDKLRIDCIFQPVSSNSSAAFVPV
                     SAVPGGVPPGTPLYGAYGQPLPPSAASAPQARAYPYPPSDHNTPPMHSPTGSYPPYDD
                     RDPGRRRTRPPEEEHSPRPPPPNFPADEDPRRRSPVSINSNGTPPTGYHTSYHQSSYD
                     PDQAPTASQNSPGRSMPPQPPLRAPQAGPSQTPPQPQSQLAPQPKGQPNPMSLDNLIG
                     PGPRGAVNDIDRNMLGRLNRRS"
     gene            <3128568..>3130353
                     /locus_tag="MYCTH_2113028"
                     /db_xref="GeneID:11514593"
     mRNA            join(<3128568..3128604,3128906..3129033,3129296..3129475,
                     3129593..3129917,3130151..>3130353)
                     /locus_tag="MYCTH_2113028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666252.1"
                     /db_xref="GeneID:11514593"
     CDS             join(3128568..3128604,3128906..3129033,3129296..3129475,
                     3129593..3129917,3130151..3130353)
                     /locus_tag="MYCTH_2113028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666300.1"
                     /db_xref="GeneID:11514593"
                     /db_xref="JGIDB:Spoth2_2113028"
                     /translation="MIHVNMTGASGPVTRKHSESTKTTAKEGQDVWFRRIAALIIDLS
                     GSQHARDRSSWPHAFPVASRSAEKPGRSQELASGIQRASPLAHESEDHQIASCSAAEY
                     GRGTSGDDAQHTYHASQNCATHNTCSMFRGREEWPDLKAIVDTVWFQLKRQGQLIAAT
                     ASLPKLLKPAVAGIRFGATRNLISPPPLPQPTLLYSTEYVACKCSREQWVAAAAATVV
                     LRAVCSGDEGTTLEPTANTPRKRPRSNPAFTTFMSHWIKTIGNESTPPAAGIDTREHT
                     EVDIQSTFPPRPGL"
     gene            3138890..3141119
                     /locus_tag="MYCTH_75151"
                     /db_xref="GeneID:11514594"
     mRNA            join(3138890..3139060,3139253..3139482,3139666..3139673,
                     3139796..3139849,3139969..3140001,3140108..3140338,
                     3140548..3141119)
                     /locus_tag="MYCTH_75151"
                     /product="methyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666253.1"
                     /db_xref="GeneID:11514594"
     CDS             join(3138972..3139060,3139253..3139482,3139666..3139673,
                     3139796..3139849,3139969..3140001,3140108..3140338,
                     3140548..3140739)
                     /locus_tag="MYCTH_75151"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003666301.1"
                     /db_xref="GeneID:11514594"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_75151"
                     /translation="MSAYAHHHHHHHGHKGTGASASSHNHEYFNKLAAEYDERHGKTL
                     DRLIEEIRARLDFIGVAWVDDDDDNNNGDGSAVDDATTRAKKSEGTLEKTVRLLDYAC
                     GTGVVSRALAPYTTQCVGIDLSENMVAAYNTRAENQGLTPSEMHAYHGNLCVPEDPNP
                     PAFASPEFTNFDVAAVGLGFHHFDDPALAARRLAERLKTGGVLMILDFLPHEKLDASH
                     PATQTITHHGFTEEHIRRIYEEAGVGKDFALQELAAVFHLSKENGEEVKRKIFIARGT
                     KA"
     gene            complement(<3141099..>3142518)
                     /locus_tag="MYCTH_98410"
                     /db_xref="GeneID:11514595"
     mRNA            complement(join(<3141099..3141136,3141222..3141289,
                     3141407..3141631,3141766..3142014,3142346..>3142518))
                     /locus_tag="MYCTH_98410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666254.1"
                     /db_xref="GeneID:11514595"
     CDS             complement(join(3141099..3141136,3141222..3141289,
                     3141407..3141631,3141766..3142014,3142346..3142518))
                     /locus_tag="MYCTH_98410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666302.1"
                     /db_xref="GeneID:11514595"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Spoth2_98410"
                     /translation="MSTPRVFIARHGETEWSLNGRHTGSTDIPLTSNGEKRVLATGKA
                     LVGNDRLIVPSKLARRAQRTLELLNVVYKDQLPWEAHGQTFCAGARCDAKVEVTEDIR
