GenomeNet

Database: RefSeq
Entry: NC_016478
LinkDB: NC_016478
Original site: NC_016478 
LOCUS       NC_016478            4116359 bp    DNA     linear   CON 27-NOV-2019
DEFINITION  Thermothelomyces thermophilus ATCC 42464 chromosome 7, complete
            sequence.
ACCESSION   NC_016478
VERSION     NC_016478.1
DBLINK      BioProject: PRJNA79339
            BioSample: SAMN00739435
            Assembly: GCF_000226095.1
KEYWORDS    RefSeq.
SOURCE      Thermothelomyces thermophilus ATCC 42464
  ORGANISM  Thermothelomyces thermophilus ATCC 42464
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothelomyces.
REFERENCE   1  (bases 1 to 4116359)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4116359)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 4116359)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 4116359)
  AUTHORS   Tsang,A., Huntemann,M., Han,J., Chen,A., Kyrpides,N.,
            Mavromatis,K., Markowitz,V., Palaniappan,K., Ivanova,N.,
            Schaumberg,A., Pati,A., Liolios,K., Nordberg,H.P., Cantor,M.N.,
            Hua,S.X. and Woyke,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003008.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043098
            The DNA was provided by Adrian Tsang (tsang@gene.concordia.ca)
            The strain is available from the American Type Culture Collection
            under ATCC 42464
            Contacts: Adrian Tsang (tsang@gene.concordia.ca)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376)
            
            Proteins in region determined to be rRNA/ITS were removed by
            database staff.
            
            ##Metadata-START##
            Organism Display Name :: Myceliophthora thermophila ATCC 42464
            GOLD Stamp ID         :: Gi01755
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Myceliophthora thermophila V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 7.66x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4116359
                     /organism="Thermothelomyces thermophilus ATCC 42464"
                     /mol_type="genomic DNA"
                     /strain="ATCC 42464"
                     /culture_collection="ATCC:42464"
                     /db_xref="taxon:573729"
                     /chromosome="7"
     gene            <4054..>7800
                     /locus_tag="MYCTH_2071684"
                     /db_xref="GeneID:11510120"
     mRNA            join(<4054..6507,6586..6894,6955..7289,7350..>7800)
                     /locus_tag="MYCTH_2071684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666455.1"
                     /db_xref="GeneID:11510120"
     CDS             join(4054..6507,6586..6894,6955..7289,7350..7800)
                     /locus_tag="MYCTH_2071684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666503.1"
                     /db_xref="GeneID:11510120"
                     /db_xref="InterPro:IPR007855"
                     /db_xref="JGIDB:Spoth2_2071684"
                     /translation="MEVFLRNLPVHLADRGLEKQLQPFMEQLSIKEYLVEKQRKTTTG
                     RITFRHEAEGAEFLRHYGEEPIHPTRSQAFQLRKPKHPPTQARLELMGRKVYCKPSDR
                     KPDEIVLKAIEHEASQRAYDEADAEKPTKTLQATELSCGHHAFTHGRLTFNAEWTVIE
                     PCHVKFARRYLIITLTRCKVQLRILYQSIVELLWRQNGSATVILYWAPTILELEHTGY
                     ELISSFLHNRKSAPSRQRLDAIDRDHARISPYCLVYHFLVPVPITGHVMNDFEVEMLR
                     LTREELFPVTRYEFGFQQAAELPFADAAARLQNQLDQHHRANSLPFDLLFLLQALMTN
                     GYLHPTTISALAQRLIQRFEAARKTGGPPPVSVDAFKKLFDWIDYPSPYGNPDMFEVD
                     GIMAYLEESESLVREGASPRARIFEETQDRTRIFRVVVTPTSVLLHGPELEPMNRVLR
                     KFPNHSYFIRAQFCDEAGNDLFFNSKVSLDRIYNRFKSILSDGIQIAGRVYKLLGFSH
                     SSLRAHSAWLSAPFFHQNQRHGPDFIIETLGDFNDIRSPARRAARIGQAFSETPWALD
                     LDEYGIQVSRIPDVERNGRVFSDGIGTISHDALSAVYKVIPKSKGFPTCLQIRWAGAK
                     GMLALDPLLEGRRICIRDSMIKFASNDKQLEICDMASRPMPMVLNRQLIKILEDMKAP
                     DEWFLNLQSTELQRLRGISATVYNTASFIRMQKVAESIKLHDFLRQTEAMGIDYRQDS
                     FLRGAVEIILLRELRLLKHKSRIPVREGITLFGVMDETGFLKEGQVYVTFDTEEGRYA
                     QPPEPGPLLVTRSPALHPGDWGSRDLPSQLSGGDLDGDVFHVIWDPEVVGALTTYQPA
                     DYGRTTPPELNRPVTLADIASFFVDFMKTDQLGVIAIRHMILADQKEDGTRDQNCIAL
                     AELHSSAWRPDFLAPGPSITVHDKSNISLDDHVVQEDSDSEDEEGQPRYGYYKSERII
                     GQLYRAVDERKIWSKDIKMIIKPRGPSFWDEMLAALKQRVSEIGPVEWRHRSNQALGI
                     LHAYEDAIHGVMVDLADQPHQPLTELEVFVGYIINKRGGVQTPRQRDRSVKLKDEFER
                     IATWITHEMRNPPSVRGYTSELDALELCLACLCIGCEKRSRDTRPRLRSSARNLESFK
                     VVAAATLIQELSALQKRRGIKEYLHDGGEILAARFQ"
     gene            8818..10449
                     /locus_tag="MYCTH_2311252"
                     /db_xref="GeneID:11506491"
     mRNA            join(8818..9609,9723..10449)
                     /locus_tag="MYCTH_2311252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666456.1"
                     /db_xref="GeneID:11506491"
     CDS             join(8973..9609,9723..10291)
                     /locus_tag="MYCTH_2311252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666504.1"
                     /db_xref="GeneID:11506491"
                     /db_xref="JGIDB:Spoth2_2311252"
                     /translation="MPPFRAEHMGSLLRPQKLLEVRAAIREKGLNPDEAGLPAIEEEA
                     VANIVKLQQELGFKAVTSGEYPRTRFWGLMWHEFEGTVRLEDANEELFRLYHPDVCSL
                     VSVSRKVMPGESVITGSKLRHNPEKSWSNLHELRLVQKFVPQSEWANIKLTMITPAWF
                     HMRYKQGRAYTKEAYANDAEYFKDVAKVYQAELDQLYKAGLRNVQFDDPGLAYFCSDK
                     FRQGWAEDPDNIGTVDDLLDAYIELYNDCLSKLPADFHTGVHLCRGNFIRGKFFAEGG
                     YDVIAQKLFQKLKVNTFYLEYDTERAGGFEPLKFLPKDKNVVIGAISTKVRELEDKEE
                     VKRRIYQAADFVAEGSNQTREEALKRISVSPQCGFSTHESGYPLTEEDEKKKLALIRQ
                     IADEIWGEP"
     gene            10832..12941
                     /locus_tag="MYCTH_2311253"
                     /db_xref="GeneID:11506492"
     mRNA            10832..12941
                     /locus_tag="MYCTH_2311253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666457.1"
                     /db_xref="GeneID:11506492"
     CDS             11069..12697
                     /locus_tag="MYCTH_2311253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666505.1"
                     /db_xref="GeneID:11506492"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_2311253"
                     /translation="MAGNGPGMLYVTMQPREGLSLDQFHEWYNNEHGPTRLRLPHIFT
                     NGLRYRATDGQQPHFLAVYDVTSMAHLETPIYTDLRANRSQREAATIGQVDVDRKFLD
                     LVATQQSPLFTPIEQLTDDEAEGLVLVSVEVSLRPGVEGAEAAVARWYQEEHIPMLSR
                     IPGWLRSRVFRTPSVIEGPPGEVRIATLHEYAKENGLGGPEHKAAMSTAWREQVFTHY
                     IAHKTRRTYELFYVFGPAPRELHALSRLPPTAAFATADGKISTTPGEKDAAIDAFVTT
                     TDGLTIPYRLEGNPSPEAPTVAFSNSLLTSMHMWDPLVAILKAARPDLRILRYDTRGR
                     HDVPSPPVPANLDMLSDDLAALLRALRIPKLHALIGVSMGGATTLKFALKYPALLDRF
                     IACDFNVASSDKNTTAWKERIAVAEGPDGGIRKLAGQTVERWFHPHTMTAKKDVANWM
                     TDMVAANSVQGFRYSCQALWDYDLREEMRGAKVPGLLVVGEGDGKGALVKAMEGFKDL
                     LGPSGAELKIVPQAGHLPMSESPSEFWNEIAGFL"
     gene            complement(14425..15579)
                     /locus_tag="MYCTH_2311254"
                     /db_xref="GeneID:11506493"
     mRNA            complement(join(14425..14835,14928..15579))
                     /locus_tag="MYCTH_2311254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666458.1"
                     /db_xref="GeneID:11506493"
     CDS             complement(join(14734..14835,14928..15437))
                     /locus_tag="MYCTH_2311254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666506.1"
                     /db_xref="GeneID:11506493"
                     /db_xref="JGIDB:Spoth2_2311254"
                     /translation="MHSGFVSLFAFAGLAAQASAHGIVTKPATRSPGEATEAACGKTM
                     ADFYRADNTSYPEALLRANPDGLKPPYDPEKCNLWLCKGYQFADNIANVQNYTVGQVV
                     DMEVWIRIPHEGYANVSIVDTSRNSVIGEPLIAWPEGYAGSANPPKDQTKFSVKLPDL
                     GDKCTKPSACVIQWYWFGQGQTYESCVDFTLATPAKRRRYRKY"
     gene            complement(<24661..>26448)
                     /locus_tag="MYCTH_97137"
                     /db_xref="GeneID:11506494"
     mRNA            complement(join(<24661..24718,24787..24917,25027..25273,
                     25370..25582,25658..25794,25882..>26448))
                     /locus_tag="MYCTH_97137"
                     /product="glycoside hydrolase family 7 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666459.1"
                     /db_xref="GeneID:11506494"
     CDS             complement(join(24661..24718,24787..24917,25027..25273,
                     25370..25582,25658..25794,25882..26448))
                     /locus_tag="MYCTH_97137"
                     /EC_number="3.2.1.91"
                     /note="CAZy_ID 267981"
                     /codon_start=1
                     /product="glycoside hydrolase family 7 protein"
                     /protein_id="XP_003666507.1"
                     /db_xref="GeneID:11506494"
                     /db_xref="InterPro:IPR001722"
                     /db_xref="JGIDB:Spoth2_97137"
                     /translation="MKQYLQYLAATLPLVGLATAQQAGNLQTETHPRLTWSKCTAPGS
                     CQQVNGEVVIDSNWRWVHDENAQNCYDGNQWTNACSSATDCAENCALEGADYQGTYGA
                     STSGNALTLTFVTKHEYGTNIGSRLYLMNGANKYQMFTLKGNELAFDVDLSAVECGLN
                     SALYFVAMEEDGGVSSYPTNTAGAKFGTGYCDAQCARDLKFVGGKGNIEGWKPSTNDA
                     NAGVGPYGGCCAEIDVWESNKYAFAFTPHGCENPKYHVCETTNCGGTYSEDRFAGDCD
                     ANGCDYNPYRMGNQDFYGPGLTVDTSKKFTVVSQFEENKLTQFFVQDGKKIEIPGPKV
                     EGIDADSAAITPELCSALFKAFDDRDRFSEVGGFDAINTALSTPMVLVMSIWDDHYAN
                     MLWLDSSYPPEKAGQPGGDRGPCPQDSGVPADVEAQYPNAKVIWSNIRFGPIGSTVNV
                     "
     gene            complement(28444..30741)
                     /locus_tag="MYCTH_2311258"
                     /db_xref="GeneID:11506495"
     mRNA            complement(join(28444..30090,30173..30741))
                     /locus_tag="MYCTH_2311258"
                     /product="GMC oxidoreductase-like protein"
                     /transcript_id="XM_003666460.1"
                     /db_xref="GeneID:11506495"
     CDS             complement(join(28611..30090,30173..30675))
                     /locus_tag="MYCTH_2311258"
                     /codon_start=1
                     /product="GMC oxidoreductase-like protein"
                     /protein_id="XP_003666508.1"
                     /db_xref="GeneID:11506495"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Spoth2_2311258"
                     /translation="MMFRWLLIGLGVLAHKGCAGSESDDKYYDYIVVGSGPGGGPLAS
                     NLARAGYSVLLLEAGSDQSNNTNSEIVSLFGVAYTDPTLRWDFFAFNFANETRNLQHN
                     HLTWRRPDGSFYVGRDPPPNSTLLGIYYPRGGTLGGSSAVNAMSTIYPSESDWQNIVD
                     LTGDTTWSPEHMREIFERIEKNHYLTPGAPGHGFNGYLDTIMSTETSWAGQNDLLAVL
                     GAISGHLGQSPSDIATNVLADPNGPIPERDQTEGIFGSPLHADAAWRRFSSRDYILET
                     ARAVGPDGQKQYQLTVQLETLATKVLFADVDDPQKKPRANGVEFLQGQSVYSADPRHT
                     ASNQGTTGRAYARKEVILSGGTFNSPQLLKLSGIGPASELAQFDIDVVVDLPGVGANL
                     QDNYEVPVVGHAARDFQQPAPDPDAPTCTYGAPGDPCVELWKQGRGPYTVGPPLDSIF
                     RKSAHAAYDERDFFLVGGTFALRGFWPPTDSVPADPPNTFGLSTVKINPQSRSGTVLL
                     RSADPRDTPEINFHLFEEDNAGTELDLNAELDTVKWARRAFADVPAPLGPIIPVEPPC
                     PGTPAADGTCDDEADREWIKNQIFGHHPTSTCAIGADSDPLAVLDSKFRVRGVRGLRV
                     VDASAFPRVPGPFPVLPIFMLSEKATESVLEDAEEW"
     gene            complement(31445..33898)
                     /locus_tag="MYCTH_2311259"
                     /db_xref="GeneID:11506496"
     mRNA            complement(join(31445..31867,31960..33103,33192..33898))
                     /locus_tag="MYCTH_2311259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666461.1"
                     /db_xref="GeneID:11506496"
     CDS             complement(join(31569..31867,31960..33103,33192..33506))
                     /locus_tag="MYCTH_2311259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666509.1"
                     /db_xref="GeneID:11506496"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2311259"
                     /translation="MGTELGRPTGARTTATGGPLVAENEHSNSSTPAETLDLIAPPST
                     SDEKENGNFASDELSPPDAAAAAEDEKQAAKAETTEYPTGFRLVSIILALIMGIFLAS
                     LDMTIVATAIPKITDEFHGLDKVSWYSAAFLMTDGGFQSCWGKAYRYFPLKSTFLAAI
                     AVFELGSLICAVSPNSTAFIVGRAVNGLGAAGIGTGAYTIVAFVAEPAKRATYTGFVG
                     MSFGVACVVGPLIGGVFADKVTWRWCFWINLPIGGLSALIIVCFFRTPSAAQPVAAPW
                     REKLLQMDPVGVVLVMGAIVAFMLSLQYGGQTAPWNSSVVIGLLVGFVLITVAFILWE
                     HFQGERAVIVPRLLRQRAICISCLFACIFVGSYYLVIYYIPIYFQSIGNARPTMSGVY
                     NLPLIIATTICMITSGMLISATGLAVPIEVGGAVLAVIAAGLLYTLDIDTGVGKWVGY
                     QLLAGIGWGLAFQIPIIAGQASAQPEDISSVTAMVLFFQCIGGSAFVTAAQAAFVNRL
                     VHTLPITAPDVDPAKVVATGATMIRMVFSDNQVPGIVIAYMAGIKAALAISIGGAGLG
                     LVICLFSKWTRLNFAAVAV"
     gene            35097..37684
                     /locus_tag="MYCTH_2311261"
                     /db_xref="GeneID:11506497"
     mRNA            join(35097..35965,36082..36684,36776..37684)
                     /locus_tag="MYCTH_2311261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666462.1"
                     /db_xref="GeneID:11506497"
     CDS             join(35434..35965,36082..36684,36776..37548)
                     /locus_tag="MYCTH_2311261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666510.1"
                     /db_xref="GeneID:11506497"
                     /db_xref="JGIDB:Spoth2_2311261"
                     /translation="MTEKFPDVDEDTDITRKSISIEEENGYFGPNDAETSGASPAGLP
                     PEDAVPRTPATEQPPSRAVVEDAPFLPLSRHQSAIRLRRLRGPALPSQADPAGSVGQE
                     SLRGRRRSSSEPQRPAIPAATALGALPTVAEAPPPRARNRRSASVNLPARPPLPQGQA
                     LDSDCYDSKIVDFLDVVDPEVATLSSITNIQNSLFVPSLGRWVNRRPTYELTQFPQTP
                     GAFLGPEEDMRAAESTAAGQSTSEPRSPNLASVLSQPQYAILPNDASLEGWPEEDIKA
                     LNNYVRHMLHSRRSKIKQRLKAFGKYIRRPLGFLVTLYATLITLFGLAWVLFLIGWIY
                     VGHRQYFAIQVIDYTLVALFGIVGDGLAPFRAINTYHMIFVAHYHRKTWKLRKKLLLP
                     ELQDSNDLPTASSNEQSDRDLEDQPQQGYKKKDEFFPVLSEKEQSRLVHHQTKLAKSH
                     TFYKPHETETHHAFPLRFLIAVVLLLDLHSCLQISLGICTWAVSAHRLSAAVTTTILC
                     CSIATNIVAGTLITIGDRRTRKRDVLERLLKQDLTGEVMKKMRKKKEKEAVKEGAKRE
                     SMDGAAKPGRSSLTAHLRIATRTDKNRKSNENGACSHGPEASQSITGADSEDQLRHDR
                     SRAQGAPPGSW"
     gene            complement(<38631..>39311)
                     /locus_tag="MYCTH_2130416"
                     /db_xref="GeneID:11506498"
     mRNA            complement(<38631..>39311)
                     /locus_tag="MYCTH_2130416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666463.1"
                     /db_xref="GeneID:11506498"
     CDS             complement(38631..39311)
                     /locus_tag="MYCTH_2130416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666511.1"
                     /db_xref="GeneID:11506498"
                     /db_xref="InterPro:IPR012506"
                     /db_xref="JGIDB:Spoth2_2130416"
                     /translation="MSSSRVLSTANPALLTGSVGAAVLYLAMARSRPSRRRMIVKTAS
                     TALLSAMAAVQGGPLLLVAALALGSLGDAFLAWDDDASFLLGLASFLVAHLLYIVVFF
                     QNNTNITEGPWALLRSWRAPAAGSLILLVSVMITILVPRIDQGLRPPVVLYSLTILVM
                     ALTALTVDSSRVVAGSLMFSGSDAILAADRFLVSPASSHRAWMQPAVWVLYYFGQLQI
                     ALGLLPLP"
     gene            43544..46020
                     /locus_tag="MYCTH_2311263"
                     /db_xref="GeneID:11506499"
     mRNA            join(43544..44454,44615..45392,45488..46020)
                     /locus_tag="MYCTH_2311263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666464.1"
                     /db_xref="GeneID:11506499"
     CDS             join(43831..44454,44615..45392,45488..45711)
                     /locus_tag="MYCTH_2311263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666512.1"
                     /db_xref="GeneID:11506499"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2311263"
                     /translation="MSAQPEARLPSAVEVPGIGAGHESSSDDGDVLLESMGYKAELVR
                     TRSTWHIAFMSFVLASIPYGLATTLYYPLQGGGPAVVVWGWLLVSLIVLCVAASLGEI
                     TSVYPTAGGVYYQTFMLAPAKFRRVAAYICGWAYVVGNITITLAVQFGTTLFFVACVN
                     VFEKPGVDGEPVGVWAGETYQVFLTFLAITLLCNVVSIFGNRWLHLLDTFAIFWTFAG
                     LLAILITVLAVAKEGRHSADFALGGFEVTSGWPAGWSFCVGLLHAAYATSSTGMVISM
                     CEEVQRPATQVPKAMVITIVINTIGGLLFLVPLMFVLPDLAMLIALPSGQPVPTIIKS
                     AVGSSGGAIALLLPLMVLAILCGIACTTAASRCTWAFARDGAIPGSKWWKQVHPTLDL
                     PLNAMMLSMVIQILLGVIYFGSYAAFNAFSGVGVISLTVSYAAPIAVSMLEGRAHVKG
                     AKFSLGRMGWLCNGIALAWSILAVPLFCMPAYIPVTAASVNYAPVVFVGFVVIACAWY
                     AAWGRRNYRGPPTESLGEDPMPAGQGAGSSKKD"
     gene            complement(46500..47857)
                     /locus_tag="MYCTH_2311264"
                     /db_xref="GeneID:11506500"
     mRNA            complement(46500..47857)
                     /locus_tag="MYCTH_2311264"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666465.1"
                     /db_xref="GeneID:11506500"
     CDS             complement(46890..47615)
                     /locus_tag="MYCTH_2311264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666513.1"
                     /db_xref="GeneID:11506500"
                     /db_xref="JGIDB:Spoth2_2311264"
                     /translation="MFRILFSLHLIIVSLLLSSFTRALPSSGGYIGGENRWYPRRILG
                     GISVVDTPIVRAADAFAKRHAQDFVYKHVMRSWLFGALVVQHNETLRATVDPEVHAVA
                     ALLHDLGWDQTEGSPFVSPDRRFEVDGAIAARDFLRAHEDGKRWEERRVQLVWDSIAL
                     HTEGSIALFKELGVQVVYNGIMLDFQGPKFGVTEDEYAAVVKEFPRDDLMQGTNETFI
                     WLCRTKPATTYGECITGFGSYPL"
     gene            complement(48256..49205)
                     /locus_tag="MYCTH_2311266"
                     /db_xref="GeneID:11506501"
     mRNA            complement(join(48256..48754,48864..49205))
                     /locus_tag="MYCTH_2311266"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666466.1"
                     /db_xref="GeneID:11506501"
     CDS             complement(join(48346..48754,48864..48895))
                     /locus_tag="MYCTH_2311266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666514.1"
                     /db_xref="GeneID:11506501"
                     /db_xref="JGIDB:Spoth2_2311266"
                     /translation="MKSLALAVAFFFSEDEPGITVTTPTPSLPTAPACASVTATRELC
                     TTCAVPACLALSTITQSCGCPTPVPTIYLDFPCGSGCDNIWCSTSYAIVTAAGCVTDG
                     PSPTSGSSLTTSAPNATKTTHSPTISSSVSTGAANRPRVPFLLW"
     gene            complement(49206..49809)
                     /locus_tag="MYCTH_2311268"
                     /db_xref="GeneID:11506502"
     mRNA            complement(join(49206..49642,49710..49809))
                     /locus_tag="MYCTH_2311268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666467.1"
                     /db_xref="GeneID:11506502"
     CDS             complement(join(49384..49642,49710..49726))
                     /locus_tag="MYCTH_2311268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666515.1"
                     /db_xref="GeneID:11506502"
                     /db_xref="JGIDB:Spoth2_2311268"
                     /translation="MFVLNMSFRLANAVGENRVLLVGFDITTRYRSGISIWRRPFHYL
                     VSAFIMWTYPRVIEQKYPSDILWLPWPGSRRSEALSSPLVTGKAVAA"
     gene            complement(<93627..>93791)
                     /locus_tag="MYCTH_2072527"
                     /db_xref="GeneID:11506503"
     mRNA            complement(<93627..>93791)
                     /locus_tag="MYCTH_2072527"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666468.1"
                     /db_xref="GeneID:11506503"
     CDS             complement(93627..>93791)
                     /locus_tag="MYCTH_2072527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666516.1"
                     /db_xref="GeneID:11506503"
                     /db_xref="JGIDB:Spoth2_2072527"
                     /translation="NTNIKLEVTLLDKLYNFANLFNKEKASRLPLYYNIAEHYIKLKE
                     GLDRKIPKLL"
     gene            complement(<126626..>127124)
                     /locus_tag="MYCTH_2113210"
                     /db_xref="GeneID:11506504"
     mRNA            complement(join(<126626..126924,127022..>127124))
                     /locus_tag="MYCTH_2113210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666469.1"
                     /db_xref="GeneID:11506504"
     CDS             complement(join(126626..126924,127022..127124))
                     /locus_tag="MYCTH_2113210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666517.1"
                     /db_xref="GeneID:11506504"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Spoth2_2113210"
                     /translation="MAPTHGMVERPLPANPARLSVTQSTRTGLDTAGDTTVPSPASNT
                     IGGITPHAGIDVSVKLAGDDSRSQPPASPKPCPRHLLTLPPEILLMILQALDFADIVR
                     LRETCMQLRALASPQQVRVLFGPDRLHSQPL"
     gene            complement(<128704..>130707)
                     /locus_tag="MYCTH_2070870"
                     /db_xref="GeneID:11506505"
     mRNA            complement(join(<128704..129629,129774..129994,
                     130130..>130707))
                     /locus_tag="MYCTH_2070870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666470.1"
                     /db_xref="GeneID:11506505"
     CDS             complement(join(128704..129629,129774..129994,
                     130130..130707))
                     /locus_tag="MYCTH_2070870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666518.1"
                     /db_xref="GeneID:11506505"
                     /db_xref="JGIDB:Spoth2_2070870"
                     /translation="MSDSCDEGFWRRASGPDDSMIYQVCDLVLQQAFAIPLHEIVLAG
                     SAPMVYESVGHCLDELSRIVLQSGLGDTHLGASRSTLGTADSGGDPVWPGRGADDGFD
                     TSNGNGDCHANGNSGRKRSNGYEHDGDGLGGGSGGGSPDGGGKRQKVLPTHQRPATAE
                     FSCPFRKRNPVRFNVRDFQSCAVMSFPNMSQLKRAMKSKMALEEHISVSRDQICDPQE
                     APSRADPEDGITSGIEEVLNERKTDGKIDDWKSLWRLLFPGDAKIPEPDFVPPTELDE
                     VYAQFYTDDSTSLLWQRIQEVLGHTGNIQPMFDAFKNYIDTVFEACRLKTCGMSYSRR
                     RARIQAARQVASGRSPVRHAPRPHGSGHSDHSILALAASSDRTNVPESLGQPSMTETQ
                     PHILGNVPPNNSSHDRGIDGAGTTVPELRFGGGGTAAVQGSEPVMVATPAPRLHIQLE
                     SGCQGQRMAGTSRGHLDQSTRLAQTNLWADLSAIFAGRGAIDASAVLPLGSQGAHSHP
                     EAYGQQMGDAYWPAITLDIAADNHGGQGRRFSTTDAGAVSEGDDAFQGMSEANDDGYE
                     VVHHTRGD"
     gene            <169284..>169553
                     /locus_tag="MYCTH_2072459"
                     /db_xref="GeneID:11506506"
     mRNA            <169284..>169553
                     /locus_tag="MYCTH_2072459"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666471.1"
                     /db_xref="GeneID:11506506"
     CDS             <169284..169553
                     /locus_tag="MYCTH_2072459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666519.1"
                     /db_xref="GeneID:11506506"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Spoth2_2072459"
                     /translation="KSNVTYYNYGKKGHYKRECRSPKKEWKIVPRKEITVINEITKNV
                     IEVAAIGYEDRGSNIDSLGYNSNNKDEQAPYSKLVTIDLEIGLAK"
     gene            178746..180379
                     /locus_tag="MYCTH_112700"
                     /db_xref="GeneID:11506399"
     mRNA            join(178746..179053,179394..179525,179652..180379)
                     /locus_tag="MYCTH_112700"
                     /product="histone H2A like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666472.1"
                     /db_xref="GeneID:11506399"
     CDS             join(178943..179053,179394..179525,179652..179840)
                     /locus_tag="MYCTH_112700"
                     /codon_start=1
                     /product="histone H2A like protein"
                     /protein_id="XP_003666520.1"
                     /db_xref="GeneID:11506399"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Spoth2_112700"
                     /translation="MAGGKGKSSGGKSSGGKTSGVEGPKKQQSHSARAGLQFPCGRVK
                     RFLKQNTQNKMRVGAKAAVYVTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIR
                     GDEELDTLIRATIAFGGVLPHINRALLLKVEQKKKAKAPEA"
     gene            complement(<215354..>215932)
                     /locus_tag="MYCTH_15682"
                     /db_xref="GeneID:11506400"
     mRNA            complement(join(<215354..215602,215696..>215932))
                     /locus_tag="MYCTH_15682"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666473.1"
                     /db_xref="GeneID:11506400"
     CDS             complement(join(<215354..215602,215696..>215932))
                     /locus_tag="MYCTH_15682"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666521.1"
                     /db_xref="GeneID:11506400"
                     /db_xref="JGIDB:Spoth2_15682"
                     /translation="PPPLIPYPWTWACHKCGSKYPLAATRRCLGCSHYLCTPTTLEKS
                     QPETRRQKQKGRDSSYCSTEFDYTGWAVWGSYRRFRGSDDGTIDHDTFATWGLVNTES
                     RSGNDCDSRSAAWQPLSRATVKQVRRRKENMYVSGQYSCSLHCDFPSECLHSLHRAFV
                     KR"
     gene            <217020..>217817
                     /locus_tag="MYCTH_97124"
                     /db_xref="GeneID:11506401"
     mRNA            join(<217020..217294,217640..>217817)
                     /locus_tag="MYCTH_97124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666474.1"
                     /db_xref="GeneID:11506401"
     CDS             join(217020..217294,217640..217817)
                     /locus_tag="MYCTH_97124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666522.1"
                     /db_xref="GeneID:11506401"
                     /db_xref="JGIDB:Spoth2_97124"
                     /translation="MQDLILLVFNLGILTRVLTLMFTNVSAPGCAELGCTSFADIIGI
                     LLAIFGGIFMMLGYGRTRECGTDDCDALRSYPAGPARDTASFLLYAASGHETTTPPVS
                     VPTRPYGTPFDTTNNLVAVKAITVWVDSGHGNYGKGTGLSPFRSSRLL"
     gene            218770..219533
                     /locus_tag="MYCTH_2311272"
                     /db_xref="GeneID:11506402"
     mRNA            218770..219533
                     /locus_tag="MYCTH_2311272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666475.1"
                     /db_xref="GeneID:11506402"
     CDS             219003..219458
                     /locus_tag="MYCTH_2311272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666523.1"
                     /db_xref="GeneID:11506402"
                     /db_xref="JGIDB:Spoth2_2311272"
                     /translation="MASPPPEVAERIRHKKVQYTRFADTKQWSKFDTIFVPDATFKFV
                     DEDGKVVTTPDGAVPYEWTSRESWVAFFEAAFASLQVIHLVGPGEFELVGPGEVKAVF
                     TVIYHDAPKGKGTGPRETGGGHYYETWVRQGGDWFCKDLFMQRIYHHVV"
     gene            complement(219615..221294)
                     /locus_tag="MYCTH_112699"
                     /db_xref="GeneID:11506403"
     mRNA            complement(219615..221294)
                     /locus_tag="MYCTH_112699"
                     /product="acyltransferase"
                     /transcript_id="XM_003666476.1"
                     /db_xref="GeneID:11506403"
     CDS             complement(219718..221166)
                     /locus_tag="MYCTH_112699"
                     /codon_start=1
                     /product="acyltransferase"
                     /protein_id="XP_003666524.1"
                     /db_xref="GeneID:11506403"
                     /db_xref="InterPro:IPR003480"
                     /db_xref="JGIDB:Spoth2_112699"
                     /translation="MPRTDVYQLRPFGWENDPEEERFKVTTLDYLTACTYNNYALFFR
                     LDDADKEKAAATLKEGLERTLSQARHYVGTIEKDPGGGHSFVKKKDSTVRFIVQWLDA
                     PEDAAKYPSIDDIERTNYSAVTLGDLDTWSVPPMTYGEKAEAHPDNRPVVSAFKANFV
                     RGGLVFNMHHHHYANDVMGWAGFTHQLAENCRAALTKTAFPAWDPACLDLSRLTKKEV
                     PEEVKVDGPAPAERHPDHKVGQSLLFHLPKSKAAELKKLAAPDDGSWISTYDAFSAFI
                     WRTLTRLRVPVFKPDPASHIFWAEAVDMRRRMHSPKVHPRIQHNVMYAALSNTAPVPQ
                     LTVDDILHAPLSKLASYIRQLTNSVTQENLDKTLDAVAMVRDKTSLNIRIDSHPPMSI
                     LQTDHRDANIVSADFGFATPLTYRHLLDRVTEGVIIIYPPRNNNPDSNEGPEFSIAYE
                     KRLAQDLINDAEFKKYFEYRGIDAEDAGKVGA"
     gene            224099..225869
                     /locus_tag="MYCTH_2311275"
                     /db_xref="GeneID:11506404"
     mRNA            join(224099..224157,224247..224354,224442..224836,
                     224924..225869)
                     /locus_tag="MYCTH_2311275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666477.1"
                     /db_xref="GeneID:11506404"
     CDS             join(224140..224157,224247..224354,224442..224836,
                     224924..225470)
                     /locus_tag="MYCTH_2311275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666525.1"
                     /db_xref="GeneID:11506404"
                     /db_xref="JGIDB:Spoth2_2311275"
                     /translation="MVILAYGAFCGAVNSTFAFVDTPGYFVHQWDIRLRDLIPTSYHV
                     LVFGVCYSFVLPLLKVAILIDWCRMFVPHGSSTRNAFWWGCVVISFVQIGAAVATIIA
                     LNLQCIPHQAIWDFTIPNAKCFKLYHLQVSSATIQLVSDVAIFLLPQRVIWKLKMSWR
                     KRMGVSVIFGLGLLACVSAAFRLATTIAYGEALDAIYALGPLVFWATAEMACGFFIVC
                     IPCLPKILQQTGVLRKMKKALGMSTGPTANSAQAGYHTGGKSGNRSRGPKVTSSSAQD
                     SYYKLEEDGMAMKDLKSESTEHLREDQQGGKLGAPRGAAAITRTTHIMVTEDQRSTSD
                     GGSNPDMNMYNQQKAPWGGYR"
     gene            <227627..>228476
                     /locus_tag="MYCTH_97120"
                     /db_xref="GeneID:11506483"
     mRNA            join(<227627..227658,227700..227755,227861..227962,
                     228169..>228476)
                     /locus_tag="MYCTH_97120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666478.1"
                     /db_xref="GeneID:11506483"
     CDS             join(227627..227658,227700..227755,227861..227962,
                     228169..228476)
                     /locus_tag="MYCTH_97120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666526.1"
                     /db_xref="GeneID:11506483"
                     /db_xref="JGIDB:Spoth2_97120"
                     /translation="MAGGSRKSMTKRVLPQKPTLGIYVRVRVRSLWPKWMAGDGLWKE
                     QNPGSLGTYCAAFPRDAPVVTNVRNTDQQGQDNGTRNPRSIDGPHRPTEKERICRYQE
                     ADYDRIDMLGARLGPGQWKRVSDRPRHPITARKGSDTADRVKSTGERMLEGDNARAST
                     PPPGF"
     gene            <228752..237561
                     /locus_tag="MYCTH_85595"
                     /db_xref="GeneID:11506484"
     mRNA            join(<228752..228934,229017..229164,229220..229491,
                     229571..229913,229987..230077,230153..230223,
                     230302..230387,230464..231076,231176..231326,
                     231437..232410,232510..236168,236259..237561)
                     /locus_tag="MYCTH_85595"
                     /product="polyketide synthase"
                     /transcript_id="XM_003666479.1"
                     /db_xref="GeneID:11506484"
     CDS             join(228752..228934,229017..229164,229220..229491,
                     229571..229913,229987..230077,230153..230223,
                     230302..230387,230464..231076,231176..231326,
                     231437..232410,232510..236168,236259..237440)
                     /locus_tag="MYCTH_85595"
                     /codon_start=1
                     /product="polyketide synthase"
                     /protein_id="XP_003666527.1"
                     /db_xref="GeneID:11506484"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Spoth2_85595"
                     /translation="MDEAKYSGRVGDQPDDIAIVGYAFRLPQDVDDDFTFWDVLQKRR
                     NLRTDWPASRINADAFKFHHGKGAHFINEDLAAFDAPFFSLTAKEAAAMDPMQRWTLE
                     TSYRAFENAGMPAEALRGSRTAVFSASMLEDYARMTAMDPDNTERTAVTGSTVACVIP
                     NRVSWYFDLRGPSIHVNTACSSALSAVDMACKNLQAGDSSCALVTGANLLLDPGVFQV
                     LSNGGFLSPDGVCHSFDHHANGYARGEGFVALVLKPVTAAVRDGDVVRAVIRAVGSNQ
                     DGNTPVLTQPSAQAQEDLIRHVYARAALPFDQTRYVEAHGTGTRVGDPIEVRAIGRVF
                     RDFRSAEEPMFVGSVKANVGHLEGASALASIVKAILILEKGIIPGQPLLEKLNPDIDA
                     DMHHIMVPLEDTVWPSPGLRRISVNSFGFGGSNSHAILDDALHYMQERGLRGNHCTVS
                     DPLVSNNTDVQARAVNGVNGEATRFPKLLVWSAADEGALNRMIQAYESYYEDRVAGDP
                     SQLDRLAFTLAARRSRMLWRAFSIVNDGAETTSLTRPSKATRSSAEVGLAWVFTGQGA
                     QYAHMGYDLCRYSVFRRTLEQVDGIYRGLGAEWSLFDELRSSENIDKPEYSQPLTTAV
                     QVALVELLRSFGVSPKAVVGHSSGEVAAAYAIGALSLPSACKVAFFRGLLAGKLRAAS
                     ACTPQAMISVNLSEAQVPDYLSKTELSTENALSSVCVACVNSPLNCTLSGPEAAIDAI
                     KAQADRDGIFAQKLRTAVAYHSPSMLAIAGEYLTLMGHLEGAAASKVSGGITMMSSVT
                     GKEVRPTELAKPQYWVSNMVSTVRFSDAVRALLDKFDSTITDLVEVGPHPALRRPARD
                     TVGKEQQIRYAGVLDRSRPATETMLELVGQLFSLGHAVSIPSVNHEKAKPAPRPLVDC
                     PAYPFDHSHRYWAESRLSRDFRLRGTVQGETLGMRASDWNPLAPRWRNFLSVESSPWL
                     GHHKVSAGMLIMAIEAAQQQTAHGDRTVMGYQLEQANFLNPIIVPEAWEDRIETQVQL
                     QPARKKENSFDVSIFSYSSRGGQWSECFHARITVEYQGEGAEGEHKRVADEAARTRQA
                     DAERRCRLPLDPEVFYRDASEHGLQYGDWFQLLREIRWDGRKTAVARVDLSRQRYRSE
                     SLVHPALLDTAFHVLRASAGQQPAANVPVRLEKAWFSATGWQHPGNGELRWLATSSRA
                     IRDTDRPNRLGEDGTLQALAADGTVLCTIKTAVTAPVSKTAEGEKGNKEKKLLYSMEW
                     KPQLSLLEPEQLARVCHVHFSARDETAIVSNHAKLCAALDLAAVRTLKHMDRSKIPKN
                     HLLRHVDWMEHHVATLPAARRQEGETISDADLETRLREVEEVLPAWKLYTACARQLGS
                     ILAGEADPLQVVFESELANVFYANLFLNLCADGRLAAFLELASHENPAMRILEVGAGT
                     GGMTGHVLNALQAREARTGAPSFAEYRYTDISPVFFERARNRWPDLHQQGRMTFQALD
                     LDRPVDTQGLEAGSYDMIIAASVLHATPYLEATLRNVRTALKPGGRLVLVEVINPADV
                     ATNFMAGLVPGWWVAQEEWRPHSAAITEPMWDKLLRANGFSGNDMLLRDYESEECHIM
                     SVIVSTAREPAKMQNGVSESESDKPKRRVVLVVDETPSDQQMQLAGLVGGLLGPGSGS
                     GWQTPTVCPFARDELSRALTGLTEDDVVICLVEVDNRPLLANLSEQSYACLQQLVKGA
                     PRLLWATAPSAADDPLAAHYGAVQGFLRSIRAEQSSSRLVSVAIEDCSDDATCADLIA
                     RAFRAAFEPSPPLGVASKEVEYVVRDGLLMTGRAVENVAGNEALRSLLQPHTQKVAWA
                     DAPALQLPMHTSGNDELLSFVQDITHDPEAEIGPDEVEMEAKAWSLSQDSLDNVVATR
                     ISDDDSLGTDERMPRSGTGCAGIITRVGRNVDKSLLRPGQRVCMLLPPGEGMRKYTRA
                     HHTAVTKLPPAGNLSFEIGAASLVPAMTAYHALIDVARLRPGMTVLIHHAAGATAQMA
                     VRMARAHGASRVLATASSPKEKQFVLDTLGLPAEDIFLARPAAAFASGVRAATQGAGV
                     DVVFNNAFLGDDALLASCECLARGGCFVEAGRANLDSGTALPMSVFAKNISLSAAHLS
                     DLSHDAVAGLAARVMELLDQGSVQPPQPLRVFDVSQANEAVKHVKTTEALGECVVIRP
                     RDQDMVSYHEKEERNWMFDQRGSYLIAGGSGGLGRAIVRWMADRGAKHIIIASRSGAT
                     SEAARDLLADLGARGVNVVAMQCDVSSESSLAGMLEECTRRSMPPIRGCINAAMVLQD
                     AIFQDSMTFAQWDLTMRSKVQSSYNLHRLLPQELDFFVLLSSLAGVVGQMGSANYAAG
                     CAFQDALARHRLAHGQRGLSLDIGWMKNIGIIAETSAYQRQRQRLEDMQPIDAGELLA
                     VLTLALDPALPLPMPLHAQPGQLLFGLRTPADLLAQGRAVPALLERPLFAAFSHHSTS
                     VTAESSPSSVNASAPDDSVLFRQAAVGSRERSMIVRRALASKLARAMLIAPEDVEPTK
                     PLSAYGVDSLMAVELRNWFGKEFGANVAVFDIMGGVPIAKIAETVAAKSTLK"
     gene            238925..241390
                     /locus_tag="MYCTH_2311279"
                     /db_xref="GeneID:11506485"
     mRNA            join(238925..239472,239548..240145,240206..241045,
                     241108..241390)
                     /locus_tag="MYCTH_2311279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666480.1"
                     /db_xref="GeneID:11506485"
     CDS             join(239110..239472,239548..240145,240206..241045,
                     241108..241163)
                     /locus_tag="MYCTH_2311279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666528.1"
                     /db_xref="GeneID:11506485"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="JGIDB:Spoth2_2311279"
                     /translation="MNQQPDLYFPAYAMSASNRSPRSSRPGYNTTTGHPGINRLEQRQ
                     MDPASQAPTGLFSTDDRFGSYDSNAFRHNRLQPSPGFAADNFVGNSQAWAYNSGASTV
                     TGALGEGRLRAGARRALPQEWTMPEQPGLGSQSLPPVPSSQYPTVGSFNPSMGLMNGD
                     GGFHPERHGYTSNMYDPRPEPKTLGSDLIPTAIVIKNIPFNVRKEMLTSIMSELGLPQ
                     PYAFNYHFDNGIFRGLAFANFQSPIDTQTVIEQLNGYEVQGRKLRVEYKKMLPEHERE
                     RIEREKREKRGQLEEQHQPLPLHSQSSMHSLNAAQTSRSRNSPLRDVDLNNPDTLSFY
                     TELMLFKNDPNREIIVFPSTITPQQRRTVHILAHNMGLEHRSVGEGQHRQIHVLKDTG
                     AAPAIHMPPGVSADAHRRGLSRAATIDFAETRSNAPGQYNTLGRQGRHGPTLEIPDSP
                     DGGLNALRGVKSFADLRSYTPSPSLSTASGYPQGSSVHAPNVAQYGEYSASLGQPSAL
                     TTPTTPGTASNNDPSMLINELGSLNLNEGPFNGNRLRPRETPGAIGSQRPGLNGTSTR
                     SVPERQPHGPGSEWGEKIGFGGRGRTNGHMQRSSDSSDNGVRTTPSSASRFQ"
     gene            complement(242790..244276)
                     /locus_tag="MYCTH_2311282"
                     /db_xref="GeneID:11506486"
     mRNA            complement(242790..244276)
                     /locus_tag="MYCTH_2311282"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666481.1"
                     /db_xref="GeneID:11506486"
     CDS             complement(242911..244014)
                     /locus_tag="MYCTH_2311282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666529.1"
                     /db_xref="GeneID:11506486"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="JGIDB:Spoth2_2311282"
                     /translation="MMDNCYRRELETATAAIQTAAQISREVLAAAAARGDQAASGTFD
                     VVKDDLSPVTVADFAIQALLRRALGNAFPADGFVGEESADELRQNRRLLSRVLAVLAQ
                     CGASALFRDADDLCDAIDSCTTLTPGAAGPTRIWVFDPIDGTKTYIRHEQYAINVALL
                     EAGRQVVSVVACPLLSVDATAPVTDRSVDPTGKGCILYAVRGHGAHIRPLFGDAGAVQ
                     PRQLPRHADEATSPDHLRSVTCWALLDSGVDSVHERVAEQLKVPFPGCDLLGWVPRWA
                     VMAMGAANMTVWVYRKRDRYAKIWDHAGAMLLFEEVGGMITDVHGKEIDLTAGRKLKA
                     NFGFVAAPRSLHPLVLRAVHDVLKTSGKHELLQ"
     gene            <247199..>248720
                     /locus_tag="MYCTH_2071628"
                     /db_xref="GeneID:11506487"
     mRNA            join(<247199..247615,247858..248054,248145..248360,
                     248431..248609,248677..>248720)
                     /locus_tag="MYCTH_2071628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666482.1"
                     /db_xref="GeneID:11506487"
     CDS             join(247199..247615,247858..248054,248145..248360,
                     248431..248609,248677..248720)
                     /locus_tag="MYCTH_2071628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666530.1"
                     /db_xref="GeneID:11506487"
                     /db_xref="JGIDB:Spoth2_2071628"
                     /translation="MHQWASLAAAAALLANGAVAQFNMLRFACSQLVVDRVDPLVNPG
                     MRYTPHLHQIVGGNSFNLTMTPVEYDLAKRSTCTSCSFKQDKSNYWTAVMFFKHKNGS
                     YHRVPQVGNGGPQGQLINNGGLDVYYIPSGRVTAFAPGFRMLAGEAANTDDSKVPRGN
                     ICHRCWTSTNENQFVGGAPCTGSDTVGIPQDPSCKMIRQTIIFPACWDGQNLDTPDHK
                     SHVAYGKGSGATGGGSCPSTHPVKLPQVMYEIMWDVSAFADRSMWPESGPAFIYSMNL
                     GGSAAHGDYLFGWEGDTLQRAMDNGCNLNADCPSAGLTAQKPEEYNACTIQQQAPEPV
                     DGWLASMPMGEMAVRA"
     gene            complement(250361..254346)
                     /locus_tag="MYCTH_2311285"
                     /db_xref="GeneID:11506488"
     mRNA            complement(250361..254346)
                     /locus_tag="MYCTH_2311285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666483.1"
                     /db_xref="GeneID:11506488"
     CDS             complement(250438..253605)
                     /locus_tag="MYCTH_2311285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666531.1"
                     /db_xref="GeneID:11506488"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="JGIDB:Spoth2_2311285"
                     /translation="MPRSSQGTPRPRPRKPPMTRRASSNAQGPHRGGVFSVDDGIAEV
                     EADAAVRQQSYATSLRRRAGAPPALARIHSRQDEDDDDDDDDELEDEDDDAANKRPDD
                     RVPEASSGIEDDTGGGALEANLPDDTMPVDDDGNISDAESFTLKDRQQAINQTHPFGI
                     RLWKPALYKKSRSVQKNAEGDIHSSPGGHVSTWLLLFNILWTLAFGWWMALIAFTGAA
                     ICFLFAAAPGGLEYGRVLWGLAGYLFYPFGKFVRLEQQEAYLDEDQGEGRSISEYEQW
                     QSGDLEYGRLFFGPDRNRSIVGRSRRSLDSEPDETESLLGRSRGQVFDDHLPRMKRRL
                     FGRGEWNLGRVVFFAFFYFLITPSLFAVSAICWFLVFTIPMGKVTMLLFSHLRRHPLA
                     LSFESDIASARAPAAPHSSILVCTYRAVGRKYWKYTVDGTNIFLINLMAIVSFVIFDW
                     LVLDGLLHMQNFLTSPAFLFISGLLSIIPLAYFIGQAVASISAQSSMGLGAAINAFFS
                     TVVEVFLYCVALRQGKAQLVEGSIVGSIFAGILFLPGLSMCFGAIKRKTQRFNSKSAG
                     VTSTMLLFGVIGAFSPTLFYQIYGTHELTCQDCLNFGTPGAGGGVLRDCRRCYFSQTP
                     ALSDRFYIEVVRPYCYLAAGTLFMSYVIGLWFTLRTHAAVIWNAEIEEKKHEEHHMPH
                     QTPRPLGNPSTGEASATDIRDSHLYKRILGQSLRQVGQSPLPDDETRQDTPLLGGGAN
                     STPHVVPPKPAGYGTTEATGPTISIPGLTEAQNSNLVHQVAEIAATAATVAARNVQGH
                     RRGPPGVISTAAHHPTSGGHSGTARGGAFIPGQDDGAGPTGAQADSHGGHDAPNWSRL
                     KSSIILMGATVLYAVIAEILVDTVDVVLESFDIDEKFLGITLFALVPNTTEFLNAISF
                     AMNGNIALSMEIGSAYALQVCLLQVPALVLFSAVNPQRIPAEDVARYTFSLLFPQWDM
                     VTVILCVFLLSYMYGEGKSNYFKGSILLLSYMVVIVGFYSSGFGTSLDDPEKGVSRFD
                     TLGTDGQWTSYNFKTIGRGLSGPAY"
     gene            255578..257484
                     /locus_tag="MYCTH_2084256"
                     /db_xref="GeneID:11506489"
     mRNA            join(255578..255981,256055..257484)
                     /locus_tag="MYCTH_2084256"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666484.1"
                     /db_xref="GeneID:11506489"
     CDS             join(255747..255981,256055..256989)
                     /locus_tag="MYCTH_2084256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666532.1"
                     /db_xref="GeneID:11506489"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2084256"
                     /translation="MALDNYYHNKIEAMQLEILKGQAVLRRLEAQRNDYNSRVRLLRE
                     ELGLLQQPGSYVGEVVKVMSTKKVLVKVHPEGKYVVDVADSVDVSKLTVGKRVTLLSD
                     SYKLEKILPSSVDPLVSLMMVEKVPDSTYDMIGGLDQQIKEIKEVIELGLKHPELFES
                     LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCKFIRVSGSELVQKYIGEGSRMVRELF
                     VMAREHAPSIIFMDEIDSIGSSRVEGSSGGDSEVQRTMLELLNQLDGFEPTKNIKVIM
                     ATNRLDILDPALLRPGRIDRKIEFPPPSVEARADILRIHSRKMNLTRGINLTKIAEKM
                     NGCSGAELKGVCTEAGMYALRERRVHVTQEDFELATAKILNKHDDKEVSLAKLWR"
     gene            complement(258767..261147)
                     /locus_tag="MYCTH_2311288"
                     /db_xref="GeneID:11506490"
     mRNA            complement(258767..261147)
                     /locus_tag="MYCTH_2311288"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666485.1"
                     /db_xref="GeneID:11506490"
     CDS             complement(258861..260831)
                     /locus_tag="MYCTH_2311288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666533.1"
                     /db_xref="GeneID:11506490"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="JGIDB:Spoth2_2311288"
                     /translation="MTTPGPVPAVSPRGLAQALSGSQSYMNAKPATSPLSPPRLPTSA
                     GQPYPPKLSPGTARGVTQDGRAPSPNYFGLAVDSNGGPRDSCLVPREHWSSPSSLVKS
                     FAAAIPKQLPLDANPEFEAFRRQIDANHARATFSLSASHFGASAGSSQTPLASTPPTL
                     QRPRPSKWHTQGGDGSDISILRPSRLATASFASADGSGDKRSKEPENVQRDSAYVSAD
                     SKRSSAVSLNRPSLPTMDSRDFSPPTAQSPVASPNRVAISSNISSAMGRLSPQPVASS
                     RANSERPSPLTKTESTITPQTPGNGGPSMITPAQLRDLLEEEGDEQILLLDLRVSAQF
                     AQSRVRGALNLCIPTTLLKRATFNLQKLQQTFQGDHNQEKFSRWRDARHLVVYDAASF
                     DQRDASSAVHMIKKFTNEGYSGPASILRGGFNAFAAAYPGLIDRSSGGPSPGLSLGGG
                     LASGSSRANLPSVIGGVLLPNTNEIANPFFNNIRQNQDLVDGVGQMDVNVPSGLAPAS
                     LPRWLREAAESEDHGKRVSDKFLHIERTEQLRMREAYSVAKPADAREGSETKNTKVQL
                     SGIEKGGKNRYKDILPFEHARVKLLGRPEGACDYVNASHLQAKRSYKRYIASQGPLPA
                     TFEVSIRNLPTPGIGAFPSERPLISSRRTFGL"
     gene            complement(263372..264327)
                     /locus_tag="MYCTH_2311289"
                     /db_xref="GeneID:11506507"
     mRNA            complement(join(263372..264067,264156..264327))
                     /locus_tag="MYCTH_2311289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666486.1"
                     /db_xref="GeneID:11506507"
     CDS             complement(join(263608..264067,264156..264172))
                     /locus_tag="MYCTH_2311289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666534.1"
                     /db_xref="GeneID:11506507"
                     /db_xref="JGIDB:Spoth2_2311289"
                     /translation="MFCLRSWLPLLFIPTNASPAFIFLFFLCTYFLNRPCFYCSFLLL
                     ILFLTSCNWSDRCFLDVGSNWFQPNLAASHIYLPQSGMGGEVTSNIEASENLHATVSA
                     VVGEMLKTTAGALATTVTEQATRAKVEWTGLGLEWLRSLLGRREWRIDCLDLYIRL"
     gene            <264649..271444
                     /locus_tag="MYCTH_109377"
                     /db_xref="GeneID:11506508"
     mRNA            join(<264649..264690,264725..264866,265009..265051,
                     265169..265253,265624..270753,270816..271444)
                     /locus_tag="MYCTH_109377"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666487.1"
                     /db_xref="GeneID:11506508"
     CDS             join(264649..264690,264725..264866,265009..265051,
                     265169..265253,265624..270753,270816..271028)
                     /locus_tag="MYCTH_109377"
                     /note="Contains conserved domain WD40[cd00200], WD40
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666535.1"
                     /db_xref="GeneID:11506508"
                     /db_xref="JGIDB:Spoth2_109377"
                     /translation="MTILCCTCVMFLCKRLPRLSLPEAEPHITTKCRSDLTRVTQGAF
                     RSCSPGSSSDVQVYECAAWCYFDISKLEGERRIKSRIATDIPPLHPNNRHIATRFGLG
                     PSANGPGKSTPAAISLLSDEQQRHEADFSFLLLIRISGLWAVIGGLQTLVFHYPYPSA
                     GSPIAVTYPSSSVGDLRDFFSGNQPATVTAAIEAVLICIDPQPRSSQRPLVMSSYGMP
                     GGGGSGESEANPKFESLLAQLRLQSSPSPGPGTGSGPDYSGQFNYHHGHQSFYAHHSN
                     SDSPNLPGHAQEPMDSPAFLPEAPTPPVAFSHSQFPPGILNQMAAARGGAAAGGDGRT
                     AHLLNLLKFSGQGSSANPHQSASHEPPKSFASAPIASPVIHAPAPAAADPTGLLAALM
                     KGNLQPEPPKHEPSSLLWNRASPPSDTQQYLLNLLNRPKPSQRDTEEPAESNLLTPPP
                     ATDDPKDNESSHGGRSAEPTLVGTLASRSEFDFETKNIESPPPKFDSTPHSQLSQQSG
                     LRQPGVFGHSDHFGNLPAASPAHHTPKSSTTPGASGSTTGSGHAPPVPTQNLKKPDSA
                     QPSHDENRPLSDHGAIGSTEQDRPKPEHPTSPPQQSNISWPSNNSSAVSNAVGIPPST
                     AAGAEQGHSEETKESVADAVSGLAQQVDREATEALTRAEQEQAKVEPNHSSEHTAITE
                     KHEEYPKPSQSVYSAAEDKSPKEELSLKEDTAFFNSSLAQDFAQGHRDSGDDSAQAAQ
                     GPVADSWESAEAEEVVVGEETAAPVKVFNFPMKPWITISLQEIDDSRPVFREEAILDI
                     ARLKKDFDQIDRNLVSASETYMAYGMSKAGGLRVIRQEDGKDAKLFTDTKDRIFNVAI
                     STSPSHQHPQEAIIGTGVSGTVYWVQLKTGDRDHLEDAHPEQYGFALPPISTQEGGDA
                     PGGVLKTRARPSAMRPEFFAVGRGKSINIIWPAFIFENDLFKNGHDRVVDTEKLLKQC
                     SLKINTGKAGKDFIFSQDDTLVVSLDKSGRVKFWDVRDLTAIKEGSDPLHPMPARTSL
                     EIKEPLMTLTTTPEGEKAWPTSVLLLDKFRPYQKRAALRYMIVGMKQNHTLQLWDLAL
                     GKPVQEFNFPHNKESDAVCSVMYHAPTSMIVVGHPTRNSIYFLHLSAPKYTLKNLSQV
                     DYIQRLVAQDSSIPQPESTAVISGIREYSFANKGVLRSLNILENPAASGDGEEPTLFE
                     LYAMHSKGVTCLFIKQSELGWTKDNKVLAPVDAVEVGLAKISKLVAPPQPQPPDAHHV
                     SGSGETAATPQIRIATRGGKDTMTKTASPQGDDKKGSDSTSPPKFERKEDVEIPGPAP
                     EKTEKKGRKKKAAAAAAAAAAAAAAAGDQSVSNGAVEVNRAISQGKAKKDARNADSPA
                     DAASSKPANDLAFTSTAFQEQLDAVVGKMESRIVSNLSGRFDAVFNDIFKQMQKFQDN
                     RDSAFASNQSALLQMVADVLNNNTEAVLKNLIIAQINNNVIPSVHSAIDKSVSEQLNA
                     KSITQVNVMQKEIQKLLPSAVNQAMQKPEVIRSISDKISHSINGQVEAQIAKSLHALA
                     PTIAKTTAQNVHQRIMEDVRIRISEAFEQLDQRRRAEDAKLDRLIAQTQDLSNAISSL
                     TASQTQLQQELAALKQHIHSQSRERTSVAEEHGRGHPHSHSASGSHGLSSVESRELVN
                     YPSQQQHQSPASHQQPVQAPFSHPHQHQHQFGNQEGQMAFAPLGREDRQKMELDNLIE
                     TIDGLMRSGNYDEAMLRWLHSGDKAEEIFQQVLSNYNPIFVRDLQPLILLSVGATVSV
                     DLNRNSQRLMKKVNLLEVVIYAFNQNLGALDDQVREVTPKIMNILKTRIEQLFLEISR
                     IAPHDPALKTLSNMSQVAGRVAETVQMRHGPMHAPGHVGVPY"
     gene            complement(<366856..>367410)
                     /locus_tag="MYCTH_2072228"
                     /db_xref="GeneID:11506509"
     mRNA            complement(join(<366856..366942,367201..>367410))
                     /locus_tag="MYCTH_2072228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666488.1"
                     /db_xref="GeneID:11506509"
     CDS             complement(join(366856..366942,367201..>367410))
                     /locus_tag="MYCTH_2072228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666536.1"
                     /db_xref="GeneID:11506509"
                     /db_xref="JGIDB:Spoth2_2072228"
                     /translation="VPPLDLYLNKRLADFEAKLDQPLLQTRAGPGASRVPTRALIQQA
                     CNRLSQRFRKRRARAKGREPKPTALEAYIGAISLYNFLFRVQVPGVSTPYYTYS"
     gene            complement(<385883..>388659)
                     /locus_tag="MYCTH_2071661"
                     /db_xref="GeneID:11506510"
     mRNA            complement(join(<385883..386660,386785..387019,
                     387117..387232,387389..388461,388600..>388659))
                     /locus_tag="MYCTH_2071661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666489.1"
                     /db_xref="GeneID:11506510"
     CDS             complement(join(385883..386660,386785..387019,
                     387117..387232,387389..388461,388600..388659))
                     /locus_tag="MYCTH_2071661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666537.1"
                     /db_xref="GeneID:11506510"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2071661"
                     /translation="MPRQHLTPNACLVCRRKRTKCDGQLPCRRCRSRGEECVYEDKKW
                     RTKDHLRSEIERLRTEQRQGQALLRALTNNDPCRWRTVLDRMTAGDPPEAIAEWILAQ
                     PSARLAGSSGRPPPLGFADGQDGKPSRGGPDALITTLGSGLAENSRTSRHPGPLVADT
                     LRPQSAASTRPERTRRFSFDPGPSIFPPGIYTPPAEAPRRLHFPPPDSSPDPIPHTWT
                     KVTSDRCLVQRLLARFFGSSLPYLSIVSQRHFMNDFRQGNPRFCSEALVNAVLGLACV
                     AATPISQPVSRVGFGDAFLAEAKRLLAREEELPSLPYIQALGVLAVAEMTRGNEEVAG
                     DLAREFARAGIRFLLQTRQQEHGHDDDFKTVRALAYCGGLSLVRLLRLLTGDLEPKTG
                     PLFMRIYPDFRDVEDDTPEARVERGISLQVQFFAELQHCPPLARFIFEVTEAAHTFSS
                     YNHSKAMTASDLEGAFGKCTGYYRQVAELSASDADGVGPDVLLARIWYNFCLLSLLQP
                     FVANSASLVDGLPPSLTGHSTPYIVCRQSSEAIISLTSIYQSRYSLDYLPPLLPYMVF
                     AAVLHQRSLAAPQLTAGEVTQEGVVLSPEPRSPDAVSDPSYSLSDRRQSMSQPGACLG
                     PAARPSTYGREPPSPAVVAATETPRSAGHKASAFPTPPTCLSSENQACRSGAYRAGSN
                     APPSDTGQHLSLAHPNAQSGALPTFTSQPADLVALGSLQLFSMGAQHRGAAEASHLLR
                     TSGSTLDIVESGS"
     gene            390184..391046
                     /locus_tag="MYCTH_2311295"
                     /db_xref="GeneID:11506511"
     mRNA            join(390184..390352,390463..390478,390603..390782,
                     390855..391046)
                     /locus_tag="MYCTH_2311295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666490.1"
                     /db_xref="GeneID:11506511"
     CDS             join(390310..390352,390463..390478,390603..390782,
                     390855..390888)
                     /locus_tag="MYCTH_2311295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666538.1"
                     /db_xref="GeneID:11506511"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="JGIDB:Spoth2_2311295"
                     /translation="MQPTRCLLRRSVWKGPHIVPLPIVRPEPGKKVPPIRTQARSATI
                     LPNFVGLKFQVHNGKVYHDVTITEEMVGHKLGEFSPTRKPFIWNKK"
     gene            complement(391476..392339)
                     /locus_tag="MYCTH_2311297"
                     /db_xref="GeneID:11506512"
     mRNA            complement(join(391476..392016,392076..392339))
                     /locus_tag="MYCTH_2311297"
                     /product="TAF10-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666491.1"
                     /db_xref="GeneID:11506512"
     CDS             complement(join(391609..392016,392076..392273))
                     /locus_tag="MYCTH_2311297"
                     /note="102] Contains conserved domain COG5162[COG5162],
                     Transcription initiation factor TFIID, subunit TAF10 (also
                     component of histone acetyltransferase SAGA)"
                     /codon_start=1
                     /product="TAF10-like protein"
                     /protein_id="XP_003666539.1"
                     /db_xref="GeneID:11506512"
                     /db_xref="InterPro:IPR003923"
                     /db_xref="JGIDB:Spoth2_2311297"
                     /translation="MASNQPTENTEQAAAPVAHANGMQTSETSGVAANLPTPTIPEPR
                     LPTRKDASLKEFLNKMDDYAPIIPDAVTNYYMTRAGLPPPPQTDQRLARLLALATQKF
                     IADIAADAYQYSRIRASNTSANNPMGNLGAAAGFPIPGQPAGQPGSKEQGRGGPLGIQ
                     RPGYGGGGQGGSQNRTVLTMEDLGMAVGEFGVNVKRSEFYR"
     gene            complement(392471..395160)
                     /locus_tag="MYCTH_2311298"
                     /db_xref="GeneID:11506513"
     mRNA            complement(join(392471..393666,393725..394957,
                     395043..395160))
                     /locus_tag="MYCTH_2311298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666492.1"
                     /db_xref="GeneID:11506513"
     CDS             complement(join(392747..393666,393725..394957,
                     395043..395058))
                     /locus_tag="MYCTH_2311298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666540.1"
                     /db_xref="GeneID:11506513"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="JGIDB:Spoth2_2311298"
                     /translation="MPQNYDPDTIRILVSTDNHVGFEERDPIRKDDSWRTFDEIMQLA
                     RTRDVDMVLLGGDLFHDNKPSRKSMYQVMRSLRKNCLGMKPCELEFLSDAAEVFEGAF
                     PHVNYQDPDINISIPVFSIHGNHDDPSGDGHFCSLDLLQVAGLVNYFGRVPEADNIHV
                     KPILLQKGKTKLALYGLSNVRDERMHRTFRDNKVRFYRPAQQKSDFFNLLALHQNHYA
                     HTQTSYLPENMLPDFLDLVIWGHEHECLIDPQRNAETGFYVMQPGSSVATSLVPGEAV
                     TKHVAILSISGKSFEVEKIPLKTVRPFITREITLATDKRFKGLEKKQDNRQDITKRLM
                     LIVEEMIAEANAKWRSIHSEDEIPEDEEEQPLPLIRLKVEYTAPEGSKFEVENPQRFS
                     NRFAGKVANQNDVVYFYRKKTGTSRKAKDVSTFPAGVAEALESVDTIKVDTLVQEFFA
                     QQSLKILPQAPFGDAVNQFVSKDDKHAVEMFVIESLSSQVKGLLQLDDDKITEGLDAH
                     IDDFRKIMEKSFISGQQRQAQRRKRFKEKPLDWDSDLDGHWTAQPGAIEEVPASPEPA
                     MEGSGAMPAPNAAFSDNNDELPDDDEPPLPKAPAKRAAARTTRATKKAPTKRAAAAKK
                     APVRSRKKANSFQDSEEEENDDEDVIMEDDAAPDPPARAAPTRSTRSRGAAPKTRQTT
                     INFTQSQKPKASQKAIEISDDEISEDDAFETMPATRSRGR"
     gene            395386..397093
                     /locus_tag="MYCTH_2311299"
                     /db_xref="GeneID:11506514"
     mRNA            join(395386..395633,396175..396496,396562..397093)
                     /locus_tag="MYCTH_2311299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666493.1"
                     /db_xref="GeneID:11506514"
     CDS             join(395624..395633,396175..396496,396562..397081)
                     /locus_tag="MYCTH_2311299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666541.1"
                     /db_xref="GeneID:11506514"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="JGIDB:Spoth2_2311299"
                     /translation="MPRSAATDRRVHFAGGRYGSGEVSEEELMQDLGEGDDELLGDAM
                     TEDLGDEMDDDGNSEAEDDEGMGDDPFNPVELGLKEINNLAHFGVSSHRPGSGVAELL
                     SDDLDKYWQSDGQQPHQLTIHFLRRVEIRAIRFYVDYNQDESYTPTHIVFYAGTGHHD
                     LIQFAELTLTNPVGWQDVPIANSGGGADGHSLCCWIVQMHIKENHQNGKDTHIRGIKI
                     YALDDQSLGSAAREPARGPRMDLSANHVPAPAAHGLNEQSLRELLDAFERHPISNTES
                     VREPVIR"
     gene            397725..399063
                     /locus_tag="MYCTH_2311300"
                     /db_xref="GeneID:11506515"
     mRNA            397725..399063
                     /locus_tag="MYCTH_2311300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666494.1"
                     /db_xref="GeneID:11506515"
     CDS             397849..398835
                     /locus_tag="MYCTH_2311300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666542.1"
                     /db_xref="GeneID:11506515"
                     /db_xref="JGIDB:Spoth2_2311300"
                     /translation="MSPPLSPSARLAASFFSRALSAFQSSGSKLQVICTAPPSLSHEG
                     EPEALPPRVRPQILVVLDSSFNPPTRAHLHMATSAIRELLQKQGQCPDAIRLLLLLSV
                     NNADKGVKPAAFDKRLAMMWAFAQDVQHDLRMSFGNRQAAPEAQGLSVDLGLATVPYF
                     HEKSAALAEAGFYKGQRDPDDDLAETEQVFLVGYDTLVRIFNPKYYGPLEMASQVATA
                     EPTPLQKALDPFFGRAKLRVTMRADDKWGGANEQVAYLENLLHAEGLNKVGGIRAWES
                     RIEMADGHKAGTEVISSTYARAAAKKRDLGRLDLMVTPRVRWWIEQENLYLE"
     gene            complement(400198..402597)
                     /locus_tag="MYCTH_72833"
                     /db_xref="GeneID:11506516"
     mRNA            complement(join(400198..401445,401539..401741,
                     401809..402414,402469..402597))
                     /locus_tag="MYCTH_72833"
                     /product="general substrate transporter"
                     /note="Has EST support"
                     /transcript_id="XM_003666495.1"
                     /db_xref="GeneID:11506516"
     CDS             complement(join(400366..401445,401539..401741,
                     401809..402414,402469..402472))
                     /locus_tag="MYCTH_72833"
                     /codon_start=1
                     /product="general substrate transporter"
                     /protein_id="XP_003666543.1"
                     /db_xref="GeneID:11506516"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="JGIDB:Spoth2_72833"
                     /translation="MAEKAPSSGADSITPQSPNMADLEKQRSTPPGDKHAPYLDPSVM
                     EEDYEGKPTEEELATLRRVPGKIPIIAYLICVVEFCERASYYGVQPLISNYVNRPLPE
                     GGNGWGAPPRGSQATGGALGMGTVVANAVTQSFSMLAYALPLVFGWLADAKTGRFPLI
                     CWGVAVFGVAHVLMVAAGAKDLLANGNAKAPYFLSVYILSVGAAMFKPNVSPLLLDQV
                     TTTVPKVITLKSGERVIEDPESTTERVMLWFYLMINIGGFMGVATAYSEKYVGWWLAF
                     LIPLILYLPLPLLLWFLHKRLVLHPPGGSDLPNVFRVLGICFRRGGIKRIGRHGFWDL
                     AKPSNIAAAGLSGKFKTQWNDEFVDDVRRTFQATGIFCFFPIQYLNDNGIGAAASFLS
                     TMLETNGVPNDVISNFNSLSIIACAPILNYGLYPLLRRFNIHYGPISRMTTGLAMSTL
                     GGVGYTLLNHFAYQKSPCGEYGSSDCRIGTGVAPISIWWMAIPFAIGGISELFVNVPA
                     YGIAYSRAPVNMRGLVSALNLFNTAVAYAIGLACSSVITDPYLTWDFGGTAIAGGILT
                     VLFYFTFRHIDDEEYVLSKNQPDTDYHLEMEGTRNVVGENSLNKSINRPAPIAENEEM
                     MISQKQ"
     gene            complement(<404831..>406185)
                     /locus_tag="MYCTH_2121130"
                     /db_xref="GeneID:11506517"
     mRNA            complement(join(<404831..404950,405009..405260,405323,
                     405396..405579,405609..>406185))
                     /locus_tag="MYCTH_2121130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666496.1"
                     /db_xref="GeneID:11506517"
     CDS             complement(join(404831..404950,405009..405260,405323,
                     405396..405579,405609..406185))
                     /locus_tag="MYCTH_2121130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666544.1"
                     /db_xref="GeneID:11506517"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="JGIDB:Spoth2_2121130"
                     /translation="MVTVTQLVVTSVLAGLSVGSNLPPRIGTTSVGNDNSATPRSGRV
                     TLHQVRRRNYRFNGARAVYRTYLKYGVPVPEYIVEAVAYTDALNAAATKRDTGSAAAE
                     PIDPRYDVAYVTPVSLGTPPQTLHLDFGTGSSDLWVFSTDTPPEQVSGQDIYAPDKST
                     TAELLEGHTWSIRYGDGSASHGNVYTDNVTAGVQCAQQVSSSFTVESEIDGLAGLGFS
                     SLNTVSPKSQLTFFDNAKPQLDSPVFTADLKANKGTTGNISYVPVNPYPGYWTFTASG
                     YGVGSTGTSLLYLPTAIVTAYYRQVQGATNSRVYGGYVFPCSATLPSFTFGIGGAKLT
                     IPPLSSSGIGVNIWGDVALKAAFVVFDGEDPPSIGWATKPLDE"
     gene            complement(407665..410813)
                     /locus_tag="MYCTH_2311306"
                     /db_xref="GeneID:11506518"
     mRNA            complement(join(407665..408154,408248..410209,
                     410291..410557,410616..410813))
                     /locus_tag="MYCTH_2311306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666497.1"
                     /db_xref="GeneID:11506518"
     CDS             complement(join(407895..408154,408248..410209,
                     410291..410557,410616..410709))
                     /locus_tag="MYCTH_2311306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666545.1"
                     /db_xref="GeneID:11506518"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013258"
                     /db_xref="JGIDB:Spoth2_2311306"
                     /translation="MGTNGAGGLGETGGMMGNNANQPPTTEYTLQGVMRFLQTEWHRH
                     ERDRNAWEIEKQEMKSRIASLEGQARRADATQKALKKYVAILEKKVKDQAALLKSGKT
                     AEPEPKLDRASLLQEKLRPSSEKPSRPSMEGGSLEASLADEEASRNELKSFLDQCQAE
                     FTYLMITPANPLPPRESPPLPMIEDLREGDGLGQPLLDQSYQQGLRQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQPQQNHVREFLASQARPVPTPNNQPPAPPAPGNI
                     PVKTLENHAAQMARASNNEHAAAGYGYFAEWPSQGSTSGKTATEQGSDLASQPTQASR
                     NEEKRDGAEKRGVSEIDSWDFNDANFPDASAPTQPQQVSSNRPDTDVFPTADNIPKSP
                     NRAPLAHRRKSSNTMARRRSAEHELSLHSLGPKTEGSNFKLKFGLRGHLDTVRTVIFS
                     GGGSPGEPEICTAGDDGTIKRFHIPDRHPGHVNAGSSDLDVVADFTHRGHVGAVLSLT
                     SWSPAPNFSTGGRAQGDGWIFSGGQDATIRVWERGRIDPKATIDAHTDAVWALCVLPT
                     NLGAIFGQSNPYGTPDRILLVSGAADGNVKVWAVSSPPQLTSPQPAAGRRAQGGRVRG
                     NSMSSGSAFPNSPQPTIASNSPFHHTLIHTISRPNSKASPTCITPLSLNGETFVVSYS
                     DAAIIVYDTRTGEEMGTMASLETYDGTMSTSVNAVVATTAGLDHQPHQGISEEDTAGG
                     GPTGGGRAMAGSGVEGVIISGHEDCYVRFFDANSGQCTYNMVAHPASISSLSLSPDGR
                     ELVSAGHDASLRFWSLEKRSCTQEITSHRVMRGEGVCTVVWSQDGRWVVSGGGDGVVK
                     VFAR"
     gene            complement(411348..413027)
                     /locus_tag="MYCTH_109373"
                     /db_xref="GeneID:11506519"
     mRNA            complement(join(411348..411976,412040..412709,
                     412764..413027))
                     /locus_tag="MYCTH_109373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666498.1"
                     /db_xref="GeneID:11506519"
     CDS             complement(join(411534..411976,412040..412709,
                     412764..412856))
                     /locus_tag="MYCTH_109373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666546.1"
                     /db_xref="GeneID:11506519"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="JGIDB:Spoth2_109373"
                     /translation="MDRPGTPPQPQSQSASRRSTSPPTPEVTRRIEVSRLRAKAIRHQ
                     REAEQRSVQPPAEPRTASGFVDAGDIQLTGPAGRKRPYASISRSEVPATNRDARANPS
                     KDGANTDNSDLRPVSRKFSKYVDYNFSAMTDTKGGFLSTEDDPWSKSMSTGASSAPSG
                     SEQKPAHMTVAEWERMQLIKKLQQNKSGPFGPALSVLADEKTKKRCRECGTVEIDFVW
                     EEVFHCAVCNTCKEKYPEKYSLLTKTECKEDYLLTDPELKDTELLPHLSKPNPHKSHW
                     HDMMLFLRYQVEDYAFNHKWGSPEALDAEFERREADKKRRKEAKFKEKLLDLKRKTRT
                     EAFRRNNTKSGSSTGVLGGIGKATKFGDTVGGSGKHVHEWGRAVENAEGITVKTCVTC
                     NMEVEELEL"
     gene            complement(413268..414334)
                     /locus_tag="MYCTH_72822"
                     /db_xref="GeneID:11506520"
     mRNA            complement(join(413268..413863,413969..414129,
                     414218..414334))
                     /locus_tag="MYCTH_72822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666499.1"
                     /db_xref="GeneID:11506520"
     CDS             complement(join(413469..413863,413969..414129,
                     414218..414240))
                     /locus_tag="MYCTH_72822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666547.1"
                     /db_xref="GeneID:11506520"
                     /db_xref="JGIDB:Spoth2_72822"
                     /translation="MAGLSPQVTNLIIILGMMQVAKRIPFDDPNVLNICRAVYVASNL
                     IVLSIYLYIKSVIDKKKDMTTLKYVEPAPMGSSEEGKLVTTTVHAYDLSQLKNLIRSQ
                     GMGVLMMGVMHLYFKYTNPLLIQSIIPLKGALESNLAKIHVWGQPAVGDLKRPFKQPA
                     GFMSGLQNGPAQADKKAVEAAERAGRGGVKEE"
     gene            <417557..>420062
                     /locus_tag="MYCTH_58125"
                     /db_xref="GeneID:11506521"
     mRNA            join(<417557..417608,417743..418588,418691..418812,
                     418962..419055,419137..419186,419252..419330,
                     419422..419621,419707..419749,419974..>420062)
                     /locus_tag="MYCTH_58125"
                     /product="cellobiose dehydrogenase"
                     /note="Has EST support"
                     /transcript_id="XM_003666500.1"
                     /db_xref="GeneID:11506521"
     CDS             join(417557..417608,417743..418588,418691..418812,
                     418962..419055,419137..419186,419252..419330,
                     419422..419621,419707..419749,419974..420062)
                     /locus_tag="MYCTH_58125"
                     /EC_number="1.1.99.18"
                     /codon_start=1
                     /product="cellobiose dehydrogenase"
                     /protein_id="XP_003666548.1"
                     /db_xref="GeneID:11506521"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_58125"
                     /translation="MQVASKLVAVTGGALALWLHPVAAQEGCTNISSTETYDYIVVGS
                     GAGGIPVADRLSEAGHKVLLIEKGPPSTGRWGGIMKPEWLIGTNLTRFDVPGLCNQIW
                     ADPTGAICTDVDQMAGCMLGGGTAVNAGLWWKPHPADWDVNFPEGWHSEDMAEATERV
                     FERIPGTITPSMDGKRYLSQGFDMLGGSLEAAGWEYLVPNEHPDRKNRTYGHSTFMYS
                     GGERGGPLATYLVSAVQREGFTLWMNTTVTRIIREGGHATGVEVQCSNSEAGQAGIVP
                     LTPKTGRVIVSAGAFGSAKLLFRSGIGPKDQLNIVKNSTDGPSMISEDQWIELPVGYN
                     LNDHVGTDIEIAHPDVVFYDYYGAWDEPIVEDTERYVANRTGPLAQAAPNIGPIFWET
                     IKGSDGVSRHLQWQARVEGKLNSSRSRGRMTITRRLNTVVSTPPYLRDEYDREAVIQG
                     IANLRESLKGVANLTWITPPSNVTVEDFVDSIPATPARRCSNHWIGNPSAAIVIAAEY
                     AAAKILALPAPEDAAS"
     gene            422274..423364
                     /locus_tag="MYCTH_85556"
                     /db_xref="GeneID:11506522"
     mRNA            join(422274..422732,422804..423364)
                     /locus_tag="MYCTH_85556"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003666501.1"
                     /db_xref="GeneID:11506522"
     CDS             join(422339..422732,422804..423087)
                     /locus_tag="MYCTH_85556"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003666549.1"
                     /db_xref="GeneID:11506522"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_85556"
                     /translation="MLTTTFALLTAALGVSAHYTLPRVGTGSDWQHVRRADNWQNNGF
                     VGDVNSEQIRCFQATPAGAQDVYTVQAGSTVTYHANPSIYHPGPMQFYLARVPDGQDV
                     KSWTGEGAVWFKVYEEQPQFGAQLTWPSNGKSSFEVPIPSCIRAGNYLLRAEHIALHV
                     AQSQGGAQFYISCAQLQVTGGGSTEPSQKVSFPGAYKSTDPGILININYPVPTSYQNP
                     GPAVFRC"
     gene            423859..425669
                     /locus_tag="MYCTH_2311323"
                     /db_xref="GeneID:11506523"
     mRNA            join(423859..424171,424353..424706,424862..425669)
                     /locus_tag="MYCTH_2311323"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003666502.1"
                     /db_xref="GeneID:11506523"
     CDS             join(424120..424171,424353..424706,424862..425148)
                     /locus_tag="MYCTH_2311323"
                     /note="CAZy_ID 267857"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003666550.1"
                     /db_xref="GeneID:11506523"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Spoth2_2311323"
                     /translation="MRLLASLLLAATAVQAHYTFPRLVVNGQPEESDWSATRMTKNAQ
                     SKQGVENPTSGDIRCYTSQTAANVVTVPAGSTIHYISTQQINHPGPTQYYLAKVPPGS
                     SAKTFDGSGAVWFKISTTMPTVDSNKQMFWPGQNTYETSNTTIPANTPDGEYLLRVKQ
                     IALHMASQPNKVQFYLACTQIKITGGRNGTPSPLVALPGAYKSTDPGILVDIYSMKPE
                     SYQPPGPPVWRG"
     gene            complement(<425824..>426222)
                     /locus_tag="MYCTH_2130467"
                     /db_xref="GeneID:11506524"
     mRNA            complement(<425824..>426222)
                     /locus_tag="MYCTH_2130467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666503.1"
                     /db_xref="GeneID:11506524"
     CDS             complement(425824..426222)
                     /locus_tag="MYCTH_2130467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666551.1"
                     /db_xref="GeneID:11506524"
                     /db_xref="JGIDB:Spoth2_2130467"
                     /translation="MKSNDALALIIVAYTALGFLVSFFIARLALAMHRRAHGSSTGSS
                     GSSGSSGSKSTASSGSVPSRYQSGDASTSTPRPAFESSAVPLSQAPPPPNVPPVTPVP
                     PPVGAFGNNGYYSPARPHSFPPPPPPPPLN"
     gene            complement(427353..430185)
                     /locus_tag="MYCTH_2311326"
                     /db_xref="GeneID:11506525"
     mRNA            complement(join(427353..429074,429613..430185))
                     /locus_tag="MYCTH_2311326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666504.1"
                     /db_xref="GeneID:11506525"
     CDS             complement(join(427472..429074,429613..429905))
                     /locus_tag="MYCTH_2311326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666552.1"
                     /db_xref="GeneID:11506525"
                     /db_xref="JGIDB:Spoth2_2311326"
                     /translation="MIVPENRAVAPVWPGPTSTAFSTDSAPPAPNPTLTSAPDAHARA
                     MPDSAGLEGKSRTLQGPSAKEWASHRETIISLYRQYPLKRVSEIMRKQYGFSASKRMY
                     DKRFREWHVFKNANSDERARAARRAQGSGPPSPARQTDQGNNFSPEDLRRTIRCARTV
                     QQSVQQTPPTTSSSSPAQTGSASPPQPSRQPRRSISISDLIKQEDEPHLPASQQSPGQ
                     EVTPRAPFSPPSTPSSTSGSSLGASDESSQEQDDRGALIVSGASSPSMAAYTEQLRRL
                     FNSPPPSMSPDSQMRTLSTITLKLREYYDWQLNNIPPGVSPDHYLGERSPDESTRYWN
                     TIKNALYLVKISAGSVEDPEHRPDRRAWSAFSEAGQLAAGAMTTQPFDFLRNVFATLS
                     PVNTSARPELRAIILQFLAKEAQRSLSSNHPITHICKELLQDENCQEISQRSLQCMLD
                     IFNTRLGRSRAITFKLLDSLATLLRRSGEYHAGLEIITELLNSARPEFGPDSDQVRSV
                     ENELAHFYMLTGEPDLALSHCMSVVTRPPPSTARAQGEPTFYQDGIAAHAMEDIAEIH
                     QRRGDLEQCIVWLERAASIALTVWGPKAVATGHLIDKMTSLQRQLGKDLLESATLWEA
                     ALSNPSA"
     gene            complement(453782..455485)
                     /locus_tag="MYCTH_2084292"
                     /db_xref="GeneID:11506526"
     mRNA            complement(join(453782..454289,454350..454588,
                     454681..455485))
                     /locus_tag="MYCTH_2084292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666505.1"
                     /db_xref="GeneID:11506526"
     CDS             complement(join(454217..454289,454350..454588,
                     454681..454932))
                     /locus_tag="MYCTH_2084292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666553.1"
                     /db_xref="GeneID:11506526"
                     /db_xref="JGIDB:Spoth2_2084292"
                     /translation="MYRTKHFRWKLMHLWGISAHLGLVAAVAIGYLGQLGNPARPERW
                     GRATTAAGTSRCTAVMAAGLDGGDTLDVGTHTLLRACLILGSLGFVINVALLAALLAV
                     EPIKITLTEGEQHWRKQVVTFFGCLLNLLLAGAGFCLAVHLGVKAADSKLLIAPLVWT
                     YFQAPLAFAVAVCDAFKNYREGKDLLD"
     gene            <457826..>460048
                     /locus_tag="MYCTH_2071908"
                     /db_xref="GeneID:11506527"
     mRNA            <457826..>460048
                     /locus_tag="MYCTH_2071908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666506.1"
                     /db_xref="GeneID:11506527"
     CDS             457826..460048
                     /locus_tag="MYCTH_2071908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666554.1"
                     /db_xref="GeneID:11506527"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Spoth2_2071908"
                     /translation="MLTQPMPESHVLSAMRALGNLLRASIPGSGLLWVLSDEGFPLQC
                     KGCGEICELLRWGEVQRRRDSTFRGSSPPRIVHNSYVELDRCALETGCDTCRTLRRAF
                     LLEQITSHGAERLGHAGNQWPIYAVLNLGSSGDSELALAVKSPKAVLYSATVHLTNDV
                     RAVARNSRRAAPGPRPDLSALRRVVDDCHRNHECSSRYRWSHRNPTWLLRILPDNLVQ
                     LVAGPSEPVDYVVLSYSWGDPATMPAAEWARIKGAGTKTINGRPVPERLNPFSVRELP
                     ETMQDAIAISASLGVFYVWIDNVCIPKGTNWDTEASLMHEVYGNSAFTLVASSSTKAT
                     DRLLYDRLAWTQRGGACRLRDLWWLHNTPMPLDRVRLESPVSLRAWTLQEERLSPRIV
                     YWAGQRWYWSCLERQVAELGESDWAASPADPCSRSCPQRFLELCRSGDEELLHEEWLD
                     IVQAYTRRDLVAPRDRFLAIAGLAVRFYNAKAANGGAVVTEDYLAGLWKDNFARHLAW
                     SVASAVEPRHNLRHIAPSWSWASLPLRVQTKTKAPFRPSAHFKFVAVRRVEAAEASYA
                     LARTETGDPSTDFINRGRAVEERGRGVKAVEVRGRFRRFISDDALNVSWDGIERKRDG
                     RSCFDFGAFPGRSIYARNKGNGTILSKDAHCGEVVGQLDYTIPADDKPDQHPAPYVRE
                     GDEREIVCLELGELAMLLLVPDHDWGRPESYRRVGVAIGYTNRKGFFYGCETRSVNLV
                     "
     gene            complement(461043..462739)
                     /locus_tag="MYCTH_2311330"
                     /db_xref="GeneID:11506528"
     mRNA            complement(461043..462739)
                     /locus_tag="MYCTH_2311330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666507.1"
                     /db_xref="GeneID:11506528"
     CDS             complement(461230..462591)
                     /locus_tag="MYCTH_2311330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666555.1"
                     /db_xref="GeneID:11506528"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Spoth2_2311330"
                     /translation="MAQPAKAFVGPMIHSLSASEIEVLPYALLAVNSEGKITSLLRDV
                     NPQRAQDALKALNFPPELVTIHYLGPGQFLIPGFVDTHNHAPQWAQRGLGQGMHILDW
                     LDAITFPNEARFHDPEYARRIYSSCVDGFLRQGITTASYYGSIHGEATKTLARLCLEE
                     GQRALVGKCNMTRNAPEYYRDASVEDSLRLTEECIDYVRSLDPAGNLVRHVLTPRFAI
                     SCDAEVLRGLGDIARNNPDLPIQTHFNEAEQEMKATRELFPQFASEADLYEHFGLLGE
                     RSILAHCCHMTDYEMERVKALGCGVAHCPISNMTVGGGFMAAPVREFLRRGIKVGLGT
                     DSGGGFSSSILDAMRQAMIASYAREVMSKGQDKGLSVDEVFYLATLGGAQVCGLGDRI
                     GNFEVGKDFDAIVVGTQGSEQGIMTVVEENDSLRTVFEKFIMTGDDRNLIKVYVQGRP
                     VKG"
     gene            465169..465913
                     /locus_tag="MYCTH_2311331"
                     /db_xref="GeneID:11506529"
     mRNA            join(465169..465251,465308..465913)
                     /locus_tag="MYCTH_2311331"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666508.1"
                     /db_xref="GeneID:11506529"
     CDS             465327..465827
                     /locus_tag="MYCTH_2311331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666556.1"
                     /db_xref="GeneID:11506529"
                     /db_xref="JGIDB:Spoth2_2311331"
                     /translation="MAVSIRIEPSDFVVPTGPAVVLVKIDREAFQHLAPSMNPLSESD
                     SASAVLRKGKPAVAYAIRQLSDMLFGDDIAPSVIRRVLPQPGVRSPRDSEPLFQSKYV
                     CFYWLRHIPAGEHLSSALVELTSASEPIDNYLDFHAVEVADEDYKVRTIASIFVDEAH
                     LEEAQA"
     gene            468928..470298
                     /locus_tag="MYCTH_2311333"
                     /db_xref="GeneID:11506530"
     mRNA            join(468928..469458,469579..469746,469816..470298)
                     /locus_tag="MYCTH_2311333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666509.1"
                     /db_xref="GeneID:11506530"
     CDS             join(469157..469458,469579..469746,469816..470149)
                     /locus_tag="MYCTH_2311333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666557.1"
                     /db_xref="GeneID:11506530"
                     /db_xref="JGIDB:Spoth2_2311333"
                     /translation="MTHESFLAATVLKEDGTTARAILRGVTESHERHYFTRIQHYKPT
                     DSTSRGLSTVKQLQKERRPTTAQWQELHQILVKQPSVVQVRTDITEEVLNALSRSQGG
                     EAPPVIIPAGKPCSLRWADMPDPPSPQRPPFIAQRRLVDIDDPRAPAILAENSFGPTS
                     DLIEESYCWWSEGVEYALTRMFVVALKTDPIVSTQVPNPAGLTSVGNIWILYVRAKVD
                     SSPTTTMPERVRQAQAQLVRVREQLKGVFDFPAFDRRCHDTRVPYSKAG"
     gene            471089..472927
                     /locus_tag="MYCTH_2311337"
                     /db_xref="GeneID:11506531"
     mRNA            join(471089..471700,471806..471952,472104..472927)
                     /locus_tag="MYCTH_2311337"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666510.1"
                     /db_xref="GeneID:11506531"
     CDS             join(471197..471700,471806..471952,472104..472907)
                     /locus_tag="MYCTH_2311337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666558.1"
                     /db_xref="GeneID:11506531"
                     /db_xref="JGIDB:Spoth2_2311337"
                     /translation="MRRLRTAAGPRQHKPTGPRPLVFIHEEPQSGRRQQQQQQQQRQQ
                     QRQQQRPGPSPQSALTIPLAHRASCHFASNFILVPAGRVAHGFMEYLGPLMDAEPPES
                     ALRYAFNACAFALLGNRARADGVDLAQLSLREHTLALAQTHKALGHPALASTDSTLAA
                     ILLLSLYESITAYKESRALAWRSHIDGAVHIVKTRGRAEMCRTRIGNLLFTAVRQHLA
                     SRVVSSGLPLPLGTDWWMSGGDTKSLLARSQRFALGFCDLRARANQLLANASRSPESL
                     AQMYELAGDIQNLDREIADWLASIPAEFQFWPACWVPEDGDLTRGTSFGEIEVFPGRV
                     DVYPDFVTAMAWNIGRSSRLLLASLHIRVAARIHAPADYRTTPEYEIAKRICKDIIPD
                     IIASVPYHLGWNMNGKRFRSPGLSAFACGEEGPCKALPALFLIWSLTSIKNHDFTTEE
                     QRMWAKGRLKYIAEVVGLKYAHIVNDASPFLVPL"
     gene            complement(474424..476010)
                     /locus_tag="MYCTH_2311342"
                     /db_xref="GeneID:11506532"
     mRNA            complement(join(474424..474736,474796..475489,
                     475587..475801,475878..476010))
                     /locus_tag="MYCTH_2311342"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666511.1"
                     /db_xref="GeneID:11506532"
     CDS             complement(join(474631..474736,474796..475489,
                     475587..475773))
                     /locus_tag="MYCTH_2311342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666559.1"
                     /db_xref="GeneID:11506532"
                     /db_xref="InterPro:IPR005581"
                     /db_xref="JGIDB:Spoth2_2311342"
                     /translation="MLPHVDAAILEALGLEATSSKLVSHGGSGFSSTHKLVATKDGQE