                     EWDYGEYEGITTPEIRQRRKEQGLNPDWDIWRDGCPGGESPAEITERLDRLIKEIREK
                     WHSPVMGEHKKGDAHGDVLIVAHGHILRAFAHRWTGQSLHGGPTFLLEAGGVGTLSYE
                     HQNIKEPAILLGGAFIVDIAGDEPDGGERTNG"
     gene            3143711..3144678
                     /locus_tag="MYCTH_2310866"
                     /db_xref="GeneID:11514596"
     mRNA            join(3143711..3144048,3144435..3144678)
                     /locus_tag="MYCTH_2310866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666255.1"
                     /db_xref="GeneID:11514596"
     CDS             join(3143791..3144048,3144435..3144605)
                     /locus_tag="MYCTH_2310866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666303.1"
                     /db_xref="GeneID:11514596"
                     /db_xref="JGIDB:Spoth2_2310866"
                     /translation="MPQLPPTARAAARSAAAAAAAAATRATVARGPSRAAFSSSSPRL
                     PADIVEQKLKVKRIIYTIGFAAVIITGTIYGAGLKTQQEWKASKQKLQEATVDEKVAM
                     LEAQKVDLLRQKEEIEGKLAELRARMRSGAGDGEGRQARG"
     gene            complement(3145065..3147106)
                     /locus_tag="MYCTH_2310867"
                     /db_xref="GeneID:11514597"
     mRNA            complement(join(3145065..3146817,3146878..3147106))
                     /locus_tag="MYCTH_2310867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666256.1"
                     /db_xref="GeneID:11514597"
     CDS             complement(join(3145169..3146817,3146878..3146893))
                     /locus_tag="MYCTH_2310867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666304.1"
                     /db_xref="GeneID:11514597"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Spoth2_2310867"
                     /translation="MATVNVVIKHQGKKYDVEVDTSSTGEVLKYQLYSLTGVEPDRQK
                     ILVKGGQLKDDADMSKLGLKPGQVIMMMGTPGEGGPQVVRPTEKIKFLEDMTEAEAAQ
                     QAGATPAGLVNLGNTCYLNATLQALRSIPELQEALAKHQHTSMSEVPQLDLTYQLKEL
                     FKEMSETQGGMTPFTFLNALRMAFPQFAERSKKGPGFAQQDAEEAWSQIVSQLRQKLK
                     WPSPTEGEIAGATSFVDKYMSGEFSSTLECDDPAAREGGEQPTSAKETFLKLNCHIDG
                     QTAHLRDGLLGGLTEKIEKRSEVLGRDVMYTKRSKISRLPKYLTVHFVRFFWKRDVQK
                     KAKIMRKVTFPHELDAVEFCTDELKKALIPVRDKVREVRKEEEDVERARKRRKRNPTL
                     DNGQGEEKKESAKKDGKKSAPSADGDVEMTETFKTDAEWEAEKDAALLEAKKELNALI
                     DPELRKDEGANKSGIYELRAVVTHQGASADSGHYTAYVKKTGPKDPVTGKVGKEDGNW
                     WWFNDDRVTEVTPDKIDALAGGGESHSALILLYKAIPLPTAEGILE"
     gene            3147247..3148540
                     /locus_tag="MYCTH_2310869"
                     /db_xref="GeneID:11514598"
     mRNA            join(3147247..3147391,3147486..3147812,3147870..3147995,
                     3148051..3148095,3148157..3148540)
                     /locus_tag="MYCTH_2310869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666257.1"
                     /db_xref="GeneID:11514598"
     CDS             join(3147389..3147391,3147486..3147812,3147870..3147995,
                     3148051..3148095,3148157..3148165)
                     /locus_tag="MYCTH_2310869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666305.1"
                     /db_xref="GeneID:11514598"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="JGIDB:Spoth2_2310869"
                     /translation="MSQSLRPYLQAVRSSLTAALCLSNFASQTAERHNVPEVEARTSP
                     EVLLTPLTIARNENERVLIEPSINSVRISIKIKQADEIEHILVHKFTRFLTQRAESFF
                     ILRRKPIKGYDISFLITNFHTEEMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFV
                     AESFLTPFD"
     gene            3151459..3153075
                     /locus_tag="MYCTH_2310870"
                     /db_xref="GeneID:11514599"
     mRNA            3151459..3153075
                     /locus_tag="MYCTH_2310870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666258.1"