                     FTFFVKTGSGPEAEIMFRGEHASLNALNAADPSLRLAPRSYAHGALRSSPGKFFLVTD
                     FLDFNSSASNGTGLSLAAKLAKLHTTPAPIPKGFSKPMYGFPVPTCCGATKQDNTWTE
                     SWAEFYAEHRLRAILREGVRQNGQDKELSEAVEKVAAVVVPRLLGDGHLKGVMPVVVH
                     GDLWSGNHGRAKIGQTGGVEEVVFDPSCVYGHSEYELGIMRMFGGFGSRFWKEYESLV
                     PKAEPKEEWDDRISLYELYHHLNHYALFGGGYRSGAMFIMRKLISKYGGGSG"
     gene            477198..480247
                     /locus_tag="MYCTH_2311348"
                     /db_xref="GeneID:11506533"
     mRNA            join(477198..477455,477552..478001,478058..479790,
                     479848..480247)
                     /locus_tag="MYCTH_2311348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666512.1"
                     /db_xref="GeneID:11506533"
     CDS             join(477364..477455,477552..478001,478058..479790,
                     479848..480134)
                     /locus_tag="MYCTH_2311348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666560.1"
                     /db_xref="GeneID:11506533"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="JGIDB:Spoth2_2311348"
                     /translation="MNGHFAAVGDGPTAKQYEHGIQVIDEDKAFNTNLNDYLNETRVA
                     EAGFNYHLISVFGSQSTGKSTLLNHLFKTDFSVMSESARRQTTKGIWMAKNKRVGANG
                     DGAAVADNILVMDVEGTDGRERGEDQDFERKSALFALATSEVLIVNIWEHQVGLYQGA
                     NMGLLKTVFEVNLQLFLKDRQSQTRSLLFFVIRDHIGNTPLANLRDTLIQDLTRIWSS
                     ISKPQGLENSKIEDYFDFAFAALPHKILQPDKFNEEVDKLSTRFTAGHRSAKDQEFVG
                     GVFLPEYHRRIPADGLSVYAQGVWDQIVNNKDLDLPTQQELLAQFRCDEISREVLVGF
                     DTVIIPLEEQQAEAARLGKNTVLPDLGATGAGAREKCLKAFETQASRYHKGVYGTKRG
                     ELEGKIDTRLKTLYQTQLSAAHKSGVAAFSNAVTNVVKAGQKAGGAYEFAEIVETQKK
                     KALEVFRKEAQSLLIQGVAWTNFKPQYRLFEKELDQVSARLRKEEMRRLAIRVERWVK
                     SRLGDSIGLEFNKLGSGRGGSGAPEDGEKPATEKDLWDRVWGAFRGIVAEAETRFTDR
                     AKSFEASPEEVEVGLWRLRRKSWVALREKIEEEMMESNILMKLRENFEEKFRYDEEGV
                     PRIWRPTDDIEGVYTRARESTLGLIPLLARFRLAATYAPPDLPGFIGPQPAGVDPEDE
                     EDLVPIGGVDEEEGKSLEEEMTVLSESKRQDLVVRFKKMADGVYVEAKRSAIGGITQV
                     PLYFYVILLVLGWNEIVMILRNPVLFMLILIMGGGTYVAYTLNLLGPMMQMANAASNQ
                     AVEIGKEKLRQLLESNETVRQAIAMPASQQSSGINLDRLDSRGRRAQSTEDEDEI"
     gene            complement(480248..481693)
                     /locus_tag="MYCTH_2311349"
                     /db_xref="GeneID:11506534"
     mRNA            complement(480248..481693)
                     /locus_tag="MYCTH_2311349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666513.1"
                     /db_xref="GeneID:11506534"
     CDS             complement(480361..481506)
                     /locus_tag="MYCTH_2311349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666561.1"
                     /db_xref="GeneID:11506534"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="JGIDB:Spoth2_2311349"
                     /translation="MGDSQHAEDMAIETPPSSIFVPPSINESALLAGDSYSYFSPVPT
                     SLLPPPGSPPSATGPPCALGVDEAGRGPVLGPMVYGVFYLPIPLSDPLLRATHHFDDS
                     KVLTPAVRASLLRTLCTPSTDLHASCGWAVTALSARDISAGMLRPGLAAYNLNAQAMD
                     ATVELIRQVYARGVNVREIYVDTIGQPAAYQAKLERVFPTAKITVAKKADSLYPCVSA
                     ASVCAKVTRDVALETLWKAPGWKAGQVVGGGEEGEEKDGVEEEKEEERKEDEQQDQEE
                     EQEQAGEASMAWGSGYPSDRRCVAWLKASMHPLFGWGPECRFSWGTAKDILEAAPAKG
                     GGVKVDWPANEDDDTHRLTDFFVSGRHEKAADELGAWFGTPTGLEAF"
     gene            <482140..>484522
                     /locus_tag="MYCTH_85534"
                     /db_xref="GeneID:11506535"
     mRNA            join(<482140..482219,482285..482448,482504..484270,
                     484347..>484522)
                     /locus_tag="MYCTH_85534"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666514.1"
                     /db_xref="GeneID:11506535"
     CDS             join(482140..482219,482285..482448,482504..484270,
                     484347..484522)
                     /locus_tag="MYCTH_85534"
                     /note="Contains conserved domain pfam11699: Mif2 Mif2 is a
                     yeast DNA-binding kinetochore protein which is orthologous
                     to mammalian CENP-C."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666562.1"
                     /db_xref="GeneID:11506535"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_85534"
                     /translation="MAPRPSLARRTLAPQGEHIYELGVVGRKTGVTVPDSGVRDEHGM
                     EPIENLFSSPGKSDNEDQQEEGSDGHGSGEEAMDITTTSGIGPAAMINGHGNRLPVPL
                     SRVRSPAKTLLNSPAQRNRFLARNSSSPARGAAVRTDDFRFSSQPTGDQASTKRRLDF
                     QSVANGGPHSLSRPQAHGHRPQPLQHDEEEGEGEQSDHGREDDEVNNFVEESMAMLND
                     GDDYDNPPEPDPAQNEAEEEEEDGSAAEDETEDPPAPAPKKRQGRPPKQKQTAAARAA
                     KPRKKTAQPVAEEEDGEDQQDDEEHPEGEEEEEEEEEEEQEPTPKPQKPTPGRRGRPP
                     KAGKPSAPPAQAPPRGAKKRRSLDQEGAAEEPSSEPKPKRPRASAAPNAEKPAPKKAA
                     APARKTPEPPAAAAPKPRGRRRRSSVEPGDVSQVAVARRPPLPKSRGLLISRREVPGD
                     PNSSMHRTRSGRTSFKPLAWWRNERVEFDKDEAEDAFVGRKHKGKFVLPSVKEVYRVD
                     EPEPEMRARSRRGGKKAPGRGGRRRSSGGGGGDFDDEDYGPAEPWELDPGTVTGEVVV
                     WQPEYEYQPPAPNDLVSVMDKQLAISSAAIKTTEVVGGEFRYAKVFSEGFIGAGVVDL
                     PPGAVKRLKNSRKVFMIFFMHVGRVRVTVQETSFRISKGGMFIVPRYNEYTIENDYDQ
                     PARIFFAQGQEVAVSPPPEQEAAEEDQDADEEVEVSEGEEVGSGEE"
     gene            complement(484919..487898)
                     /locus_tag="MYCTH_2311354"
                     /db_xref="GeneID:11506536"
     mRNA            complement(join(484919..486501,486561..487081,
                     487146..487382,487485..487898))
                     /locus_tag="MYCTH_2311354"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666515.1"
                     /db_xref="GeneID:11506536"
     CDS             complement(join(484930..486501,486561..487081,
                     487146..487382,487485..487710))
                     /locus_tag="MYCTH_2311354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666563.1"
                     /db_xref="GeneID:11506536"
                     /db_xref="JGIDB:Spoth2_2311354"
                     /translation="MTPGRVPLRPLARNGSAPPFLATAASAFRYQSLVAAGLSPWRCP
                     ARRWESTSGAAGSGKTGHIDTHPKESILFFDNIFPLKLTSVLLMRAWETSDILERFNN
                     ASLSFLNPIGLVKRAIPRTAPIKVTEIIPRLKEGGAYVKFTYPDNMSAAEIEDELVRS
                     LENKPIKPWFNPFRSIKARLVLGRPWLEDLHRLPKSRLKVEFVPAKDSELPAELSQES
                     LYSLFRRYGKISDIISQPSDSKVLPRFAYVDFVLVRDAILARSCVHGFVLQEEGSRTA
                     TRLRLSYEQRVKPHHIWNWITSHPRIVIPIVAAFLAAFTVAVFDPIREFFVKIHVQKS
                     FEITNSRFYKWLKRQTWDIFTFRKHKDDDAGLSALFAHRKDLIDSLQNALLETVETFI
                     VVHGPRGSGSRELIMDQVLAGRRDVLLVDCRQVVEARGEAGTIRKLANQVGYRPVFSW
                     ANNLSSMIDLAIQGTTGVKTGFSETLESQIAKILQTTAGALKDVALAGRKKDDKDAAL
                     TDDAYLEAHPERRPVVVIDNFLHKSDEKGIIYDKISEWAAALVQSSIAHVIFLTTDTS
                     YSKSLSKSLPDRMFHQITLGDLTPDVAKHFVVSQLELDEPGKKEENGNPPAVTGSQLR
                     KDLQELDQCIDALGGRLTDLQVLARRLKLGQSPKKAVSDIIEQSASEILRMFLLTNKG
                     ANERERKWSTEQAWYLIKEIATKESLRYNEVLLSSTFSSSTTPGASNAEAAIESLSNA
                     ELITVKSHHGRPSTIRAGKPVYQAAFKRLLEDAVVRARMDLAVLSELAKIEAKNIDKA
                     EGELSLLGSLPSQSYQAEDRVNYLLAKLQSSQQKIAAYEKEMAVLKEVLAEEA"
     gene            488440..489731
                     /locus_tag="MYCTH_2311356"
                     /db_xref="GeneID:11506537"
     mRNA            488440..489731
                     /locus_tag="MYCTH_2311356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666516.1"
                     /db_xref="GeneID:11506537"
     CDS             488694..489539
                     /locus_tag="MYCTH_2311356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666564.1"
                     /db_xref="GeneID:11506537"
                     /db_xref="JGIDB:Spoth2_2311356"
                     /translation="MGWFWRSSPSVKTEGSSSVPPATSTTPSSSVAETPPQAKAAPSG
                     PESSPGDREIAMFMDMLMKDAQSSSSAQHKTPPPPPPPSSLPSSLPSQASSDSKSTRS
                     SWLPWASTKPAAEPAAEQAQPPRRKTRSPQSLAMSEHVLPTTMSCRDAFDYAWHCHTP
                     GSQWNAVYRYGSVRTCSELWDDFWFCMRTKSYPPELRAEAIREHYRAKEEAKYGGGKP
                     SSEDVWESREERVPPGTAFKKSFDPPIVDDAEFQRVDAERRRRIREAIGIEGRDGGGS
                     EKKGE"
     gene            complement(490023..492851)
                     /locus_tag="MYCTH_112686"
                     /db_xref="GeneID:11506538"
     mRNA            complement(join(490023..491469,491764..492444,
                     492667..492851))
                     /locus_tag="MYCTH_112686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666517.1"
                     /db_xref="GeneID:11506538"
     CDS             complement(join(490272..491469,491764..492444,
                     492667..492734))
                     /locus_tag="MYCTH_112686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666565.1"
                     /db_xref="GeneID:11506538"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Spoth2_112686"
                     /translation="MAPAVGIDLGTTYSCVGVFREDRCEIIANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFTDPEVQADMKHFPFKVIERNGKPVIE
                     VEFKGETKVFTPEEISSMVLTKMRETAESYLGGTVTNAVITVPAYFNDSQRQATKDAG
                     LIAGLNVLRIINEPTAAAIAYGLDKKADGERNVLIFDLGGGTFDVSLLTIEEGIFEVK
                     STAGDTHLGGEDFDNRLVNHFIAEFKRKHRKDLSTNARALRRLRTACERAKRTLSSSA
                     QTSIEIDSLYEGIDFYTSITRARFEELCQDLFRSTLQPVDRVLTDAKIDKSQVHEIVL
                     VGGSTRIPRIQKLISDYFNGKEPNKSINPDEAVAYGAAVQAAILSGDTTSKSTNEILL
                     LDVAPLSLGIETAGGMMTKLIPRNTTIPTKKSEVFSTFSDNQPGVLIQVYEGERQRTK
                     DNNLLGKFELTGIPPAPRGVPQIEVTFDLDANGIMNVSALEKGTGKTNKIVITNDKGR
                     LSKEEIERMLAEAEKFKAEDEAEAARVSAKNALESYAYSLRNTLNDSKVDEKLDASEK
                     EKLKSEIDKIVSWLDDNQQATREEYEEHQKELESIANPIMMKFYGAGAGGMPGGMPGA
                     APGGFPGAGGASNDNDGPTVEEVD"
     gene            493122..495694
                     /locus_tag="MYCTH_2135843"
                     /db_xref="GeneID:11506539"
     mRNA            join(493122..494246,494324..494366,494429..494469,
                     494544..494695,494802..494927,495021..495694)
                     /locus_tag="MYCTH_2135843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666518.1"
                     /db_xref="GeneID:11506539"
     CDS             join(494183..494246,494324..494366,494429..494469,
                     494544..494695,494802..494927,495021..495449)
                     /locus_tag="MYCTH_2135843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666566.1"
                     /db_xref="GeneID:11506539"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="JGIDB:Spoth2_2135843"
                     /translation="MLIKESFADVQTTANGKESSMRIFVFHPTIPGYPNARFPGVVLF
                     SEIYQVTGPVARFARQIAGQGYIVAAPSSYHDFTGPEPLAYDVPGTDQGNKWKITKTL
                     ESYDEDSNRTVDYLLSLPTCTGRIGATGMCLGGHLALRASLDPRITASVCYFPTDIHT
                     RTLGPYTAPNSSATAPSPDSPHTIDQLSRIRGEVALIFGVKDTHVPDAGRDLIRLKMR
                     EAGVTFSFHEFAWAQHAFIRDELSKGRYDPAVSKACFEVLLELFGRVLRTELGEKDGG
                     PQEIEHVC"
     gene            complement(496241..499550)
                     /locus_tag="MYCTH_2311364"
                     /db_xref="GeneID:11506540"
     mRNA            complement(join(496241..497552,497611..497861,
                     497935..499403,499499..499550))
                     /locus_tag="MYCTH_2311364"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666519.1"
                     /db_xref="GeneID:11506540"
     CDS             complement(join(496395..497552,497611..497861,
                     497935..499345))
                     /locus_tag="MYCTH_2311364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666567.1"
                     /db_xref="GeneID:11506540"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="JGIDB:Spoth2_2311364"
                     /translation="MSLRSPISPQRRGFLPISGDSSTPDVQDIPLRPIKSNASSTGTR
                     KANTEGMEEKHAIFDKAVGGPAGRRRLRNDLHRGDTGESSEEASLNAMGRLYHKIVGF
                     SVVTRYLVYVAPVALLLAVPIIVLPLTGDKDRVSLGDQKRHSLFLLFVWIEVSWLALW
                     TGKLAAHVLPYVFMFFCGVVSSGTRKYATVLRALEIPLSLFFWGLASWLSFKFMFEGA
                     NKEWSEVIVRILLSLFLSSAVLLGEKFLVQLISISYHQRSFANRIQDSKREIYLLGLM
                     YEASRTLFPMYCPEFAEEDYIIADSIEAMLTRGKGGKQGVAAAPMKLVGDVTRLGDKI
                     TSVFGNIASEITGKQVFNPNSAHSVVVEALEKVRSSEAMARRIWMSFVVEGQDALSRD
                     DIIEVMGPAHREEAEECFEAIDADQNGDISLDEMIRKVVAIGKERKAIAHSMKDISQA
                     LAVFDKVLLFVVLIIVIIIFLAVFQSTFIATLTTAGTTLLSLSFVFATTTQEFLGSCI
                     FLFVKHPYDVGDRVDITGPEKEQLIVEKISLLYTVFTRIDKMQVVQVPNIVLNNAWVE
                     NVTRSKAMKETIEVNVSFDTSFEDIELLRLELERFVRAPENNRDFQPDISIGVGSVGD
                     CDKLTLTVAIKHKSNWHNDAVRATRRSKFMCALTLALKRVPIYGPGGGGDALGGPTNP
                     SYSVAVTDEFAAQARAKSEQEKAAKRLANQSAEEAANSESAAAAEQRAADQINTSRPV
                     VEVLDDWGYEKTLTSHEPSADRPRPSDSGAATTTSRSDVLGGISTRESQRGRRKAGET
                     LPPHALDDDSNMPAVQLTRTSTSTRTDKRSFDVERQAGIPPPAGSPYNTWAAYNTQAS
                     GTMPSGAGGQPPQDPFGGPSPPPGMPTHLTVQQPGAAPTQSASPGRTLVGARPRGGSV
                     SRPQEGGPAQGQPGPSGTAGPSGRS"
     gene            502221..504253
                     /locus_tag="MYCTH_2311368"
                     /db_xref="GeneID:11506541"
     mRNA            502221..504253
                     /locus_tag="MYCTH_2311368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666520.1"
                     /db_xref="GeneID:11506541"
     CDS             502352..503977
                     /locus_tag="MYCTH_2311368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666568.1"
                     /db_xref="GeneID:11506541"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="JGIDB:Spoth2_2311368"
                     /translation="MKPPVAGAGRPFTCLRCLVQSSPGRPAIAARCRSRNPQILPSAP
                     YHSTRALQQNAPAYPTSPEVQQPPPLRQPTTAPKAVLDIKHIRQNPDLYAENCRQRNY
                     HAAAAYPARINELFAQWQAKQREGRSLRERGNLLRRQLANPGTTRDEADEEAAGLRSL
                     SREQLLEEARKVKTELSAIEEAESALSAEMQRLALAIPNLTSDATPRGSEPTVLSYIN
                     DHPKTASPDSSDRVWRSHVHIGAELGILDFAGAASTSGWGWYHLLDEAAQLEQALVNY
                     ALTAATRAGWRQVSPPSMVYSHIAGACGFQPRDVNGETQIYTIAQDADDAARGRPELC
                     LAGTAEIPLAGMKADTVLDEADLPLKRVAASRCFRAEAGARGALTKGLYRVHEFTKVE
                     LFAWTGPDAHAVGDVFDEMVDLQTELHGSLGLHCRVLEMPAADLGASATRKCDIEAFF
                     PSRRDRNDGWGEVTSASICTDYQTRRLATRLKLAGGKLVYPWTVNGTALAVPRVLAAI
                     LENGWDESEKTVTIPEVLRPWMDGKEKIGPRHR"
     gene            complement(513135..514387)
                     /locus_tag="MYCTH_2311371"
                     /db_xref="GeneID:11506542"
     mRNA            complement(join(513135..513857,513909..514080,
                     514242..514387))
                     /locus_tag="MYCTH_2311371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666521.1"
                     /db_xref="GeneID:11506542"
     CDS             complement(join(513349..513857,513909..514080,
                     514242..514346))
                     /locus_tag="MYCTH_2311371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666569.1"
                     /db_xref="GeneID:11506542"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="JGIDB:Spoth2_2311371"
                     /translation="MSEIDMKVDPARASALISQLQSVNVRIAAVAKGRAVRLVAVSKL
                     KPANDILALHDSPLRQVHFGENYAQELSQKAELLPRSIQWHFIGGLQSGRCKELAKIP
                     NLWCVSSVDNVKKAQLLDKYRGEKIKAEPETPKLNVHVQVNTSGEESKSGCAPGEDVV
                     SLCRAIVNDCPNLHLLGLMTIGAIARSVATTAENENEDFRLLVEQRDLVAKELGLERE
                     LELSMGMSEDFEGAIVMGSSEVRIGSTIFGQRPAKSEAKIVSS"
     gene            <515342..>516460
                     /locus_tag="MYCTH_2071198"
                     /db_xref="GeneID:11506543"
     mRNA            <515342..>516460
                     /locus_tag="MYCTH_2071198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666522.1"
                     /db_xref="GeneID:11506543"
     CDS             515342..516460
                     /locus_tag="MYCTH_2071198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666570.1"
                     /db_xref="GeneID:11506543"
                     /db_xref="JGIDB:Spoth2_2071198"
                     /translation="MGPEPLPHLPSEIWMMILESLPPSFFQQDIRRLALSKRWYSLAF
                     PIFYPRIEYTPRVISRLVHRKSKSLDRSRAMLRKSLRCVNIVLDGVPGDDAELVRFNT
                     PANLARFCLMLLEFRELDEVRFAARWPNRAWPADPLQPDYLCIRTLEPYLSLLTHVTA
                     LDLDLCGTDIVACPGPGPGHGYGYGHGHGHGHGHGDGAAATPVHFCEHVRPLLSRLRA
                     LRLRMRSICHTALVPLDGRPVTLRELRLSLYLGRVSENNPKLNSSRTCRRAGGSRERT
                     VPMNEMRAAMRALIVDMAPSARAEMVHLAPTGEIHVWDAGTDRCSRDPSEKPMRFPLC
                     FEATHSRVCFSAHADDLASGDHAGVGGVLTSSSDDMSN"
     gene            <517111..>518226
                     /locus_tag="MYCTH_2113259"
                     /db_xref="GeneID:11506544"
     mRNA            <517111..>518226
                     /locus_tag="MYCTH_2113259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666523.1"
                     /db_xref="GeneID:11506544"
     CDS             517111..518226
                     /locus_tag="MYCTH_2113259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666571.1"
                     /db_xref="GeneID:11506544"
                     /db_xref="JGIDB:Spoth2_2113259"
                     /translation="MSTVGPTRPQEEATPRQVESRGVKKGSTSPQEYLLERFPSVRRA
                     APTYQGSAPVGRRANTLRPALRKLCEGEQHPNTRPYQRPYQRPNQAGRRQVQESGGIS
                     HHAGSSAGPDTAHNHNSAVTGLGLEVIEVLLSQVANHNSAVTGLGSEVIEVLSRFAQN
                     RDARRWETGANGRPNAASRGFLHQLRTQRQRRGPLRPCMGSSHTNRRGGNARRTTRTL
                     NESKAPGIHHDPEGGSSNSPATQAPLPLPTPALIFDETTNPNLLRTLRPATDPGLRTG
                     NNNNDNNNDNDDDDADDADGLQAPFALRADNLSSVLADRAAPAGLRYASMRLALVTET
                     LEIETPGTGVARVTHRGDGLQGAPLRLLPESRRELNG"
     gene            complement(519094..520620)
                     /locus_tag="MYCTH_2311373"
                     /db_xref="GeneID:11506545"
     mRNA            complement(join(519094..519585,519700..520181,
                     520258..520315,520394..520620))
                     /locus_tag="MYCTH_2311373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666524.1"
                     /db_xref="GeneID:11506545"
     CDS             complement(join(519118..519585,519700..520181,
                     520258..520315,520394..520501))
                     /locus_tag="MYCTH_2311373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666572.1"
                     /db_xref="GeneID:11506545"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="JGIDB:Spoth2_2311373"
                     /translation="MSFFFGRTRTRTNTTDLVRQAREDVTKLEGPQGAAKAEELAKVL
                     AQMKQVLQGTHETEPNTEQIYQLVTAMIEEDLLYLLAVHLHRFPFESRKDTQVIFSYV
                     FRFRPPTGPQKPEPLALAYVVERRPQVLVELCRGYDHKESATPAGTVLREVLKNEAAA
                     AIILYDDGDEEGSSARGIGGINPDRTQSGRGVFWKFFDWIDKSSFEVSADAFTTFREL
                     ITKHKELVPRYLAANFDLFFDRYNNVLVQSNSYVTKRQSIKLLGEILLDRSNYNIMTA
                     YVDRGEHLKICMNLLRDDRKMVQYEGFHVFKVFVANPHKSVPVQKILIMNRDKLLHFL
                     SHFLEDRTEDEQFIDEREFLIKQIRNLPPAPVPPQQR"
     gene            complement(521507..522557)
                     /locus_tag="MYCTH_2316445"
                     /db_xref="GeneID:11506546"
     mRNA            complement(join(521507..522249,522312..522424,
                     522491..522557))
                     /locus_tag="MYCTH_2316445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666525.1"
                     /db_xref="GeneID:11506546"
     CDS             complement(join(521965..522249,522312..522424,
                     522491..522509))
                     /locus_tag="MYCTH_2316445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666573.1"
                     /db_xref="GeneID:11506546"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="JGIDB:Spoth2_2316445"
                     /translation="MAKVRANVSSSRRKSRKAHFTAPSSVRRNIMSAPLSKELREKYN
                     VRSIPIRKDDEVQIVRGINKDKEGKVTSVYRLKYVIHVERVTREKATGQSVPVGIHPS
                     NVVITKLKLDKDRENILARIKAGREQAAKSKGKSKA"
     gene            complement(<523142..>526280)
                     /locus_tag="MYCTH_2130496"
                     /db_xref="GeneID:11506547"
     mRNA            complement(join(<523142..526014,526124..>526280))
                     /locus_tag="MYCTH_2130496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666526.1"
                     /db_xref="GeneID:11506547"
     CDS             complement(join(523142..526014,526124..526280))
                     /locus_tag="MYCTH_2130496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666574.1"
                     /db_xref="GeneID:11506547"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="JGIDB:Spoth2_2130496"
                     /translation="MQHEPPSRPHHGAANHHASSDHDADSPPPQPDSTISSVFHYISG
                     RHESYSDEDIALVHEIVTLGESLYPTLPERERLPTNALFLAAEDVLPRHGLDPENTPP
                     HIARLIFKIGGQRSGNTLSDKFRAVLGGLGIQLEFVPSSPPARPDSRASFALSYTNTS
                     DLHTNSNQDFEPSRETYADQRDGGRDPGRPENGHDEARILSAVEPFTASRLRSGPGSR
                     PFQLPIQPGAGSLPVVDVDAGVLERKLQQLKMQEERELVQDVLSIWRATTFQTKRVND
                     ELMSIAVEYDNNDLLGEVLDIWNEEAAAAEQLRLEAERAAEHEAYVERMERRATRVYE
                     IFTIHTVLAEWQERAQEELDRTAVARRHLVRKRTFEGWHAQHIKDQTKVKNFILNNVL
                     QKWSQVALHHEVRREVAVQWHQQELCKRSFHTLWQETKERAADEFYAVGLASHCLSIW
                     VNKACEIQDEYQVAVALDERLVLDEAVNIWLEEVDIQQYNAYECTRQWLVQGCRRDLD
                     YWQEQARLSALLKQHNAKEEQALKRRVLEALSIALRKVKRDTAVADAFLLTEPVDHWE
                     REMRLKLFLERDELEMKAAVLEHWALEEKLAWYKGHLETRNKRQTLNTLFAAARQARG
                     ERERHEEEADYVDAYYTQTEVLDTWIEGTDQMWKHRQNANLVNLYRTTRPCIDHWRER
                     CQQSQARDGFYWKRAEKHRARSIVSAVLEKWPAVAETARRERMMTSLRQFRRKYKVEL
                     AQECLGKWLDATVDALDAQHDARQTNLHYKREDLNECLDLWNQAAKRAEGIQQIAADA
                     EVEVYCVKWQAQLQEAKENMQDAIEYDAEQTRKRCWEKWEFQNLQNESKRHMAATLQE
                     KNERRVCRRILAEWQQKAVPEAAARNDLRLSTLSARRSVRQQLARPSTATTGFYTASQ
                     LATLRPRDSVSSLGPMPEFDDEPLMPDPDDPGVMSTPTKWTGSTRVLGYRPTSTPSAI
                     LPSPYERELRRQYGASALKARVGFADINEDSAEDLYR"
     gene            complement(527022..530922)
                     /locus_tag="MYCTH_2311378"
                     /db_xref="GeneID:11506548"
     mRNA            complement(join(527022..528444,528499..530200,
                     530266..530619,530681..530922))
                     /locus_tag="MYCTH_2311378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666527.1"
                     /db_xref="GeneID:11506548"
     CDS             complement(join(527336..528444,528499..530200,
                     530266..530619,530681..530755))
                     /locus_tag="MYCTH_2311378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666575.1"
                     /db_xref="GeneID:11506548"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="JGIDB:Spoth2_2311378"
                     /translation="MSIDFPKEEEAIIARWREIKAFERQVELSKGNPNYTFFDGPPFA
                     TGLPHYGHLLASTIKDIIPRYWSMKGYHVERRFGWDTHGLPIEHEIDKKLGISGKAAV
                     MELGLEKYNAECRAIVMRYREEWRHTIERLGRWIDFDNDYKTMDRTFMESEWWVFKQI
                     FDKGQVYQGYRVMPYSTALTTALSNFEANQNYQDVTDPAIVVSFPLNDDPETSFLAWT
                     TTPWTLPSHLALAAHPDFEYIKIHDEKSGKNYILLEKLLGTLYKDPKKAKFKVLQKFK
                     GKEMLGWKYQPPFNYFYEEYKDVAFKLLNATYVTDDSGTGIVHQAPAFGEDDYNVAVE
                     NGIVTEKRPPPDPVDDAGRFTSKVSDFAGMHVKEADKHIIKHLKNSGRLVVESQFKHS
                     YPMCYRSDTPLIYKAVPSWFVRIPEIIPQMLKNIEGSHWVPSFVKDKRFASWISNARD
                     WNVSRNRYWGTPIPLWVSDDLEERVCVGSIAELKELSGYEGEITDLHRDKIDHITIPS
                     KQGKGTLRRVEEVFDCWFESGSMPYASKHYPFENQEQFAKSFPGDFIAEGLDQTRGWF
                     YTLLVLGTHLFGVSPFKNCVVNGIVLAEDGKKMSKRLKNYPDPNLIMAKYGSDALRLY
                     LINSPVVRGEPLRFKESGVKEVVAKVLLPLWNSYKFFEGQIALLKKMENVDYVFDPSM
                     ESSNTNVMDKWILASCQSLLKFVNEEMAAYRLYTVVPKLLELIDNTTNWYIRFNRKRL
                     KGENGLNDTLHALNTLFEVLFTLCRGLAPFTPFLTDNIYLRLLPHIPEHLRGPDPRSV
                     HFLPFPEVRQELFNAEIERRVQRMQKVIELARYSREKRNIGLKQPLKTLIVIHHDPQY
                     LEDVGSLQGYIAEELNVRDLVLTSDEAKYGVQYSVTADWPVLGKKLKKDMARVKKALP
                     NVTSEEAHGYATTGKLVVDGITLTEGDLVVKRGLKEDDSSKNLETNTDNDVLTILDVE
                     IYPGLAEEGLAREIINRVQRLRKKAGLQPTDDVKMEYQVLSDPEQTGIEKVFETHKPT
                     ILKALRRALDKHEATHVDGQVSDKKEEGLIAEEEQEVGKATFLLRLLKL"
     gene            complement(<531675..533960)
                     /locus_tag="MYCTH_2311380"
                     /db_xref="GeneID:11506549"
     mRNA            complement(<531675..533960)
                     /locus_tag="MYCTH_2311380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666528.1"
                     /db_xref="GeneID:11506549"
     CDS             complement(<531973..533723)
                     /locus_tag="MYCTH_2311380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666576.1"
                     /db_xref="GeneID:11506549"
                     /db_xref="JGIDB:Spoth2_2311380"
                     /translation="MVSHHGDGVTSLMVRGPSSVIGTSSSGRGTGLHSSSRSRRYNRS
                     HAGGTSYVPQNEFPIFSQTGDVEIIVRVPSGHENRYLLHRHILTRCSGFFEASTSNEW
                     SRAQAVPELPAPGTVGAIEAGNADGGELARIETDRGESSDGGSRPGSLALSQPKKRWR
                     YELDYGSDDNDIPMLVQKEEIDNPPPVANSLFGGSSSSHSSNRPSHRKSASHSFFRSV
                     ANLSLSATHASSLPPPTPEEEDLLRDYDNLFRIMYNYPPVLDAVNIADGYVQCKSLLH
                     LADQYDALAVVGPRVDHHMLQFQSRLWKQIAKYPISYLRLGYLARSKVIFQEALIHVV
                     GQWPAGERSIRAALPESVIDIIEDKVDELEETVSRVEARLFRLTLTTRSGERVTPANS
                     YLDWLAVSLFRQWLAENTSPPMPPAPERPRGGGSSARNTSGQRARLGSSGSGSGGSAI
                     NGPSGDHGGGGGSGANASNNMQAALPPATPSLASLGRTYRLLGGGVGPGGSGKGYLGH
                     DECKRFLKLTPELYTRDNLRKFEKRIDELKAMAREVVRPLMGSGLELEMVHGAGAGGI
                     GYLTCITVRDRDLPWAY"
     gene            complement(534985..>536934)
                     /locus_tag="MYCTH_2135849"
                     /db_xref="GeneID:11506550"
     mRNA            complement(join(534985..536181,536414..536507,
                     536834..>536934))
                     /locus_tag="MYCTH_2135849"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666529.1"
                     /db_xref="GeneID:11506550"
     CDS             complement(join(535240..536181,536414..536507,
                     536834..536934))
                     /locus_tag="MYCTH_2135849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666577.1"
                     /db_xref="GeneID:11506550"
                     /db_xref="JGIDB:Spoth2_2135849"
                     /translation="MERGERLTTGGEQADLTTYGPLPSSAALKPLQDRPSAAYTTRLR
                     AKSSPRPPNAPTSLSLSHLAGVVKMPSFDRVYASSPVLAIPAQTAHPVSLDKSFLQHQ
                     ILPLSQPASWRPQLVRTCTAAGRKRSRDEASVNLDPPEKLVELPVKEREDEWVYGPGM
                     TLIKKSAGYVADASNQSGTWLEERVAAEEARKTEAALLAQQQLAQSRPSLRSHKSQRL
                     DMTTTSISSDGMLSGCRSSPTREAINPVTASSDSLAQPIVDDFTLHLGIGWSRISDNE
                     HIQAAARGWARFIENHYPVTNAKILLESRGLQSYLVEATEGYFLFAENLRQGRLVSTT
                     SEGALDNLKVSPPVFDGLEIMNASASARSLDSIASTTSADIDMS"
     gene            complement(<537616..>539008)
                     /locus_tag="MYCTH_2071385"
                     /db_xref="GeneID:11506551"
     mRNA            complement(join(<537616..538064,538170..538303,
                     538449..538489,538556..>539008))
                     /locus_tag="MYCTH_2071385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666530.1"
                     /db_xref="GeneID:11506551"
     CDS             complement(join(537616..538064,538170..538303,
                     538449..538489,538556..539008))
                     /locus_tag="MYCTH_2071385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666578.1"
                     /db_xref="GeneID:11506551"
                     /db_xref="JGIDB:Spoth2_2071385"
                     /translation="MLRPRPTVIFLTHADITEVVHRRRFRRFLEYDNDDACVTLAPTD
                     PETTHLVKESKSSSSRTFKYDRTPEAYDSAGYISPSPPYSRIRPLTADLPLPLPAGMG
                     AEGNTSSSPNACSSQTSSSKTRRNQQRGSVWTRQLCLRPKRSVPPAATASTNDGSRTE
                     RSRAAEQACLLSDGTDARRDAAGQSTQQHGMRSESFTTPLTPSPSSACVCSQDFDRSL
                     RADVTDSGAQESRSDVSSPVLVMRTPGRLRVYNDSLPASSQPQTPQHLLEARHQSQLQ
                     AHYTAPVRRTSPHMLWARTTTWSRRYFGRRREPSPLGLQSPGFRGLYGSVENRDDAEL
                     GQEMAEDMTQRWGGALRPRPSSTG"
     gene            540298..543190
                     /locus_tag="MYCTH_2311384"
                     /db_xref="GeneID:11506552"
     mRNA            join(540298..540490,540584..542643,542700..543190)
                     /locus_tag="MYCTH_2311384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666531.1"
                     /db_xref="GeneID:11506552"
     CDS             join(540484..540490,540584..542643,542700..543059)
                     /locus_tag="MYCTH_2311384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666579.1"
                     /db_xref="GeneID:11506552"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2311384"
                     /translation="MNDDGHTIQPTSNGETEEGNASETLQNARLESAARDAPPGQPHT
                     YESAAAILKSAQNNLNAARGIWGSIDSEGHQQGTQYGPYQPSSEGQPPGSAALPTQGR
                     VVEHDPQGGPYAGPRNEQSRSSIYGARSDPRFDQSSPAQIPSREGSRSHHAGRPGPPK
                     TGNGPNGMMPVRKSSKVMGGGYAPIPGIPQAPPGSYGPEVPMLASSEEWKDRGAAVSV
                     KREVDSEGRTVIRSVKKGVRDFSFGRILGEGSYSTVFLATDRQTLREYAVKVLEKKHI
                     IKEKKIKYVNIEKNTLNRLTEHPGIVRLYYTFQDEASLYYVLDLCNGGELLGVLKKTG
                     TFDVDCTRFYGAQILDAIEYMHSRGVIHRDLKPENVLLDDQMHIKITDFGTAKLLPDP
                     RDPRPPEDSSGQNNAQDDKRNASFVGTAEYVSPELLTDKAVGKPSDLWAFGCIIYQLL
                     AGRPPFKAATEYLTFQKIVSLDYEFPAGFPPAARDLVERCLVLDPARRLTVEHIKNHE
                     FFDGQQFGKELWRTKAPRLRPYVPPAQEPHVIQLNGGGSSPQKPPNSRGAHGPPNGSR
                     PARIITELPPPTQLDIEWSPVLTRNNERILKLGDLMVISSPIPNSQHGRGDGDGHKKL
                     ARFFGGSTTKKRQRLVMVTSSGRILLAPAGGEEKRAKQEISLLGSDCVWKTQIDSKGQ
                     PVWCVDTNGIHYTFEEPKSSQQNSDAKFSVDDWIESLERAKDLAISQNLIGTYNSDNG
                     FGDMSSSMSSPASTMGGGLASYSEGGYSVSDRSGRNQPSKSQASLEEVNVKRNRFSKR
                     QSKNGLGAAF"
     gene            <544389..>546000
                     /locus_tag="MYCTH_56853"
                     /db_xref="GeneID:11506553"
     mRNA            join(<544389..544661,544724..545401,545482..>546000)
                     /locus_tag="MYCTH_56853"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666532.1"
                     /db_xref="GeneID:11506553"
     CDS             join(544389..544661,544724..545401,545482..546000)
                     /locus_tag="MYCTH_56853"
                     /note="Contains conserved domain COG5531[COG5531],
                     SWIB-domain-containing proteins implicated in chromatin
                     remodeling."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666580.1"
                     /db_xref="GeneID:11506553"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="JGIDB:Spoth2_56853"
                     /translation="MMSAGPHHSVPMTQAQINQQHHQQQQANHLAKLRSRKPTDKNLP
                     DGVEEALAAGSDVATSYKQLRDLERRLDATMTRKRLDIVDSLSRNTKRYKTLRIWISN
                     TVEDQFWQNNGLNVDTFDFSSNLESSYRVKIEGRLLDDEWEAEVEEEERKGSDDNRNN
                     SSGNSNETDGDKMETDSPSKTKAKPAPTKRPRLSHFFKAITVEFDHPKSGRQGAETTV
                     EWKKPDRPPAGAGNLPAMADFDEFTFKRNGDENVNITINLYRHEDPERFELAPALAEI
                     VDMREATRQEAVMALWEYIKLMNLQEDEEKRNFRCDDLLKKIIPRETGYIPHLNDYIT
                     PHLRPLPPVKLAYTIRVDEEFHKNPQPTIYDVRVAVDDPLRARLLPFIQNPQYAAMLK
                     EVAGLDDQLATLIQAVAHSKAKLDFLTSLSKDPVNFVKGWLSSQKRDLEVIMGEATRG
                     GGEDAAGDEWRRGGPNSVWATQNARESVNVLLAKQPARV"
     gene            complement(546202..549288)
                     /locus_tag="MYCTH_2311387"
                     /db_xref="GeneID:11506554"
     mRNA            complement(join(546202..548851,548919..549055,
                     549119..549288))
                     /locus_tag="MYCTH_2311387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666533.1"
                     /db_xref="GeneID:11506554"
     CDS             complement(join(546318..548851,548919..549055,
                     549119..549132))
                     /locus_tag="MYCTH_2311387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666581.1"
                     /db_xref="GeneID:11506554"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="JGIDB:Spoth2_2311387"
                     /translation="MGIKGIYKEIGPGDRISLCKLAIDTLEQTGRPLRLAIDFSIWQF
                     QVQAARGGANPAIRTLFYRLTRLLGLAIRPIFVFDGPNKPAFKRNKRSSGRGDSVSIA
                     MAKRLIRLFGFTIHEAPGEAEAECAMLQQKGIVDAVLSEDVDTIMFGCRKTLRNWSAE
                     GSKGSKTPTHVSMFDADAIAAGPTKLDREGMVLVALMSGGDYLPEGVPGCGVKVACEA
                     ARAGFGRDLCRIKRADRDGLAAWKARLLHELRTNESGFFRTRHKALHIPEDFPNMEIL
                     RYYTHPVVSREAAVDRVKREFLAAGNVDIVGLREFTRQTFDWEFKIGAIKLIRVLAPS
                     LLVQKLLERYELAEQHPDDLELKQKEESALVKAISNKRAHFSTDAIPELRISFVPADI
                     VNLDLANEPEEVVEAFGRSGIALNSDDEFDEDAAQEFTGEQSKLGGRKPFDPLQPELA
                     WIPVALAKLGIPLTVEDWEGKQRTKEQRVAAKLTKKQKSNKTDMPVGALDKYVKVIKN
                     LGNDTTNDAPKPELALSPPRINSQRNPPAPKGRSKQYKKTSSSSQAEPAADLNPWTLA
                     SLHASPRVAKSLPSATSQPQPKPSSTRETILISSSPAAAASPAVPRSSVSDPPTTPTR
                     AKRVSPLVETNPSPPSVFHASPGPREHRLSDSGEPVEEEQSTGSPQLPRRARPFKRVK
                     SGAGDTTRPALAQKSIKGFGRVLKNQRPSQEKSKRDINDAQQIEIVSEDDNVSLSPHK
                     RSLTSESSDCNPTPPGGGGFNISSDDDPFAALPPPCRLASPCSRAVSIATPDASSKSK
                     QGQEENDAIDGTDTGEVSTGGAATVVPPAHKSTKTKILIPRTSLDGEGYFTTLEVDRE
                     DADRIMAAHNERVLQGKAPRRRAWRQSEVSVLDLTGED"
     gene            549511..551555
                     /locus_tag="MYCTH_2311388"
                     /db_xref="GeneID:11506555"
     mRNA            join(549511..550080,550137..551555)
                     /locus_tag="MYCTH_2311388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666534.1"
                     /db_xref="GeneID:11506555"
     CDS             join(549647..550080,550137..551418)
                     /locus_tag="MYCTH_2311388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666582.1"
                     /db_xref="GeneID:11506555"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="JGIDB:Spoth2_2311388"
                     /translation="MSAPMDSAPLPHRSVANIRSPAGVGHHHQTGPSTPLRSIPSNFG
                     SPSSLRADEEIIIIEFGTRKLQVGFSGDPAPRGCVWFGPDQQRRAGDFRAWQTDYRYD
                     WRTATAGGLWGKDHELWQYDVRGADLGLVGDKIERALREAFTKHLLIDSRPRRMVWVI
                     PSSLPIPLLSAALDSVFTRFQPPNISLLSSPLALAVGAGVRSALVVDLGWAETVVTSV
                     YEYREVDTRRSIRGGRMLVEQTHKLLAKHLPQTQSGLDDSQDHVVSFEECSDITTRMV
                     WCKPRRASNANRASSDVLAPVQEQDEGEPQVHTASGRTSSVKIPLRSWLSPTTLELPF
                     DALAEPCEDAFFDSQYAPTSFDDHELPLHLLVYRSLLQLPVDVRALCLSRIIFTGGCS
                     NVLGLRGRIFDEVTQLVQERGWDPVRGRAVEQLRTNPNLKRRVSRKASSTSAGTASPG
                     DEDGSEEQDGIWHDAANTIPEVDTIEEQLKRRYDEVPPIHGDLRAIESLGAWSGASLV
                     THLKGAAVATIDRELWLQHGAAGASRASDVDHKTQRQSLGAGSLIRSSAAHHTNWTLG
                     IWGAV"
     gene            <552809..>555679
                     /locus_tag="MYCTH_2121166"
                     /db_xref="GeneID:11506556"
     mRNA            join(<552809..552957,552993..555275,555337..>555679)
                     /locus_tag="MYCTH_2121166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666535.1"
                     /db_xref="GeneID:11506556"
     CDS             join(552809..552957,552993..555275,555337..555679)
                     /locus_tag="MYCTH_2121166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666583.1"
                     /db_xref="GeneID:11506556"
                     /db_xref="JGIDB:Spoth2_2121166"
                     /translation="MARRTYTLTELLGLRTNRVPNEVLAMANDPEIGTVTRTHCFSFL
                     EICLTCESSSASCRPPTSRHKDDSSVTSDELVFKGTVSRRMGRDFAREASQNSIRGLS
                     REIPRGAVQAVGPESAQNPPHPMEWKYRGRSDTEATTAEPIPAPTGVSAQRDEGFQRF
                     YKAVVSPTHVRVTAGGRIVPNTRGPPSPTTKRANDNSIMDSHGLSDKAAISQPPTAPV
                     SLSQAVPIVSPLVTGYPSGFQPLQTPVSFVPMTLGAHLHPGFPFPQGAVSPASMAPFI
                     PASALKDLHSTKATEDDKQSKTKTSLSEPFYYNGQLICPVGTFPGPLGSPVVPVHMVG
                     IPQGVAPQLPGNYMQPQSTQASSAATGSSYVTSNQSLSGLPSVVNHIVPANANFSGNT
                     APPISSIRPSDITKKQIGSFKQNLKYHEDQLQYNRHQIDEKDMEQRIQIIKGHIQRFE
                     QTLKTQLEYEEAHFKATQGKNNGVPAQAGMAVEENKAQPQPPTLTVPLGYGAPGIKKE
                     PDEAINQGVALATHGTTINVDQSGKPLHKSHVELASTGISSKPNAAGLPNEAATAPIF
                     QPSGYASTWIGSKYAREMKACEEADKRIHALGVENTESLCEGEQRSVSQPFSASMAAA
                     AHSESSLHGSDERGRSGSNSTKPQSGYGVPYLLGTLPKGVNPRTARDQDYVYKRPLTE
                     EERRARFLYWGKAPKSAVRGLPKYDGKHFYPPSPIKEPSAEQAQDSSCRTTDSDGDPF
                     RPMTPVQRVNIKGVSVSEDNCVSARLTRTISFETQVNGGSEDFTGGAPLKCENSLDAA
                     SVGQSDRRWDNTSAKLWQAVLRKGATSSALSSTTAQGFLPHYTGNAAASLTPSLSTNQ
                     ISSTRDISSGKLSDVQDLSENSGPAPSNVPEKRRENCPPSGVSSLEDQFKHLAVDDAT
                     RREMAPAFSM"
     gene            complement(556284..558566)
                     /locus_tag="MYCTH_2311391"
                     /db_xref="GeneID:11506557"
     mRNA            complement(556284..558566)
                     /locus_tag="MYCTH_2311391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666536.1"
                     /db_xref="GeneID:11506557"
     CDS             complement(556368..558497)
                     /locus_tag="MYCTH_2311391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666584.1"
                     /db_xref="GeneID:11506557"
                     /db_xref="JGIDB:Spoth2_2311391"
                     /translation="MPKQYVVCGRPVPRLGTRHISLLLACLALFALFSLLITAPGSVP
                     GYSPRNPGVRAAGNTFSVPKTFKSPWMDKLNPFKPPSHPPRVQKGDTDGESVWHSSWN
                     WLLMPFSGSVTLDENRALLPVLKERTPVYCYYDGDAFRGGDRASAEAESALLLAWRRA
                     WWAQGFRPIILTSAEATNNPLYQEVQKLQDISPALKVDLMRWLAWQAMGDGVLAHHLL
                     FPMAPHDDPFLTYLRRGEFPKLTRFKDLDDGLLVGSADEVLTLIKTAMDGAETSKAEG
                     VVATAESGKDGGVSLILVEDTPTSLAYYSPSRVEALYPKVGDLLRASHAAGVRSLTQL
                     VNSHLHLIWQNTFADGISVVKPLPHHTTLLITPAYELAQRLAHCPESPLPESCPPNRL
                     NCRPCGDSKPLKIATPSSYQDADTLYTIGTVPHPYTSSTLNYLKTQLSIPWIRRRSPR
                     DAWITSLTSSFFTDKVSTTPRLIRFKEAVASDEPSPVETKDEGKGEKSTRGGGGAHRS
                     LWLPAEQPIPDDLDWHFGFALPDRASYADQSSAPVDTVGTQTRIPLHSSEDGPQPTES
                     DLALEPALLSRAQLIVLSSSSSSSSSSSRISGLLKSSAKPKAPQASREDLALRDAVEA
                     WNLADTEAWRFARAYLARKSLERREWEEEESKYAGGLGTEKSLAKGTSTSTSTSTSTS
                     TSTSNPRKGSGGRGAGGNVWDRWLDRD"
     gene            <559414..>560437
                     /locus_tag="MYCTH_2130506"
                     /db_xref="GeneID:11506558"
     mRNA            join(<559414..559492,559633..559855,559921..559940,
                     560043..>560437)
                     /locus_tag="MYCTH_2130506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666537.1"
                     /db_xref="GeneID:11506558"
     CDS             join(559414..559492,559633..559855,559921..559940,
                     560043..560437)
                     /locus_tag="MYCTH_2130506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666585.1"
                     /db_xref="GeneID:11506558"
                     /db_xref="JGIDB:Spoth2_2130506"
                     /translation="MAFCLRARPGRLPMGERVRRELMRSVDHAPAVAVAVRVVATLPV
                     GGDPGSSRYRVTNPKLGRGGLAEVVHRVDLERATPGAGASSGSRKNRHSHLVVGRISG
                     PKGGGGAMAVGHGAAPFIVASQERTWFEETRAASPSCFEWREEGAVSREFYVAGLEEH
                     VYGCRDNYFSDITIASTTTTTTTASRMSRPTGSPDEEGSGPTTTSGAAPEPTGRPDGA
                     AHRAAPVLLAAGGLVAVLLV"
     gene            complement(560669..563436)
                     /locus_tag="MYCTH_2311393"
                     /db_xref="GeneID:11506559"
     mRNA            complement(join(560669..562426,562486..563436))
                     /locus_tag="MYCTH_2311393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666538.1"
                     /db_xref="GeneID:11506559"
     CDS             complement(join(560750..562426,562486..562887))
                     /locus_tag="MYCTH_2311393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666586.1"
                     /db_xref="GeneID:11506559"
                     /db_xref="JGIDB:Spoth2_2311393"
                     /translation="MAATHQPPEPTVSRASSPTAAQPPNQRSPPRRALPDRDVDATSI
                     EDAYVAFILYCNPAVPADTDATALREAFRTPPKSGGKSFSTYTLFELIKQLETKKLKT
                     WAELALKLGVDPPDQEKGQSSQKIQQYAVRLKRWMHSMHVDAFFEYLIGRPSPYWTEI
                     PPEHIPVAELERDGVAAEDDMALRALLPQIKPRRGRKKPEDEEPGKSPPQRPSPQRDE
                     AGGGRPANTSEPWTAQPDGRGSVFLFPPVPDPSRLHPSAPSWGNDVAQTPMSAYPVPQ
                     SAITPSSRNAFWADEPKSAITPSKPKSASRRHGAKVVSSAWRSGGLGAGGKTRGRPPI
                     NRGGNAEGPFSAFPTSDGPVFRFPSPTPDKRPAPDSSATTPTSHPSATTSAAVAPGGT
                     SPAGPQAPPPQPKQNTSILSPIQESAASRPAKRRMLSLQVPERKGGEVRLATPPLPEP
                     ATPPAVMVNGQAPEPHQSQTTSRPPEANQTSTTVSGGPISGASGVDSAATSAAASWRQ
                     PIFSPASTDRTNVAEVEALFVSKLLEAEWYDANQSRIPPCGLDEALAISQTVVENLLL
                     AAPSKEAFLINLSGLVGGGLLMPKNCLRVTRLEELPDRTQYSTSWELRFGSIAGTWTM
                     EETVPHAKWKKREQDEGAAPGSATRNGAAGSEAEDWERKYKEVAAMLRQRDEELMRLK
                     SKIVESVRKS"
     gene            564369..565934
                     /locus_tag="MYCTH_85489"
                     /db_xref="GeneID:11506560"
     mRNA            join(564369..564510,564618..565366,565457..565934)
                     /locus_tag="MYCTH_85489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666539.1"
                     /db_xref="GeneID:11506560"
     CDS             join(564419..564510,564618..565366,565457..565581)
                     /locus_tag="MYCTH_85489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666587.1"
                     /db_xref="GeneID:11506560"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_85489"
                     /translation="MSHSKPVLPQNDNVAHALAGAGGGILSMALTYPLITLSTRAQVE
                     SKRAETAFLAAVQNIIAREGVAGLYSGMSSALFGISVTNFVYYYWYEWTRAFFEAAAA
                     KAGRASKKLTTVESMIAGAIAGSATVILTNPIWVVNTRMTARKNTAAADKDSLPGPAT
                     GNKVDKKPSTIGTLLNLLRTEGPQALFAGVVPALVLVINPILQYTLFEQMKNAVERKR
                     RVTPTVAFFLGALGKLFATTVTYPYITVKSQMHVAKAGEKKEGVMEAINRVIKEEGYA
                     GLYKGIGPKVTQSVLTAAFLFAFKDVLYEYSVRLRGSVGRRTVAA"
     gene            complement(565932..568795)
                     /locus_tag="MYCTH_2311397"
                     /db_xref="GeneID:11506639"
     mRNA            complement(join(565932..567291,567343..567804,
                     567856..568086,568138..568266,568332..568399,
                     568476..568613,568693..568795))
                     /locus_tag="MYCTH_2311397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666540.1"
                     /db_xref="GeneID:11506639"
     CDS             complement(join(566023..567291,567343..567804,
                     567856..568086,568138..568266,568332..568399,
                     568476..568613,568693..568711))
                     /locus_tag="MYCTH_2311397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666588.1"
                     /db_xref="GeneID:11506639"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="JGIDB:Spoth2_2311397"
                     /translation="MVPLDKELMDLSINDPTPVPHFDASQEPPPPPLSSEGIVAQDIT
                     QKFLSAAATLEPGELIKDGFFSLFESVGALEIMDPKMDSGCLAPGESLDDDYDVTRPL
                     LPSEVVGIIDQLLCLEMAWHLGYPLSQTLFTSFYVEKMLNPNPGALRDADFVRDGGDR
                     CSRDPMHRVLRAYCLGLLKSCYYVNERIKHEHSYEEEDFVTNTYNRSLLESIDRYEIR
                     DEIIEARNVIYDVRHKLTDEMAHALAFRLELRTAFLRAIELCELRSDPESLSLPWAQM
                     QGVWEAINKTRHLGKPVPEAFSTKIQRRLASTMPPRPIVQPSPEETYEHFKKLIADGL
                     NVLNVLNYADSQSLLNFVLTFQAQKPQPLVFIRSILQNFLFHDMVILGRLSIRQVLDD
                     DLSIVVLPSSLLLDPANDSVEAPHHPRYAIAHQMELFRQRAAQSYLDIFRAFCQNRCR
                     VRRTLFHSLQDWEMVQADAEEIDQLLQLQTEEKPLVYPPSGDEASHSLPLSSWAYHYK
                     LRLMEWTVQLGFELEIYQADELAGMYWYLSHLSKTRARHLERIKFFTTHRLETSSAAA
                     ATTASNAKAASTASSPQYARSKSYLRVTTLEAALTSELAAAFCDLYIALQRLSLIPRP
                     PRPYGTDALRYEVRMKSFANIGLPELPSFEAFSHAVNQPDTPTIKLLDNAAAAAAHAH
                     AGLEVMAKMSAIEAFAVGSHERWLESVKGWSKAATALGMAVSKVKKAVTAAAAAEGSG
                     NDGVGGRLQVQVPRPEEGYHEWWIVPKVTER"
     gene            complement(<569854..572405)
                     /locus_tag="MYCTH_2145409"
                     /db_xref="GeneID:11506640"
     mRNA            complement(join(<569854..569940,570026..570140,
                     570271..570359,570805..570894,570955..571790,
                     571856..572030,572130..572405))
                     /locus_tag="MYCTH_2145409"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666541.1"
                     /db_xref="GeneID:11506640"
     CDS             complement(join(569854..569940,570026..570140,
                     570271..570359,570805..570894,570955..571790,
                     571856..572030,572130..572387))
                     /locus_tag="MYCTH_2145409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666589.1"
                     /db_xref="GeneID:11506640"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="JGIDB:Spoth2_2145409"
                     /translation="MICRPALSRGSQLALRRQGAAKLAQRGFAAAASPKPSYEPTTIA
                     GVKVASRDDNGPTTRLAVVAKAGTRYEPLPGLTVGLEEFAFKNTQKRSALRITREVEL
                     LGGQLNAYHTREALVLQANFLRDDLPYFTELLAEVLSQTRYTTHEYHEEVVNVIHQKQ
                     AKLDAAAIALDAAHSVAFHTGLGAPLYPTPSTPISSYLNENSVAAFAEAAFTKGNIAV
                     VADGASDAGLSKWIEPFFKAVPAQSSSSLSNAASKYYGGEQRIARPGRNAMVLAFPGA
                     ALSSSQPETAVLVGLLGGESNIKWSPGFSLLSKAATAAPGSTVKATNFAYSDAGLLTI
                     QINGPAAAVRKAAEESVKALKSVAEGGVSQENLVKAIAKAKFNLLSGGEVVGTGLLHA
                     GTDLIHGFSQPLKVAETVKALEAVTTDKLKAAAKTLLEGKASVAAVGDLHVLPFAEDL
                     GLKKRIPIQQDSATSQPAKLAKMTFAWKAAGITYNRYLAVAARALRRSLKEDKRLAAE
                     RRGQQELRFAKWTNGKQGELRNLADANAQAAVESAATGGTA"
     gene            572721..575179
                     /locus_tag="MYCTH_2311408"
                     /db_xref="GeneID:11506641"
     mRNA            join(572721..572910,573007..573069,573159..573932,
                     573992..575179)
                     /locus_tag="MYCTH_2311408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666542.1"
                     /db_xref="GeneID:11506641"
     CDS             join(572902..572910,573007..573069,573159..573932,
                     573992..575158)
                     /locus_tag="MYCTH_2311408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666590.1"
                     /db_xref="GeneID:11506641"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR013197"
                     /db_xref="JGIDB:Spoth2_2311408"
                     /translation="MLVTKPAAELCALLVDELHGELPSRIFAMLLSKGRSTVPQLSQY
                     TSMTPRQVRHGLAVLQQHNLLFYHVDPGAEFAYYEANPDHAYNLIRSGKILEMIDTTF
                     GAPAKDVMQSLLLSGQTRISDLVAAYQEKIEQANKSAAGVGNEDEVGAEPNGLHGDSQ
                     SSKKTGPLVKSTAHLNSIICRLVEAELIDVVHAKSFESPEDVLKSVEKEVMDKYFPNG
                     VKGNKAKAELQERIAEGLRKVRGESKSLKRKLEQNGTAAKRRKLMSGIGAVNGVQDED
                     MDPALDPRQVIRINYEKCLVDLRNRRLVQYASDMIGETTAYVYGILLKLLTKDVPRCR
                     LDPVLDAENDNDEGEKGPGSVTTEQILDNLKTSVDLSLGIGKAERRHISSTAAEKIER
                     YPPQKKVLIEEAEVDGEASADEDEGDDESSEESDYESDYKAPTTNGTNGVNGTNGTRV
                     KFEDATAPKERRMDRPTQLRQHLLILAESTQHFVRHCGPDEWTVDFGPVMNSLREAEL
                     DSVIERTCGRQGLRLVRILRAKGKLDEKALPNVALMRKPELQQKMLEMQTAGFVSVQE
                     VPRDVKADVKKSFFLWYCDIDRSLKRLLDTSYRTMVHCLQVLEALRQKERDVLETTKR
                     TDVRGRERDIMRKSYYERYSRFLDCERKLFAQVMRIDDLVSVLRDF"
     gene            575821..577794
                     /locus_tag="MYCTH_2311411"
                     /db_xref="GeneID:11506642"
     mRNA            join(575821..576078,576154..576191,576293..576334,
                     576424..576671,576743..576920,576990..577244,
                     577309..577794)
                     /locus_tag="MYCTH_2311411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666543.1"
                     /db_xref="GeneID:11506642"
     CDS             join(576015..576078,576154..576191,576293..576334,
                     576424..576671,576743..576920,576990..577244,
                     577309..577395)
                     /locus_tag="MYCTH_2311411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666591.1"
                     /db_xref="GeneID:11506642"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2311411"
                     /translation="MSPPMAGAKEKESNLARLLGSGSAGIAELAIFHPVDTIAKRLMS
                     NEGKVSSLSQLNTVIFKDKASAPLGRKFVSLFPGLGYAAGYKVLQRVYKYGGQPVARD
                     FLSKHYGKDFENAFGKKTGKAIMHSTAGSLIGIGEIILLPLDVLKIKRQTNPEAFRGR
                     GIFKIIKDEGFGLYRGWGWTAARNAPGSFALFGGSAFAKEFLFKLQDYNKATWFQNLV
                     ASIAGASASLVVSAPLDVIKTRIQNRNFENPESGFRILSNMARKEGPTAFFKGLVPKL
                     LMTGPKLVFSFWLAQTLIPAFDTAFRK"
     gene            complement(578007..581615)
                     /locus_tag="MYCTH_2311416"
                     /db_xref="GeneID:11506643"
     mRNA            complement(join(578007..580862,580939..581615))
                     /locus_tag="MYCTH_2311416"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666544.1"
                     /db_xref="GeneID:11506643"
     CDS             complement(join(578362..580862,580939..581155))
                     /locus_tag="MYCTH_2311416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666592.1"
                     /db_xref="GeneID:11506643"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2311416"
                     /translation="MEHTRRTADAVVDLPSYRAATTRPDWLALVAPYVRINDYARLCL
                     VSRHFYRQFAPRLWNDPLAVMRSLNPHCDPGCLIRFMRHVKTRVRATTPGNLVRSFDT
                     RWVSQSYDYAVFAHAGVGGAVPLSSLLLSIASGFPRLRCILLDGYPNLAHEPPGSPLA
                     PDRLPPFEPPFEPPFEPPLLLSTARCQVALPPSFFASPYLKRLVYLDVSDMPGSLRHP
                     LAQRTLSPANLPGLRILKLRGREMDDATATLLFKTFGEQLWSLDLSRNKLTGDALDAL
                     NQFSFPSQTSRTDHYSVEGRIAWLLTGSPSFGTFCTVTESEWSADFSHPHRHIADPPC
                     YIAPGEAGPHPTIAPRLDGRVKILPDSADAVKAMLSGGVGSHSPPLESVQIADVCRAP
                     HGITHLYLSSNKVSAEGLSRTIRSSPGQLQRLECDSVSFKLPDAAPPSWLSKARLSGA
                     LGCAHLFRPVFSANLQVLRIHHSVVTQLLTLSLDRLSPMANMWVAETQLLPRAELAYP
                     EAFVPDMNPRLQSLVLTRIPRYSTGPLIDKLIAFLNLASIQERAIQDTKSASRHGPVT
                     LLGLRHIRLEFDPDPLEDLSRDSFGLELGFDAAAVMEDATKEFSFFGDSGWSSVLSTD
                     KAASRATPPNDPESEPNPRGSESEPTRISQSARSHPPHPPSSVHAPAPVAPATACPDE
                     TSVFPRHPDHHHHDSPERPKRQLNHVRIPHSWTWHKGATPLSALVWAGYSSDRQEEEG
                     AGGEGGEEGSGDRDDGSAPPAVREYTRLLRAHPQLRCDPVPATPCHVRAGVPPGELLF
                     GPAWASILCPPPSPSACATTAAAAAAAAAGASRPAVPTRQQLRGMRDVVKAIKEYRAR
                     TRQAYEAAKKEAEARGEQVRCGPPHFHWGGRLEVEVDGAGAYHQSRYWR"
     gene            <600280..>601302
                     /locus_tag="MYCTH_2130517"
                     /db_xref="GeneID:11506644"
     mRNA            join(<600280..600460,600521..600675,600772..>601302)
                     /locus_tag="MYCTH_2130517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666545.1"
                     /db_xref="GeneID:11506644"
     CDS             join(600280..600460,600521..600675,600772..601302)
                     /locus_tag="MYCTH_2130517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666593.1"
                     /db_xref="GeneID:11506644"
                     /db_xref="JGIDB:Spoth2_2130517"
                     /translation="MGRYVRPRAREPIFSEGHTNEFCGTRDSTPEAAGACAPLRIGRW
                     VYEKGAGKPEARGNCYFSHPLAARIRPSWWLRAREPIFSEGHTNEFCGARDSTPEPAG
                     ACAPLRIGRWPSQAAVGPISYVAAFAWCPTVCRGTDDCGEHRLSTAAATGATSPGGAR
                     GIWEDSAGVREYPMCAEGWAMWVLGGSPDLSKATGGTYRLGTPTGLNLPVGPPLGALR
                     RRLRGAIAPRSRPPTALWGIQEGKADVTRGSTGALPDELRGHAGPRARRPSNLVNSSA
                     LKHGRLALTGSR"
     STS             601323..601873
                     /standard_name="PMC106412P1"
                     /db_xref="UniSTS:270119"
     STS             601704..602500
                     /standard_name="PMC343294P1"
                     /db_xref="UniSTS:273189"
     STS             601731..602251
                     /standard_name="PMC125238P1"
                     /db_xref="UniSTS:270483"
     STS             601845..602348
                     /standard_name="PMC104890P1"
                     /db_xref="UniSTS:270115"
     STS             602237..602313
                     /standard_name="PMC152246P1"
                     /db_xref="UniSTS:271203"
     STS             602314..602607
                     /standard_name="PMC84574P1"
                     /db_xref="UniSTS:273448"
     gene            complement(<602389..>602576)
                     /locus_tag="MYCTH_2071285"
                     /db_xref="GeneID:11506645"
     mRNA            complement(join(<602389..602473,602491..>602576))
                     /locus_tag="MYCTH_2071285"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666546.1"
                     /db_xref="GeneID:11506645"
     CDS             complement(join(602389..602473,602491..602576))
                     /locus_tag="MYCTH_2071285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666594.1"
                     /db_xref="GeneID:11506645"
                     /db_xref="JGIDB:Spoth2_2071285"
                     /translation="MHHHPRNQERALNLSILIVSGPGEFPRVELHPWWCPSVNFFKFQ
                     PCDHTPPGAQTF"
     gene            complement(<604638..>604856)
                     /locus_tag="MYCTH_2071504"
                     /db_xref="GeneID:11506648"
     mRNA            complement(<604638..>604856)
                     /locus_tag="MYCTH_2071504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666549.1"
                     /db_xref="GeneID:11506648"
     CDS             complement(604638..>604856)
                     /locus_tag="MYCTH_2071504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666597.1"
                     /db_xref="GeneID:11506648"
                     /db_xref="JGIDB:Spoth2_2071504"
                     /translation="YIRQVSCYTVLSGFRLPWPPSCCQDVLTPFVVSDERPLRHLNPA
                     FGSSRIASSAYQKWPTSVDTFEGPRSTK"
     gene            <605181..>605677
                     /locus_tag="MYCTH_2071514"
                     /db_xref="GeneID:11506649"
     mRNA            join(<605181..605280,605314..605422,605497..>605677)
                     /locus_tag="MYCTH_2071514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666550.1"
                     /db_xref="GeneID:11506649"
     CDS             join(605181..605280,605314..605422,605497..605677)
                     /locus_tag="MYCTH_2071514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666598.1"
                     /db_xref="GeneID:11506649"
                     /db_xref="JGIDB:Spoth2_2071514"
                     /translation="MWVLRGNATERGDDGGGPGQSSLFFLTVYHPGNKPDTSVGSGAL
                     STSLENPREGIILTPGRTHNRSRSPRIGSKGWARWALGGRPGSRSPLAGQPAGGFQHP
                     GADALSRLRPSGARLTTNLELVRTGGI"
     STS             605658..606033
                     /standard_name="PMC133845P2"
                     /db_xref="UniSTS:270669"
     STS             605668..605915
                     /standard_name="PMC120649P1"
                     /db_xref="UniSTS:270380"
     STS             605727..606021
                     /standard_name="PMC89798P1"
                     /db_xref="UniSTS:273611"
     STS             605727..605983
                     /standard_name="PMC89798P2"
                     /db_xref="UniSTS:273612"
     STS             605731..606179
                     /standard_name="PMC156610P1"
                     /db_xref="UniSTS:271418"
     gene            complement(<605934..>606388)
                     /locus_tag="MYCTH_2071953"
                     /db_xref="GeneID:11506650"
     mRNA            complement(join(<605934..606043,606124..>606388))
                     /locus_tag="MYCTH_2071953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666551.1"
                     /db_xref="GeneID:11506650"
     CDS             complement(join(605934..606043,606124..606388))
                     /locus_tag="MYCTH_2071953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666599.1"
                     /db_xref="GeneID:11506650"
                     /db_xref="JGIDB:Spoth2_2071953"
                     /translation="MNAWPPQASYPCGNFSGTSSLKFRGTKGSIGHTFMVCIHTENQN
                     QGDFYPFVLLEISVLHEPPLGHLRYGLTDVPPQPNSPPDNVFNPGVVVFHRRRSSHLF
                     YTSYVFSQCQTRVKLNRVFFPR"
     gene            complement(<709077..>710301)
                     /locus_tag="MYCTH_57823"
                     /db_xref="GeneID:11506651"
     mRNA            complement(join(<709077..709268,709408..>710301))
                     /locus_tag="MYCTH_57823"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666552.1"
                     /db_xref="GeneID:11506651"
     CDS             complement(join(709077..709268,709408..710301))
                     /locus_tag="MYCTH_57823"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666600.1"
                     /db_xref="GeneID:11506651"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_57823"
                     /translation="MELTRPSICKNPFDRGSDANIEFTGFPTEWPLGSVDDSSHTFSS
                     FSPHTPSSGRSTPPCSSSLDFNYSSFASSIDTVPFDLSPISCVTSIYLPMTPKAGPIS
                     DFTRPSIPITPIWPKYDSQNHPLSERTAQVYFSQTMDCGLAITQLSTHPHLGGSSVLV
                     QYERLSGTTTSNWMVPDSPVNFEPHSPTQFAVSGPSMEQQDGAEPTAPRTPSMKARRR
                     ALTDEVRHKTTVLQQQMQQCPSPKTRTRAKKETRCRTVMMADGSFALDSVELASTFKC
                     PIEGCGKMYRRSEHMKRHIQRLHTTNRWDNLKAHIRLHGIQREHPGSKPRVQFAAGAV
                     LQYEEIMKNESRRGDGTKHKKRTSSDS"
     gene            712300..713060
                     /locus_tag="MYCTH_2311417"
                     /db_xref="GeneID:11506652"
     mRNA            712300..713060
                     /locus_tag="MYCTH_2311417"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666553.1"
                     /db_xref="GeneID:11506652"
     CDS             712827..713045
                     /locus_tag="MYCTH_2311417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666601.1"
                     /db_xref="GeneID:11506652"
                     /db_xref="JGIDB:Spoth2_2311417"
                     /translation="MPEAIRGGSAPHRCRDTEALADNDSRNLHSSSNKQSNQIADRGN
                     IHCPIHGSIGATQTTSNSRYYPPDLKSL"
     gene            complement(713969..716539)
                     /locus_tag="MYCTH_2311419"
                     /db_xref="GeneID:11506653"
     mRNA            complement(join(713969..714427,714631..716007,
                     716136..716539))
                     /locus_tag="MYCTH_2311419"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666554.1"
                     /db_xref="GeneID:11506653"
     CDS             complement(join(714309..714427,714631..716007,
                     716136..716316))
                     /locus_tag="MYCTH_2311419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666602.1"
                     /db_xref="GeneID:11506653"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="JGIDB:Spoth2_2311419"
                     /translation="MPHAVSIATPGLQALILCGPGSSFTTFTANPDENPKALLPIANR
                     PMVWYPLEFCYRAGITNITLVCPPSAAEAITTALKTNPFLTSLPFPRPDLLAPKDLDQ
                     NTGTAEILRLPELQATVTSDFLVLPCDLVCELGADKLLQAWMVKSASLDDLVGDSQSR
                     GPRSGGLSVYYQTKTETPIKDEETDFVATVPLPPASVLPPKGSLFPNMAKVVYSMPTD
                     SLKDLTEEKKGFPVRHGLLRQHPRVKMLTTHRDAHIYIFPHWVMQFIKENERLETIGE
                     DVIGWWVKASWQKGLSTRLGLDSILQRPSKGGSDGQASPGGHNPSSGTHNLGLDSRAT
                     DAPNPVVSVRNGSGDDGHSIPGDEAVSAEAPVPPMLAYFHPTDPSAPVIRRVDTAQLL
                     LQVSLQLAKIPSLEETVPDAPASPFAHARKVAYPEGVKPRTTITKHDSLVADNVTVQE
                     KTSIKECVVGANCQIGEGAKLSQCLLMDGVVVGKNCKLTKCILGKRSELGEGCVLTEC
                     EVQENLLVEAKTEAKGEKFMSSSGLEASEQELDAFEADHGIDDDDDVSDE"
     gene            716767..718718
                     /locus_tag="MYCTH_2311420"
                     /db_xref="GeneID:11506654"
     mRNA            join(716767..717693,717788..717978,718050..718718)
                     /locus_tag="MYCTH_2311420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666555.1"
                     /db_xref="GeneID:11506654"
     CDS             join(717061..717693,717788..717978,718050..718461)
                     /locus_tag="MYCTH_2311420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666603.1"
                     /db_xref="GeneID:11506654"
                     /db_xref="JGIDB:Spoth2_2311420"
                     /translation="MSPPYESSRRRGVWSHWVPLAVTITVATMGVAAWVWSQRKDDDR
                     GDAEQIAAEYQDLDYDNADYGDNPPYGASKDGPDPKSTAVGGVQPRSGDAGYGPGQPP
                     AESSSSYWAALRRTPSPQQFFDSARRTVAAGVTAAGAAVGSALAAIREEDKTAFADHE
                     TWSEEADAKQERAAGPPQTKDTGKRRKKVAIVVSADSGLGEVDADVFHEHASILSHIP
                     TQLDHSVIKLYVLIYAPSLKDTALDTTSNLPPPSLSSSFSNIDHAQAQTSEEARSPLA
                     GASSADPAYHAIYSQAQALVEKDSMILTFTSPNGHAHILRHIQPEIIYLQESLSGDNG
                     SVVTNLQSWLRHDLVLVVGAERGHGGLADSESEAEQPDKGKEVWWHREDRVGRGRGVV
                     VVDGMRVQDDWARRVLGKE"
     gene            719429..722973
                     /locus_tag="MYCTH_2311422"
                     /db_xref="GeneID:11506655"
     mRNA            join(719429..720005,720070..722973)
                     /locus_tag="MYCTH_2311422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666556.1"
                     /db_xref="GeneID:11506655"
     CDS             join(719786..720005,720070..722954)
                     /locus_tag="MYCTH_2311422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666604.1"
                     /db_xref="GeneID:11506655"
                     /db_xref="JGIDB:Spoth2_2311422"
                     /translation="MSARRAPPSATRPPSNPPTANGAAPTSARAPSRPRRDGSGQALG
                     RGQRSAGLRSASTAPDLSSSSPVTEPRPYVVTDEYILKKFHGCPPSLIVHLHQTHFRF
                     DQQQGMFPFHSPMRIFLEHLKTRTVPYEMLEYFSDVPFYDGCLIVQVHDHKSVAQAQD
                     EARPTSSSSKSTPFSIHNYNQYITPSPYVPYPKENLPSNGTSDSAAEKTAGEKDKENM
                     PAPNASADGQKDKAAPKAKVYTIVLHPTPLSLHADLSVKLHTPQGASDARADGTVPPP
                     TPHTAVPPTPAATNMPPPAKKQKRERMELDGLSKYEAEAQILLATTPPLDLEPTKNAE
                     QTIALLEKQAHPDHSHKPPEPKIRKRTVAEVAADEAQAAGQERFMLSMDERLSAKLAG
                     SQAAGNGPDGDGQAGPSTWEPRFERFKLIADIKREHAERKEAERIKQLEKERKFQQQK
                     LQQQQQQQQQQEAAMLAARQAEAERQRKEQALREQQQRQENQRRMQAAAQAAQAQAQA
                     QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQAQAQQSA
                     GASGMGTPRAHPVHQSPLPAGMTGGMPVNMAQGQARFPQVSQGQASSPIIRQNTPQNA
                     SSPMGMAGVAMQHSNSNLGQAGSPARPPSVVQNHPMGAPMAPNMSARGSQQSHAGGTP
                     RMPNATPSMAHATPISRPQMVATPRMTQASPPPGMMSAAQLGHMMMTPQGIVQMPNVG
                     ATAATIAQQQRLMQQQQQLLQMQQQNGMMNGNPALQHQLAQQQRLMAQQQLLLQQQQQ
                     RGQMMNQPTQAQLAAQYSQQLSNMQQQAAQMGQMNPMQQAAQRQFLAAQQAARNQNMM
                     AMSGMTPAQIAAMQQFQLAQQQQQQQQQQQQQQQQQHQQQQQHHPQSGQQQPGHQQQQ
                     QQIAMALNTPQIQNQIRNITTALITKNLPTFTARYNGMPIPEKELTEFKRGCALQARN
                     IVLNQLNGMAGQQQQMGQNRINLQAQMQAAAMQQQQQQAQAQAQAQQQAQQQAQQQMG
                     GQGM"
     gene            723861..725634
                     /locus_tag="MYCTH_2311423"
                     /db_xref="GeneID:11506656"
     mRNA            join(723861..724479,724603..725194,725268..725634)
                     /locus_tag="MYCTH_2311423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666557.1"
                     /db_xref="GeneID:11506656"
     CDS             join(724137..724479,724603..725194,725268..725463)
                     /locus_tag="MYCTH_2311423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666605.1"
                     /db_xref="GeneID:11506656"
                     /db_xref="JGIDB:Spoth2_2311423"
                     /translation="MRASTAWRSTAVEAAALASLVLALAPAVTATAATQQTPTAPDLL
                     PAAAALACDNIVTDQGRKYDLRPLEGPHVVVTHEYTRPTYHNTSYAIDVCGVLKSKGK
                     GKAEERCPDGTRVCAIKHRWDPEADKLIGVDQVIPIVAGDEQTISWEAKRLPPEEDGE
                     AKKDGEKKEGLRLTLQGALKYQERIQRTVIDFRCNPDLEGTEGEWESPDEYVPGEKDA
                     RAEEDKKNKEEGGEEGDGRKDGDKEEKVSTPEKQLKKDGAALIWGGYKRGKDADGGEM
                     DTLYLTWYTKHACDAAVDEPAEESKGSSFFTWFVVLFFLAIASYLIFGSWLNYNRYGA
                     RGWDLLPHGDTLRDAPYIIRDLVRRILNTLQSTGSRGGYSAV"
     gene            726360..727634
                     /locus_tag="MYCTH_2311424"
                     /db_xref="GeneID:11506657"
     mRNA            join(726360..726855,727046..727634)
                     /locus_tag="MYCTH_2311424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666558.1"
                     /db_xref="GeneID:11506657"
     CDS             join(726536..726855,727046..727547)
                     /locus_tag="MYCTH_2311424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666606.1"
                     /db_xref="GeneID:11506657"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Spoth2_2311424"
                     /translation="MTGTLFTVPIPPLGAHPGGTIVATEPAPAVYLLTITSPPDNRLT
                     TASCNALLDALDLIEFGGYKPGVVVTTSGIEKFYSNGLDLEHALSTENFLPGVLYKLF
                     HRFLTYPMPTIALLSGHAFAGGLMLAMHHDYRVMNPTRGFACVNELEFGVPLKAAMSS
                     IFRLKLPAATYRDLVLEARRFAGPAAVEAGLADRVGGLDAVLDLVRERKLAGKAQTGI
                     YGLLKAEMYRESVALLSRQGWEQGEERDRLLAESEDKRRREGEKRVAELKEMARL"
     gene            complement(<730194..732686)
                     /locus_tag="MYCTH_2311425"
                     /db_xref="GeneID:11506658"
     mRNA            complement(<730194..732686)
                     /locus_tag="MYCTH_2311425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666559.1"
                     /db_xref="GeneID:11506658"
     CDS             complement(<730272..732349)
                     /locus_tag="MYCTH_2311425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666607.1"
                     /db_xref="GeneID:11506658"
                     /db_xref="JGIDB:Spoth2_2311425"
                     /translation="MSNPPFAPENTAAADAAAVSPIRTAETGDAAPSPSSPSGTQTQT
                     PPPSWLPGTAAQEEGSVSSVPPPPPPPPPPSPLPPSQSPPAGQRDTAGAVPLAAQATG
                     ASATAHADPVKHARGPVALQRPHGPSLLTQALATARGIPRQTQCDPSQPQKAHPSQHP
                     QNHSEPQELHNKDTGSRNTRHGSRPQGDGDSLTPRLSPRKSAMSSSSTATSTAVAAPV
                     FGRLDLAEVNSMLSGHRDFLNKTKAKVGPLESSERERPARWDGYSNDKTATSAYHHTS
                     VHPTDPPAAVHHVADAENGVVDGRPQLRPWKTEHRVSMGPEKVWSIGAGDAGGVQDGQ
                     VEKSISEVLAGVEHNNRSRKASHSLRFFKEGLPEEKGKRKDQRSSHSTRDRSPSRGEK
                     LADIQEQPVGGESADAQALGDAASISEPHKRMPESKATQGSPRYHAVPQHGEFAQGPT
                     APAAAAAVVVAEPVPSEHELGGPEQQGPDSADSSHQSKPRPESDLGNGVGESVEEGED
                     SGEEKISSAVFLPHQGPGESPESSPVSGMPQKMVPSRRHSRHGDFHPWLVKADEPEID
                     DEQKSLNNFEGEVGLEAAEYPSVAPEVAYRQAEDSAPVAQREPAVHSSRLSRPVSHYH
                     EDAVHEHQWTPKQPLEAIELIPYKHQVGGHTTLWRFSRRAVCKQLNNRENEFYEKIEK
                     YHRDLLAFLP"
     gene            complement(736269..740196)
                     /locus_tag="MYCTH_2311426"
                     /db_xref="GeneID:11506659"
     mRNA            complement(736269..740196)
                     /locus_tag="MYCTH_2311426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666560.1"
                     /db_xref="GeneID:11506659"
     CDS             complement(736413..740024)
                     /locus_tag="MYCTH_2311426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666608.1"
                     /db_xref="GeneID:11506659"
                     /db_xref="JGIDB:Spoth2_2311426"
                     /translation="MKRRFGFGIADLEWLHPDNFGNEPICCEALTNPDEVLCYGSDDE
                     AYDSPAERRIRYEAQAERFLEGKPVFLLSASLRGPFDKASGWTNPWRSKSGTREKYNQ
                     RKPSSAPRRAAEEGECKAVLDSSNSRREASETKPTLPQHVYTPPRYMDEDTFHRVQSW
                     RDKVIVESDLPPSSIQHSPQPEPTSAESRRATQHTNRRQSGLTLDTLDDGASELMSHT
                     PRVYNNLEQDRSSETSRRKGTRAVACKPGQDLGLNRPRSGLPPSSTHLLERTDPLPHA
                     AQHDEQLGRAARSNRTSAGGRDAPDTTAPTPQTRATSPTTDTPAASAPLGVGNATPSG
                     ALPERAASFVLPQVQATPRTDGSFRYRTKDARGKESSLDRSKLANASSAPNSPAQRQG
                     SDGQTFPKRATGAGGDHSLHSAESGGDVPGNVETPKGAGVVQNREAATEVAEHGISGE
                     GHEVEASVNVAHPPHEEGNEDGQGQAEDKDSAKTPSQIDGPTLVPSESLSGSEYDGGP
                     SFGHFSAEKQSQDVISEVFGSSRRLLWPKTQRSTGGDSPRMLGIGSPRPQESMHSRHS
                     SDCRRSMSVSSAALPQETVYLPHEDKTVHAAAEDCGSFIKTEPHSNGEVAADEVDPAV
                     GTAKAQAENEVDDDAMSVTEQLQAGAQTGFSCESSSANHLQPTSSCPAPEIQSPWASD
                     GPAPCLKSQGFQPQHEGGNKAADIRVTPPRTVQSPWCKTEDVVPGALDIPAPPPHLDL
                     ANTRLSSIASQALEQAVSQSPWVRGDSQMQLPEVRLFNPLSSPASSHVSPPADPLQDS
                     VIPYNINNDDADMCSPPPYPPQPSTPETKQSGLPSPDFTLSVKSFRDFMTPSPAKRRR
                     ISAVTNEEHLPSTQALVEAAISNPWTRESTAKAKQPNFKPRRSQKQQQQARPPKRVSW
                     APLPGESTPDDANMTSSSPHGAGQPLHTQEPSTPRSPSLGKGRTKDGLARPFRATSPP
                     PSILSTSALPTASQKFGKHFAAVAAASSRRGDVGMGMGVGVSVPTPRTSQRTQASRTV
                     EKSLLPSASQQVCGSPAVEAMAEAFLRAEVGIQPHAGATAPDAADVTAPSAVGHVMGR
                     EGEGEGEGTEPIEMDGVVHGECGEGGGEEGEMGASGDEGNLEEEEAPGFADEESPVDE
                     VSAVMDNLDEFLGGNWDLEADLAKVRAEQARNGREYEDGMSRGAAGLSGLMAVNVWD"
     gene            740749..746476
                     /locus_tag="MYCTH_2311427"
                     /db_xref="GeneID:11506660"
     mRNA            740749..746476
                     /locus_tag="MYCTH_2311427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666561.1"
                     /db_xref="GeneID:11506660"
     CDS             740847..746384
                     /locus_tag="MYCTH_2311427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666609.1"
                     /db_xref="GeneID:11506660"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2311427"
                     /translation="MGHAWLDSLSEDWVSQPGSADASFAEHEAAPVPAQKLPKPQTPS
                     RIPRLSPHVRKFQSALGNAGNSNASNGNSATKSNSNSNNSNNNNNSSSSNILSERSLN
                     ERLAAQSRRTPSKLSQEVSPNTGGRDCPACRSASASTTNSVVRRPFLRKSTGTSQSKG
                     RAGDTPEWKRRLVYGELSYGEQKDLFTSAGAGLESIFKPPHPTPGPSRDGKMDDSCHE
                     HDQEQDFAAPPSPPSHRRNPLTVDTHVDESPQQLPQPQPSRRAGPPVRYRRTEESPDT
                     SKDSELSMQQHESCSCQTSKTDQTALSAEEGPRKVSGRSDIRNEDFSPILLERRQASN
                     GATTFSPADLPPDELRKRLEMLRRNQMLLAGGANDGTIHNHTPSRNETTEDYVRLEGF
                     VNFQRGGRSEEGSFRNRMLSSALNDSSELNPEESLQASTPKQFLSVRVEQCDSSEHRP
                     VDSPDVPRVPDPSPEKRLAPVQPSPGSPLKLFQPYDTFTSQTLLRRLSQVHGEAGDIS
                     FSIAVDESRMQGDNPSGLLPPASQNGPDDHSFAHASRFGAGELDGYEFNDEFSHLSHN
                     ATCMDGDKENREPAEDSLLPQRQPIFDLPHNSSPSGTPDLVVNRRRKSTNSRPSRRSA
                     RASFPAYSDMLSPPGGRRDLSGTEIKRPRTSPSKNPTPKRRRTLHRSDISYGSGDPNS
                     GVDSAQLSHLQMQSVLGRLRQDVRESDEHEMAGHDLHHSLRSRTPTPSQRRSLQAERQ
                     PLAQIERSPARSSRHSQPPAALPLGTTVETNRKSSIKTEDFINEANKIMAMIRSKAGL
                     PSGLASVEESDEEKGQPSPELEGSFEESTQEPFSRPPSREGRPPLTRKSTKQEDPVLA
                     EQLKKYEEASDMGDILPSSVRSSHPVRGSDSVTREQATEEWAKEQSQRSGSQVNTVSD
                     PPNIRISRNSDWQEQQSANGPADGIPSQGSAGLNTQSTGLSLPTGSSRVSSKGSEARK
                     TIMPESVSHLIPDQVGNMVLDRQRNMWVKRKSTGEPKESFYQSEASDDDPFAGIPDLS
                     VDVTKEMQNLLLTGKRETALQNRVASSAEISPTRPPRVGSFTRAALDAAGGMPTNQAP
                     NSGSAEIPAEKGSSVNEGRVKELRRLTISFSSPVASVIQDAGVTNEMLSEDSMLNAQA
                     EAPAPPARGRRLVSVQTTMGSRTARSRSTSRGPARHLSIRGKSLMARPVSRIDERDED
                     SASHHDQPQEAASGMELSVLGDYSVANHDDGGPRGSLNFLVTTPARAPSCPVSGADAA
                     PIISQYVGTFSLSPLSEFTVHRPEETLPLEASYVVDNHRLVTGDKPKHVMSMSIRELV
                     EKLAEVEPFEPYWEDMRELELREKGLSALHALDEYCGQLESLDVSKNKIRNLGGIPSS
                     VLHLRITHNQLSSLTAWNHLINLQYIDVSNNSLTSLAVFKNLIHLRSLRADNNQITSL
                     DGIKFHKGLQTLRVRGNLIKEVDFDGSTLHQLTDLDLKNNQIRHVANIDQLPLLSSLD
                     LDGNRLTSFSVDSAEPMTSLRYLRLDDNNLTTLNVRALPHLRLLHADRNALVQIAGFS
                     RARRIDSLSLREQRGAEPLDLPHLLSRAYEVRKLYLSGNLLQSFSPKADLLNLQLLEL
                     ANCGLSSLPQDVGLMTPNLRVLNLNMNALTDLTPLRAVPRLKRLFAAGNRLADPAGVV
                     GTLGGLACLAVVDLRDNPLTQGFYAPVQVVVRKSGSDDSVADGAEGEQQFVLGDQDAE
                     RDARYCARLDMDTRMRRRLYETMVKKKCARVKKLDGLVLGDAAATGESDGKEGVDVVW
                     AAMEEKGLVKTRGSGSSSAKGEKNEGVPAAAADADAAAGEKEAAGTVRERSGRWPAED
                     SFA"
     gene            complement(746889..748726)
                     /locus_tag="MYCTH_2311429"
                     /db_xref="GeneID:11506661"
     mRNA            complement(746889..748726)
                     /locus_tag="MYCTH_2311429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666562.1"
                     /db_xref="GeneID:11506661"
     CDS             complement(747289..748314)
                     /locus_tag="MYCTH_2311429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666610.1"
                     /db_xref="GeneID:11506661"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="JGIDB:Spoth2_2311429"
                     /translation="MSLFGSLRDKLSNRNRSRSPSLNPDVLSHSGDAHLAGPSGNKTV
                     SGADNAPPPPYTPIDPAPAFPTLAVSNPPSARQPSPAPSFSSARSNPSITSREDPYAF
                     LSSFDTIFLIDDSGSMAGRSWREVKEVLVSIAPVCTSHDANGIDVYFLNARNPSPSDR
                     DDRTQGFRNITTPKQVEDVFRRVRPQGATPTGTHINAILRPYLRELEHAIARTGNPDE
                     CGVKPINMIVITDGAPTDDPEAVIVSLAKKLDALDAPPHQVGIQFFQVGNDPEATRAL
                     KELDDGLTEQGGGIRDMVDTVTWESSPGKPLSADAILKVVLGAVVKRLDRRTLDGQGR
                     RGDHLAP"
     gene            750156..752820
                     /locus_tag="MYCTH_2311433"
                     /db_xref="GeneID:11506662"
     mRNA            join(750156..750549,750637..750682,750749..750867,
                     750927..750940,751010..751274,751366..751397,
                     751451..751708,751774..751892,751996..752430,
                     752521..752820)
                     /locus_tag="MYCTH_2311433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666563.1"
                     /db_xref="GeneID:11506662"
     CDS             join(750444..750549,750637..750682,750749..750867,
                     750927..750940,751010..751274,751366..751397,
                     751451..751708,751774..751892,751996..752430,
                     752521..752545)
                     /locus_tag="MYCTH_2311433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666611.1"
                     /db_xref="GeneID:11506662"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2311433"
                     /translation="MADVPGFVHRKFSINRNTGVPRPARRFSIGEPGLSEASSKAHRQ
                     FRAAHEGHLPHAGLDATRASTGVVWCTERAAEFGFFDEPEKWANLGQGAPEVDDDIEG
                     CFPRPTQIDISAASREYGPTAGIKPLREAVARLYNEMHRKGKPSQYTWENVAIVPGGR
                     AGLIRIAAVLNNAYVGFFIPDYTAYNEMLSLFKNFAAIPVPLSEEDGYHIHPEKIAEE
                     IARGTSVIITSNPRNPTGRVVQNPELAEIQDICRERATLVSDEFYSGYNYTSDCDGST
                     ISAAENVIDVDEDDVLIIDGLTKRFRLPGWRVAWILGPKEFIKAIGSCGSYLDGGTNV
                     PFQEAAIPMLEPSLVRQEMAALQRHFREKRDYVVARLRAMGFVIRHVPDSTFYLWLNL
                     EGLPAPISDGLNFFQACLEEKVIVVPGIFFDLNPARRRDLFDSPCHHFVRFSYGPRME
                     VLKMGCDGIERVINKFKNLASH"
     gene            complement(<753453..>753987)
                     /locus_tag="MYCTH_97047"
                     /db_xref="GeneID:11506663"
     mRNA            complement(join(<753453..753845,753883..>753987))
                     /locus_tag="MYCTH_97047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666564.1"
                     /db_xref="GeneID:11506663"
     CDS             complement(join(753453..753845,753883..753987))
                     /locus_tag="MYCTH_97047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666612.1"
                     /db_xref="GeneID:11506663"
                     /db_xref="JGIDB:Spoth2_97047"
                     /translation="MHPRTSIDSDFALASSDIRPTTNQFIVWHVATPALPSRKGARRK
                     PTDMNQASFSEAVAHGDLEPTVSDHATDTLPPGPLSPGDTGNMRANTDDPRAIAGGRL
                     GSKARFLNTGVSVAVGEAGSGSDNGGGSIEPGQRPSFHINIPWPLVCLPFPVALAHRE
                     CSELS"
     gene            755459..756558
                     /locus_tag="MYCTH_2311439"
                     /db_xref="GeneID:11506664"
     mRNA            755459..756558
                     /locus_tag="MYCTH_2311439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666565.1"
                     /db_xref="GeneID:11506664"
     CDS             755748..756299
                     /locus_tag="MYCTH_2311439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666613.1"
                     /db_xref="GeneID:11506664"
                     /db_xref="JGIDB:Spoth2_2311439"
                     /translation="MSSNGFSSAAAAASPAPAASTPPVPGSSPSQPASAGPSGPGGAA
                     PAPPQARAETQPTVEDDTASTSPNGNAKENGQQQEEEEEQGTTTDAPKPLPALPSPES
                     VSGEGGDGVRTVHVNGQPIALDALGPMVVNRDGTISRIANWPEMTEIERENTLRILCK
                     RNQLRLGNLRAGRPADAPQEGSS"
     gene            complement(<756784..>758431)
                     /locus_tag="MYCTH_57777"
                     /db_xref="GeneID:11506665"
     mRNA            complement(join(<756784..756849,756931..757484,
                     758149..>758431))
                     /locus_tag="MYCTH_57777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666566.1"
                     /db_xref="GeneID:11506665"
     CDS             complement(join(756784..756849,756931..757484,
                     758149..758431))
                     /locus_tag="MYCTH_57777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666614.1"
                     /db_xref="GeneID:11506665"
                     /db_xref="InterPro:IPR011700"
                     /db_xref="JGIDB:Spoth2_57777"
                     /translation="MSSYGTGSRVNVSQYLRNLNVQGPTVEETFTDEDLEKDLALFTN
                     TQFFDFETGQHTDYQAPPPKPTVVQSPTEDVTPTESIMGDYPASYDFPISADHGTMSP
                     GDFTFGDYSSTTFNSPTVPAFPETLGNHLQPIQPNPQTAYPGQVPHHQHHQQPTGYVA
                     PSPAGAAIVGGGGQKRKAESISGHTHAPNGRVLSFEEASRLAAEEDKRRRNTAASARF
                     RIKKKQREQALERSAKEMAEKVTMLEGRISALETENKWLKGLVTEKHGGREEILERLL
                     KELESSKDTAKDSISVASDQPKKD"
     gene            760653..762636
                     /locus_tag="MYCTH_2311445"
                     /db_xref="GeneID:11506666"
     mRNA            760653..762636
                     /locus_tag="MYCTH_2311445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666567.1"
                     /db_xref="GeneID:11506666"
     CDS             760800..762500
                     /locus_tag="MYCTH_2311445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666615.1"