                     /db_xref="GeneID:11514599"
     CDS             3151612..3152679
                     /locus_tag="MYCTH_2310870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666306.1"
                     /db_xref="GeneID:11514599"
                     /db_xref="JGIDB:Spoth2_2310870"
                     /translation="MERVSSKTQDCYVEFVSAQDAVRAVDRHRDNMQKGRPSRLGDRP
                     VEVQLSSQAALMKDLFPLAAGVWWDNAKPVILAPIDGQPWKTFKGFVTEEEMTMLVKH
                     VEIPQRVSSNLRLCVLAWHPQGKLNHNHADPPRFGCLQSPYSKECPQRPYECMISTIK
                     KLPWYMADHITLRQRHAIYDATVRLIVLLKQALQREHRSHETVINPQLMKRLVTAAML
                     CPGFSVVQKDNIAVLADMEDDRARTFNQPRFAEQWVHLHGICPRPGTPLDVLEWYIAI
                     IREETTRRVHRKHIVERSEIQRTACYTSLYFGYMWHEIGLPTGRELDNLTLRQVARCE
                     LAVIERILRRVFPAQEEYALN"
     gene            3154100..3155938
                     /locus_tag="MYCTH_2310873"
                     /db_xref="GeneID:11514600"
     mRNA            join(3154100..3154534,3154620..3155358,3155461..3155938)
                     /locus_tag="MYCTH_2310873"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666259.1"
                     /db_xref="GeneID:11514600"
     CDS             join(3154362..3154534,3154620..3155358,3155461..3155673)
                     /locus_tag="MYCTH_2310873"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666307.1"
                     /db_xref="GeneID:11514600"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2310873"
                     /translation="MVGGPEKSMSHMSHADAPLTQSREIGDINPESRQGDPIVNRAQS
                     ISFAKSWNHMLAGGIGGMTAATLTAPLDVLKTRLQSDFYQAQIKASRASIAAPMNPLR
                     TVAFHFNETMSILGAVYRQEGPRALFKGLGPNLVGVIPARSINFYTYGNGKRIIGDYF
                     DNKDSAWIHLSAGGLAGIVTSTATNPIWMVKTRLQLDKNMALESGGVTKRRYKNSLDC
                     IRQVLRDEGIRGLYKGMSASYLGVAESTMHWMLYEQIKRSLARREERITLSGRPKNWW
                     DHTVDWTGKFGAAGFSKFVAAVITYPHEVARTRLRQAPMADGRPKYTGLIQCFKLVFK
                     EEGMMGLYGGMTPHLLRTVPSAAIMFGMYEGILRLLNTPA"
     gene            complement(3156718..3158406)
                     /locus_tag="MYCTH_2084007"
                     /db_xref="GeneID:11514601"
     mRNA            complement(join(3156718..3157478,3157590..3157911,
                     3158141..3158406))
                     /locus_tag="MYCTH_2084007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666260.1"
                     /db_xref="GeneID:11514601"
     CDS             complement(join(3157450..3157478,3157590..3157911,
                     3158141..3158359))
                     /locus_tag="MYCTH_2084007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666308.1"
                     /db_xref="GeneID:11514601"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Spoth2_2084007"
                     /translation="MASQTDDANTQTAPADSKQQQTPASSSTSSATRSAAEAAAARLH
                     RPILQSLPESRPQSFDEIYGPPENFLEIEVRNPRTHGIGRHMYTDYEIVCRTNIPAFK
                     VRHSSVRRRYSDFEYFRDILERESARVTIPPLPGKVFTNRFSDDVIEGRRAGLEKFLK
                     IVVGHPLLQTGSKVLAAFVQDPNWDRNAW"
     gene            complement(3159148..3161092)
                     /locus_tag="MYCTH_2310878"
                     /db_xref="GeneID:11514602"
     mRNA            complement(join(3159148..3159550,3159632..3161092))
                     /locus_tag="MYCTH_2310878"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666261.1"
                     /db_xref="GeneID:11514602"
     CDS             complement(join(3159240..3159550,3159632..3160961))
                     /locus_tag="MYCTH_2310878"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666309.1"
                     /db_xref="GeneID:11514602"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="JGIDB:Spoth2_2310878"