                     /db_xref="GeneID:11506666"
                     /db_xref="InterPro:IPR007902"
                     /db_xref="JGIDB:Spoth2_2311445"
                     /translation="MARISVPTTAHLPSTLRVDSTNPAAARILGRLSRSSLISVALDW
                     LDETNLPQALPYLRHDDGDEEDEEGDDEEDDFYPPARSAEELRDMYNSLLERKGSKRE
                     VLDRITEGDWRHGLTLYQLAMADLQYLYDHPTSQQWSAYRIVPLKPPRDPDGEEPPQV
                     DRQSLTIPRFHPSTFLRTLQTQVLPDVKAHYNFDTHKSLPLLILRIFILDSPYNTNQA
                     VQQTTTTTTTKTTAFDSSRTVYIAFPDASPHLFISRPQTTSSSPSPGAAGAGAGGESR
                     SLRNLLVEGIPKALSRPLQRQRFTLQSTSLVTRNLAELVERRGSGRTNFAGGGWSIYA
                     EGGEGRGARGNNRETPLDLVLPSPPLSERDEDGLGGEDDPRGGKRSGGEKRAAPLPVV
                     LTAEERREERAAKRARLVARARFGRTAVMGDGKGVERVDVVIEDPFPEVAARRRDGGP
                     ADGEGAAAVGRRRGKGGGGSRADAASKGGGRVDDADRNVQPEEEEGEEQEEGGAQGWR
                     PHVRLTFHGSHVFAGIRQLVECGIIDGERMPGWMTGEEGVTIGAVRNGRIRGHKGSGV
                     "
     gene            complement(762637..764520)
                     /locus_tag="MYCTH_2311447"
                     /db_xref="GeneID:11506667"
     mRNA            complement(join(762637..763866,763956..764133,
                     764204..764520))
                     /locus_tag="MYCTH_2311447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666568.1"
                     /db_xref="GeneID:11506667"
     CDS             complement(join(762773..763866,763956..764133,
                     764204..764272))
                     /locus_tag="MYCTH_2311447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666616.1"
                     /db_xref="GeneID:11506667"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="JGIDB:Spoth2_2311447"
                     /translation="MARINTQQASGTPATAYTPRYIDIGINLADPIFRGRYHGKQRHP
                     DDLKAVVGRAVEVGCTKLIVTGSSFKSSRDALKLAKEFPGTVFSTAGIHPCSSSIFSP
                     SHHKHHDESQSEGEEDEHTPACDPDPSKPIPDGEGVDHERSTKIIADLSDFITQARNN
                     TSSSSPGLVAFGEFGLDYDRLHYCSKEVQLHSFAAQLALAASLTPQLPLFLHSRAAHA
                     DFVRLLKEAFGPRLERLEKGGVVHSFTGTVDEMRELMDLGLYIGINGCSFKTAENCEV
                     VREVDLSRLMIETDGPWCEVRPSHEGWKYLVEWEAKAKAASEAIAAEEAEVAAPAAAA
                     AAAAANNSTNSSEGQENVEQPERKEKPKKQQQQQQQQQQQGKKNQKKEPEVPERYKVV
                     KKEKWEEGAMVKGRNEPCTIERVAKIVAGIKGVSLEEVCEAAWANTVKVFGLDS"
     gene            764936..768291
                     /locus_tag="MYCTH_2311451"
                     /db_xref="GeneID:11506668"
     mRNA            join(764936..765228,765282..765439,765512..768026,
                     768089..768291)
                     /locus_tag="MYCTH_2311451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666569.1"
                     /db_xref="GeneID:11506668"
     CDS             join(765210..765228,765282..765439,765512..768026,
                     768089..768132)
                     /locus_tag="MYCTH_2311451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666617.1"
                     /db_xref="GeneID:11506668"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="JGIDB:Spoth2_2311451"
                     /translation="MYVRKRDGRQERVQFDKITARVSRLCYGLDMDHVDPVAITQKVI
                     SGVYGGVTTAQLDDLAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKQWSSVVSDLY
                     HYVNPKNGKPSPMIAKETYECVMRHKDEFDSAIVYDRDFNYQYFGFKTLERSYLLKLD
                     GKIVERPQHMIMRVAVGIWGDNVERVIETYNLMSNKFFTHASPTLFNAGTPQAQLSSC
                     FLVDMKDDSIEGIYDTLKTCAMISKMAGGIGLNIHRIRATGSYIAGTNGTSNGIIPML
                     RVFNNTARYVDQGGNKRPGAFAIYLEPWHADVFEFLDLRKNHGKEEVRARDLFLALWI
                     PDLFMKRVEKNGEWTLMCPNECPGLADCYGEEFEALYERYEREGRGRRTVRAQKLWYA
                     ILEAQTETGNPFMLYKDHCNRKSNQKNLGTIRSSNLCTEIIEYSAPDEVAVCNLASLA
                     LPQFVDYNEGVYDFKKLHEVTQVVVRNLNRIIDINHYPVKEAYNSNMRHRPIGVGVQG
                     LADAFLALRMPFESPEARELNKQIFETIYHAALTASCDLAKEQGPYSTYEGSPVSQGI
                     LQYDMWNVKPSDLWDWDALKAKIKEHGVRNSLLIAPMPTASTSQILGNNECFEPYTSN
                     IYQRRVLAGEFQVVNPWLLKDLVDMGLWSDNMKNRIIAEGGSIQNIPNIPADIKALYK
                     TVWEISQRTIVQMAADRGAFIDQSQSLNIHMREPTMGKITSMHFTGWKLGLKTGMYYL
                     RTQAAAQPIQFTVDQEALRVQDSAVSKTPGLKKRGPLVPSYMSSPTAVPRPMALTSKE
                     STPNGTANGSVATPTTPPPPLTPVKDTKPRVLASPSKPPAFKADIDEGDSPKTLPTEP
                     ADKPKTEDIGSPALDSKKDAEDNEDESKEREMDIYSEAVLACSIENPEACVMCSG"
     gene            771250..772762
                     /locus_tag="MYCTH_2311457"
                     /db_xref="GeneID:11506669"
     mRNA            join(771250..771358,771440..771537,771683..771856,
                     771916..772194,772254..772762)
                     /locus_tag="MYCTH_2311457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666570.1"
                     /db_xref="GeneID:11506669"
     CDS             join(771448..771537,771683..771856,771916..772194,
                     772254..772325)
                     /locus_tag="MYCTH_2311457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666618.1"
                     /db_xref="GeneID:11506669"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="JGIDB:Spoth2_2311457"
                     /translation="MKRTITAIFAVAGAATVAAVDFPSNMPDCGENDIACLCRNKDFG
                     FGIHDCTIQVCDSVDQANVAIDWGNSLCAGVNVPANIPSATSVAGPTGGSGSASSAPV
                     TSESSESGEASAITTSTWTSTLSSNSATTTVIGETTITGTGGAGGATSAVESTVTSPI
                     VSTRTAVTSVSEPSTTTSSAQAPQMTAAPALGALAAAGIAFAFF"
     gene            781472..785804
                     /locus_tag="MYCTH_2311467"
                     /db_xref="GeneID:11506670"
     mRNA            join(781472..781981,782107..785804)
                     /locus_tag="MYCTH_2311467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666571.1"
                     /db_xref="GeneID:11506670"
     CDS             join(781722..781981,782107..785497)
                     /locus_tag="MYCTH_2311467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666619.1"
                     /db_xref="GeneID:11506670"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2311467"
                     /translation="MEPQQPSQPPFRRPSHPRLHSILPPTPSHLGQHRTASSTPVSPP
                     GLFSPSMPRPNMVFQSQPGSETATPGGLNSPYLHPLQGHKVRETHKANVEHDYTTGRK
                     HINNYEIIEELGRGVHGKVKLARNVENGEFVAIKIIPRFSKKRRLGKVTAMSTQDKSK
                     KEIAILKKIRHPNVVALLEVIDDPELKKIYMVLEHVELGEVVWRKKGLPHICEYERRR
                     IEREKRGAKSTPEEDRFERALLRRQAAKAAAQRASLRARAQKPSADYWSLEYGPADDE
                     ELDAHVGSLGRDDSDLSAIRPALSNSSSLAGSRATSRAPSRSQSVKSLSRFAEPDVAP
                     AAHDGDLETPGALPIKGKPGSSTALDGTMYGPYADDPSLQGRSPSMADSLISHISSFD
                     FNRVHDPFVDDFSYVPCFTIEQARNTFRDTVLGLEYLHYEGVVHRDIKPANLLWTKDK
                     RTKIADFGVSYFGRPVRDGEPDDTISESEARDFDDDFELAKTVGTPAFFAPELCATDL
                     YDAPPGKQPKVTEQIDVWSLGVTLYCLIYARLPFLAEDEWQMFKKIANEEVYIPDRRL
                     RPVDPATKPSEKSLYTRLNKPPYRNDDELAYEDIEPELQDLLKKMLTKDPEKRIRLRD
                     VKRHPWVMHGVDVMSWIDDTDPSRRASGKRIQVDEKDMARAVVPLSLMERARSVVKKA
                     VGKVIHPRGDRTDSVSSRRRATSSAASSAGDITGLITPHLRDSRRKSLRPDDYFSSPS
                     QQPGGHPLTHSVLASPETGSPPVPSPPNQASPAGGHASRRPLELLSNLAGRDDASRRR
                     QSGSPHRGLLPRHGQSRSITNAFLALTPNPIETLLAQSATPFLDSPSDDPIRALRKAR
                     DTKPHADEPGRARSVDRGLFASDDTRAEARVSLSTAVAPGNVHFAVQPRPPRSTDPGG
                     QDASTAAPPAPGSLSENSPGQSKPDPDLLQSEKRPVAAQVPEAVQKPSTPEPTEPALV
                     PCPPSPDDETLPPLPPSRGDTATGPSSSSTSVGALTTPMTSPSESASPIYELNNQMTK
                     EVADRMLAFQSDPSLPALLSSTSSVSADPEGEFLGHPGFVGRSAAVVDTTDSLTPPAF
                     AKEPMSGFPLEAQDLEGAVPVKLDNSSVCAGAPAGGMFSTGRRGSRCRQHDDDEGDND
                     SDSDEGLTMARRKKKPAESSISTAAGASSLRDVQVQTHGVERLVRNARRRDTTASVDS
                     TETAKKMSVDND"
     gene            787446..789507
                     /locus_tag="MYCTH_2311469"
                     /db_xref="GeneID:11506671"
     mRNA            join(787446..787758,788016..789507)
                     /locus_tag="MYCTH_2311469"
                     /product="glycosyltransferase family 4 protein"
                     /transcript_id="XM_003666572.1"
                     /db_xref="GeneID:11506671"
     CDS             join(787581..787758,788016..789346)
                     /locus_tag="MYCTH_2311469"
                     /note="CAZy_ID 268087"
                     /codon_start=1
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="XP_003666620.1"
                     /db_xref="GeneID:11506671"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="JGIDB:Spoth2_2311469"
                     /translation="MAGDKRRSKTIVFLHPDLGIGGAERLVIDAAVGLQKRGHKVVIF
                     TSHCDPAHCFDEARDGTLDVRVRGNTLVPPTILGRFAILCAILRQLHLILQVAVLTRE
                     LAALAPDAFFVDQLSAGLPLLKLASPGPGRAPVFFYCHFPDLLLARGRARLWKRLYRL
                     PFDALERWSMGFADAIAVNSDFTRRVVARTWPGLARTRQLHIVYPCIDTTAVGGARGR
                     GKEEEEAEEKEGKKGKKGREKEQEQVVEVEPLPWKQDGVVLSINRFERKKDVALAIRA
                     FALLPAERRRGAKLVVAGGYDSRVAENVSYHAELAALADRLGLRHATAKTLVSALHVA
                     PAVDVLFLLSVPGLLKEMLLRSARLLVYTPSNEHFGIVPLEAMLRGVPVLAADSGGPR
                     ETVVDGVTGWLRDPERPEEWSAVMDRVLNDMPEQELQRMGRAGVERVKSKFAEAQMAE
                     RLEDIFDGMEKTSQGPSGASLFMMTAMAGLVAAVGLGSSAFLAGRIGGISFA"
     gene            complement(<790871..>793763)
                     /locus_tag="MYCTH_58223"
                     /db_xref="GeneID:11506672"
     mRNA            complement(join(<790871..791337,791546..792491,
                     792625..792666,792788..793123,793182..>793763))
                     /locus_tag="MYCTH_58223"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666573.1"
                     /db_xref="GeneID:11506672"
     CDS             complement(join(790871..791337,791546..792491,
                     792625..792666,792788..793123,793182..793763))
                     /locus_tag="MYCTH_58223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666621.1"
                     /db_xref="GeneID:11506672"
                     /db_xref="JGIDB:Spoth2_58223"
                     /translation="MAGARSDIGSPSSSDDESVAGSGGGAPLYAWSPERCALLSQKNP
                     ALGFHVNSAGTRSDEATDESLSAAAGSAFGSEKEEPETPSDHAVQISEPVKPRRSFSR
                     SALRPTTDNLAGSSATSAAAIPPSLSLSAYPGPGDASAQRLPTLSLYAPASSSASGTL
                     DRSSIPGSTTHSFISAMQAMTLHAAEDNLHPSQKAHREQTCKLQARVWGLRQGMYRQN
                     SIPHDFLLSFDYDVQELMNNTVKMNQAVDQLAAELKKDPDECERIPGLEATIRGLESD
                     LKDWKDRALNAEKTLAGIAGRADEDMKTIQFLKEQLRQNEMARTILQEQVNGKRNLWL
                     NVHSNPEERAAILDTLARSSTPLSGQTFAMTTDHPYAPSLKGPASLRSSSTHVTHVTH
                     SGSIDRSGTASPGAANPAAFHHSATGQLAGPLVRGRPPFHQALPHSHSVPAVYHAQPN
                     QNHQRCLSNTTAASGRSAAGYALRPPSGPRRNTRVGPVVTETGSPKERKRSTPHSLVR
                     AVGLEDSNCLEWADEFQSLFALVYGFCASYFHELPTLDDDWKRQLQSEANGQLWDYIC
                     KICRTHQEQEPGDHAMRLLKDRDSRPYLMQRLILQHILIFICSYEGWKDYSEDADDEM
                     EKLEEELKKMDSSKTYDRQVIIDRRAQLVADMAEGPNAAAFKNYKLTQHHQYLKTMVA
                     PFLARRKVPNVTNEAFYDLFTITTAAWDLSAKLLRSRLTFQYSWGDAGARFSAETHEP
                     LDCTVDRLTLQYEHCRLRFCATPAVTMRNDQGMTIDTKNILKAGVLVMGF"
     gene            complement(796370..798748)
                     /locus_tag="MYCTH_2311474"
                     /db_xref="GeneID:11506673"
     mRNA            complement(join(796370..796410,796475..796777,
                     796842..797297,797396..797701,797784..798748))
                     /locus_tag="MYCTH_2311474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666574.1"
                     /db_xref="GeneID:11506673"
     CDS             complement(join(796519..796777,796842..797297,
                     797396..797701,797784..798490))
                     /locus_tag="MYCTH_2311474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666622.1"
                     /db_xref="GeneID:11506673"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2311474"
                     /translation="MSGLDVEALLDSTASSKEQNGKANANGDSPQNGSRSEYDRDRER
                     DKDRRSRDRSRDRSRDRSRDRSRDRSRDRSRDRGHRRRDRSSGRYRNSSSGRDTPRSE
                     AGSHRSRRRSRSRDSGRHSRRHRNDGDYYRGSNRGRGGRSRSRSPSRYYRPPGDDRRD
                     RDDRGYRRRDDDRRGRRHSTPRDPSPTGDERDRRTVFVQQLAARLRTRELKEFFEKVG
                     PVAEAQIVKDRVSNRSKGVGYVEFKNEESVAAALQLTGQKLLGIPVIVQPTEAEKNRQ
                     ARNSESSGHPNSIPFHRLYVGNIHFSITETDLQNVFEPFGELEFVQLQKDDSGRSRGY
                     GFVQFRDASQAREALEKMNGFDLAGRPIRVGLGNDKFTPESTANLLRGFQGQNQGSAF
                     SGAGGRGLQASNFDRAGGRDSDKGTAASALDDTDVAGVNFNNYSRDALMRKLARTDEP
                     STGQPERQILKPKTETQPLPVNVSMASRCVVLHNMFDPTEQEGEGWIKELEEEVRQEA
                     EEKYGHVVHIAVDPNSQGDIYLKFDKVSGGENAIKGLNGRYFDGRMISAAPVVDAVYS
                     SLFSRTKAI"
     gene            complement(798936..800636)
                     /locus_tag="MYCTH_2145425"
                     /db_xref="GeneID:11506674"
     mRNA            complement(join(798936..799662,799728..800636))
                     /locus_tag="MYCTH_2145425"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666575.1"
                     /db_xref="GeneID:11506674"
     CDS             complement(join(799272..799662,799728..800461))
                     /locus_tag="MYCTH_2145425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666623.1"
                     /db_xref="GeneID:11506674"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="JGIDB:Spoth2_2145425"
                     /translation="MPGRTLPTFTLAEVESHNSTKSCFVTLGNNVYDVTDFIDSHPGG
                     GDLILEYAGKDIKAILEDETSHAHSEAAYEVLEESHVGFLASADAKAEPTGTEKTNGA
                     ANGSNGKFVHPRTGMSCEEDLTKDTDIVSDYKTHKFLDLSRPLFPQVWYGGFSKEFYL
                     DQVHRPRHYKGGASAPLFGNFLEPLTKTAWWVVPLIWLPLVSYGLYLASEGFKNPLEE
                     VPYFAFGLFMWTLIEYLMHRFLFHLDYYLPDNRVGITLHFTLHGIHHYLPMDKYRLVM
                     PPALFMILAAPFWRLAHTIFFWNWHIATTVYCGGVFGYVCYDLTHYFLHHQNLPWWWK
                     QLKKYHLEHHFLDYENGFGVTSPFWDKVFGTELKSKPKMI"
     gene            801686..804884
                     /locus_tag="MYCTH_2311479"
                     /db_xref="GeneID:11506675"
     mRNA            join(801686..802135,802197..802357,802445..802831,
                     802893..803022,803088..803127,803194..803859,
                     803974..804884)
                     /locus_tag="MYCTH_2311479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666576.1"
                     /db_xref="GeneID:11506675"
     CDS             join(801991..802135,802197..802357,802445..802831,
                     802893..803022,803088..803127,803194..803859,
                     803974..804730)
                     /locus_tag="MYCTH_2311479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666624.1"
                     /db_xref="GeneID:11506675"
                     /db_xref="InterPro:IPR010816"
                     /db_xref="JGIDB:Spoth2_2311479"
                     /translation="MASLRFGWGSALLVLGLLLVVLPGKAAAFGAGNIPSIAQVEGHN
                     WRHGDIEDMLKTVAFLYGKKWSTLMVGRVYFGNWLRDYSQAVDVGSLKGINAATIRII
                     VWVLSFMANGYATEEFEVTEERLGVYRPEEHIDNPLGYADGKDAREFDPRLRGPVDPR
                     ELEIDPRTGMKNYIANESGGWATSAGYLRWSFARSIHFGRLYTSGANGTSGKEADLCE
                     ALRCLGQALHCMEDFGAHTNYCELALIEMGYHNVFPHCGSATKIPLNGKMVYPLVTGT
                     FGAVDFLHSVLGEATDHFTQSEVDEIDIALKNAEQATMSGDSRRGFFGSGSGSGSGGS
                     DFISLLGQLPGVGDGFAAQARELKAASAAQEQENMRAAGNTNIVPGMSPNFDPVKVSG
                     QIYPILQFRDKIVRSINSMISKIPGLEKLLEHISETLTAFILGLLAPFVRPIINQVNQ
                     TLKEGSSGLLATSAKQQFEPWDNPHCTDPTHSMLSKDHFTNVLNSCSGRVAVTILQYV
                     VPRIMFAWENPGVPVDEVVNDVLRAFHHPAARDERIEIQRDMFETVRKWAQETPYRNQ
                     LDHLLSSESVRNHKNHILNGQAGSRSAPGGGCGHGDGGHGKPAGSLWSHIQNVNRDAR
                     EAGASPGVGAGVGAGGAGGAHHAPPPMHGEAASYYAASSPQPSQPYAGRPGQSGYAAT
                     YERPTPPASQPPYGGGYPGQGGYGQHPHPHQHQPPSAAHGGYGQPQYGGHHGGYGAPQ
                     PGGYPPHGQQPSPSWGQYPRY"
     gene            complement(805194..807541)
                     /locus_tag="MYCTH_2311481"
                     /db_xref="GeneID:11506676"
     mRNA            complement(805194..807541)
                     /locus_tag="MYCTH_2311481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666577.1"
                     /db_xref="GeneID:11506676"
     CDS             complement(805246..807048)
                     /locus_tag="MYCTH_2311481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666625.1"
                     /db_xref="GeneID:11506676"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Spoth2_2311481"
                     /translation="MWPRALRAAGLRRRPLRVPAQGAALLTLQDAAQHRGNQRQQFRD
                     QATRRSFHNYFVTHLPSSSLHPDSRSSAGPGHKLPRAASTPHTPSPGSAPAAAPPNMP
                     SRDLTVVRIPLRSAKHHFGVCNSRGQRARNEDTHQAGTISIPAFARRVPVSLVRHQAA
                     KTAGEGTSADSALGDPQVFYFGVFDGHGGSECSEFLRDELHGYIEDAAARLGLKSSLE
                     RDPGAPDSLKDPERQQQQQQQQQQRPQQQPAVEPSTAARLESELLDEYKRTIGGYFRR
                     FRPNYFTTAASTTRNSASSSSSSSSSSPSPSSSNERTSPGQQPAGPQPGGVSLESVLT
                     YAFLRADLDFVTAQARKPDPDDPYASDVPLNKDEVLGSPHLPPSGHGIGGPVRFKGGS
                     TASVALISTPTPSPFWHPAAHSTLVVAHVGDTRVLLCETATGLPRPLTSDHYPSSPAE
                     SRRLRRYAADSVVTDSFGEERIQGLANSRSFGDMQGKRVGISAEPDLARVDLGPAQYA
                     FLVLVSDGVSGTLADQEIVDLVKEAATPEEGARAVVEYATEVSADGDNATCLVVRLGG
                     WERRSEGGVGSLGTREMREMRRAEASDPRRRGRL"
     gene            <807523..>809093
                     /locus_tag="MYCTH_2130550"
                     /db_xref="GeneID:11506677"
     mRNA            join(<807523..807622,808363..808881,808948..>809093)
                     /locus_tag="MYCTH_2130550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666578.1"
                     /db_xref="GeneID:11506677"
     CDS             join(807523..807622,808363..808881,808948..809093)
                     /locus_tag="MYCTH_2130550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666626.1"
                     /db_xref="GeneID:11506677"
                     /db_xref="JGIDB:Spoth2_2130550"
                     /translation="MLIRVLGTQSGIDHSGELFRVLLELRCHTVYSVCDTADGPDGDP
                     ADSFPTKAGFPIVDIVLDVTFETSKETLKAARRAAKPRPRQNVAPPPALKPETRVGYR
                     VQLSALKQNSKYFDNLLSDTRFAEARSIEQGFKELSLRNVKPSEADAGDLPVVRIHED
                     DEATRSAGHVSVFEDLLRILHREQSTSKAVIMHYLAVLAVLADRFDCRPGMTALPYPG
                     QVKRSSGKRSSSAWLLDQPLKLHAATRELIMSGSRR"
     gene            809080..809550
                     /locus_tag="MYCTH_2311482"
                     /db_xref="GeneID:11506678"
     mRNA            809080..809550
                     /locus_tag="MYCTH_2311482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666579.1"
                     /db_xref="GeneID:11506678"
     CDS             809274..809435
                     /locus_tag="MYCTH_2311482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666627.1"
                     /db_xref="GeneID:11506678"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="JGIDB:Spoth2_2311482"
                     /translation="MYQDVKRRLPYDWSDIVDAFTYRTVASTIRIYFVKCMFATYASI
                     SMLTNGIPA"
     gene            complement(811346..812565)
                     /locus_tag="MYCTH_2311483"
                     /db_xref="GeneID:11506679"
     mRNA            complement(811346..812565)
                     /locus_tag="MYCTH_2311483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666580.1"
                     /db_xref="GeneID:11506679"
     CDS             complement(811523..812476)
                     /locus_tag="MYCTH_2311483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666628.1"
                     /db_xref="GeneID:11506679"
                     /db_xref="JGIDB:Spoth2_2311483"
                     /translation="MTLVVVGWCFMVTGQSVVLYSRLHIVMRNTSRLRLVLAMIVANA
                     VIGHIPTAVFAYGSNSSNPAPFIVPYSIYERVQVTLFFLQEIIISGLYIHETVLLMRV
                     RSRSGISGRNQGRDSTRRRLMTHLVVVNAVIVVLDITILALEFAGLYAIQTAYKGFVY
                     SIKLKIEFSILNRLVEMTQGGSSGHDSSYARTAANNNTSLPLETMDGLREKNRRSRAA
                     ADHHYPHQHRNDMGNKVYVGAGGPGADAEDGKHNGVSVVMTTEVTVQRDRLYVDSDRD
                     RDAESISGRSGATVESAVEGSIGQARQPSYSSQRNIVNTQY"
     gene            complement(<814446..815681)
                     /locus_tag="MYCTH_2311484"
                     /db_xref="GeneID:11506680"
     mRNA            complement(join(<814446..814689,814800..815681))
                     /locus_tag="MYCTH_2311484"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666581.1"
                     /db_xref="GeneID:11506680"
     CDS             complement(join(<814508..814689,814800..815296))
                     /locus_tag="MYCTH_2311484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666629.1"
                     /db_xref="GeneID:11506680"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Spoth2_2311484"
                     /translation="MTCESTSSLSSRAIASWEANAAYWDSTITKQGNKYWRRLQEPSL
                     TRLLKLTLSSSSPCRALDLATGNGLCARWLVRNGATSVLATDASENMLALARAHCEDG
                     EESELERKEIRWRRVDVTSKSDLTALARDESPFEIVLMNMAIMDVADLEPLAGVLRDL
                     LVENGVFVATLLHPVFFTSNATRNIEVRFDPVTGESEIVRGKIVREYMSVPPSLGIAV
                     PGQPEKQV"
     gene            complement(816229..818713)
                     /locus_tag="MYCTH_2311486"
                     /db_xref="GeneID:11506681"
     mRNA            complement(join(816229..817583,817657..818713))
                     /locus_tag="MYCTH_2311486"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666582.1"
                     /db_xref="GeneID:11506681"
     CDS             complement(join(816564..817583,817657..818442))
                     /locus_tag="MYCTH_2311486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666630.1"
                     /db_xref="GeneID:11506681"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2311486"
                     /translation="MTRNANSSTLFHLVPENAAASDALLHPDNARFVSTSKRGLDGLE
                     IGFHVPSIPKGRVITRLGRDADLILRGRSVSAVHVAFEIHPETLVVLLSVRSKYSSSV
                     TVSPDVGQTMEPVEGDCVIVYGTDYRISIASYDFRLMWRDLGSVEALRQLAIEGYQIS
                     LQRLQTVRSRDLPTDGDSSELHSWHNTRLHTARRILFREAVGAPRELIGEGTFGAVYR
                     AIDLESGNPFAVKVVKLYVYGARYVEQARAAVHREMKTLEYLKHKHIVECLGTAKFDS
                     DQPEIFMPLRPGNLRVLAGDKDKRCTDDSLCMQVLEQMLSALDYLADRGYCHRDIKPE
                     NILYYEHAEQGTYTFQLADFGLANHQANAGTMCGTKFYQAPELYRDYGTAGIQSPKMD
                     IWSLFCTILDVHPKFNFPPWNATSYHDILVAVRAAVPLIPKLADMAREDPAQRASAAQ
                     LLVAHFGGRGLTTRKSAIPPLPSQPPAYREQAPPPANLGSPPPANARSPSPRPLPQRA
                     PKAPPLIVYDSRHRRQRGKEPAVGPSNLFEVARAQNRAQNPRPPQPMMMAAPRQDGGG
                     VRKSRAVPAGSPTQSQRIVDALDTELLSAAYAGRA"
     gene            819033..820796
                     /locus_tag="MYCTH_2311488"
                     /db_xref="GeneID:11506682"
     mRNA            819033..820796
                     /locus_tag="MYCTH_2311488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666583.1"
                     /db_xref="GeneID:11506682"
     CDS             819179..820768
                     /locus_tag="MYCTH_2311488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666631.1"
                     /db_xref="GeneID:11506682"
                     /db_xref="JGIDB:Spoth2_2311488"
                     /translation="MPPLFDEAQIHNALRNEALPELARLAGDQRLRERALDRFDRDEP
                     PPYLSSTDDEEYLENELPLGSDGSGVLQEFVDLMKQPLTDAERDTVAMDLHFSGKVYQ
                     PGHRYHQEAVIEAQRIRRVCRELRPANAEAQKFLDFQGRAGDERLNILVRRNIKRRWR
                     KLGVWNPQWGIPGRRNGTNPDDDASKWKWRWQHGDAAAEWTPSATATAANPKHPITRA
                     LALRQGLLHGEHAPVPPRSRLPDDASASQAESFIISRPWFVFMAEYFEERERFYRIPP
                     MKRRHYREPIAKPVIERWKSRGDWRDEWDQPVEGAYVPGWKWRHESPSPEPEDLTPLE
                     TMDLEFTPSEVDALEAIRPPTPPPPPPPRSHSPRHFPSGDQTVHSGTGLFSSHPLPRA
                     PPTPPAADDSAPEVPEPAQAAPQQQQQQPRRRPRQRKDEQPVQPVRRSARIAAMNKTK
                     ANPPPPPAPAPPPQARQSRQRAARAPVGEQPAGRPKTDRSTRAQRRAAASDKPSARSM
                     QAEKPTTARSRGRPKKKTGRR"
     gene            complement(821114..824973)
                     /locus_tag="MYCTH_2311492"
                     /db_xref="GeneID:11506683"
     mRNA            complement(join(821114..822334,822401..823086,
                     823385..824404,824497..824973))
                     /locus_tag="MYCTH_2311492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666584.1"
                     /db_xref="GeneID:11506683"
     CDS             complement(join(821368..822334,822401..823086,
                     823385..824404,824497..824649))
                     /locus_tag="MYCTH_2311492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666632.1"
                     /db_xref="GeneID:11506683"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2311492"
                     /translation="MPATSVEGVAPGAGLEWPPVSASKEQQTRPPPRKRRRIVISCTE
                     CHRRKQKCDRKFPCTNCVSRNKDSACRYETGAPTAKQHGRRAVTGMTAAPSDMAGKQE
                     LSQERTTTTAAAATFGYSHTSANTLGFLHHIESTTSATSANPDNDDDDDDDDDDKNNS
                     NSNSNNSNSNDNNVADVTAIIAELHNPLSRTSTTTTANSSDLTTTTTATTTTTNTTNN
                     TPTLTPAERATRDRYKTLIRQLPGRCAIEKLSALYFAEFNTHYAMLDRDVFDAQLAAW
                     YRLPFSLLSSGPGPAALSREMRAFPAVVFQVCAVALLVLEDEDALDSGGGGGDAAWFS
                     GLKYAGGMTFEDLAREYSDCGVELLTVLGKREMSLNTVLAGWMRASWLKYVGLVTESW
                     HAVGSAVRDAQEIGLHRDSLDPKPASNDAEAVLENQWEVQRRRKAWMTLVQWDIHMAS
                     VLGRPTTTDLRMAPPSLAVDAPVPKDRSKTPVLPRGEIDPPTPVTRAIWAYHVTRPLK
                     EILELEKEGPCPKDFSRVDRLHNELLDLEARTPAFFRLENPDIRFDALPKCAWLPLAR
                     VVFPQLISFELMALHRPYIFTRPKSRTEALKASLDMLDAQRLHFQSLRPQMYKTFSMF
                     FGTFDAIVLMASIYILFPKEHPDMVPRAVQHFHWAVERFEAMSTRNSLAKSALGVLHA
                     IYMRMTKALGLSKLAAKRMLLPGSASNSNFQANGSANSSIASSSGFSPCATTSYNPSP
                     STGSGTAMSSTAMSTPGHDFSPPQHSGLNGSTQQTSAAELTTTTTPPEDPATGFSFNW
                     DPDPDLFTVNPSSNDNPFEWNPPSDFDWSSLQPIYATSDLVYHNLTRTVPGAPGAPGG
                     GDGGQNGVGWDYQAQQGTYDGRGGGGTGLQCNGPDMTAGGGGGGMGMGTATAPDGGGA
                     TTLPYCQFRGDFGDDSVWNLLNQYSPF"
     gene            complement(825797..827344)
                     /locus_tag="MYCTH_2311494"
                     /db_xref="GeneID:11506684"
     mRNA            complement(825797..827344)
                     /locus_tag="MYCTH_2311494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666585.1"
                     /db_xref="GeneID:11506684"
     CDS             complement(825837..827018)
                     /locus_tag="MYCTH_2311494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666633.1"
                     /db_xref="GeneID:11506684"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="JGIDB:Spoth2_2311494"
                     /translation="MADRHPTLSQSFAERAKTASHPLTRYLFRLMDLKASNLCLSADV
                     STARELLTLADRVGPSIVVLKTHYDLISGWDYNPQTGTGAKLAALARKHGFLIFEDRK
                     FVDIGKTVQMQYTAGTARIIEWAHITNANIDAGKDMVRAMAEAAAKWKERINYEVKTS
                     VTVGTPVSDQFDDAEEQAQWPQHQQHQQQQYQQQRDEKGGPRRLGTREEQHQQDNGDG
                     DGRKGSIVSITTVTQSFEPAHSPRLSKSNELGDDAVFPGIEEAPVDRGLLLLAQMSSK
                     GCLMTKEYTQACVEAAREHKDFVMGFVSQESLNSAPDDTFIHMTPGCKLPPPGEDEET
                     SQIEGDGLGQQYNSPSKLINICGTDIVIVGRGITAAGDPPSEAERYRRKAWKAYLARL
                     A"
     gene            830459..832094
                     /locus_tag="MYCTH_2311495"
                     /db_xref="GeneID:11506685"
     mRNA            join(830459..830796,830898..831274,831428..832094)
                     /locus_tag="MYCTH_2311495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666586.1"
                     /db_xref="GeneID:11506685"
     CDS             join(830607..830796,830898..831274,831428..831817)
                     /locus_tag="MYCTH_2311495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666634.1"
                     /db_xref="GeneID:11506685"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Spoth2_2311495"
                     /translation="MAGSKNRRQGTAASPEPKAQQDDNNNGTAPIAHGNGSANIAANA
                     KSTVEGPRENIFLLWPNIIGYSRIILAVASLYYMPLHPRTCSLLYSVSCLLDALDGYA
                     ARYFEQSTRFGAVLDMVTDRCTTSCLLVFLSSAFPRWAIVFQGLIALDFASHYMHMYA
                     TLAMGGSETSHKNVDKSRSRILSLYYTNKTVLFVACTLNEAFFIALYLLSFSSPLLSP
                     SLLQTVPDQAAEAINRGAEVDSSLLRQLFANPHSAGALELARANKMDSFWPWVLAGVS
                     FPVMAFKQVVNVIQLVKASRWLAEGDVALRRAQGLPRKRKTN"
     gene            832998..834111
                     /locus_tag="MYCTH_2311498"
                     /db_xref="GeneID:11506686"
     mRNA            832998..834111
                     /locus_tag="MYCTH_2311498"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666587.1"
                     /db_xref="GeneID:11506686"
     CDS             833039..833998
                     /locus_tag="MYCTH_2311498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666635.1"
                     /db_xref="GeneID:11506686"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="JGIDB:Spoth2_2311498"
                     /translation="MSHPRVEEVSDSDVDMSDPSEGDIDELIESDIMRRVDSKPQSSR
                     PQPPRPQQQQQQQQQQQQQKQKQQQQQQHARPGPPPPYPRMQTTTDEKAYKSFQCLYP
                     VYFDATRSRAEGRRVPRSMAVANPLAFDIVQACARLGLHTVLEAGKLHPKDWANPGRV
                     KVDLRHHHQQQQQGESGGGGGGGGGPPKINNKHHLYLLVAQHLRAHPTTDSSRSLRVE
                     VRGAPMPPQALEPGKPWPRPAVPRGWKMGELLPYYSPAMTGGGVSENFLKDMMKEMQQ
                     HGGGAGGMPDMASLLAAAGGAGAGGLGGAGSSGPGSKKKGKGK"
     gene            complement(<841854..>844196)
                     /locus_tag="MYCTH_2070581"
                     /db_xref="GeneID:11506687"
     mRNA            complement(join(<841854..842019,842164..842376,
                     842533..843074,843201..843380,843432..>844196))
                     /locus_tag="MYCTH_2070581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666588.1"
                     /db_xref="GeneID:11506687"
     CDS             complement(join(841854..842019,842164..842376,
                     842533..843074,843201..843380,843432..>844196))
                     /locus_tag="MYCTH_2070581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666636.1"
                     /db_xref="GeneID:11506687"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="JGIDB:Spoth2_2070581"
                     /translation="FILYRQHHQARVVQQNPGLANPEISKIIGEQWRAESEEAKSQWK
                     LLAEEEKQRHQRQHPDYRYQPRRGNKVGSLHSSRPTSTPGEDPHHCPKCGGRYIATPR
                     TPSTPFMMPTGSKIGSTPYGSPPGDHNLGSKGDMSRQNRSHPAAQWGAATSNPYPSNA
                     YDVHERYEAAMSPNDVKRRRYNTTGSYHNFHALPSPPTPFTQPGHHAQYHHATPHSYS
                     RRPSLSNPTTPAATAHPSPSLSGLSAIMPPPPRPSHASSSSSSSPNQHRHHHYSHHRR
                     HHPDFDESLRLPPLQTHLPASPDENSEPATAAAAAAAATRTHARSVEAKVMSISFVSK
                     LRVLERISPPLGAVPGAPGSGMSRGPVIAVEGPDARMVRAVSRVVERALRAASPAADD
                     KGGGWEVRCWEDENASLQRRGSVSGGQEKDEALNNAGQQSASRHGSQASAISSPSANL
                     NPFTAYLRTIADWHAKSAEIVQFVTSSAPAPAPASTATRQTRLLSTTTTSAINKNVSR
                     LPIALLPSGFSLTLSDRFASAVLISDAYAPVDHWQWMATLWRGIVGPDLVIYVSGTST
                     LSGSRGSGLGFAEAERMMIDQKMERRLGFEVVEWVRSGGWTTAGRGVDGGFNVEY"
     gene            complement(845832..847816)
                     /locus_tag="MYCTH_2145431"
                     /db_xref="GeneID:11506688"
     mRNA            complement(join(845832..846202,846275..846606,
                     846700..847467,847560..847816))
                     /locus_tag="MYCTH_2145431"
                     /product="AAA family ATPase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666589.1"
                     /db_xref="GeneID:11506688"
     CDS             complement(join(846070..846202,846275..846606,
                     846700..847467,847560..847703))
                     /locus_tag="MYCTH_2145431"
                     /note="1| AAA family ATPase Pontin [Metarhizium acridum
                     CQMa 102] Contains conserved domain TIP49[COG1224], DNA
                     helicase TIP49, TBP-interacting protein and AAA[cd00009],
                     The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily"
                     /codon_start=1
                     /product="AAA family ATPase-like protein"
                     /protein_id="XP_003666637.1"
                     /db_xref="GeneID:11506688"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="JGIDB:Spoth2_2145431"
                     /translation="MVQISEVRGNSRDHRTAAHTHIKGLGLNSQGIAEKHAAGFVGQT
                     AAREACGVVVDLIKAHKMAGRGVLLAGGPGTGKTALALAISQELGTKIPFCPITGSEI
                     YSTEVKKTEVLMENFRRAIGLKVRETKDVYEGEVTELTPEEAENPLGGYGKTISTLLI
                     GLKSARGQKKLRLDPSIYEAIQKERVQVGDVIYIETNTGACKRVGRSDAYATEFDLEA
                     EEYVPIPKGEVHKKKEIVQDVSLHDLDVANARPQGGQDIMSMMGQLMKPKMTEITDKL
                     RSEINKVVSKYINQGVAELVPGVLFIDEAHMLDVECFTYLNRALESPISPIVVLASNR
                     GMCPIRGANDLVAAHGVPPDFLSRLLIIPTHPYEPDEIKRIVRVRASTEGVQITDAAI
                     DKVAEHGVRISLRYALQLLTPASILARVNGRTQIDVQDVAECEDLFLDARRSADVLAS
                     ESGQGFIS"
     gene            complement(847999..850152)
                     /locus_tag="MYCTH_2311505"
                     /db_xref="GeneID:11506689"
     mRNA            complement(join(847999..849252,849406..850152))
                     /locus_tag="MYCTH_2311505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666590.1"
                     /db_xref="GeneID:11506689"
     CDS             complement(join(848338..849252,849406..849921))
                     /locus_tag="MYCTH_2311505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666638.1"
                     /db_xref="GeneID:11506689"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="JGIDB:Spoth2_2311505"
                     /translation="MASSVQQASKATTQPGEDDDDRNTIDSILLAQVSSKPSSPFLSP
                     VVPRSHSASPMSEFGLPAPSHPRGLSPAPYPLYPRRKMTVAEMAKRFWNRNRGVILVA
                     VSQLFGALMNLAARLLELESDMHPLHILFVRMSMTTVFSCLYMWWNQVPDFPLGARGI
                     RGVLVVRGISGFFGIYGMWFSMMYLPLAEATVITFLAPMLAGYMCHILMKDPFTRKEQ
                     LAFLVALAGVVLIARPASLFGSSGIAADSETLHEAQPDSTTTTSQPGAGEEPTSAQRL
                     LAILVALIGVLGAAGAYTTIRYVGKRAHALITVTYFSAWSTLVSTAALLLCPLLGIGQ
                     AEQPIINFRALLRPLSAHEWFLLLALGVCGFVMQFMMTAGISGEKSNRATAMVYTHML
                     FAAGFDKWVFGHEMGLVSLLGCGMIVGSALWAALGKKAPTEGRRKEEDVEGAGRVSEE
                     AAPMLDGAEEEEEGRLNGREGLARER"
     gene            850896..852128
                     /locus_tag="MYCTH_2311508"
                     /db_xref="GeneID:11506690"
     mRNA            850896..852128
                     /locus_tag="MYCTH_2311508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666591.1"
                     /db_xref="GeneID:11506690"
     CDS             851174..852025
                     /locus_tag="MYCTH_2311508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666639.1"
                     /db_xref="GeneID:11506690"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="JGIDB:Spoth2_2311508"
                     /translation="MSVVERHQGSPTATEDRGSRAVPEGQQRGSDQTEQSITAKKPSM
                     SPSEPTESGSSRTPIPKSAKSQVPPPPAAAAAAAAGTGATNITLAPDPSPPTARIRIA
                     DRIGDLFAAPPNSVLIHACNTVGSWGGGIALAFRSRYPDAFKVYRAHCARSIPDQLVG
                     TALLIRPPAAATAGGATGGSRGMGHYIGCLFTSRGYGRSRDPPESILGATGPAMRHLM
                     RLIAEEEERTGAQIGEVRMCRINSGLFAVPWDRTKRVVEELELAEGEVPGNAEGGVVE
                     IVAWERE"
     gene            complement(852130..853184)
                     /locus_tag="MYCTH_2311509"
                     /db_xref="GeneID:11506691"
     mRNA            complement(join(852130..852815,852886..853184))
                     /locus_tag="MYCTH_2311509"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666592.1"
                     /db_xref="GeneID:11506691"
     CDS             complement(join(852388..852815,852886..852946))
                     /locus_tag="MYCTH_2311509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666640.1"
                     /db_xref="GeneID:11506691"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="JGIDB:Spoth2_2311509"
                     /translation="MEPRARAGKNVGKMNFGHNELAQLLYGHGDVRAPLNETVRVLDE
                     ILTEFIQGVSFEAARAAQHAGRQKVKFEDFEFAMRRNPDYMGKIQEMFEKKKEIEAAR
                     KGFNIEEQLVRDADKEEKAAEKDREKGGSKRGRKATSQMQIGEEDLEDGDDDLDLVGD
                     GS"
     gene            853293..854077
                     /locus_tag="MYCTH_2311511"
                     /db_xref="GeneID:11506692"
     mRNA            join(853293..853454,853532..853584,853691..853747,
                     853835..853916,853991..854077)
                     /locus_tag="MYCTH_2311511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666593.1"
                     /db_xref="GeneID:11506692"
     CDS             join(853452..853454,853532..853584,853691..853747,
                     853835..853916,853991..854014)
                     /locus_tag="MYCTH_2311511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666641.1"
                     /db_xref="GeneID:11506692"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="JGIDB:Spoth2_2311511"
                     /translation="MTALFNFTSLLLVILLLICTCAYVHQLFPAILDRNKTGITGTFW
                     KCARIGERLSPYISLCCGFMAISIFLGM"
     gene            862958..865590
                     /locus_tag="MYCTH_2311515"
                     /db_xref="GeneID:11506693"
     mRNA            join(862958..863014,863279..865590)
                     /locus_tag="MYCTH_2311515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666594.1"
                     /db_xref="GeneID:11506693"
     CDS             863447..865501
                     /locus_tag="MYCTH_2311515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666642.1"
                     /db_xref="GeneID:11506693"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="JGIDB:Spoth2_2311515"
                     /translation="MSDQGAGGGIESHMSTHRRQDSGEEPLPTEPAPEKRAPASESDT
                     EELTPPPQDLPRGSRKLSQSGSNRGARAVSPAQGLSRNPSTCSTSSNARPHAEYLPAR
                     TPGLEQRHSPPTSHPNIAPSPQLEPPVTKATLSELDVQKIVHNPKLRHDINFDPELHF
                     RPNLDGDKGKRKQEKANQFWNTLYEQLVLFVTDRETFHARYGHGDWCLPVLLRAVRDI
                     IETLVPQRDRQLLNEGLNVDLLMQQFNRGVADLEKLASWLASVLKLHCAPMRDEWVDE
                     MYQELSNGNRNNDMGELVKGMRSLLSVLEAMKLDVANHQIRCLRPVLIEDTVHFEQRF
                     FLRKMESRKLSIAPSRMWYRAAQEYTERLYAGSPMPHLQAFGEMSVFFEALSRLVLPS
                     TCLKAIPPTFVFDEDRILKLRSDMHDSICLEICMRKFEELERLSRVTQLYARIPSYVS
                     ENVAGNRSSGDFNFMAAAAATSRPTSLAFSDNSSAFSSPRSSGLFAQPPAADSADPRS
                     RASELYSSLLALLHTACPASSPAERWKGLAPSMALQILRYANAPASLPGFESQLAACL
                     DDVNSDLFREVEAHFQRRLLAELARRVAEFKNLSGVALFSHATGGRVPRRCGGCSDQG
                     RPAGALFGAEVSREPRDDAGVDDMAVRLAHLGVLHWRVWAPLAYEGDIESELSAMQNS
                     MI"
     gene            <867251..867483
                     /locus_tag="MYCTH_2311517"
                     /db_xref="GeneID:11506694"
     mRNA            <867251..867483
                     /locus_tag="MYCTH_2311517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666595.1"
                     /db_xref="GeneID:11506694"
     CDS             <867251..867428
                     /locus_tag="MYCTH_2311517"
                     /codon_start=2
                     /product="uncharacterized protein"
                     /protein_id="XP_003666643.1"
                     /db_xref="GeneID:11506694"
                     /db_xref="JGIDB:Spoth2_2311517"
                     /translation="MHAPFIGSNLLPASHFLSFFFTPYLGAYSGVLGLERVAERDRVA
                     RGGCNKENEYDCAM"
     gene            <867675..>868444
                     /locus_tag="MYCTH_57924"
                     /db_xref="GeneID:11506695"
     mRNA            join(<867675..868040,868358..>868444)
                     /locus_tag="MYCTH_57924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666596.1"
                     /db_xref="GeneID:11506695"
     CDS             join(<867675..868040,868358..868444)
                     /locus_tag="MYCTH_57924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666644.1"
                     /db_xref="GeneID:11506695"
                     /db_xref="JGIDB:Spoth2_57924"
                     /translation="RGQKYRPLHPLKRVSRHPRVSYLFFNILQFNNIDLNLQDFIRKL
                     KANHRAKQELSPYLRVAICSLMAIGYTKQSLATLFGISRHAIRSIIERWNSYHTFDSK
                     PRSGRPEVLTPAEKRYILLILFYFSSEKYNRRFINLKNYIRVNITIIV"
     gene            complement(870153..873301)
                     /locus_tag="MYCTH_2311518"
                     /db_xref="GeneID:11506696"
     mRNA            complement(join(870153..870388,870490..870710,
                     870776..872830,872909..873301))
                     /locus_tag="MYCTH_2311518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666597.1"
                     /db_xref="GeneID:11506696"
     CDS             complement(join(870257..870388,870490..870710,
                     870776..872830,872909..873116))
                     /locus_tag="MYCTH_2311518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666645.1"
                     /db_xref="GeneID:11506696"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="JGIDB:Spoth2_2311518"
                     /translation="MAPARDTPFRSADMSMVQLYISNEIGREVVNALGELGLVQFRDL
                     NGDLSAFQRAFTQDIRRLDNIERQLRYFHAQMEKAGIPLRKLDLDVDTLAPPTTAEID
                     ELAERSQGLEQRVASLNESYEALKKREVELTEWRWVLREAGGFFDRAHGNVEEIRAST
                     DNDDAPLLQDVEHHISAPEVERSFSGMNIGFVAGVIARDRVAAFERILWRTLRGNLYM
                     NQAEIPEPLIDPANNEPVQKNVFVIFAHGKEILAKIRKISESMGAEVYNVDENSELRR
                     DQVHEVNARLSDVQSVLRNTQQTLEAELTQISRSLSAWMVLVAKEKAVYNTLNNFSYD
                     RARRTLIAEGWCPTHDLPLIRSTLQDVTNRAGLSVPSIINEIRTNKKPPTYLRTNKFT
                     EAFQTIVNAYGTATYQEVNPAIPVIVTFPFLFAVMFGDLGHAIIMLCAALAMIYWEKP
                     LKKVTFELFAMVYYGRYIALVMAAFSIFTGLIYNDIFSKSMTLFDSSWKWDVPKNYHP
                     GQTVRAVIRDDNYRYPFGLDWRWHGTENDLLFTNSYKMKMSIILGWAHMTYSLCFSYI
                     NARHFKRPVDIWGNFVPGMIFFQSIFGYLVVCIIYKWSVDWFAIGKQPPGLLNMLIYM
                     FLQPGFIDVPLYPGQKYVQVGLLLLAVIQVPILLFLKPFYLRWEHNRARAKGYREIGE
                     RSRVSALDEDDEGLVGGAANGNRHSVDSAGEGVAMIAQDLDDDDEAGDGHGHGHGGEF
                     DFGEVMIHQVIHTIEFCLNCVSHTASYLRLWALSLAHQQLSAVLWSMTMGPALKATGI
                     GGAIFLVVVFAAFFCLSCIILIIMEGVSAMLHSLRLAWVESFSKFAEFAGWPFAPFSF
                     KQLLEESEELKEYLG"
     gene            complement(<873556..874265)
                     /locus_tag="MYCTH_2311519"
                     /db_xref="GeneID:11506697"
     mRNA            complement(<873556..874265)
                     /locus_tag="MYCTH_2311519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666598.1"
                     /db_xref="GeneID:11506697"
     CDS             complement(<873674..873879)
                     /locus_tag="MYCTH_2311519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666646.1"
                     /db_xref="GeneID:11506697"
                     /db_xref="JGIDB:Spoth2_2311519"
                     /translation="MAWRAAAARQSGLNADELRFTVERQLLEGHAVLSHAHAIRQLGL
                     HIQVLDPGSEEQIALEATSAAAED"
     gene            complement(874621..875669)
                     /locus_tag="MYCTH_2311520"
                     /db_xref="GeneID:11506698"
     mRNA            complement(874621..875669)
                     /locus_tag="MYCTH_2311520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666599.1"
                     /db_xref="GeneID:11506698"
     CDS             complement(874737..875120)
                     /locus_tag="MYCTH_2311520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666647.1"
                     /db_xref="GeneID:11506698"
                     /db_xref="JGIDB:Spoth2_2311520"
                     /translation="MVLWSISYSGDGFTLEISIHSPSDREHAFSSFDFDAVLDSGTLP
                     NSEPSGSGPPRPAYDRDHNPRWARKVGAIRRLFGRGAMPVEFSCMLPPVEIINRLVVR
                     RQTRRRMTPTGYARTPEPNLFLMGF"
     gene            complement(877307..879676)
                     /locus_tag="MYCTH_2311521"
                     /db_xref="GeneID:11506699"
     mRNA            complement(join(877307..878856,878928..879676))
                     /locus_tag="MYCTH_2311521"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666600.1"
                     /db_xref="GeneID:11506699"
     CDS             complement(join(877457..878856,878928..879399))
                     /locus_tag="MYCTH_2311521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666648.1"
                     /db_xref="GeneID:11506699"
                     /db_xref="JGIDB:Spoth2_2311521"
                     /translation="MAADEPSRPSTPDRVSRSSFSSIREHDNTLPQTFSQSKISSYFG
                     VDSDEAIDDTPPPPSSANPSSSSTSARGINMIQARFQPPITQPNSKLLGYWTPAETFQ
                     GWKAIQVKGKLASKSFGDLQVLNQVFSSHNPTRPTKRGQNRPGEAPIERLPTEILTAI
                     INLLALDVPPNGVTRRNIDLMSLLLTSRTLHVATLSTLYSKITIPHSRIFQKFLAHIS
                     AHPNLGTIVRRLDFCHFNPNQLFLTAAERSKARNLTSETLLQCLELTPYLQEFLAQEY
                     IDGDLDPAVLQKLFLGLPQLVALDFCGCTSNSFKESFVSILSPNWPKELTVRRLSLHK
                     CLTLPSSVFETILPRLARLTHLDVAGTRVTDAALASIPPTATLTHLNLTKCTLLSARN
                     VIDFLANHPAAKGLQFLSLATDARSHQTFDADHITELLPLLPRTLRSLNLKGSKMTAS
                     HIDLLRPLTKHLEELALGRSLTLRDVNRLLVPDEDGDDVAMQVDWVPHTLRYIDLSDL
                     WGQELDMVYLFGTSCAILKSYSEPLEVVELAEDVCRRVSKSTTALQRIGWHLSECGSR
                     GWLVRQPSKSHGSGPATRDDGRRSWKMGAESWGMRKIPVAHAEVGGMYGSFMFSRKL"
     gene            complement(<884231..>886972)
                     /locus_tag="MYCTH_97015"
                     /db_xref="GeneID:11506700"
     mRNA            complement(join(<884231..884286,884632..885779,
                     885840..>886972))
                     /locus_tag="MYCTH_97015"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666601.1"
                     /db_xref="GeneID:11506700"
     CDS             complement(join(884231..884286,884632..885779,
                     885840..886972))
                     /locus_tag="MYCTH_97015"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666649.1"
                     /db_xref="GeneID:11506700"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Spoth2_97015"
                     /translation="MKTAKPPAPEGVTGSSRRQPVRQTRVNPPRTSSLNRNNPLAGAP
                     ASEQPINILPGVTHFADAITALPRELVRHFTLLKEVDAKIFAPEAALLQLLHDALNTP
                     PPDLSRPVNDALSSTASVSAPMSTTGPANPAAPPSDATTSSVFDPANIPRRTLFRDTA
                     LKIQEILVSLEEKNHVLATANDALQKQLARIEDIWPHLEAEFSEEAKWGSATHWAYVE
                     NRQAKANDKQAERSRREGAATLSAAAQALAEEAAARSSDRKQAIAAKKNAKNQAADAD
                     SDKVQDSGKRAQGTKSRKPLPDHGPVGLGITSAPSGGASASKRRKVAESKSNGATAER
                     AMGSVFGANSTRRGTTSPTETPAPEGGNKKRKALPTSSSQAKKSRTNAAMSPSVTSSP
                     VVGALPDPVKPGRASPAPSATASRPASSRARQNSTHSNVDNSRQRLPSVASNKPSGNS
                     QGTPDPAQPSNGAKTSTDSKTQKEATVPIMNKPSPLKTETEEPPSAPEPAQDDNDDNS
                     ARQTDEQPAQSNKEAAALGTQSTPASGVKTKSGRASKPSTPAISTFAEAASSNSSATT
                     SRSRPSRGAENSANNATSGTAASNQSNTTTAKRSHKKGASVSTSATAVAQAAAAATSS
                     SSTSAGTSSSGALATTAAGKDKERDRDRGSGPGVSASGTTPAASGGRKDKANSGSSSG
                     GTGNTSNNNNAGARKAGAGAENEDDADEDDDQDVADEDVYCYCNQVSYGEMVACDGEG
                     CPREWFHLECVGLKVAPKGNAKWYCEDCKKRLKITERR"
     gene            complement(887378..889191)
                     /locus_tag="MYCTH_2311525"
                     /db_xref="GeneID:11506701"
     mRNA            complement(join(887378..888326,888381..888640,
                     888700..889191))
                     /locus_tag="MYCTH_2311525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666602.1"
                     /db_xref="GeneID:11506701"
     CDS             complement(join(887735..888326,888381..888640,
                     888700..888921))
                     /locus_tag="MYCTH_2311525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666650.1"
                     /db_xref="GeneID:11506701"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="JGIDB:Spoth2_2311525"
                     /translation="MSDLYLSRLRSWFLSSPPAEWALNRLRSTLIGALSQGPIPRHVA
                     FEMDGNRRYARSHKIETIEGHHLGFEALARVLEVCYKCGVKVVTVYAFSIENFHRPKY
                     EVDGLMQLAKVKLEQLLQHGELLDRYGASVRVLGRLDLIPPDVLEVVGRAMAATQNNT
                     ECVLNICFPYTSREEMTTAIRTTVEEYSTTPRPHSTPFSQSRITQKILSKQAGKPDVL
                     EPIRESVSPTPTSIHSDDQDDAVSTATTLHSDSAAVKGIDGEEAVAIYPNAETITSET
                     IDKHLYTADCPPLDIFVRTSGVERLSDFMLWQCHQDTQIFFLKCFWPEFDLWNFLPVL
                     VEWQWRQKQKARDERPRRRVKQA"
     gene            889337..890664
                     /locus_tag="MYCTH_2311528"
                     /db_xref="GeneID:11506702"
     mRNA            join(889337..889831,889888..890664)
                     /locus_tag="MYCTH_2311528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666603.1"
                     /db_xref="GeneID:11506702"
     CDS             join(889577..889831,889888..890457)
                     /locus_tag="MYCTH_2311528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666651.1"
                     /db_xref="GeneID:11506702"
                     /db_xref="JGIDB:Spoth2_2311528"
                     /translation="MSFASTPVTRTLVLGLVGSSIAASLLDIKHYFYISVGTHILQYG
                     QTWRALIWQLCYTNSSEVLFAAMTLYNLRVVEQQWGSRKYASFILVSGLLTSIIPPVI
                     LTTILRPLSWGIFDFLPAGPTPIIFAVLAQYHAMVPHIYQYKVALSTRAPSNNDEDSG
                     VTFSDKSTKYLLALQLALFQWPGSLLGAGIGWLVGQAWRSELLPGALTRWRVPGWVVG
                     LRTPKSSERFEGMRRRLESEGASSGAASGAQQQAGVDGNRRRTMAQQLLDEARGAF"
     gene            891733..895041
                     /locus_tag="MYCTH_2311529"
                     /db_xref="GeneID:11506703"
     mRNA            join(891733..892231,892296..895041)
                     /locus_tag="MYCTH_2311529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666604.1"
                     /db_xref="GeneID:11506703"
     CDS             join(892034..892231,892296..895034)
                     /locus_tag="MYCTH_2311529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666652.1"
                     /db_xref="GeneID:11506703"
                     /db_xref="JGIDB:Spoth2_2311529"
                     /translation="MDSATMTIGAPAGGPPGRPGSPFSSSGRLSFPDVQSVVMPTGKA
                     LVEGYRKDILNGFEQEKPTYNPLSENRPQRSAHVDLKDPIQVHLLTETALSDSKAYEI
                     LSQEEVDDLKKQIQSLSMRIEQARANLAIQTKYRDAAISMARLYMPSKAEGKRKSLLG
                     NRMSDSAKEAEMERLASERRCEELAAELFSLEKRLMEPQRRLLQHTAGILQMTHRASA
                     KKSGQVPVGPMMNGIPGSPESLYTYTNTRNSMEIPQDDLSFDRGLYLPLEQADGPPAL
                     PRKNPIEIPLKSPIREQNAQLRELREEVEKLREENERILEENMQLKTAEQQLREDQAF
                     ARDEISRLQSREQQLVEEHARAVEEASRMKEETNRFQDADSRLKALENQMTVEIDALR
                     AQTAGQLQAASDAEAKLEALNHKLRDVIVAFNPTKNEGFDSPDRATGSGASLTGQLEY
                     MEKALAAAAEEQKLLAAEVSASSAETAAITSSLSHLEASLGHASTRSQALIRQVLDML
                     QQSNLDLPPPPEGSLDDQLGYLEQALESLGSELSRALEASSSASARKQDIDQVDAVLR
                     GLWEIIQSGFAEIEQQKTARRQNRALGQNGGDDDEELSSTEFESDINEPYSLQAFSAK
                     VQWLYAQVTGLREQKYILQRQIKQQRELNNRSETEKDLELKAKSEELERTQHLLDQAE
                     RAAADAQSQLEQVLADMDTLQKTTAANEAALAASTKTAQDQLQARTARIAALEADVRE
                     AESRLATAEASVAATQSQLAESNTARAAAEAELSSLRAQLTNAAAAADSAAAEVSKLQ
                     QELQSKDAELDRMNMMVVELKTEVTVAKAELDGAYGSRKQRAAEAAALSNSSQSEELN
                     NTITRLRAELENALRDLEEVTRDSIAAEKERLEIEARLDQVLAHKEDLEAEVSRLGQR
                     LMRVQEELDQERLKAVPSPGRAGMGASELSKQFRGVMKEERRKFQEEIRVSSAVFFFL
                     LCCLRW"
     gene            complement(895908..899394)
                     /locus_tag="MYCTH_2311535"
                     /db_xref="GeneID:11506704"
     mRNA            complement(join(895908..896588,896701..897367,
                     897431..898562,898935..899032,899113..899394))
                     /locus_tag="MYCTH_2311535"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666605.1"
                     /db_xref="GeneID:11506704"
     CDS             complement(join(895999..896588,896701..897367,
                     897431..898562,898935..899032,899113..899265))
                     /locus_tag="MYCTH_2311535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666653.1"
                     /db_xref="GeneID:11506704"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="JGIDB:Spoth2_2311535"
                     /translation="MASKRKASAMASAAPEEPVDPADELMFLCLGGGNEVGRSCHIIQ
                     YKGKTVMLDAGQHPAYDGLAALPFFDDFDLSTVDVLLISHFHIDHAASLPYVLAKTNF
                     RGRVFMTHPTKAIYKWLIQDSVRVGNTSSNPTTQLVYTEQDHLNTFPMIEAIDYHTTH
                     TISSIRITPYPAGHVLGAAMFLIEIAGLNILFTGDYSREQDRHLVSAEVPKGVKIDVL
                     ITESTYGIASHVPRLEREQALMKSITSVLNRGGRVLMPVFALGRAQELLLILDEYWAK
                     HKEYQKYPIYYASNLARKCMLVYQTYVGAMNDNIKRLFRERMAEAEASGDGAGKGGPW
                     DFKFIRSLKSIDRFEDVGGCVMLASPGMLQNGVSRELLERWAPSEKNGVIITGYSVEG
                     TMAKHIMQEPEQIQAVMTRSSAGGRRGPGGDAEKVMIPRRCTVQEFSFAAHVDGTENR
                     EFIEEVGAPVVILVHGEVHNMMRLKSKLLSLNANKTNKVKVYSPRNCEELRIPFKTDK
                     TAKVVGKLASIPQPMKMPKAESEEPRLITGVLVQNDFKMSLMAPEDLREYAGLTTTTI
                     ACKQRLRLSAAGIDLIKWGLEGTFGSIEELPEAKQQPKSSANGDGPSNGDTKMEDADE
                     EFPIDEVVAAYLVMGCVTVRYRTSGEVELEWEGNMLNDGIADAVMAVLLGIESSPAAV
                     KRSASKHSHSHSHAPASGDSDAFALPNRNLHANLSPEERLERLMMFLEAQFGADNVSP
                     IAEPKLPPVSPSLPKSKSVKPSPTAAPKEEEEGADGATPMDVSSPADGEDQETKPAEA
                     KEGGEEEGDGEQREHERRVRAELARLHKLGIPVPGVRIKVDKMEASVWLEGLEIECAN
                     RVFADRVRAVVERAVEVTAPLWG"
     gene            900222..902358
                     /locus_tag="MYCTH_2311537"
                     /db_xref="GeneID:11506705"
     mRNA            join(900222..901630,901687..902358)
                     /locus_tag="MYCTH_2311537"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666606.1"
                     /db_xref="GeneID:11506705"
     CDS             join(900325..901630,901687..902342)
                     /locus_tag="MYCTH_2311537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666654.1"
                     /db_xref="GeneID:11506705"
                     /db_xref="JGIDB:Spoth2_2311537"
                     /translation="MAQPQSQVPQAPPHQVPHGMPQMQQMQQMQMPQMQQQRPSYSPP
                     QHSPSPAGTPQPGYAVPPNKRPRTSPTSPPSHPQSPYVATPYTASPQMTTASPAPVTS
                     PGYSNLAAPAGAPQYNTAHTNGNSAQSPAPTPMLSLPDTRPSYPSSPAPSGPATAPTP
                     PASQQYTTATMAPVVPPPPAATPGTMGPPSKPPAKEIEYDVADSLAGTGIDLRAEEQF
                     LAEFYAGSFTQDARTGLPANAPGGKGSFYGAGMANQPGEAVGAVSQEAYEAEAAQKAW
                     DEAAHRLAVVRSNEINNPFLMIANLHHRVEKIAKEHGLSVNLDLKNANPAGKLRPPQE
                     FPPPKVTVSTKPGPDGVMVTTTGSFIPHDAYLVDQLALLSIATKHRLRELIEDANAVA
                     IHRQTTSHGEIPAEWADVAVPLRTGLDSLPDDPESAALLKTRKRSFDAYASQGSSLKG
                     GKHGPRNLMEAVRDGARIDRDLEEARLRKRQKRLNPEPAAAASRAGSVAPGIPGTGAG
                     PETETAAKAPSKKELKKGAAAARLAEASSTASTNQTLSTLMGGFGRKKKEYSWMKKSG
                     SGTSTPRAIAGDAGSAAGGDSGKVPEKTSLTSDARYPRLGTWREDKEKGRNIQLRDWV
                     TALELDGIETRAIQQAYLNLDSSGPKDRS"
     gene            904099..904169
                     /locus_tag="MYCTH_t181"
                     /db_xref="GeneID:11506706"
     tRNA            904099..904169
                     /locus_tag="MYCTH_t181"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:904131..904133,aa:Gly,seq:gcc)
                     /db_xref="GeneID:11506706"
     gene            complement(904447..904934)
                     /locus_tag="MYCTH_2311539"
                     /db_xref="GeneID:11510121"
     mRNA            complement(904447..904934)
                     /locus_tag="MYCTH_2311539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666607.1"
                     /db_xref="GeneID:11510121"
     CDS             complement(904506..904700)
                     /locus_tag="MYCTH_2311539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666655.1"
                     /db_xref="GeneID:11510121"
                     /db_xref="JGIDB:Spoth2_2311539"
                     /translation="MRRSHSLVITQTLSPGHCLLCMKQLCRALARDIPLAREAVQRCL
                     AHAWLLSSIPRHPAREDLAS"
     gene            <905345..>907391
                     /locus_tag="MYCTH_2113329"
                     /db_xref="GeneID:11506707"
     mRNA            join(<905345..905401,905675..905721,905900..906019,
                     906154..906192,906574..906690,906795..906826,
                     907330..>907391)
                     /locus_tag="MYCTH_2113329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666608.1"
                     /db_xref="GeneID:11506707"
     CDS             join(905345..905401,905675..905721,905900..906019,
                     906154..906192,906574..906690,906795..906826,
                     907330..907391)
                     /locus_tag="MYCTH_2113329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666656.1"
                     /db_xref="GeneID:11506707"
                     /db_xref="JGIDB:Spoth2_2113329"
                     /translation="MRLVLPGPTGQPGVGWGGRGQNATFAGVSNTVKASGEYHCFPRV
                     VEMHLRGPLALGLSKLIQLTGVYSAPFRVPHVALRHEHASSTQRYPTSVFTEARTRTE
                     YFTLMYSTEYGMRYLMDNTRALHVRGEYMRPRNSQGTLIVHKLVDPTHDWLPRRR"
     gene            920321..921701
                     /locus_tag="MYCTH_2311543"
                     /db_xref="GeneID:11506708"
     mRNA            join(920321..921014,921247..921701)
                     /locus_tag="MYCTH_2311543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666609.1"
                     /db_xref="GeneID:11506708"
     CDS             join(920632..921014,921247..921484)
                     /locus_tag="MYCTH_2311543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666657.1"
                     /db_xref="GeneID:11506708"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="JGIDB:Spoth2_2311543"
                     /translation="MSIIREHTQATLTDAWRTINIDALQEDSSVNFDTSTLRPPLPEV
                     SEAEVRQLTSQVRQLLRGGDAEGALRGCLESPVYAGSDAAREAALQTVVEVLQSIKAS
                     EMTPMLQRIYASSGGSECLDVLMKYLYKGMESASSSSPSASSAPRTPTRVTPQPTGFS
                     QIVPRPGASSESTGAAMSVLLSWHEKVVEVAGLGCIGRVMTDWRRV"
     gene            complement(921701..923086)
                     /locus_tag="MYCTH_2311545"
                     /db_xref="GeneID:11506709"
     mRNA            complement(join(921701..922598,922761..923086))
                     /locus_tag="MYCTH_2311545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666610.1"
                     /db_xref="GeneID:11506709"
     CDS             complement(join(921783..922598,922761..922994))
                     /locus_tag="MYCTH_2311545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666658.1"
                     /db_xref="GeneID:11506709"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Spoth2_2311545"
                     /translation="MRLNTPRACLPQRLRSLTAPPCARRAYAFQAPGGAVFKVFNSRA
                     KRLQKERAAANPELSRQADYLKDEVAMRVCERLLDIKRHFPRVLDFGANSCNIARALT
                     RENPDPDAPTSPPLATKLTELVAAESSRSLLYRDAELPFNEELKLTRRVLPDDESLPF
                     EPSSFDMVLSSLSLHWINDLPGVLAQINKVLKPDCPFIGAMLGGDTLFELRTSLQLAE
                     QERRGGISPHVSPLADVRDVGGLLGRAGFQMLTVDVEDIVVDYPDTFALMQDLQAMGE
                     GNVVLGREMGAIGRDVLLANEAIYRALHGNEDGTVPATFRIIHMIGWKEGANQPKPLK
                     RGSGEVSLKDVLERK"
     gene            923736..924233
                     /locus_tag="MYCTH_2311547"
                     /db_xref="GeneID:11506710"
     mRNA            join(923736..924157,924210..924233)
                     /locus_tag="MYCTH_2311547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666611.1"
                     /db_xref="GeneID:11506710"
     CDS             923819..924097
                     /locus_tag="MYCTH_2311547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666659.1"
                     /db_xref="GeneID:11506710"
                     /db_xref="JGIDB:Spoth2_2311547"
                     /translation="MSSSGPTGFLGRSSSSNANMRGLVQFIADLRNARARELEEKRIN
                     KELANIRYVCRTLEHPAQSSVLTLPAHPGKSSRVCHVHATFVRSRAAC"
     gene            924898..927401
                     /locus_tag="MYCTH_2311548"
                     /db_xref="GeneID:11506711"
     mRNA            join(924898..926892,926993..927401)
                     /locus_tag="MYCTH_2311548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666612.1"
                     /db_xref="GeneID:11506711"
     CDS             join(924967..926892,926993..927172)
                     /locus_tag="MYCTH_2311548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666660.1"
                     /db_xref="GeneID:11506711"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR003164"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="JGIDB:Spoth2_2311548"
                     /translation="MIRDSLQKTLDLALETNKNVQQNNAQNAVLFEAINLIIHLDTEQ
                     ALMQQISSRLGKFIQSRETNVRYLGLEAMTHLAARADTLDPIKQHQEVIIGSLKDRDI
                     SVRRKGLDLLYSMCDASNARAIVGELLHYLQNADFAIREEMVLKIAILTEKYATDVQW
                     YVDISLRLIAMAGDHVSDEVWQRVIQIISNNEELQVYAARNILQYCKQDHCHETLVKI
                     GAYILGEFGHLIAEERGCSPIEQFLALQNKLPACGSSTRGMILSCFIKFVNLFPEIKP
                     QLVNVFSVYSHTLDPELQQRACEYLTLANMPTDDLLRTVCDEMPPFPERESALLSRLH
                     QKHSKTSDKRTWVVGGKDANSDAAELSMAKQGGLRRAFTTNYQTNGGTPATNGHSAAN
                     DLAGLDMNNLGPAEAKALKPPNLASAAHLSPGWERGYNRLLLRADGVLYEDGQLQVGV
                     RSEYRGQMACLILYFTNKTPALISSFTTTLDLDESEKGKLTWDIKGLPETALAQGAQA
                     QQVIMFEAKRVFEKSPTIRISYLAGALQALTLKLPVTIHKFMDPAELSSDDFFKRWKQ
                     IGGSPREAQQIFGLVKANEREITESFIRTVVEGFRWGVLPGVDPNAKNFVGASVVHTS
                     EGGKYGCLMRLEPNYQSQMVRLTIRATDESLPPVLLKLMQERISKGVSTVVQEKHVPP
                     TMSEISDAFRNVMVTTSSR"
     gene            927868..928449
                     /locus_tag="MYCTH_2311549"
                     /db_xref="GeneID:11506712"
     mRNA            927868..928449
                     /locus_tag="MYCTH_2311549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666613.1"
                     /db_xref="GeneID:11506712"
     CDS             928178..928402
                     /locus_tag="MYCTH_2311549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666661.1"
                     /db_xref="GeneID:11506712"
                     /db_xref="JGIDB:Spoth2_2311549"
                     /translation="MSGNSLNFVTFNQDHSCFAVATTKGFRIYHTDPFNKIFNSDEGN
                     VTIIEMLFSTSLVALVRSPRHLVIQNTKAS"
     gene            928455..929600
                     /locus_tag="MYCTH_2311550"
                     /db_xref="GeneID:11506713"
     mRNA            928455..929600
                     /locus_tag="MYCTH_2311550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666614.1"
                     /db_xref="GeneID:11506713"
     CDS             928582..929580
                     /locus_tag="MYCTH_2311550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666662.1"
                     /db_xref="GeneID:11506713"
                     /db_xref="JGIDB:Spoth2_2311550"
                     /translation="MALLHTIATSPNPNAIFALSPSSERCYIAYPLPKPREDQGERRP
                     AHAPPLSTYVPTTSGEVIIYDTNTGKALNVIEAHRSPLSFVALNHEGTKVATASETGT
                     IIRVFSVPDGQKLYQFRRGTYPSTIYSMSFNLSSTLLCVSSSTDTVHIFRLVNAQNTS
                     AGGSAVPEPEEPGSPRSNRWSRSRSIDSDDPEYSPGSSGSSPRGGETPNAGSRTKDSA
                     RKRQSGTFSSMLRRSSQIMGRTVAGAVGPYLPQSVTEMWEPQRDFASIKLPKPANTTA
                     RGSLIGGPAPLRSVVAMCNNSPQIMVATSDGGFFVYNIDLQNGGEGCLVRQYTYVL"
     gene            complement(931545..934293)
                     /locus_tag="MYCTH_2311554"
                     /db_xref="GeneID:11506714"
     mRNA            complement(join(931545..932065,932150..934293))
                     /locus_tag="MYCTH_2311554"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666615.1"
                     /db_xref="GeneID:11506714"
     CDS             complement(join(931752..932065,932150..934079))
                     /locus_tag="MYCTH_2311554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666663.1"
                     /db_xref="GeneID:11506714"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="JGIDB:Spoth2_2311554"
                     /translation="MATIALSRPVTTHRSTSLSATIALDSHPSQCPPPVPNKHIPVCP
                     PGPIPQQEPTTPPPSPGSQEDQVNRSLLYPPDKYPRVEMGRLSIYELDTDDVAAALDH
                     VARQPLPDASQVFPWLHGLHPSNTVQQTFFMARKRALRRTPPCLRGITVVKANGELTV
                     SRLKGAIAPHEFLRTGGASAEFLDVDPTEGFSVRNFHIQAAKAAMTSDIIVYGDDDAA
                     VRKLAWDVAAAQQQWRERHEAMRHPLPHYNTFVCVSPFDEFEEKHPEIVSVSSDGLLT
                     GNVLDFFHQERLDMYDMTQASEISPNVWLGPTPDSSSEDEQAYDILIDCNDLGRLNPA
                     ALQAIADAPDDETKQYHLDFPSSGSIIAPSWSNAEADGILETCKWLYHLAHGTRPSPP
                     ATTTPSSPQPQSAADADGDIPMVSTTAASPSPLSSSSPAPAPPQPTARPRRILLHCND
                     GYTETTLLAVAYHSFATGQPVPLAWLDLHASKHRNLFAYPSDVSLLSAIAPRLLAESP
                     SFSGTAAAGEGGRGGGRGRGRGRKGAGTTRSQAPSAEQLADILREQEPRWFAGFDGSF
                     PSRVLPYMYLGNLGHANNPDLLRALGIGQILSVGETAMWRDGELEAWGEDNICLVKGV
                     QDNGIDPLTDEFARCLEFVDRGRRNGTATLVHCRVGVSRSATICIAEVMRSLGMSFPR
                     AYCFVRARRLNVIIQPHLRFAYELLKWEEHLFSTGHGSGGSGHKRELEWAEIAREVAL
                     MNKPYAR"
     gene            936831..939055
                     /locus_tag="MYCTH_2311557"
                     /db_xref="GeneID:11506715"
     mRNA            join(936831..937143,937251..937829,937919..939055)
                     /locus_tag="MYCTH_2311557"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666616.1"
                     /db_xref="GeneID:11506715"
     CDS             join(937054..937143,937251..937829,937919..938899)
                     /locus_tag="MYCTH_2311557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666664.1"
                     /db_xref="GeneID:11506715"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Spoth2_2311557"
                     /translation="MSNGVAANGASDETHTASQRYLSTRGNDSGLSFEEVVLKGLASD
                     GGLYIPEEVPIASQWESWKDLSFVDLAFNVLSLYISPSELPAEDLKDIIRRSYSTFRS
                     DDVTPLIHLQGNIHLLELFHGPTFAFKDVALQFLGNLFEYFLVRRNEGKTGRDRYHLT
                     VVGATSGDTGSAAIYGLRGKKDVSVFMLHPKGRVSPIQELQMTTVLDANVHNLAVTGN
                     FDNCQDIVKALFADPDINSTHKLGAVNSINWARILAQTVYYFYSYFSLARQQPDSFKV
                     GDKVRFSVPSGNFGDILAGYFAYRMGLPVDKLVIATNENDILDRFWKTGRYEKKPAYG
                     SAAKGGIESDGVQAHEDGVKETLSPAMDILVSSNFERLLWYLAYEFAASAGMDDEWNK
                     KQAGQEVSAWLSSLKTKGGFGPVYKDVLESARRTFESERVSDPETLDTIRSVYREVGY
                     VLDPHTAVGVEAARRSAARLNGANTPIISLSTAHPAKFAGAVTLALKDEPGFEFDSKV
                     LPPEFVGLDKKEKRVREVANDWKAVRDLVKEEVEEELKGQR"
     gene            complement(940036..941705)
                     /locus_tag="MYCTH_2311558"
                     /db_xref="GeneID:11506716"
     mRNA            complement(join(940036..940344,940449..940878,
                     941008..941705))
                     /locus_tag="MYCTH_2311558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666617.1"
                     /db_xref="GeneID:11506716"
     CDS             complement(join(940141..940344,940449..940878,
                     941008..941564))
                     /locus_tag="MYCTH_2311558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666665.1"
                     /db_xref="GeneID:11506716"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2311558"
                     /translation="MTSVPKPGPAKLRPGAGLDEWLEEAKQCHYLPEHVMKQLCEMVK
                     EVLMEESNIQPVVTPVTICGDIHGQFYDLLELFRVAGGMPGESNVQAPMTSTTVITSD
                     DIEPPTEITNPKLKGKVKSAGTPADGNGDDTAAAEAQEETTHSAPPADSGVQSVQTRF
                     VFLGDFVDRGYFSLETFTLLMCLKAKYPDRIVLVRGNHESRQITQVYGFYEECQQKYG
                     NASVWKACCQVFDFLVLAAIVDGTVLCVHGGLSPEIRTIDQIRVVARAQEIPHEGAFC
                     DLVWSDPEDIETWAISPRGAGWLFGHKVANEFNHVNGLKTIARAHQLVNEGYKYHFPE
                     KSVVTVWSAPNYCYRCGNVASIMTVTSSDCLESSTKFSIFSAVPDDQRHIPGGRRGAG
                     DYFL"
     gene            942125..944780
                     /locus_tag="MYCTH_2311559"
                     /db_xref="GeneID:11506795"
     mRNA            join(942125..942581,942664..944780)
                     /locus_tag="MYCTH_2311559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666618.1"
                     /db_xref="GeneID:11506795"
     CDS             join(942334..942581,942664..944584)
                     /locus_tag="MYCTH_2311559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666666.1"
                     /db_xref="GeneID:11506795"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="JGIDB:Spoth2_2311559"
                     /translation="MVMSTPQLLARKTNGGATDGQSSNDAPKAPKAKAPPQGEKVVVR
                     RLPPGMTEDEFVTILGDEWKVGGPKVDWFSYWPGKVSRHPSKPSRPSRAYLHVIRRDD
                     LTALLQRVQTATWEDAKETYNDPALLSLPTVEFAAYKKIPGDKKRVDGRQGTIDQDPE
                     FMAFLEALANPDAPKEVQEVEPPAEDPAKAEKTMTTPLVEYLKEKKAAKAKEAAAAKS
                     AKHARQDSQGAKGKNAAPAPEESKKRSRESRSEREKASEKASDKASERPRESVKILTK
                     KAAAAVEAAAEAAKTVAAQTRSAASSTSNPQPGGQDAPPKNRKAGVAAAALILQRDLG
                     LSPKNAHRKARQEAAKEAAREGAKEAAKAESEAKATTKENPKPAAPATSETAPPAAPT
                     EPPASSTPAKTQQPASGKSRNRKRGAGEDNSKTKGEANGGKPTDTPATASAKPPVTVL
                     KKKDSQRSQSPQAQTTPASTGQPSKAGQSAQATSQTAPSSTKSASQKQSGGSKKANAP
                     ATPSPGATRAFVKHANHSQGVTEAVLRDVMQTFGTVTNIEIDRKKGFAYVDFGDHSGL
                     AKAMAASPVTVAQATVQVLERKEMAKKGSGSGSGSGSGSGSGSAQGKNAAAAATASPA
                     ATPAPGAAKTPGPASAEQNSGARAPEKAGGSAPEKAGEQQPSKRSGRRRGGRGRGDRE
                     AKEAKDSSKDGGGGVKKGGDGGGGGGGGGGAGSAASAAAT"
     gene            complement(<947574..>948608)
                     /locus_tag="MYCTH_97001"
                     /db_xref="GeneID:11506796"
     mRNA            complement(<947574..>948608)
                     /locus_tag="MYCTH_97001"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666619.1"
                     /db_xref="GeneID:11506796"
     CDS             complement(947574..948608)
                     /locus_tag="MYCTH_97001"
                     /note="Contains conserved domain: pfam07200, Mod_r,
                     Modifier of rudimentary (Mod(r)) protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666667.1"
                     /db_xref="GeneID:11506796"
                     /db_xref="JGIDB:Spoth2_97001"
                     /translation="MSRSVKFRRPSPSGHYDHQRSDSGFSDCESRASNPDADYLVPGF
                     EDHGLYSIRQALDTAREESEKWRARAEELEERNKEMRNDLEQTKARLRALTNELEIAN
                     QAKETLAKTNKELAEQNAQLQETIKELKKTNRKSSSGSSPSGSSATASESSDEKKLRR
                     SPSKRRKDPSEKSEKERGREREREREKERDKERDKERERERRKEKEKERERERERALQ
                     EETERLRKRFDTRAEDSDAKSSTTAKSQRSRHENYIEPLGHGAPRPQVPVAAPAPRQY
                     TAYTASTAPTVYSAPAPAYGSIREPFTAATPRSLHPKVYVADEYAYAAADEEDAAFVH
                     PLSRPTRHPR"
     gene            complement(954176..955137)
                     /locus_tag="MYCTH_2311562"
                     /db_xref="GeneID:11506797"
     mRNA            complement(954176..955137)
                     /locus_tag="MYCTH_2311562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666620.1"
                     /db_xref="GeneID:11506797"
     CDS             complement(954257..955030)
                     /locus_tag="MYCTH_2311562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666668.1"
                     /db_xref="GeneID:11506797"
                     /db_xref="JGIDB:Spoth2_2311562"
                     /translation="MTTARSRRVYFEDEIRAAEARRTRGDSQRSRSGRSRSADRVHGL
                     FDDAEMAQGRDRVVGREAYDQLLRENQYLRIELRELESAQAWIDQLRRENAELRQENR
                     ELRELESAQAWIDQLRRENAELRQENRELRRAGGGGGGYASSDVNDGAATGHHKDTKL
                     RKKVAKLEVEVDELKTKLSDAKAKTAKWRALYDELSQAYEDVRRRERDAQRRVDIVRQ
                     NITLVEEAKTRLEQENASLKLGIDLDLDLEDRLRRRQNY"
     gene            <956143..>957615
                     /locus_tag="MYCTH_2113341"
                     /db_xref="GeneID:11506798"
     mRNA            join(<956143..956173,956251..956329,956551..956562,
                     956627..956715,956772..956896,957135..957217,
                     957391..957497,957563..>957615)
                     /locus_tag="MYCTH_2113341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666621.1"
                     /db_xref="GeneID:11506798"
     CDS             join(956143..956173,956251..956329,956551..956562,
                     956627..956715,956772..956896,957135..957217,
                     957391..957497,957563..957615)
                     /locus_tag="MYCTH_2113341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666669.1"
                     /db_xref="GeneID:11506798"
                     /db_xref="JGIDB:Spoth2_2113341"
                     /translation="MCVYAGARPNANCVEGACSVKQRPRREGETARGMYVHPGPCTWA
                     AASRQGMPESAGEFLPCAPAGSKVYHTFYGTHNERWGYRPRQTALKNPFRLLKIGTRR
                     GRPSFASSASSSTGTVSDAQFFPHLGSPGQIQGLQDSGLAAAAPKAPWLPLLSTHTLK
                     IEREQTCCAVAARTVFIVVVLSGKDKRGRPPR"
     gene            complement(960518..963004)
                     /locus_tag="MYCTH_2140820"
                     /db_xref="GeneID:11506799"
     mRNA            complement(join(960518..960934,961048..961515,
                     961601..962021,962116..962515,962631..963004))
                     /locus_tag="MYCTH_2140820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666622.1"
                     /db_xref="GeneID:11506799"
     CDS             complement(join(960795..960934,961048..961515,
                     961601..962021,962116..962515,962631..962695))
                     /locus_tag="MYCTH_2140820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666670.1"
                     /db_xref="GeneID:11506799"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Spoth2_2140820"
                     /translation="MSNLFVELKTPITGPYKQPTGLFINNEFVEGVEKKTFEVINPST
                     EEVICSVHEATEKDVDIAVAAARKAFEGEWRRVTPQQRGVLLLKLADLAEKNLDLLAA
                     VESLDNGKSITMARGDVAAVVGCIRYYGGWADKIEGRTIDINPDMFSYTRREPIGVCG
                     QIIPWNFPLLMLAWKIGPALATGNTVVLKTAEQTPLSALVFAQFVKEAGFPPGVLNII
                     SGFGRTAGAALSSHMDVDKIAFTGSTIVGRTIMKAAASSNLKKVTLELGGKSPNIVFN
                     DADIEEAISWVNFGIYYNHGQCCCAGSRIYVQEGIYDKFVEAFKKRAEQNKVGDPFHP
                     ETFQGPQVSQLQYDRIMGYIQSGKEQGARVVTGGNRHGDKGYFIQPTIFADVRQDMTI
                     MQEEIFGPVCAIAKFSTVEEAIKLGNDTSYGLAASVHTKDLNTAIRVSNGLRAGTVWV
                     NCHNILNHALPFGGFKTSGIGRELGELALANYTENKSVAVNMAGKLF"
     gene            965063..968840
                     /locus_tag="MYCTH_2311569"
                     /db_xref="GeneID:11506800"
     mRNA            join(965063..966501,966588..967100,967164..968840)
                     /locus_tag="MYCTH_2311569"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666623.1"
                     /db_xref="GeneID:11506800"
     CDS             join(965166..966501,966588..967100,967164..968686)
                     /locus_tag="MYCTH_2311569"
                     /note="Contains conserved domain TRF[pfam08558], Telomere
                     repeat binding factor (TRF) and SANT[smart00717], SANT
                     SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666671.1"
                     /db_xref="GeneID:11506800"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Spoth2_2311569"
                     /translation="MADTSEIEAELLAALGVSPPARDGPVPTETDTSQLQSHERQQAQ
                     DPASEALPAPAPAPSLPAPSTSPETPAPLPDPASNPIPTATSAPAAAPVTTASAPFPT
                     ITSSAHDDHPVPDLGANGSNPPAVQQPSTVPPLPAAHDAPEPRSPKRPRSSDASGESS
                     AKRQRTEQPPPKQDDATGGSNIDFAAMLNDALANFDQHAGSGDNDMVMQDAAALSQPA
                     TAAPASTASDHEKAESRIVKVSSNPFYVMRSMSLPVLGNIAVQILLRLSQQPRSETES
                     LLANPTSEFRKSYDMLRDIFVATRKAFCDSPLLSPDELDVTDSEDRETIRMSNLAATA
                     VSAFGAHDVAVQDVHDAFFSIFIPEDGEYKAPLTDLLVSLKTRLLLDALNKPEQSQPV
                     SQLLGALFPANFDDSLRQRSGDMILNADEEALVLRIRERREQLVKSAADESIKALLEE
                     QSSATMFTESLSAFLQSHLGVVVDYAEKYGVNIPLSEDEPATARGPNNSQHEEDKSLA
                     ALLQSQLEQTDRDLAAAGKDALSNGTASNQFGSAGNDGLELKKLIEESLPNCIPELKE
                     QPTNMNSSDGASDFDSKNLASFISEKLKSEFDNPTHGLSNMPAPAHSPNTVHPQYLAQ
                     LNQSHHSSPRQSHTQGSTPTPPIGTNGDTLPPNQSMPTAALYEKARQAAVAKSSHTTR
                     REGLHSTRRPWTAEEEKALMAGLDMVKGPHWSQILTLFGPNGTISDILKDRTQVQLKD
                     KARNLKLFFLKTNSEMPYYLQSVTGELKTRAPGQAARKEAEEKARMNLADEQARIEGI
                     MTLAGGLQNNNHHPSSSTPLAASPAKRKSPSTAGYGGSGAGAATTANGSATPAMSAPP
                     RVKTEPADQHSLHKVPAFPPIQPAPAPASSMQQGRSNLPPLQPQPGPHQQPRPQAQQQ
                     YHQQSHHPQKLQQPQQPQQPSRLEPQKPMSAQQQQQYRQQVQPQHQPQPQQQSQPQAQ
                     PQAHSQPQAQQHQQPQAPPPPQSQAQSQTQPQAHSQPQAQQRQQPQAPSPPQSQAQSQ
                     AQPQAAPRPPSASQPAPPQPAPPQVHQSRPSPSATHTQPLPTPPIPPNHHSTPDHAQE
                     TKMIETLQAATAASTANEAQPPVPAAAVSEGSAAP"
     gene            complement(<969333..>970259)
                     /locus_tag="MYCTH_2130591"
                     /db_xref="GeneID:11506801"
     mRNA            complement(join(<969333..969453,969634..969835,
                     970199..>970259))
                     /locus_tag="MYCTH_2130591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666624.1"
                     /db_xref="GeneID:11506801"
     CDS             complement(join(969333..969453,969634..969835,
                     970199..970259))
                     /locus_tag="MYCTH_2130591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666672.1"
                     /db_xref="GeneID:11506801"
                     /db_xref="JGIDB:Spoth2_2130591"
                     /translation="MSDQRLPVRRRFKRLKIAIASCNQCQRKRAACVYRSDAGATNGN
                     NIIGSRVRLELPDRHASLPVRGQTAPADADPPERDGTVPAVLRVPVPASSSRGKNNQG
                     THTPSGNLPVKVSLTPSSFRMPLVQ"
     gene            970824..971586
                     /locus_tag="MYCTH_2311571"
                     /db_xref="GeneID:11506802"
     mRNA            970824..971586
                     /locus_tag="MYCTH_2311571"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666625.1"
                     /db_xref="GeneID:11506802"
     CDS             971180..971518
                     /locus_tag="MYCTH_2311571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666673.1"
                     /db_xref="GeneID:11506802"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2311571"
                     /translation="MAEFGSGPEVAALGVSLFVLGFAIGPALWAPLSELYVRKILFVI
                     THGVVVAFVAATAGCNSTASLLVFRSLAGTFGASTMTNSGGVVADLFPLLRVPPTIEG
                     AFATKVWLGL"
     gene            973053..>974347
                     /locus_tag="MYCTH_85367"
                     /db_xref="GeneID:11506803"
     mRNA            join(973053..973584,973662..>974347)
                     /locus_tag="MYCTH_85367"
                     /product="stomatin-like protein"
                     /transcript_id="XM_003666626.1"
                     /db_xref="GeneID:11506803"
     CDS             join(973188..973584,973662..974347)
                     /locus_tag="MYCTH_85367"
                     /codon_start=1