                     /translation="MAVAATNGDAAADAAAALDNLKPPPGVIIPPPGEIREAIEKTAG
                     YVMRGGAGLEQRIRDNHGKNPKFSFLMSSSDPYNAYYEWRKEEIRNGRGTALSAGRVG
                     EAAAAPAQEKPAGPPKPPDFQFSARMPRMSQKDLEIVRLTALFVAKNGRPFMTQLAQR
                     EASNPQFQFLIPNHTFHNFFQSMIDQYTILLRESGVNGEGGKAQQERVDQLRQNVADK
                     YKVLARAKQRAAYAKWQEAEKAKQEEEEEKKKMEFARIDWNDFVVVETIVFTEADDQA
                     NLPPPTTLNDLQYASLEEKNKVSVSSTLRIEEAFPFEDTSYNAYPPQTYGAQAPATQP
                     PPAAPATAQANNAPPPPAQGAPVPLASRTKSAEEEKEEEAQKAQEKEQERTRVQQAQA
                     EARGGAAPMKIKENYVPRAAQRAASKFGTQTAMCPNCKQQIPLNEMDEHMRIELLDPR
                     WKEQKAKAEARYATTNLSTAEVANNLKRLASQRSDVFDTTTGQAVSEEELARRKKVAL
                     HAFDGNPDGKSQAHINQLQTFNLDEQIRAIHQKFADKK"
     gene            3161949..3166081
                     /locus_tag="MYCTH_2310881"
                     /db_xref="GeneID:11514603"
     mRNA            join(3161949..3162301,3162369..3162658,3162720..3163003,
                     3163059..3164525,3164750..3165212,3165286..3166081)
                     /locus_tag="MYCTH_2310881"
                     /product="glycosyltransferase family 39 protein"
                     /transcript_id="XM_003666262.1"
                     /db_xref="GeneID:11514603"
     CDS             join(3162042..3162301,3162369..3162658,3162720..3163003,
                     3163059..3164525,3164750..3165212,3165286..3165440)
                     /locus_tag="MYCTH_2310881"
                     /note="CAZy_ID 267790"
                     /codon_start=1
                     /product="glycosyltransferase family 39 protein"
                     /protein_id="XP_003666310.1"
                     /db_xref="GeneID:11514603"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR003608"
                     /db_xref="JGIDB:Spoth2_2310881"
                     /translation="MARSASSKPPAARASPPPAPSSIDEKLNSNATKRKDDDYSSEGV
                     EDHDVFLLPGSDFKLVLAITLLAAAVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFM
                     DVHPPLAKLMITLFGWLAGFKGNFDFKDIGKDYVEPGVPYVAMRMFPAICGILLAPTM
                     FLTLKAAGCRTFTAVMGAGLIIFENGLLTQARLILLDSPLMIATAFTVLSFTSFTNQQ
                     ELGPSRAFGLSWWFWLVMTGLGLGMTVSIKWVGLFTIAWVGSLTLVQLWVLLGDYKHV
                     TIRIFAKHFMARVFCLIIIPLTFYLAMFGIHFLCLRNPGDGDGFMSSEFQSTLNSKAM
                     KNVPADVLLGSRITIRHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDDNNLWLVENQ
                     TQPLDINGQPINGTDAWYKLPEPHYVENGAIIRLNHLATHRRLHSHDVRPPITEADWQ
                     NEVSAYGYEGFDGDANDFFRVEIVKKKSKPGVAQERLRTIDTKFRLIHIMTGCVLFSH
                     KVKLPEWASEQQEVTCARGGTLPNSLWYIEYNDHPMLGPDAETVNYRNPGFFGKFWEL
                     QKVMWKTNAGLVESHAWDSRPPSWPILRRGINFWGKDHRQIYLIGNPVIWWSATAAVV
                     VYVVFKGIAVLRWQRSCNDYSKPVFKRFDYEVGSSVLGWALHYFPFFLMQRQLFLHHY
                     FPALYFGIIAFCQIYDFVTARIPGIGLRENPVIGKAGAVGFLILSMIAFTLLSPLAYG
                     NPWTRAECRRVKLFSTWDWDCNTFLDSYDAYKTLSSTSAAASQTPQQPIDAKKVPPAQ
                     PPVAGGQQAQVPIVDAQQQQEQQQQAQEEKAKVSGAPVAGNKRLVHTEERVEYRDQDG
                     NLLNEEQVKALKGKVEFKTRYETRTRIIDAQGNEVLLPPGQQVPLDQEQKPDAPAGVA
                     PPHPDVEGANSETAKGGIPDEPIPEPKESVEGEREREEKAAKPASEKQEASAKVDDEV
                     "
     gene            complement(3167337..3167915)
                     /locus_tag="MYCTH_2310887"
                     /db_xref="GeneID:11514604"
     mRNA            complement(3167337..3167915)
                     /locus_tag="MYCTH_2310887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666263.1"
                     /db_xref="GeneID:11514604"
     CDS             complement(3167552..3167728)
                     /locus_tag="MYCTH_2310887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666311.1"
                     /db_xref="GeneID:11514604"
                     /db_xref="JGIDB