                     /product="stomatin-like protein"
                     /protein_id="XP_003666674.1"
                     /db_xref="GeneID:11506803"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="JGIDB:Spoth2_85367"
                     /translation="MASVSDHSGPKGKAPTPPTTSGNGGFQAQQPMRVEPPKPEDLQR
                     SYASVVDEAHFPGWYGAMIDCLGEVIGTLGAIPCCICFPNPFKRVNQGHVGLVTKFGR
                     FYKAVDPGLVKINPLSEHLTSVDVKIQIAEVGQQTCMTKDNVTLNLTSVIYYHVVSPH
                     KAAFGISNIRQALIERTQTTLRQVVGSRILQDIIERREEVAQSIGEIIEDVATGWGVQ
                     VESMLIKDIIFSQELQESLSMAAQSKRIGESKIIAAKAEVEAAKLMRQAADILSSAPA
                     MQIRYLEAMQAMAKSANSKVIFLPAANQTMPSTAAFNAALSGNNNNNNINDPFAEGSS
                     TADPSGAGAGDSGFQQALHARIIENI"
     gene            complement(975692..>977762)
                     /locus_tag="MYCTH_2084467"
                     /db_xref="GeneID:11506804"
     mRNA            complement(join(975692..977476,977538..>977762))
                     /locus_tag="MYCTH_2084467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666627.1"
                     /db_xref="GeneID:11506804"
     CDS             complement(join(975764..977476,977538..977762))
                     /locus_tag="MYCTH_2084467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666675.1"
                     /db_xref="GeneID:11506804"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2084467"
                     /translation="MAPVQARPKKAPRSWDALTPSLAQWILDYLSSMGYEQPTPVQKS
                     CLEIFRGNKDVVVEAVTGSGKTLAFLIPVVERLLRSEEPAKRHHVQGIIISPTRELAS
                     QIYNVLVSLIRFHAPSADLLSYSKSDEKRPATTEPVIVPQLLVGGTIKAAEDLSTFLR
                     LSPNLLVGTPGRLAELLSSPYVKAPASSFEVLVMDEADRLLDLGFSPEITRILGYLPK
                     QRRTGLFSASLSEAVERLITVGLLYPHKITVRVKSLKDGGEIQERKTPMSLQMSYIIT
                     PASQKIPALCQLLDKLEPRPARSIVFFSTCFAVKYFARVLHGVLPPGFSIISLHGKLE
                     PQVREKNYERFVNATSPTVLLTTDIAARGLDIPQVDLVVQHDPPTDTKVFIHRCGRAG
                     RAGRRGLAVVMLQPGHEEGYVQLLEVRQTPITPLTRPSISVTDAEAELVSSKIRDQAK
                     ADREIFQLAQRAFVSWARSYMEHQATSIFRVSELDWVDLAKGYGLLELPKMPEVKGLD
                     RSLGLGIDTESIPFKDKAREKKRLAELEQWKKEKAEREAQRANGEDPGSLKRKKNEAW
                     SGKHEHEDAKAARREKKRRKREAQRLAQMTEKEKEEQKKLEELIAEVRRRNAGQTTAG
                     AAGGQKADAADDDDSFEGFDD"
     gene            979238..981028
                     /locus_tag="MYCTH_2311577"
                     /db_xref="GeneID:11506805"
     mRNA            979238..981028
                     /locus_tag="MYCTH_2311577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666628.1"
                     /db_xref="GeneID:11506805"
     CDS             979579..980625
                     /locus_tag="MYCTH_2311577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666676.1"
                     /db_xref="GeneID:11506805"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="JGIDB:Spoth2_2311577"
                     /translation="MDEDDSPDLSRARSRSRSPVDSRRLRRLATRKSATVPNGTKATA
                     AATTAASNGHPPQPADANGHLSPASATATATSSPSYYGWSWRDFSRSPSPLGLIPIHR
                     RWRAFVHKHEVPRKALHVSIGFFVVWLYLSGTQTLDVCPYLMGALVPIAAVDVLRHHH
                     APFNRLYVRVLGALMRESEYAGYNGVIFYLLGAWAVLYWFPKDVGVMGTLLLSWCDTA
                     ASTFGRLYGRYTPRIRRGKSLAGSLAAFVVGVCTSAFFWGWLAPTKGPLPGDENFMFT
                     GALSLPRALADAVGLEPAKATITGGLALGVMSVWSGLVAATSEALDVFGWDDNLTIPV
                     LSGLGIWGFLKIFG"
     gene            981767..982893
                     /locus_tag="MYCTH_2311579"
                     /db_xref="GeneID:11506806"
     mRNA            981767..982893
                     /locus_tag="MYCTH_2311579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666629.1"
                     /db_xref="GeneID:11506806"
     CDS             982339..982506
                     /locus_tag="MYCTH_2311579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666677.1"
                     /db_xref="GeneID:11506806"
                     /db_xref="JGIDB:Spoth2_2311579"
                     /translation="MGAFCTLGTPWRTKRRGPKSRQFLVSHGEGLVDGPNASFHLGGP
                     PSFRFYPSVAQ"
     gene            984641..986189
                     /locus_tag="MYCTH_2311581"
                     /db_xref="GeneID:11506807"
     mRNA            join(984641..985426,985737..985889,986069..986189)
                     /locus_tag="MYCTH_2311581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666630.1"
                     /db_xref="GeneID:11506807"
     CDS             join(985014..985426,985737..985889,986069..986153)
                     /locus_tag="MYCTH_2311581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666678.1"
                     /db_xref="GeneID:11506807"
                     /db_xref="JGIDB:Spoth2_2311581"
                     /translation="MSSTYAPQYYATGALPIPPSKPQYQYPGGSHQPYYPYGDDGAYA
                     VSPPEDLDDLDASASSTSGYGNSYSVGTVTTTSSSSTAAGSNISGGGGRVEYDRASSS
                     AGSASGIDLNEFMQERFAATFDPLALDKCTAKQAQTSGHLNAKHRELLELQAKAQARL
                     AKTRARFAKGLEDAREVRNDLEWTQKKVTSLKATASRKHSKEYARARERYPSPDMY"
     gene            complement(<987827..988952)
                     /locus_tag="MYCTH_2145454"
                     /db_xref="GeneID:11506808"
     mRNA            complement(<987827..988952)
                     /locus_tag="MYCTH_2145454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666631.1"
                     /db_xref="GeneID:11506808"
     CDS             complement(987827..988588)
                     /locus_tag="MYCTH_2145454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666679.1"
                     /db_xref="GeneID:11506808"
                     /db_xref="JGIDB:Spoth2_2145454"
                     /translation="MARSNPDEIDLAEDDFDDTSPNDYEVAEEDATMAVTMGFTSFGG
                     GDGARPSKKRRFNPRLDEAVIATGEPAPAAHTGQAKAAPVGPATRDEITYTDDDNDIF
                     SKKDDGDGDGADDLDPDGPPTPPGTASPALTAGSQPAGAWHKPGNPSRGWGGAGRGGA
                     HGGGGRGGRGGRLNPLWYVDYYDPSFNENPWEGMEKFKGLEPVGTWLSRSRGREKEVG
                     TGKDEQQQQQQQQQPGEGVGAGQGLAEGAATPADS"
     gene            989751..990857
                     /locus_tag="MYCTH_2311585"
                     /db_xref="GeneID:11506809"
     mRNA            989751..990857
                     /locus_tag="MYCTH_2311585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666632.1"
                     /db_xref="GeneID:11506809"
     CDS             990065..990787
                     /locus_tag="MYCTH_2311585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666680.1"
                     /db_xref="GeneID:11506809"
                     /db_xref="JGIDB:Spoth2_2311585"
                     /translation="MDTGTTPQAHRPITIRLPSKYATGETSASSSSSSSSSAPPSSRA
                     TPFTPPPLSFMQRTWTVTHSTLSMWRGSRNVRITYGALPPRDGRERLSDTVEHETVPW
                     WGGGGSASNNKGAVLRRISGTDTASSRGGGETGAWDWRGRGWLALVGGSHWEVLGWGQ
                     RECPGEPGRPVRWMVTWFAPTLFTAEGLDLYSDRADGGNEELARDVLAELARVCRGKE
                     RLRKLVEQDMREVAISLPWKEA"
     gene            complement(990858..992427)
                     /locus_tag="MYCTH_2311586"
                     /db_xref="GeneID:11506810"
     mRNA            complement(join(990858..992113,992212..992427))
                     /locus_tag="MYCTH_2311586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666633.1"
                     /db_xref="GeneID:11506810"
     CDS             complement(join(990928..992113,992212..992219))
                     /locus_tag="MYCTH_2311586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666681.1"
                     /db_xref="GeneID:11506810"
                     /db_xref="JGIDB:Spoth2_2311586"
                     /translation="MPLHLLGKKSWNVYSPANIARVRRDEAEAQAREEAQERRMQEID
                     AARRLAILRGEIPPPLEDAEPGPPSQSRDGERDRRGDDYSALASGRKRKRRGEDDTDF
                     EMRIARERAAAGDRAARAARELAAPASLIDSKGHLTLFAPPEPSPRGGGKDDEASRRE
                     REDKDQYQMRFVNAAGRDGQGLTDGGPWYASRAGVSSAALAPSKNVFGQEDPRRKERA
                     AARLDASDPLAIMKQGAKMVRELEKERRREAEERERELRELEKEERRRERKRRKREEE
                     GEEEGKEERYDEKTRRRRRSRERRRDSPDGDSDPARRERSHRHRDDGRGERDRYRSRE
                     RERTSRNERDGSDRRKDPHQDYQDRGRDGSRERRRRPEEDDGREWPRRGDGDRARRSH
                     RKEDL"
     gene            992487..995950
                     /locus_tag="MYCTH_2311587"
                     /db_xref="GeneID:11506811"
     mRNA            join(992487..993198,993273..995044,995139..995950)
                     /locus_tag="MYCTH_2311587"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666634.1"
                     /db_xref="GeneID:11506811"
     CDS             join(992906..993198,993273..995044,995139..995728)
                     /locus_tag="MYCTH_2311587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666682.1"
                     /db_xref="GeneID:11506811"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="JGIDB:Spoth2_2311587"
                     /translation="MDLRNNLFSKPAPRGGAPGLPGRQIQRPPGDTAGYAPVPNGYDP
                     YGGRSPAPARPQNPPGGGGGYGGGYAQSRGRQVRLRLAKVEDKTLQAQYIFGNICAVS
                     PNDFPPNRDGTDLYVRLTGNQLRGDYVVTARPTPGFPDGCISLSDPQRTWCGVGMMDE
                     VVGELYDPFSQGGQVYIGSLDVEIGFASARKIVDAPYDQDELAAMFVRNFQNQIFAPG
                     QRLLLDVQNVPLAIVVKTVTLIDLTMQQRPTDEPPTRSDPQARGILTSHTSIGFYKDA
                     RSPIKLKGSNKRPAANAIISPDFKFEDMGIGGLDTEFSTIFRRAFASRIFPPGLIDKL
                     GIMHVKGMLLYGPPGTGKTLIARQIGKMLNAREPKIINGPEVLNKYVGQSEENIRKLF
                     ADAEKEYKEKGDESGLHIIIFDELDAVCKQRGSGAGGGTGVGDSVVNQLLSKLDGVDQ
                     LNNILLIGMTNRKDMIDDALLRPGRLEVQIEISLPDEFGRSQILKIHTAKMKENNVMG
                     DDVDLAELAALTKNFSGAELSGLVKSATSFAFARNIKVGTMATVSEDVANMKVVRQDF
                     LNALEEVKPAFGADGAELEDALPYGIIHFSQSIPAILNDGMLYVENVRQQERLRHTSV
                     LLHGPPASGKTALAAHIAMKSDYPFIKIITPASMVGFRDEVAKKDHLHKIFTDAYKSP
                     LSMLIVDNIERLIEWNPVGPRLSNSILQALVTLLQTPPPKGPPPPHPRHHLTAVRHGA
                     ARHHYRVRPPDPRARRPGHARAVGRAGRVGRLRRAGRRQPGAEPPPRVLQLGPRRRRH
                     QDHPDHGRNGPPERRARRVVCRADRHADCEVQSLYGEGVELIFFFFLEIEAGLVKKGF
                     IYGRLGRRIGMTLYCWLFLPPGFFFALQ"
     gene            complement(<997306..>999263)
                     /locus_tag="MYCTH_2113353"
                     /db_xref="GeneID:11506812"
     mRNA            complement(join(<997306..997359,997578..997581,
                     997836..997848,997897,997934..998036,998128..998244,
                     998282..998397,998457..998507,998690..998742,
                     998827..998842,998925..998980,999053..999078,
                     999202..>999263))
                     /locus_tag="MYCTH_2113353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666635.1"
                     /db_xref="GeneID:11506812"
     CDS             complement(join(997306..997359,997578..997581,
                     997836..997848,997897,997934..998036,998128..998244,
                     998282..998397,998457..998507,998690..998742,
                     998827..998842,998925..998980,999053..999078,
                     999202..999263))
                     /locus_tag="MYCTH_2113353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666683.1"
                     /db_xref="GeneID:11506812"
                     /db_xref="JGIDB:Spoth2_2113353"
                     /translation="MELHQGAASQAPQNPLMPDRSTAGQRIRSGEYVHYGVGFVTRNY
                     TKNTWGTTSGIVATAKRTNDAHKHLISRPGPRVGLLLRGGALLLLTGPEEIEERSGNR
                     RKECQAGRQCHFTCKVLEYDVWINCVVSSLLWRWHSWTASLERYEVTFAMSRLLNVDA
                     DIWSRRAVETTNISGLETRPPGAPPTPPVPLVLISDQRVGAWREGYHKIHRMAIDESA
                     WQIAA"
     gene            999954..1005901
                     /locus_tag="MYCTH_2311589"
                     /db_xref="GeneID:11506813"
     mRNA            join(999954..1000510,1000609..1005901)
                     /locus_tag="MYCTH_2311589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666636.1"
                     /db_xref="GeneID:11506813"
     CDS             join(1000047..1000510,1000609..1005643)
                     /locus_tag="MYCTH_2311589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666684.1"
                     /db_xref="GeneID:11506813"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="JGIDB:Spoth2_2311589"
                     /translation="MGPELFVSSTGATRPAPQPLEPMPSSPTEGVSFWGLAPPPPPPQ
                     PPQPPERVLVQRPPRPGNGLKRAKTAGGHSTAGPGRAKTTNPWASTGSQAKPLLPLTE
                     RASHEETLGARRARKGSQDEDKWDITPDGGSAGREGRQFAVANVGNNGRIYLRPTVRP
                     AHQRYPQPPFVFPMTPPSTAGLEAIAPEQRLDLDAPSPLPLRDWTPSHPPSSSPSITS
                     GNPGEKQVRIRQRHRRAMSDSTIPDTSVARESESGGFKVVITQPGDEERPRTVDETMD
                     LSRPPVLEVAIPSWRIGTPRFSIHGTSYIRGSSYAPTEEARSSSTSFLRLTPLDGTSS
                     NSAKPSFFRTSGMPTPFPGPSYPPSHGSSARTPPTQLRASYMSPRLVIEPSMFDTLTF
                     KPTCDDRTIVRYSASGSVTAATPPRLVAEITSPRFVDYELLSDFFLTYRSFLEPSDLL
                     RMLFARLRWALSRVDEVGQVVRVRTFVALRHWILNYFIDDFLVDYNLRASFCTLLNEL
                     VGDVLRDPQTPKVPLKILAELKKCWRRVCAQFWDGPEFDISLGPDVRVSPGGTAGVRD
                     SQQLNSTVWLENNTQPPQMDDLMFPVSPRSHASAYGGVAIAGNIDAVVAGDRPATPEN
                     AADSEDMERNGAISPASVTSVDAVSCSFPTKSARAVRPGAACPTAHPVRPGPLHNADP
                     VATTPRALVGKRAREQQSHKRNASLSDSLREDPTTMERGLYKNAEFLLALPYAGSLVR
                     GELLPPSKSLVEVHPQGPDGRQTTIFQLNAAEMPKDGAGPAAMSGQGMKKLLGSVRRA
                     LSTKGQHLSPAQGTFINISPIGPRGATTNRLPGTPIVPQASGRQNRGRPPVRIDLLGA
                     EVAEDFRKAVREDSQARSEQSEQPAPPPAEAQPQNGTEDSSGPGPHSSPMPLSSDFVL
                     TRPTSDMGITAGSKSIVIVDDTSLPSNYPAMTGALPAATPSAEAFSEPFHPNLADPTP
                     PNTPPGRPPGTPGNSSCVLGQDMHHQSLSASELPPFVPDMDTLGGHPRPSQDQSRPSF
                     DGWDEALSPRSVDCGKEDVRVPSHLSFTPYRSERQGHRASFTSASFHRPTVRSFDATT
                     VSGQSIDDSTPAMAPEPLRVLRRRPGGDLRAVAHVGELEQSAALRRSRSVGSLTTYSE
                     SIRSSYLRSAVADSSGYVDVVASDCSPGHAGTFSLGALAERNPKQQKFSLFSTHSSKP
                     IMRPSFEAEAQKLAMIPDDLDDDGGVESALLKLEGKFPAKKPGLKLSMDLTPPPAEID
                     VAPESNVADAEEDNATHEERPEHGEIRVAGKEHPPSSSASSPTMTHQSGLLSAANAEG
                     RHGMQSFLSDDSRASYSSIPLLDRDLTDDGRSGRTATREWTDRSVLQGPEDDPATPED
                     RSPHDSQHPSYEFIKKTDSLDLLVQEGDTAPTAEPKRCSVEHSFLDVDSDSESVISSE
                     LSGESLILQDAGDGGVSPNAMGVAMSTLPAHPLAEGPPSARPPPSPPPTRTQASRSSP
                     EASHTPTLHNHQVWEKPLPPTPDATPTATAPPDLQSPFSPRDPTGTREALRDAPTLDM
                     PDPVAEPRRGPAHNKYTVHLPFILAFDSDVLAQQFTLVEKDALNEIDWKELIDMRWKN
                     AEQNGVHVRSWVSFLRDTDARGVEVVIARFNLMVKWAISEIVLTQDVEERARCITKLI
                     HIAAHCRRYRNFATMSQITIALTSNEVARLAKTWAMVPASDRRTLHELETLMSPTRNF
                     YNMRAEMEGGGASVAEMGCIPFVGIYTHDLLFNAQKPSEIASSPTTPPLVNFERCRTA
                     AAVVKTLLRLLEASMLYNFQPVEGVTERCLWMGALGDEEIRRLGEALE"
     gene            complement(1008151..1009738)
                     /locus_tag="MYCTH_2311591"
                     /db_xref="GeneID:11506814"
     mRNA            complement(join(1008151..1008265,1008317..1008716,
                     1008777..1009225,1009317..1009374,1009443..1009462,
                     1009528..1009738))
                     /locus_tag="MYCTH_2311591"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666637.1"
                     /db_xref="GeneID:11506814"
     CDS             complement(join(1008457..1008716,1008777..1009225,
                     1009317..1009374,1009443..1009462,1009528..1009619))
                     /locus_tag="MYCTH_2311591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666685.1"
                     /db_xref="GeneID:11506814"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="JGIDB:Spoth2_2311591"
                     /translation="MAPANLPSIFNATSTDIEQLLAAQCHIGSKNLGVHMQPYLWKTR
                     ADGVNIINIGKTWEKIVFAARIIAAIDNPSDVCVISARPYGQRAVLKFAAHTGAQAIA
                     GRFTPGSFTNYITRSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIALCDTDSPTEFVD
                     VAIPTNNKGRHAIGLIWWMLAREVLRLRGTIYNRETPWDVMPDLYFYRDPEAEAEEKV
                     EEEKLPGVDEEGPVAIESGFAAGAGDWEAAPAGFPAAATGEWSEAAPATWESGAAAGA
                     APATTEWADAPKESGW"
     gene            <1010053..>1011070
                     /locus_tag="MYCTH_2121249"
                     /db_xref="GeneID:11506815"
     mRNA            join(<1010053..1010098,1010163..>1011070)
                     /locus_tag="MYCTH_2121249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666638.1"
                     /db_xref="GeneID:11506815"
     CDS             join(1010053..1010098,1010163..1011070)
                     /locus_tag="MYCTH_2121249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666686.1"
                     /db_xref="GeneID:11506815"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="JGIDB:Spoth2_2121249"
                     /translation="MPPRIPAPQGLRSLALCLRPRPAPTPAPSLLPLVQTANLSMKEK
                     KKRMKQDPYGWAQAQQRKNAHLKRREEIEAERKAAYGDPVHGITTPFVESFDSAGQEP
                     LSPENPEAGGEQHPLPTSPHIRNYLLSQEELDKAIEYSRRVTMPLTNAESATTDPTAE
                     AAELEEHARKHAKAVEALRRITDLKNAGAKDRKHANIRRCIETFGRHVTDHTLENAAP
                     PPGPGQEPKPKPVRAGPDTGSSEVQIAILTAKIRALALALEGPKGHKDKNNKRSLRRL
                     CHKRQRLLRYLERKERGSGRWQYLVQTLGLTPATYKDQISI"
     gene            complement(1011088..1012687)
                     /locus_tag="MYCTH_2316483"
                     /db_xref="GeneID:11506816"
     mRNA            complement(join(1011088..1011388,1011490..1012382,
                     1012458..1012546,1012625..1012687))
                     /locus_tag="MYCTH_2316483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666639.1"
                     /db_xref="GeneID:11506816"
     CDS             complement(join(1011305..1011388,1011490..1012382,
                     1012458..1012546,1012625..1012656))
                     /locus_tag="MYCTH_2316483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666687.1"
                     /db_xref="GeneID:11506816"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="JGIDB:Spoth2_2316483"
                     /translation="MEGLLFNVNNGYIEGIVRGYRNGLLTSTNYTNMTQCETIDDLKL
                     QLGPAYGDFLASLPPNPSTSSLAAKTTDKLVSEFRYVRANAVGSLAKFMDYVTYGYMI
                     DNVALLITGTLHERDTRELLERCHPLGWFETMPVLCVATNIEELYNSVLIETPLAPYF
                     KGSLSHQDLDELNIEIVRNTLYKNYLEDFYEFVNTHPDMAGTPTAEVMSELLEFEADR
                     RAINITLNSFGTELSKADRKKLYPNFGRLYPEGTLMLSRADDFEGVRLAVEGVADYKA
                     FFEAAGLGGGPGGPGNMAGGTGSDGRSLEDMFYQKEMEIAKSAFTRQFTYAIVYAWVK
                     LREQEIRNITWIAECIAQNQKERINNYISVF"
     gene            1012932..1015428
                     /locus_tag="MYCTH_2311601"
                     /db_xref="GeneID:11506817"
     mRNA            join(1012932..1013108,1013225..1013314,1013381..1015428)
                     /locus_tag="MYCTH_2311601"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666640.1"
                     /db_xref="GeneID:11506817"
     CDS             join(1013074..1013108,1013225..1013314,1013381..1015082)
                     /locus_tag="MYCTH_2311601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666688.1"
                     /db_xref="GeneID:11506817"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="JGIDB:Spoth2_2311601"
                     /translation="MPLFILTETSAGYGLFKAADKKLLESDNLSERLSTVDKIVKEIK
                     YKEFAKFDSAATALEEVAGVIEGKVTPKLASLLNEFKDEKKVTLAVAESKLGSSILKL
                     PGLNIKPISDSSTTDLFRAIRKHLPDLIPGMLPENFQEMSLGLSHSLSRHKLKFSPDK
                     VDVMIVHAVSLLDELDKELNTYAMRVKEWYGWHFPELAKILPDNLSYAKVIVALGMRA
                     NASKADLSEILPHEIETAVKAAADISMGTEITEEDLENIKLLAEQVISYSEYRRQLAE
                     YLENRMKAISPNMTELVGPLVGARLIAHAGSLINLAKNPGSTIQILGAEKALFRALKT
                     KHATPKYGLIYHASLVGQASGANKGKMARQLAAKVALGVRTDALAEFEEDADDETRAS
                     LGIRARAKLENNLRLLEGKPLSKGVAVGPNGVPLGAPAKWDIKEARKYNIDADGLGAE
                     AQAPKKPLIQEVDEEMAELDVADKSDVEMKDAPSKKDKKDKKDKKDKKEKKDKSQKSK
                     ESEAPAPAKITEKDYERLAKEAGMSVSKFTRKLEKGQIKVNADGTVEVLSKKDSKTQE
                     VEEEQAETPVKSKSSKRKHEPEEETPAKEEKPKKKKKKSSKE"
     gene            1015469..1016684
                     /locus_tag="MYCTH_2311602"
                     /db_xref="GeneID:11506818"
     mRNA            1015469..1016684
                     /locus_tag="MYCTH_2311602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666641.1"
                     /db_xref="GeneID:11506818"
     CDS             1015618..1016289
                     /locus_tag="MYCTH_2311602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666689.1"
                     /db_xref="GeneID:11506818"
                     /db_xref="JGIDB:Spoth2_2311602"
                     /translation="MPDSPRRRSRSRSRSPPRRPKVSGGFKWKDKRSADTDDRRDDRG
                     LQRGYRDRSPRRDRERDRGFGRDRDRDRDRDRDTRDRSPRRDRSRDRDRERERDRDRD
                     RDRYRRDRSPRSSNNSRPSDRDRDAKPKPKKERPAAAPTNPGEEMIVVTVNDRLGTKA
                     QIPAFPSDTIGQFKIMVAMKIGREPHEILLKRQGERPFKDAITLGDYGISNGVQLDLE
                     VDTGD"
     gene            1017359..1019294
                     /locus_tag="MYCTH_2311603"
                     /db_xref="GeneID:11506819"
     mRNA            1017359..1019294
                     /locus_tag="MYCTH_2311603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666642.1"
                     /db_xref="GeneID:11506819"
     CDS             1017419..1019119
                     /locus_tag="MYCTH_2311603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666690.1"
                     /db_xref="GeneID:11506819"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="JGIDB:Spoth2_2311603"
                     /translation="MSGTVLSTLCSICHTEPPKYKCPRCGVRTCSVPCVQKHKARADC
                     DGVRNPRAFMPLKQLKTPAGVDHDYNFLTSIERARERAEKEVLEARRLLSEKDLRPKN
                     EDKVFQKVWYGDELRHVPVQSQPYGKPEGPAFIDGFDKHVRRRLRYLNIDAITMPKGM
                     ARQRENKTAWNRRTQSINWQVEWLVYSASDLGFTSALHDQQQPLRILCKTLEGTALHS
                     GLASALDWHRGQLDRRSREQPDPTETDNEAESDDGPPAAKKRKTHHHNKNQFPTVCPI
                     QDPSTSTWSSAPYSLQYQPTTAWSQTITLPHAETTLEEKLMSWDFYLVNVVPPPLAAF
                     ATATNDGKNQTKKGGSKTIIPLSSTESLTAALSGRRVLEFPTVVAVPGGWGPPAGYTV
                     ELDERPDRIRGAAGRAARAHRRGANADMSADTGNTGDAGETLPRPGPAKRPRRQGADG
                     AGGRGGKRFRSSPSPSRTAALPREELVGQHQQQSDDEGDAEEGEVNSDGDEVMGEAAD
                     ADGYVEEADDSDSEDGSSSTTMGREDEAGQPQQQEENRPEAGRPRGGLVDYGSSDESD
                     "
     gene            1021499..1022901
                     /locus_tag="MYCTH_89127"
                     /db_xref="GeneID:11506820"
     mRNA            join(1021499..1021758,1021827..1022901)
                     /locus_tag="MYCTH_89127"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666643.1"
                     /db_xref="GeneID:11506820"
     CDS             join(1021696..1021758,1021827..1022423)
                     /locus_tag="MYCTH_89127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666691.1"
                     /db_xref="GeneID:11506820"
                     /db_xref="JGIDB:Spoth2_89127"
                     /translation="MAETKTSPVTNGDSPNSDTLRHLLTLPAVQDGVRAFSSNPLGRI
                     SIRLTNSAYHLVGAPVLSLFNKPLSYVTPYAQRVDEFGVQTLAKVEEKYPIVKKPSPE
                     LLKGAKEAAYAPVRHVAEVYNGAYQKTSGNHTIASGKAAAKTAVVVSVEGAIYALREA
                     LKFGQSFHVTESIKAAIDQLEEALRRQNGENINNHTANSGHASNRRDEPETTGAKISS
                     D"
     gene            1023192..1024975
                     /locus_tag="MYCTH_2311608"
                     /db_xref="GeneID:11506821"
     mRNA            join(1023192..1023670,1023831..1024975)
                     /locus_tag="MYCTH_2311608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666644.1"
                     /db_xref="GeneID:11506821"
     CDS             join(1023514..1023670,1023831..1024690)
                     /locus_tag="MYCTH_2311608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666692.1"
                     /db_xref="GeneID:11506821"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="JGIDB:Spoth2_2311608"
                     /translation="MTAANTTTTRLLPRLIRQSFLAVEQSEGAGARVRRSIGTPKLRN
                     LSPFLMLDHFSVSPGAGFPDHPHRGQETITYLLQGGMEHEDFAGNRGRLGPGDLQFMT
                     AGRGIVHAEMPVQNEDGSPNVGLQLWVDLPKRLKACEPRYRDLRADEVPVAEADGGRV
                     RVKVISGRSHGVDSVKDLAYTPVWLLDVEIQPGGRIVQPLPEGWNAFAYTLEGEVLFG
                     DGDGDGEVAAGPAPPPPAQQQQQQQQQQQQQQRAVGPFHNVVFEADGQAVYAAVDERA
                     ESSARFVIVAGTPLDQKVVQYGPFVLTSQEEVYQAFMDYQTHSNGFERANGWASEIGK
                     TMVH"
     gene            complement(<1025317..>1026157)
                     /locus_tag="MYCTH_2113362"
                     /db_xref="GeneID:11506822"
     mRNA            complement(join(<1025317..1025643,1025687..>1026157))
                     /locus_tag="MYCTH_2113362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666645.1"
                     /db_xref="GeneID:11506822"
     CDS             complement(join(1025317..1025643,1025687..1026157))
                     /locus_tag="MYCTH_2113362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666693.1"
                     /db_xref="GeneID:11506822"
                     /db_xref="JGIDB:Spoth2_2113362"
                     /translation="MSPDTTTPPETQSHAFAPPIAEDQGSRLSHSTFPTSLSQGEHLA
                     SLAGPMRTLSTMDEESSTRSSITAAPTDSSTTLPVNEQDYRLYGSELRHNCLVPVNGQ
                     EDYDDDGHSTNSNNNRRRCYRPSFLECLSWRLGGCPSPLPRGCTPSPAQLAYQAQPRR
                     RRRRRWRRRRMLRKQRQMRRTPRRLYEEEKKKKKKKKKKKKKKKKKKRNGGDRLNDHD
                     GGDGDMEEDRWWEVSGEASDAGGEPQGEYGREGSDVLRVLFEKTKTR"
     gene            complement(1026752..1028569)
                     /locus_tag="MYCTH_2311611"
                     /db_xref="GeneID:11506823"
     mRNA            complement(join(1026752..1027709,1027780..1028093,
                     1028199..1028569))
                     /locus_tag="MYCTH_2311611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666646.1"
                     /db_xref="GeneID:11506823"
     CDS             complement(join(1026980..1027709,1027780..1028093,
                     1028199..1028315))
                     /locus_tag="MYCTH_2311611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666694.1"
                     /db_xref="GeneID:11506823"
                     /db_xref="InterPro:IPR007312"
                     /db_xref="JGIDB:Spoth2_2311611"
                     /translation="MKRFFVNLLAWLWVGVALSAPVRRGKAFDRFITIWLENQDFAKV
                     VVDNRIVDLKRHGILLTRYFAHTHPSQPNYLAAIAGDYFGLNHDDWVRLPEDVATIVD
                     LLEEKGVTWAGYFEDIPSPGYMGNASDGSTGTDGWDYVRKHNPFVSFDSITNDGERLL
                     KIDSFDAFQRAFAAKKVPEYVFMSPNMMNDGHNTTLDYATKWSHKFLQPLLAAKAFDE
                     RTLIALTYDESETYEEPNHIVTLLLGNAIPPALKGTEDDTFYTHYSMLSTLELNWRLH
                     TLGRYDVGANVFKFVADQLRYTANKEPENAATVDNSVPYPGLLNNDTSARLPLPFPNT
                     KLVGASGLGILPSIEKALSRTKITKTPYDGSGKVFDGDKNPPVYKPPAGNPS"
     gene            1028956..1032465
                     /locus_tag="MYCTH_2311613"
                     /db_xref="GeneID:11506824"
     mRNA            join(1028956..1029961,1030111..1031874,1031941..1032465)
                     /locus_tag="MYCTH_2311613"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666647.1"
                     /db_xref="GeneID:11506824"
     CDS             join(1029320..1029961,1030111..1031874,1031941..1032219)
                     /locus_tag="MYCTH_2311613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666695.1"
                     /db_xref="GeneID:11506824"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2311613"
                     /translation="MSEPSDRSESPAVTESHPDTTTTTTHEEAHHNDRDDRPPPRKRQ
                     RVRLSCLECRRRKLSCDREFPCSRCIQSGTPERCEYETRPGLAPPNKLGLPPTALAGL
                     DARLSLPSTGGESPYFRKDGRESDRIRRLELEVAQLKSLLVKQVSLDGSTVQERSPSD
                     LPKSDAEQEAEAEVPPFLQTQVTTADKEELRFFRGKEFKTRYFGPHSAYLAFQELTGL
                     CPFMKETSEEWLRPLHIHRNKDRRKDAEERERKFRAPDPALEALLPSKEETDNLVNIY
                     LNQFEQVHRIVHIPSFRRDYAKFWLPSETRSAAFTALVLAIMGISSCLSAQMPHKFEK
                     MVSHSHANAIKWVEAVDAWQERQSQKHRRLIHYQIACLVYLAKRVNTMKKKRFWKNAG
                     AMTQDAISVGLHREPSHMCDKISPFNQEMRRRIWATIQSYDLQASFDHGLPSILCSLH
                     YDVNPPRNIDDDEFDEDTKELPPSRPPNEYTFSSYQHISRQSLPLRLELSRVLTGPPE
                     ELDYDRVIRYTNEINQEIDSLPSWDVSEASSQDPVVKKPLLAYTLLHIQLRQYIIPLH
                     QPFLRLRKTNSKYQYSEIIYYNAARDMVLLNDRLAQQGIRTLNFLREDSLTLAINLAS
                     VTMLQPRGSTNMIMINSQHTLQLLERCLAMKEDRILRCGNNEPWGYSMMCATFGLLEA
                     HLGVKTPEAAKAASAERFVHLHWKLLAGQDPPPGSQQSASGGAAGASGGCCGAGGGGG
                     GGGSGANTGAGAGAAAAAGGQTGAAAGEQGRAVAGTPFSSTGMGTYPAGPGPSPADAF
                     VRSKSVTPFAPSSSQQGAGQQQIEVPGTPWWMPNTADQSTIPQVGFPSAPLYRRRRAR
                     ADVPQMLPLNPDFNFETLGFNLNELWGSGNFDWDSMMP"
     gene            1032699..1033978
                     /locus_tag="MYCTH_2311615"
                     /db_xref="GeneID:11506825"
     mRNA            1032699..1033978
                     /locus_tag="MYCTH_2311615"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666648.1"
                     /db_xref="GeneID:11506825"
     CDS             1033002..1033958
                     /locus_tag="MYCTH_2311615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666696.1"
                     /db_xref="GeneID:11506825"
                     /db_xref="JGIDB:Spoth2_2311615"
                     /translation="MTTTSSFSRHEQEHEQEQQQDAIPPAQKARTIAHMNADHRADMR
                     YILMRYGADPPVPPSYFYFSSGSTRGAHKKPAAGSDADHDRAEDRDPIMLDIDLDRFT
                     VRLPAGGSAAGAAAGSVHAVAFDPPLRTWAERRERLVEMTRMAREAAAAAAAAAAASS
                     SSSSAEDGVGVGVGVGVRRVVVVDEYMPPRVPYDLAIFLAVLAYYASLALVRAGMVTP
                     GSPAARWLEAARFPGGAAGFRWLVDALLVPVLGIHLAETWWLERSRLRKFGVRRGSRV
                     WWLWVGSVFIEGAMAFKRFDIIVERLKRGEEGEEEKEEKKRR"
     gene            complement(<1048260..>1050220)
                     /locus_tag="MYCTH_2113368"
                     /db_xref="GeneID:11506826"
     mRNA            complement(join(<1048260..1048402,1048496..1048563,
                     1048812..1048861,1049158..1049404,1049860..1049942,
                     1050068..1050070,1050143..>1050220))
                     /locus_tag="MYCTH_2113368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666649.1"
                     /db_xref="GeneID:11506826"
     CDS             complement(join(1048260..1048402,1048496..1048563,
                     1048812..1048861,1049158..1049404,1049860..1049942,
                     1050068..1050070,1050143..1050220))
                     /locus_tag="MYCTH_2113368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666697.1"
                     /db_xref="GeneID:11506826"
                     /db_xref="JGIDB:Spoth2_2113368"
                     /translation="MGGPEYVFYKTRGDNPRKGARERERQYYYHIHKGKKQQPPSSPV
                     GSGGGSSPEDRGGGSSGGVEKGEIPWVLRWKREAEEQGSENRETCPDAHVFDAAKPNR
                     TERSEIHYTVGQPQARGAGTRKRTKQPEAGNNDGLCRRNWGMNLGLSAQQGRRKCEGP
                     PSQSRRMDKKKMEAVSELEHKDGTDHRRAGSSRYHLERVTNSPHLYSLDNPTPLPGEM
                     RMLHW"
     gene            1053156..1055391
                     /locus_tag="MYCTH_2311619"
                     /db_xref="GeneID:11506827"
     mRNA            join(1053156..1053728,1053783..1053862,1053923..1055391)
                     /locus_tag="MYCTH_2311619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666650.1"
                     /db_xref="GeneID:11506827"
     CDS             join(1053486..1053728,1053783..1053862,1053923..1055060)
                     /locus_tag="MYCTH_2311619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666698.1"
                     /db_xref="GeneID:11506827"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2311619"
                     /translation="MPPLTQPAANQQLTPHQGFNRKSDLQRHYRIHTNERPYKCHHQD
                     CGKSFIQRSALTVHTRTHTGEKPHHCKHQGCGKRFSDSSSLARHRRIHTGKRPYRCDH
                     QGCSKSFCRKTTMVKHWKRTHQRGPHSPELDDMISDGGSDSAPPTPESHTAMSWRSHQ
                     GPIMGQTGQQLQRAASFADFGQHMNNYSLQQQYNAHRHSLSSSGGAEYHGAPHLGQSP
                     LQPHGHPQHQQQHPGVQMLQRTGSIAHHNYFVPDQNNPGVATMNTNQHAAPQHPQYHP
                     QVPRQGVERLPLEIPSYPNAPDLASSIPNSSPGSYSAASGRSPSVQDAGFYTHVPPGQ
                     TAAYALHTTSSVAQQGPQMMAFQGQLPPTQAAAAAAAAQVMSHTATVQPVQQHQPHQQ
                     HQQGQGGPQQQTPEQYHHHHQQAQQQAQQAQQQQQPPQEQEQWYDSAQYQSPVEVATI
                     GSLPPFGSGGMYDPWGPKLEFDDPTMQMPSARIESM"
     gene            1058651..1059512
                     /locus_tag="MYCTH_2311623"
                     /db_xref="GeneID:11506828"
     mRNA            join(1058651..1059029,1059120..1059512)
                     /locus_tag="MYCTH_2311623"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666651.1"
                     /db_xref="GeneID:11506828"
     CDS             join(1058903..1059029,1059120..1059445)
                     /locus_tag="MYCTH_2311623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666699.1"
                     /db_xref="GeneID:11506828"
                     /db_xref="JGIDB:Spoth2_2311623"
                     /translation="MRLSGIIVAALAGRALGHGDHGSGSQRPVVDENASWMQKHMAEE
                     HHAADFDAASFFALHDFDGDGSWDGEEILRTYGLMDESNKHVTEDRKAEIVGVITKLL
                     DTNRDGVVSRDEFVHVIEVEGKTLPDMGTGPGHHGDDEYEYEIHHWEK"
     gene            complement(1059514..1061513)
                     /locus_tag="MYCTH_2311624"
                     /db_xref="GeneID:11506829"
     mRNA            complement(1059514..1061513)
                     /locus_tag="MYCTH_2311624"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666652.1"
                     /db_xref="GeneID:11506829"
     CDS             complement(1059801..1061426)
                     /locus_tag="MYCTH_2311624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666700.1"
                     /db_xref="GeneID:11506829"
                     /db_xref="JGIDB:Spoth2_2311624"
                     /translation="MPPPNKIGRPPKQKQNALQAAISSWLDSLPPVLVESITERVAAD
                     AGANVDTKRLLLAGAPKRWVVYEPMVLLPSGSFTNQPWPALLSSLYPSQREALWTAIL
                     GQLSPTNKPPLTHLAINEGIPLHLPSQPSGTEGDDNPAGEEEHKEENLLRSPTRLQPL
                     HGSFGNSSPPANPTPSDFDSAFWVSTKQNGLVQTWAPLHTMFSRGNIKEKARLLSFHH
                     RTRPGPGSGSGPGTRSEAGQDDAPPTAKTMTPPQAPAADLRGGGGTTRSMGSSSSSSS
                     RRQQRQYAVDLYAGIGYFAFSYARLGLRVLCWELNPWSVEGLRRGAAANGFSVRVVVP
                     RTPHPARLSSSSSSSFPGGGGGGGGGDSRHLLDVEEEEEEEEKEEDVLAGDEQIVVFL
                     EDNRHAAGRIRGWRARSGGGIEVLHVNCGFLPSSQPVWKDAWGMVVSGDGGDDGDDGS
                     SNGDGAEGGEGDGEGQSWLHLHENVGVADIETRRAEIQGLFDGWATEENRKQGAGGRR
                     TARVEHVELVKTYAPGVWHCVFDVSITRSNAGR"
     gene            complement(1062095..1062189)
                     /locus_tag="MYCTH_t194"
                     /db_xref="GeneID:11506830"
     tRNA            complement(1062095..1062189)
                     /locus_tag="MYCTH_t194"
                     /product="tRNA-Ile"
                     /note="Anticodon: AAT"
                     /anticodon=(pos:complement(1062153..1062155),aa:Ile,
                     seq:aat)
                     /db_xref="GeneID:11506830"
     gene            <1063839..>1064582
                     /locus_tag="MYCTH_2130620"
                     /db_xref="GeneID:11510134"
     mRNA            join(<1063839..1063938,1064008..1064120,1064189..1064377,
                     1064466..>1064582)
                     /locus_tag="MYCTH_2130620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666653.1"
                     /db_xref="GeneID:11510134"
     CDS             join(1063839..1063938,1064008..1064120,1064189..1064377,
                     1064466..1064582)
                     /locus_tag="MYCTH_2130620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666701.1"
                     /db_xref="GeneID:11510134"
                     /db_xref="JGIDB:Spoth2_2130620"
                     /translation="MGLREKFGQKFGHSTDKVGATQTSALSRGNKAESGSQALDDTPI
                     RKLWDLAYDKLREEEEGAILEYEKKLQRKMDEVNRDSWKLRFGSNEVLVKDLAEPVSG
                     IISRANDYIIGAVITSNPYAATAWTGVALLLPLLLNPSMQAASLARGLEYISSLISQS
                     RMWEELYEMTAG"
     gene            complement(<1064840..>1066273)
                     /locus_tag="MYCTH_104386"
                     /db_xref="GeneID:11506831"
     mRNA            complement(join(<1064840..1065389,1065479..1066070,
                     1066216..>1066273))
                     /locus_tag="MYCTH_104386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666654.1"
                     /db_xref="GeneID:11506831"
     CDS             complement(join(1064840..1065389,1065479..1066070,
                     1066216..1066273))
                     /locus_tag="MYCTH_104386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666702.1"
                     /db_xref="GeneID:11506831"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Spoth2_104386"
                     /translation="MDFPPLSASQAGGFDGDILGKSLFESFTFKWLRWCPPTASLYPL
                     PSGIERFFVDTPGGEIEMLYARSQSSPPPPPPPSSSSSPSSSPPSPGDDTSEDTPRPF
                     LYFVHGGMGGAWVWLEYMQFLAARGVPCYAVSMRGHGGSYHPSFLRMVYATTMRMLAD
                     DVLAGLRWVQRKREGGRREAVLVGHSSGGGLCQLLLAEKQVTAKGLVLVASVPGFGSD
                     RVYESWKILDPWFVPRMILHLWHPNSPLSHPALTRRAFFSREQTDAYLEAFQDKMCAY
                     ESLASALGMIRPFIHQQSVLSQVTGGSTGQGVMVLGGELDRIMRQPIMEDPVHTYRTT
                     YSNMVQQNQLRGEDAEVVPLTGEGGRDKTGHGVRYCLVPRAAHHLMNEVTWEVGAEKV
                     LAFYEQL"
     gene            <1066815..>1068670
                     /locus_tag="MYCTH_2071905"
                     /db_xref="GeneID:11506832"
     mRNA            join(<1066815..1066868,1066928..1068017,1068096..>1068670)
                     /locus_tag="MYCTH_2071905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666655.1"
                     /db_xref="GeneID:11506832"
     CDS             join(1066815..1066868,1066928..1068017,1068096..1068670)
                     /locus_tag="MYCTH_2071905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666703.1"
                     /db_xref="GeneID:11506832"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="JGIDB:Spoth2_2071905"
                     /translation="MSSSTSETSGVRIAVEGCGHGTLNAIYAAVERSCKERQWDGVDL
                     LIIGGDFQATRNAADLNAMSVPVKYRELGDFHEYYSGARRAPYLTIFVGGNHEASSHL
                     WELYYGGWVAPNIYYMGAANVLRLGPLRIAGMSGIWKGFDYRKQHHERLPFNADDIKS
                     FYHVREIDVRKLLQLRTQVDIGISHDWPRPIEKYGNRKRLFEMKPHFESESRDGSLGS
                     PAAEYVLDRLRPRYWFSAHMHCRFAAIKQFQPPEGTQESDERAKSIQAAPGPVADANP
                     DEIDLDPDNDGDPPEGTAATTAAAGAAAEPAVKPQSPSGENTTTQDTEALRAQLPEAF
                     AKRAQVSSNRSIPGQPVPPGITNTTTRFLALDKCLPGRKFLQLMEIPAAAAAAGRGSK
                     LRLQYDPEWLAIVRAFHPLVRIGERGAATPPDEGEERYRALIEEHRAWVDEHVVAAGR
                     LDVPDNFAVTAPAHRPGIDPEMTDEQPREWTNPQTAAFCDMLGLVNYWDASEEERKLR
                     MENGPAPAEYGGGGGGRGRGGGRGGLGRGGRGRGGDGGRGGRGGWGGGRGGGRGWGGG
                     RGRGRG"
     gene            complement(1069095..1070141)
                     /locus_tag="MYCTH_2316489"
                     /db_xref="GeneID:11506833"
     mRNA            complement(join(1069095..1069472,1069713..1070141))
                     /locus_tag="MYCTH_2316489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666656.1"
                     /db_xref="GeneID:11506833"
     CDS             complement(join(1069310..1069472,1069713..1069867))
                     /locus_tag="MYCTH_2316489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666704.1"
                     /db_xref="GeneID:11506833"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="JGIDB:Spoth2_2316489"
                     /translation="MADSKYITLVSSNGFEFVVLREAALVSPTIKGMLRGGFREAQTG
                     VCEFPEISAHVLEKVVDYFHYWYRNRDKENVPDMEIPVEMCLELLMAAHFLNLESMPT
                     SKA"
     gene            <1071150..>1072057
                     /locus_tag="MYCTH_56516"
                     /db_xref="GeneID:11506834"
     mRNA            join(<1071150..1071254,1071371..1071574,1071641..>1072057)
                     /locus_tag="MYCTH_56516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666657.1"
                     /db_xref="GeneID:11506834"
     CDS             join(1071150..1071254,1071371..1071574,1071641..1072057)
                     /locus_tag="MYCTH_56516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666705.1"
                     /db_xref="GeneID:11506834"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_56516"
                     /translation="MTEGPAFSKKIVVVGDGGCGKTCLLISYSQGYFPEKYVPTVFEN
                     YITYPIHPPTGKTVELALWDTAGQEEYDRLRPLSYPETDLIFVCFAIDCPNSLENVMD
                     KWYPEVLHFCPYTPLILVGLKSDLRYKKTCIDMLKTQGLTPVTTEQGLAVAKKMGAQY
                     MECSSKEMKGVEEIFERAILTVVANDRKMLEAEAAAAASSGGGGLGIGRRGSTALKSG
                     ITFGSDGVPIPIVKKKKRKCALV"
     gene            complement(1072807..1073436)
                     /locus_tag="MYCTH_2311631"
                     /db_xref="GeneID:11506835"
     mRNA            complement(join(1072807..1073049,1073107..1073169,
                     1073269..1073436))
                     /locus_tag="MYCTH_2311631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666658.1"
                     /db_xref="GeneID:11506835"
     CDS             complement(join(1072900..1073049,1073107..1073169,
                     1073269..1073364))
                     /locus_tag="MYCTH_2311631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666706.1"
                     /db_xref="GeneID:11506835"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="JGIDB:Spoth2_2311631"
                     /translation="MASQQRPTSVADTREKTYFEQQREELIGEIAANFEHVLANINKL
                     NRSLEAVIAVGNEFSSVEALWSQFENVMAKDPEESGEKSEEQGDAPEGSRQVKTEGSE
                     "
     gene            complement(1074761..1075785)
                     /locus_tag="MYCTH_2311633"
                     /db_xref="GeneID:11506836"
     mRNA            complement(join(1074761..1075304,1075365..1075432,
                     1075496..1075627,1075688..1075785))
                     /locus_tag="MYCTH_2311633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666659.1"
                     /db_xref="GeneID:11506836"
     CDS             complement(join(1075112..1075304,1075365..1075432,
                     1075496..1075627,1075688..1075705))
                     /locus_tag="MYCTH_2311633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666707.1"
                     /db_xref="GeneID:11506836"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="JGIDB:Spoth2_2311633"
                     /translation="MLSRRMLTKEEEEAMGDEVEVRREDQDKINKFSRLHQRELVIEE
                     ELKVKNKEKEELDDITTELELADEDDTVPYKIGDAFFHIPLPQAQEMLGVSTAKLEEE
                     IGELEEKLGNIREEMTQLKVELYARFGKTINLET"
     gene            <1076044..>1076498
                     /locus_tag="MYCTH_104380"
                     /db_xref="GeneID:11506837"
     mRNA            join(<1076044..1076136,1076214..1076245,1076308..1076389,
                     1076472..>1076498)
                     /locus_tag="MYCTH_104380"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666660.1"
                     /db_xref="GeneID:11506837"
     CDS             join(1076044..1076136,1076214..1076245,1076308..1076389,
                     1076472..1076498)
                     /locus_tag="MYCTH_104380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666708.1"
                     /db_xref="GeneID:11506837"
                     /db_xref="JGIDB:Spoth2_104380"
                     /translation="MPGQKLYPRATVKKIVKAHSNCNVSKNADVMMFLDYMLFMQNLM
                     KEAAIEAKKGGERGITARSVRKVTADSLARFRG"
     gene            1077152..1079019
                     /locus_tag="MYCTH_2311637"
                     /db_xref="GeneID:11506838"
     mRNA            join(1077152..1077262,1077385..1077606,1077668..1077695,
                     1077753..1078269,1078337..1079019)
                     /locus_tag="MYCTH_2311637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666661.1"
                     /db_xref="GeneID:11506838"
     CDS             join(1077428..1077606,1077668..1077695,1077753..1078269,
                     1078337..1078953)
                     /locus_tag="MYCTH_2311637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666709.1"
                     /db_xref="GeneID:11506838"
                     /db_xref="JGIDB:Spoth2_2311637"
                     /translation="MAASDIQNPPAPVESKSAKKKAKAERTESPAPAPSTGPASVAAG
                     EGRDETENSYIRDLQKSIRNITKKITNTARIDAIIAEHNGKSLDELVAAKIINADQKA
                     AHLKKPALQAQLFQLEEQLAQHKKVDQDYRARLAEQEKNLTEKFEKEKADLVAELTQK
                     AEADVKKSLHDNLLILSQFLRLAAARRAEDVDSTADENMALEGVLLHIYSGDENAVAT
                     MLKLVQGADEQTRSTTGETLQTTFAQVKQVAVAYAASFAQPEPVPQSTESEPAAESKQ
                     EPQTDRTVANAALTEVDDCTATQLTNGHVEASSSSAAPSNAEVADEAANAAGESQWNA
                     SDNDPSSSPEWVDVKVPREASETETAPAPTAAAPAQSWADDHPEKEAAPAAAADDGFQ
                     SVPGRNRGHREGGGYRGRGGYRGRGGYRGEGRGRGRGGQRGGLPSRPRRGGDEH"
     gene            complement(1079723..1080634)
                     /locus_tag="MYCTH_2316490"
                     /db_xref="GeneID:11506839"
     mRNA            complement(join(1079723..1079932,1080062..1080634))
                     /locus_tag="MYCTH_2316490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666662.1"
                     /db_xref="GeneID:11506839"
     CDS             complement(join(1079752..1079932,1080062..1080282))
                     /locus_tag="MYCTH_2316490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666710.1"
                     /db_xref="GeneID:11506839"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="JGIDB:Spoth2_2316490"
                     /translation="MPPPNNSSSKIPLPPPLLASPRGTAFERAVWSLTYQIPRGSFST
                     YALLAARLGSSPRAVGNALRRNPFAPAIPCHRVVATGGTLGGFKGKIGRRDGEGITLA
                     EKRALLRKEGVKLEGDGPNVRVLGTPFAGFV"
     gene            complement(1081555..1085140)
                     /locus_tag="MYCTH_2311641"
                     /db_xref="GeneID:11506840"
     mRNA            complement(join(1081555..1082488,1082564..1083026,
                     1083085..1083321,1083400..1084419,1084496..1085140))
                     /locus_tag="MYCTH_2311641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666663.1"
                     /db_xref="GeneID:11506840"
     CDS             complement(join(1081752..1082488,1082564..1083026,
                     1083085..1083321,1083400..1084419,1084496..1084885))
                     /locus_tag="MYCTH_2311641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666711.1"
                     /db_xref="GeneID:11506840"
                     /db_xref="InterPro:IPR001194"
                     /db_xref="JGIDB:Spoth2_2311641"
                     /translation="MPPSLNTHASFSRPRTSDRDARPVTRDQADSNLIIPSRTSSLHS
                     RITQPIPSTLNMKPQQRTPKTLTHAYMVCGVGREPSQWVKAPPPPQGKIGHMKGAVPQ
                     FWLPEILGSSPRLEQDNEIARALHAAMRACFPHDVEICTGRTQPHCVHHAFVLQQDSS
                     HTLYGICLRVWSRADEKRAETIRELRRRTEPDFYDNPEEQYWIPYCLSFLSRYPLYNL
                     LGDYLRGMWIHWNKATNLFHAEEVSRILSFPAPRLNDLVRIDMKDYALCYQFPSSPTG
                     FQNFAMWPLFCCLSIPNIVGVIEAAISPTRRIIFVSHYPAMLTMAAETVRFCVRVYEW
                     SGLYVPVVHARHAKDLVEEPGPYILGITAECRSLFTAPSDALVVDLDRNFVLTSNPPT
                     ALTPSQRNKFVTRLTQALNGDVTPSGVPQHLRSAYGGGKLVPAGQIIVMRGEVESIQD
                     PEWWNQDAVMAVMDHVCEKISRNTGLKAVFGGSVKKPLMTKVSMRHLNEIVRERNQYS
                     RDALEAWQDFINLKGRLDTELSKVTKRNNYLNEELENWKQQFLKFQAFADTLTKETQE
                     LKVKIEGHKRENRRLAALIDQQKDDASRLSARLAGTEKQRDDALEALVLQQEIAEELE
                     RERKRNRKELSALQHTNMTIARQRDEARRVVLHLRSLISGQHHHMEHLVKTLTSPEEL
                     AAEIEAGFAAQEEAEAAAIAEREGMEESDARFIKNLTLARRRISTQTFIDVADRHLKD
                     KTDAIAHIIRNIAEQCQAAVEGLQLAQDAELGRPQSSASRARDLSKSRRGSSLSVAPS
                     DDGNASSTSTATSDVGDDSSSVTLLRPHSGRTSSIPPTPDLIPNRSSTSMSFASTTAT
                     TPERTSQQYLLQLHGGGGNGHGQQQHDIPTKIVEDDEDVDDLTPDERVARDADEGNPI
                     PAPHPTESGVVGKQPESLIHRLSGARISALGSSR"
     gene            complement(1087732..1090485)
                     /locus_tag="MYCTH_2316492"
                     /db_xref="GeneID:11506841"
     mRNA            complement(join(1087732..1089632,1089839..1090082,
                     1090157..1090192,1090264..1090485))
                     /locus_tag="MYCTH_2316492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666664.1"
                     /db_xref="GeneID:11506841"
     CDS             complement(join(1088229..1089632,1089839..1090082,
                     1090157..1090192,1090264..1090280))
                     /locus_tag="MYCTH_2316492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666712.1"
                     /db_xref="GeneID:11506841"
                     /db_xref="JGIDB:Spoth2_2316492"
                     /translation="MSEFIGARISLISRSDIRYSGTLHSINSDDSTVSLENVRSFGTE
                     HRKTNPDEFVPPSDQLYEYIVFRGTDVKDLRIEEGPAPVKEEKPPAVPNDPAILGARP
                     RPGNAAPGLSGPVGPQGPQGPQGPIGHAGPQNQQGPPPGAPGFGYFPPHMSGWGRAGA
                     PGPGPGPFGGMPYPPPGWFPPGQEFPPMGHGPWGPYPFQPGPGGHPGAPGAPGAPGQG
                     RQSANQTPSNQGPTQKPAPIGPAADRTPTTPSQPASASSEPKTADLAHMQPAAAAPPP
                     PPVESKPTVEEVNATAASISNKSPTAAGQAASVPTGPKGNRPTQIMPAVPLPAALTAK
                     VAQNQSGPKPLADQTNTAAAAAALRDATQAAKDAVARAMAQVDSSATTLQQAETNGVD
                     NLTKRVNEMRINAARSGQSNRGGRGRGPRPAKVEVPDTDFDFASANAKFNKQDIVKEA
                     VASSSLGEAGLANGADPEASDAIPPAEPAYNKNKSFFDNISSDLKDRENAAQRPGGAH
                     WRGEETRKNIETFGLGSVDGGPRGGFRRGRGRGRRDYRGGRGGSGGYRSRGPQTAPSQ
                     "
     gene            1091398..1094143
                     /locus_tag="MYCTH_2311646"
                     /db_xref="GeneID:11506842"
     mRNA            1091398..1094143
                     /locus_tag="MYCTH_2311646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666665.1"
                     /db_xref="GeneID:11506842"
     CDS             1091697..1093922
                     /locus_tag="MYCTH_2311646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666713.1"
                     /db_xref="GeneID:11506842"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="JGIDB:Spoth2_2311646"
                     /translation="MASRQLRKIRKQQELLSLQNGAADKSEEESEDEPIVARPRANMF
                     SGFAALGDEGDDGNDDEDQKSDEEDARQAAHQEQIVEEAEPAKKTKKKQKKKKKKGKQ
                     AGQPAPAQDERDSVDEIDRVLEELKLESQQPGDVVETPAGGESANELNELLRINFQHL
                     KAVNEMRRVFGKAMDVAEVEERTQENRQRGLPQNVDLETFLSARAAHPGQGSQNNKSM
                     FDTILRTNPFIDGKKTWPRGTAQGLKMIRVTEGSQDEVEFAFAHDKTYDALEGSFFGL
                     VQMYDPMQIVHFLYRYPYHVSSLIQVSKVARQDQNSALAADLIERALFTFGRVSLSEF
                     RKKLEKGQARMSFSRPENRQFYLAGYNLIQKLVLKGTYRTALEWAKLFLSINHDDPYG
                     MINWIHVLAIRALEAKWFIKFCSSDALTNASSTYAKQTLPLAHFQLGDTAAAKSTLIK
                     GMQALPWLYCALFSALNLDTPRPIWGIQPRNEDEALHTELYIHTAKDLWNTPQHISLL
                     QDAAASVSIPPNYASALGPPPAVSLATARFIYLDNTPALMSAVPRGMLHTAVPNFDFD
                     PLPPPEEANTFSSETQRLPWRVTQAERARSAVGQLPGMRAAIARLREEIEREVEERVR
                     RRPHLAGGGEAGGDGVDDDGQEDDGAADEAAAEAEQRRRFLPRESPAPGIMNYLRYVM
                     NGNLEVVDQLEEWQAPTGMPGGWGQGEGWEEEDDFEGVDEFEGPDDFEGGGYGDEADR
                     G"
     gene            1094815..1095811
                     /locus_tag="MYCTH_2311647"
                     /db_xref="GeneID:11506843"
     mRNA            join(1094815..1095343,1095487..1095811)
                     /locus_tag="MYCTH_2311647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666666.1"
                     /db_xref="GeneID:11506843"
     CDS             join(1095223..1095343,1095487..1095653)
                     /locus_tag="MYCTH_2311647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666714.1"
                     /db_xref="GeneID:11506843"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="JGIDB:Spoth2_2311647"
                     /translation="MADVVAASGPAPGEHKYQFNVSMSCGGCSGAVERVLKKLEGVKS
                     FEVSLESQTATVIAEESLPYEKVLRTIAKTGKKVNSGEADGVAQSVEVPAE"
     gene            <1098576..>1099886
                     /locus_tag="MYCTH_2070572"
                     /db_xref="GeneID:11506844"
     mRNA            <1098576..>1099886
                     /locus_tag="MYCTH_2070572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666667.1"
                     /db_xref="GeneID:11506844"
     CDS             <1098576..1099886
                     /locus_tag="MYCTH_2070572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666715.1"
                     /db_xref="GeneID:11506844"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_2070572"
                     /translation="LADAQRTFQRVHQKALEPFVVHVESVVPIQKRMAGILPPRPVCD
                     RLVDFYFSVLETMFPIVHKPSFGREYKKYWGGNLENDAFLPRLLCILCFASRFCTGTQ
                     SHCSVHIPTACVLVRDWLDGLRKREVFDPYILQTELLLLLAQWTIGAQKGAAWAQLSY
                     VVRMAMELGLHQDPSALAGISEFNMECRRRLWFAIMEMDFYVSLAHNWTPVLGHKDYS
                     CNPPRNLNNADIPADARTLPESKPLDQATDNHLQAYAAQTFPLRMQAADLLARLDPAD
                     DHREILDVGAKLEKMLDDINETFPRHVLGKGHKHREWRRRVLLDLHLRLPLMALYRPM
                     VVGRPNCSPEISCGYLKCCMTVLKYLDDEPIGDHVGSPDVAALSLLFLQRALTEAACD
                     VCWYIKQAREINFAGGLMWIPPTGSRRRNAESTQQYVWYVKSSF"
     gene            1099995..1100808
                     /locus_tag="MYCTH_2311648"
                     /db_xref="GeneID:11506845"
     mRNA            join(1099995..1100229,1100293..1100403,1100461..1100808)
                     /locus_tag="MYCTH_2311648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666668.1"
                     /db_xref="GeneID:11506845"
     CDS             join(1100026..1100229,1100293..1100403,1100461..1100532)
                     /locus_tag="MYCTH_2311648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666716.1"
                     /db_xref="GeneID:11506845"
                     /db_xref="JGIDB:Spoth2_2311648"
                     /translation="MVETVERTIDRLSSLIHQGLSSQVGDIVALLIVLVVVQPGTARE
                     KISIIQAKLERLRTVHSQMYPVYPSLPLPSSAASLKTTDKRRNLQSIYGEPLASDRFM
                     RAGPLEPASLTWADLLMHWESRVAET"
     gene            complement(1100808..1103145)
                     /locus_tag="MYCTH_2311651"
                     /db_xref="GeneID:11506846"
     mRNA            complement(join(1100808..1101392,1101489..1101590,
                     1101747..1101962,1102047..1102216,1102285..1102357,
                     1102421..1102680,1102768..1103145))
                     /locus_tag="MYCTH_2311651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666669.1"
                     /db_xref="GeneID:11506846"
     CDS             complement(join(1100995..1101392,1101489..1101590,
                     1101747..1101962,1102047..1102216,1102285..1102357,
                     1102421..1102680,1102768..1102823))
                     /locus_tag="MYCTH_2311651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666717.1"
                     /db_xref="GeneID:11506846"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="JGIDB:Spoth2_2311651"
                     /translation="MTEKLKPAARVSGRRQDVWSIINEAAAASPKQPIVNMGQGFFGY
                     NPPDFILNAAKEALNRVECNQYSPTKGRPRLKKAISEAYAPFWGRKLDPDTEITITTG
                     ANEGMLSAFMAFIEPGDEVIVFEPFFDQYISNIEMPGGKIVYVPMHPPKEGNVKTLSA
                     AEWTIDFDELERAITPRTKMLVLNTPHNPVGKVFSRDELQKIADLCLKHQIIILSDEV
                     YDRLYYVPFTRIATLSPEVEQITLTVGSAGKNFYATGWRVGWLMGPPHLIQYVSAAHT
                     RICYSSVSPLQEACAIGFEQAPAHNFWEESIASMRHKMNLFNAVWDELGIPYSEPEGG
                     YFVMVNLSAVQIPDSYPFPPHVAERPRDFKLAWFLIQELGVAAIPPSEFYTDTNAHIV
                     EDYLRFAVCKPDEVLEDAKERLRGLKPFLKKD"
     gene            1104122..1106239
                     /locus_tag="MYCTH_2311655"
                     /db_xref="GeneID:11506847"
     mRNA            join(1104122..1104624,1104831..1104975,1105113..1105516,
                     1105646..1105673,1105745..1105945,1106032..1106239)
                     /locus_tag="MYCTH_2311655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666670.1"
                     /db_xref="GeneID:11506847"
     CDS             join(1104323..1104624,1104831..1104975,1105113..1105516,
                     1105646..1105673,1105745..1105945,1106032..1106181)
                     /locus_tag="MYCTH_2311655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666718.1"
                     /db_xref="GeneID:11506847"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2311655"
                     /translation="MSQPARPPIPLQMEGGRAQPGSLMHRRETPSTREASTAAPSFTG
                     ITGASGHRNFEFTFDSAVRPRIVAAPTSPSTGGLWGRAYLAGQGQLHFEASPRMEDWL
                     GKLQALSLGRREEEEAMPAIRQRGSTTDEDTVHDAHENARAGGKRSAPLPADEDETGA
                     PNQPARKRSRISAVLQRTFPRLGRPRAATTGAIITTTTGNGSSSGSRSSSGSSIPALL
                     AAPSGTSPSAPLLSHLVDAGGTAAELSSSSPASATTAQQRVQVSGSRTVKVCLVGDSG
                     AGKTALFNRLAGRPFVPTSTSLVPDFSFVTVRAHDGSTVNVELWDFPGIVAGARPGPL
                     LSTFFHAAIICFSLESKDNLRNVADVWKPKLNACLHDQFIFVLGLKRDLRPAFPALNL
                     SFLPTAEPATAEMVSPA"
     gene            1107271..1108730
                     /locus_tag="MYCTH_2311659"
                     /db_xref="GeneID:11506848"
     mRNA            1107271..1108730
                     /locus_tag="MYCTH_2311659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666671.1"
                     /db_xref="GeneID:11506848"
     CDS             1107354..1108595
                     /locus_tag="MYCTH_2311659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666719.1"
                     /db_xref="GeneID:11506848"
                     /db_xref="JGIDB:Spoth2_2311659"
                     /translation="MSGAKSGSSARASSSSSSPPTKPPQDGRPRVSRTPPALLFPPAP
                     PPLHITVRFSIALPDIQLEIPSPQQTTVVALKHLIRRRLAADADAEAEAEASDKEDDG
                     DAPGAQTPSPAAQASRARLRFIHNGRILPDPAVLSAVLKAPPPPPLSHHPDPKGKSPA
                     GAHHQQQRVFINCSIGDPLPEVDIAAEAEAATAPGITTTTTTTTTTTTPKLSVTTTGL
                     DRHPQHEQQNPSEAGESGSGSGLRSRPRPQQQQQQPAGFDRLLQAGLTPAEIATLRSH
                     FRAIHTARFTPDTMPSPDTLRSMEDAWLDGGGFQRLPPTADSSNGYYYGGGGGGGGGG
                     GGEAGEGGDADGVEDAFAVSAVAGPLIQGMLIGFMFPLGVIGWLGKEDGLWSESMQAF
                     VILGVLLSVSVGLVRALTGEG"
     gene            complement(1109277..1112792)
                     /locus_tag="MYCTH_2311660"
                     /db_xref="GeneID:11506849"
     mRNA            complement(join(1109277..1109496,1109590..1112792))
                     /locus_tag="MYCTH_2311660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666672.1"
                     /db_xref="GeneID:11506849"
     CDS             complement(join(1109316..1109496,1109590..1112654))
                     /locus_tag="MYCTH_2311660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666720.1"
                     /db_xref="GeneID:11506849"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="JGIDB:Spoth2_2311660"
                     /translation="MDDLFAVFEEQPRASKRKADADADADVEMTDGVGNGTKNGDQTA
                     VKDEDTANAADEQPYGDGQGPSESKRRKKEDEAEPIMTDTFETAESREVNAAQGFAPS
                     TDQGSLVLSHNIQHQVALPPDLDYEYIPLSEHKPPAEPARTYPFKLDPFQALSVASIE
                     REESVLVSAHTSAGKTVVAEYAIAQCLKKNQRVIYTSPIKALSNQKYRDFQAEFGDVG
                     LMTGDVTINPTASCLVMTTEILRSMLYRGSEIMREVAWVIFDEIHYMRDKTRGVVWEE
                     TIILLPDKVRYVFLSATIPNAFQFAEWIAKIHRQACHVVYTDFRPTPLQNYFFPAGTK
                     GIYLIVDEKGNFKEHNFNEAMAAIESKKGSDPADWSAKQKGRGKNKKTNKGGEAPDEK
                     SDIERVIKMIIKRSFQPVIVFNFAKRECEQLALKTSNMKFNAPDEEQMVEKVFENALQ
                     QLSDEDRSLPQISNILPLLRKGIGVHHSGLLPILKETIEILFQEGLIKVLFATETFSI
                     GLNMPARTVVFTQVTKWDGVQRRPLTSSEYIQMAGRAGRRGLDDRGIVIMMVDDKLEP
                     DVARSVVVGQQDRLNSAFHLGYNMILNLLRIEAISPEFMLERCFFQFQTASSVPQLER
                     ELANLQQERDSMIIPDEAAIKDYRSIRQQLEGYQKDMIAVMQHPTYCLKYMKSGRPVE
                     IETPKGTYYGWGVVLDFKARKAPKMGEPDYPPQEAYFIDVLLKISSDDSAESPDLNGD
                     TALRGDAAVPEGIYPAKAGERGRWEVVPCLLSCVKALGSLRLHVGKQLSSRDERDRAG
                     MMLEEAKRRFPDGLPVVDPLENMGITDESFKKLLRKIEVLESRLIASPLHNSPLLDEL
                     WQKLETKLALGEKIKEKKRAIMKAHSIAQMDELKSRKRVLRRLGFINEAEVVQMKARV
                     ACEISSTEGHELLLAELLFNRFFNELSPELCASVLSVFIFDEKVETAALKEELAKPFR
                     EIQAQARIIAKVSAESKLEVNEDEYVQSLKWQLMETVLAWANGKPFAEICKMTNAYEG
                     SLIRLFRRLEELLRQMAEAAKVMGSEELKEKFELSLSKIRRDIVSFNSLYL"
     gene            1112987..1114445
                     /locus_tag="MYCTH_2145474"
                     /db_xref="GeneID:11506850"
     mRNA            join(1112987..1113504,1113572..1114445)
                     /locus_tag="MYCTH_2145474"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666673.1"
                     /db_xref="GeneID:11506850"
     CDS             join(1113243..1113504,1113572..1114260)
                     /locus_tag="MYCTH_2145474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666721.1"
                     /db_xref="GeneID:11506850"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="JGIDB:Spoth2_2145474"
                     /translation="MSTKLTLKVGNRAPKKPIRKLPSSIELPHDATVEDAKKAIARES
                     SVKDFNRLGLYDPVSKQFLKNRRALLRDEAGVVKAGELLVKDLGPQVAWRTVYVIEYF
                     GPIIFHVLIPFLRPYIYGILPFVDKAAAEAPMAQVQWLLCALFHLHFLKREYETIFVH
                     KFSANTMPARNIVRNSAFYWLMAGLLCSLDIYAPNSLAARDELTLLDYVGLAVFTIGE
                     ACNWIVHQHLASLRKPGGTEKGIPNCIGSNLVTSPNYMFEVLAWVGVILISRSWAVVL
                     FICTGIIYMRSWSRDKEKALREAFGDRYKKKRYTMLPGLI"
     gene            complement(<1114599..>1115786)
                     /locus_tag="MYCTH_2113390"
                     /db_xref="GeneID:11506851"
     mRNA            complement(join(<1114599..1114645,1114802..1115189,
                     1115251..1115476,1115518..>1115786))
                     /locus_tag="MYCTH_2113390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666674.1"
                     /db_xref="GeneID:11506851"
     CDS             complement(join(1114599..1114645,1114802..1115189,
                     1115251..1115476,1115518..1115786))
                     /locus_tag="MYCTH_2113390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666722.1"
                     /db_xref="GeneID:11506851"
                     /db_xref="JGIDB:Spoth2_2113390"
                     /translation="MTSPAAPFRLTPASIGPARPVAPSVTNTTAIASSLSSTDEDVQS
                     SGPPRRRRPLSLFSSLLSGSTAAKPRTAVSASSTPSIAASSVSVFVTRQHRHHHNHHQ
                     HDHYYYYHHHYHCRIRHLGQDFPELVLPHRHIRSPNGSSSPNHNPAAASTNLSTHRAL
                     RITTTAPAPQAEQVAQARTAVLASIGNLLDRELATRAAQLHANGAAIERQEREVERAT
                     AALRRENDRLGRLAETHARRVKEVGDVQNWAEMLERDFLILEETLRLVNDNNNEEATE
                     GSETGSESGDGSEGGSRSNGPETVPLPASPPFG"
     gene            complement(1116218..1120194)
                     /locus_tag="MYCTH_2311665"
                     /db_xref="GeneID:11506852"
     mRNA            complement(join(1116218..1119070,1119131..1119242,
                     1119408..1120194))
                     /locus_tag="MYCTH_2311665"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666675.1"
                     /db_xref="GeneID:11506852"
     CDS             complement(join(1116578..1119070,1119131..1119242,
                     1119408..1119745))
                     /locus_tag="MYCTH_2311665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666723.1"
                     /db_xref="GeneID:11506852"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="JGIDB:Spoth2_2311665"
                     /translation="MDFPRGLPDNPAQARRARAAAELANPTPPPPVPSLRDVPSSSNL
                     SAGQPISPSQVLALAREAMRAAHENEAKAAEASGVSNTLKPGLTIDLSRKKIQTLPEE
                     IVDVIKDELERLALSHNYLQTLPARFSECTSLRYLNVRQNRIKEFPLALCDLKSLEIL
                     DLGRNLLQVLPPEIVKLSSLKVLSIPKNKITHLPHCMADMPSLSVVKLEGNPLQYPPP
                     EVLQVQGGGGQGEGSGKEGELTEVAAVIKKFLKQEASGRAESPGDGASEGAETPRPTI
                     KRVFSGRFPIKVNGSDVPDLRSPALPRPPPIPTRSHYRGLSQHNTAHRRPGVMPLIIG
                     NPNERLRSNSETIIQTSSRERSESRSRRMGMVTKRSELSTLEETEVNNRFSHYRGLSH
                     GSAMQGNGTSTQVSSPNMGSPAEPALQRPVYIRRLSVLPERRRESKVFDPVLEAAKGI
                     LYSIFQIHPMIQTLVGLTNDDASRRSNLEIVVYNTAAHVEQLEYEIQRHDQADEGLGQ
                     KENENVQRACLTLINAYTHVCSLLMSNVDLFLDNGDPRYIRTLLTQLYNSIMELRVTC
                     TRAAPEGNHRPTPSFSRLDPGETIKPHSREPSVTPTADRMLNRSRNGAFVYNPSNLRV
                     ATDVSMPYVNGSGRSAMAGAATPRSGESFASTSTTGIRNLSADFTEEDRMFERIFLSL
                     QKTTDLVMQVLPTLNTQFASSMRSCAAQRAPDHRIQSWKKVISKCSTSIQQTEVLKAR
                     LSSIKLKEPGIRTQPSFWRLCNSFIDSWYVLIKNIKQLQNDVQLPVDTKARLRPIQTS
                     MKDTCDLMMSSPWAYLLRQPGPEPILSPYGGQITTTPVQMHMPMTPQSAALGPAVQAT
                     VPSTPQSASFTMAFSGVFDRGRSDTLLSSTGGEGRGGFGGGFGGGFGGGGGGSGFGSA
                     LPSRSGTMNSSSTASLTASSVNSMSSVGSSHDGVVTPSSALSPGGGPLGPLPFRLNGG
                     GNMKVGGF"
     gene            <1121297..>1122975
                     /locus_tag="MYCTH_2072733"
                     /db_xref="GeneID:11506853"
     mRNA            join(<1121297..1121373,1121447..1121565,1121636..1121670,
                     1121749..>1122975)
                     /locus_tag="MYCTH_2072733"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666676.1"
                     /db_xref="GeneID:11506853"
     CDS             join(1121297..1121373,1121447..1121565,1121636..1121670,
                     1121749..1122975)
                     /locus_tag="MYCTH_2072733"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666724.1"
                     /db_xref="GeneID:11506853"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Spoth2_2072733"
                     /translation="MPLARSDSLQDIDFTLRQQFNKTAFRPYQREIILAALDGKDVFV
                     QAATSFGKSLCFQLPAVIDRGITIVISPLLSLMMNQVETLRAANVDARTLNSNISLAE
                     RDRIYQDLATGHPRARLLYVTPELCSLDRFRERLKFVHEQRELARIVVDEAHCISEWG
                     HDFRRDFKRLSWFRETFPDVPIMCLTATANEQVRRDILSTLGLDKTPERLRNFTMTAH
                     RPNLHLEVRFTSDEANDRYDDFVTWLKGVYSRRAAADRKRELDATGERVENVPGIIYT
                     LSRDECESLAAALRCDEIGARPFHAKLPKEVKEETLARWIANEPGYDIIVATTAFGMG
                     IDKENVRFVVHWRLPKSFEGYYQEAGRAGRDGNASYCFLYYAREDRDRVCNMVMRDGP
                     GSGAGGAGSAKNKQARLESLSRLVEYCEDTNTCRHAAICRYFGEEQVPECDYACDWHK
                     DAPGLKRRMMKGLASEEWVSTQRQEGAYDDYYYSD"
     gene            complement(1123063..1124598)
                     /locus_tag="MYCTH_2311667"
                     /db_xref="GeneID:11506854"
     mRNA            complement(1123063..1124598)
                     /locus_tag="MYCTH_2311667"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666677.1"
                     /db_xref="GeneID:11506854"
     CDS             complement(1123151..1124335)
                     /locus_tag="MYCTH_2311667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666725.1"
                     /db_xref="GeneID:11506854"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="JGIDB:Spoth2_2311667"
                     /translation="MTNKPLLGETALVLRTLCSSCGLPKTGPKRVLVQRLRRAARQFQ
                     PIPPEARILSIDLGLKNFAYALLSPAAPSKRKQPAGGSSIDTPLNSPVHLHAWNRLDL
                     TLRSHTQSTPNNTRRQPIARGEGKEVGATAAAAAAAAAEEEEEEEEEEEAYSPAALSA
                     RAAHLVRTRLLPLRPTHVLIERQRFRTGGAAAIFEWTLRVNSLEAMLHAAFAALRGVR
                     VPAQPGEDDDGSGGGGVVWNGVVCSVLPRAVAGFLFPAGSDAVLSVQDGENVGGKEKK
                     KAVGAGAAYQMLKRGKVDMLARHLNDRRLIIPAEGQAEEMVRLFMAGAEKRREGKRRG
                     GRRRRQEGVEETERKDAEAEEEVVAKLDDLSDAMLQGMVWLQWQSNLEALIRERPALF
                     DN"
     gene            1125104..1126817
                     /locus_tag="MYCTH_2084531"
                     /db_xref="GeneID:11506855"
     mRNA            join(1125104..1125392,1125478..1126817)
                     /locus_tag="MYCTH_2084531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666678.1"
                     /db_xref="GeneID:11506855"
     CDS             join(1125139..1125392,1125478..1126738)
                     /locus_tag="MYCTH_2084531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666726.1"
                     /db_xref="GeneID:11506855"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="JGIDB:Spoth2_2084531"
                     /translation="MQPLSLLARRTLPPSIPAAGRIKTLSRHFAQTSLAMAPISKETD
                     FLVIGGGSGGLGAARAASARYGAKAMVIEGKRLGGTCVNVGCVPKKVTFNAAAIAEAL
                     HDAKSYGFNVQETAPFDWTTFKQKRDAYVLRLNGIYERNLANDKVEYVHGWAKLLSRN
                     EVEVTLDDGTKTVVNAKKILIAVGGNPTIPPQIPGAEYGTNSDGFFDIDTLPKKVALV
                     GAGYIAVEFAGMFNALGVETHLFIRYDTFLRHFDPMIQEGVTKEYERLGVKVHKRSQA
                     KKVEKDEKTGKLTIHYKEGDDEGVVSDVDHLIWAIGRTPATAGLGLESAGVKVDEKGH
                     VVVDEYQNTTVDGIYALGDVTGRWELTPVAIAAGRRLAARLFGPEQFRTAKLDYTNIP
                     SVVFAHPEVGAIGLTEPEAIEKYGRENVKVYKTNFTALYYAMMDPEEKAPTAYKLVCV
                     GPEEKVVGLHIMGLGSGEILQGFGVAVKMGATKADFDNCVAIHPTSAEELVTLK"
     gene            1127272..1128401
                     /locus_tag="MYCTH_2316497"
                     /db_xref="GeneID:11506856"
     mRNA            join(1127272..1127362,1127551..1127776,1128032..1128401)
                     /locus_tag="MYCTH_2316497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666679.1"
                     /db_xref="GeneID:11506856"
     CDS             join(1127551..1127776,1128032..1128060)
                     /locus_tag="MYCTH_2316497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666727.1"
                     /db_xref="GeneID:11506856"
                     /db_xref="JGIDB:Spoth2_2316497"
                     /translation="MLARATLRTSGAASAAANQLVARRAFTTTRARLSSPYHYPEGPL
                     SNLPFNPRKKGFAFWYWTFMATGFGLPFGIAVWQTYHPAK"
     gene            1128589..1131216
                     /locus_tag="MYCTH_2311673"
                     /db_xref="GeneID:11506857"
     mRNA            1128589..1131216
                     /locus_tag="MYCTH_2311673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666680.1"
                     /db_xref="GeneID:11506857"
     CDS             1128789..1131044
                     /locus_tag="MYCTH_2311673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666728.1"
                     /db_xref="GeneID:11506857"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="JGIDB:Spoth2_2311673"
                     /translation="MDVPPVKLSELLRHPDDLDKIAGLKAEFGRKKAAVDSQLRAGLR
                     EQLETAQAGMNGLTDGQKTVQQIKDEMIKIDKICSESQNMITDFATINLVSQAHRNFG
                     AVEAMRRNLETFDDRLDAIQEMLRQNDEDAENMPNLLPVHYELTQLRNIRDDAMDQIK
                     RADDPGLQSTLEDYFERLDQVIEWFDEHISLIGRSLINLVVADNTSLVVRFALVIEAE
                     EKSDQRVLALQEALKDHREMAARFQSITDGAKTVRGYKDKFLECIRKIGEGQFEQARE
                     RFMNDPSELEKSLKWYFNDLNTVRLGMVQLMPKKWKIFKTWTDIYHRMMHDFLVGIID
                     DPDTSSAHTLEIVGWPEKYYRKMNKLGFKQEELTPHVIDNRETELVRDFRALIIKFLD
                     EWIGRIWAQEKKDFADRNVEGGNLDQDEYGYFRTKNLVDLWRMLRGQLDAAANSKRAD
                     VAEGVVDAMFQRLRQRQQSWQKMLEDEAARYETDKAGDLEGFQPLQDWLVATANDQIA
                     CIDDNEDEGRLAYLSDFKRKFGALVTPQYMDRAEAEVAALRDGYLDLSTWCITKFAQL
                     VFAVDFKTVMPDFFTPRWYTSTAMARMVATFDEYVGDYRQVLHHSLVDIFIEIFADEL
                     LIRYLSSVRNKGAKFRRVDQFQDKIFDDLKTAFDFFNSLPNPAVANSIKETWRVTEPF
                     LQLLSVEKDAVPDTFAAFKTAYWDLQISWVEAVLRSRDDFERSMLNAVKARAAQMDVV
                     RGPETIMSKIK"
     gene            complement(<1132199..>1134429)
                     /locus_tag="MYCTH_2031268"
                     /db_xref="GeneID:11506858"
     mRNA            complement(join(<1132199..1132353,1132468..1132790,
                     1132848..1133311,1133391..1134215,1134301..>1134429))
                     /locus_tag="MYCTH_2031268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666681.1"
                     /db_xref="GeneID:11506858"
     CDS             complement(join(<1132199..1132353,1132468..1132790,
                     1132848..1133311,1133391..1134215,1134301..1134429))
                     /locus_tag="MYCTH_2031268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666729.1"
                     /db_xref="GeneID:11506858"
                     /db_xref="JGIDB:Spoth2_2031268"
                     /translation="MPRLYRNRYLTCFYCGRKTSTRYDGKTRRFDCPFCDATNYLDEN
                     GDITDPPVATETESTPRQFAAARPFSPPSSPPASDVIFCDTCLKNQHLLNASLAQYLP
                     DPDDPDYAEREKGLYRFRRNQERLYPQICEQCEPKVRQRLEKAQYTAKTDLLRRMLDR
                     SASARSRVTTRGWPERFDAAGRWLWIAGFVLQLGWHAVVVHSLLSQYLIWSEADDAQF
                     TFRLLRICGPLVGSLPSDERLLGWSSLATILGVWWNPRFSQVYRGFNRHINGVSKWYC
                     FQAMAVGLRVCLRRIDGLTTPDPAQLSTQTAAHALALTFALLILTLAPRCIRINMAPL
                     FGTPHTTQNPLRDDPPEPSSTTSRHDETKTIADLLDEISRSPVSPTPPSPTPTDASSP
                     SLPRRRANALPMGHNHTQAAQNLTASLREIDNLHLNLSPRRQPAASAWGAGRPYSSFS
                     RSSPPRSAPDQGEEEMDWSPTPSSKYRAFNTQGGQRANQPFGSAPTSDEKAASKPFWY
                     RVPPAPTTPAQRVFNPPNQPRLRPSPVEATTPTPSFRFGQQRDSFAGGGSGNKKGLGF
                     SSFSSSLSSAAGAADVTFAEPRFFAEMLGRAPGVVSEERKNDPRNELSGLFGESFKLT
                     EEEKKRRG"
     gene            1135272..1137089
                     /locus_tag="MYCTH_2311677"
                     /db_xref="GeneID:11506859"
     mRNA            join(1135272..1135393,1135632..1136043,1136132..1137089)
                     /locus_tag="MYCTH_2311677"
                     /product="glycosyltransferase family 1 protein"
                     /transcript_id="XM_003666682.1"
                     /db_xref="GeneID:11506859"
     CDS             join(1135876..1136043,1136132..1136869)
                     /locus_tag="MYCTH_2311677"
                     /note="CAZy_ID 270020"
                     /codon_start=1
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="XP_003666730.1"
                     /db_xref="GeneID:11506859"
                     /db_xref="InterPro:IPR013969"
                     /db_xref="JGIDB:Spoth2_2311677"
                     /translation="MEEFIRELVADIGPDRFALFVYIGLIGITILSTAGFFLLSWSWI
                     VAIVNVFVGFVIWRHVSLRRAHPRPETGRRWISRRDPSTPNTAGLPAVYFLYILGSGG
                     HTSEMLETIKRKFVPQANAHRRYLVTTGDQDSLDRLIKLECLIRRCLPPGDPRAGTVD
                     AFRVPRARRVHQPLWTAPLSCLSTAIHAVNALTREPDCRPASRHGAQFKYPHVVVTNG
                     PATGFVVCLVAHLLKLFYLVPEGRLKMVYVESWARSRSLSLTGRLFRRTGIADMFCVQ
                     HEDLARRTPGAVYVGRVAAPLAPPG"
     gene            complement(1137166..1138364)
                     /locus_tag="MYCTH_2311679"
                     /db_xref="GeneID:11506860"
     mRNA            complement(join(1137166..1137818,1137939..1138364))
                     /locus_tag="MYCTH_2311679"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666683.1"
                     /db_xref="GeneID:11506860"
     CDS             complement(join(1137488..1137818,1137939..1138330))
                     /locus_tag="MYCTH_2311679"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666731.1"
                     /db_xref="GeneID:11506860"
                     /db_xref="JGIDB:Spoth2_2311679"
                     /translation="MVRGRQFRAARVLETAEAQLSSSIVSSKPNVAAPWVRALRYIPP
                     AEVLTRPYPIQHTEPKDRGRALHRPRNLFRPTRIVHPEDELRADFYRDHPWELARPKL
                     VLELDGKDARYRDWSKGLRQPGMVLSGESVVQRQLWLMENRGLSKARAYDIARKEFYK
                     LRQMEQIERRIAVEEARMYGAYFGKTDLQVGMELEDAAYENWKKWATEEIAKLEAERT
                     AAYNNVVDAPEEKSLLDDDADL"
     gene            1138911..1141279
                     /locus_tag="MYCTH_2311680"
                     /db_xref="GeneID:11506861"
     mRNA            1138911..1141279
                     /locus_tag="MYCTH_2311680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666684.1"
                     /db_xref="GeneID:11506861"
     CDS             1139155..1141155
                     /locus_tag="MYCTH_2311680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666732.1"
                     /db_xref="GeneID:11506861"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Spoth2_2311680"
                     /translation="MRVSSRIDGSICGAILFLHRPSLSSNRSAAAASLPTSAHSLGGG
                     PVQGFRGGCCTAWRRPITFLASSSRSLAPQHRSGLNPSTPRVSTTTPLGSLPRPSIIP
                     EATATTTTSTTTRANHTAAAAETSPDLELDDDNDNNNNNNNNNKADPPQPQSPPAKLK
                     RRPSYTQKELLALVDPYDDEEIGAVEDYLQYLRDPYMRGYAQPDVPKFSFARTAEDFE
                     YPTLEQVIEAGEEEQKILWELRFAVLNRLRSPHKVDLDHIYEIYRRLPEPRMLYIHAR
                     FRHQLLRALGQPDERDTRSMLRYFEVIADVKNTGIPLTTAEWNCAIAFASKYVGTVTE
                     TEVETALKLWREMEVEAGIKATNVTFNILFDVACKAGNFTLAEMIYREMESRGHYYNR
                     YHYTSLIHFFGLKHETGGMRAAYREMVKAGEMIDTVVLNAMIGGLLRSGEEAPAERLY
                     ERMKAATLSSGSSSGSSSSSSSDEGGGGGGGGDNTPLPVRTPPSDRAITQALLMFAKI
                     ARRHPASRAALQRMAPLSPDLQTFRILVNHYGVKRGDLAKTAAFLDEMKLFRIPLHHA
                     IFLALFKAFAHHGGYPRSPWSERRLTGIWNALLDAVDAGAAGIEIKTWLAVWALRAFA
                     RCSTRQRVLDVYDALKARWTLNEADEQFMIDFLSSLLNNNNK"
     gene            complement(<1143403..>1144012)
                     /locus_tag="MYCTH_2071219"
                     /db_xref="GeneID:11506862"
     mRNA            complement(join(<1143403..1143786,1143851..>1144012))
                     /locus_tag="MYCTH_2071219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666685.1"
                     /db_xref="GeneID:11506862"
     CDS             complement(join(1143403..1143786,1143851..1144012))
                     /locus_tag="MYCTH_2071219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666733.1"
                     /db_xref="GeneID:11506862"
                     /db_xref="JGIDB:Spoth2_2071219"
                     /translation="MAGPAADLSRGPVLLSFSLATASFAMATTFVRFYVRRSLYGGFG
                     TDDYVSGAATLVALIATILGILEATAASGERAVQFDVAGRPWYLISATLSKISICLFF
                     LRVLGRARQWRTLLAALIAIMAIITLAFTLFTYLQCRPLEKVWKPFVTGSCLDASIRM
                     NFAYAQSGRSFSLGLSRQTLD"
     gene            complement(1145635..1147363)
                     /locus_tag="MYCTH_2311684"
                     /db_xref="GeneID:11506863"
     mRNA            complement(join(1145635..1146619,1146717..1147363))
                     /locus_tag="MYCTH_2311684"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666686.1"
                     /db_xref="GeneID:11506863"
     CDS             complement(join(1145722..1146619,1146717..1147210))
                     /locus_tag="MYCTH_2311684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666734.1"
                     /db_xref="GeneID:11506863"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR013751"
                     /db_xref="JGIDB:Spoth2_2311684"
                     /translation="MAPKQKQPCYVLGVGMTKFIKPRGKVDYTELGYEAGIKAMLDAQ
                     ISYDDVEQGIACYCYGDSTCGQRVFYQFGMTQIPIYNVNNNCSTGSTGLAMARNLISA
                     GAADCVLVVGFEKMMPGSLQTFFNDRESPLGTTYAMMAKTRGLSKAPGAAQMFGNAGR
                     EYMEKYGAKAEDFAEIARINHAHSVNNPYSQFRDVYTLEQILASPKIHEPLTKLQCCP
                     TSDGGAAAVLVSQAFLDARPHLRDQAVLVAGQCLATDAPSLFSGSAIDLVGREMTTRA
                     AAAAMAEAGVTPSDVAVCELHDCFSANEMCLLDALGFAEPGRAHELVRSGGITYGPGR
                     KVLVNPSGGLISKGHPLGATGIAQCAELVWHLRGWANNRAVPGTKYALQHNLGLGGAA
                     VVTVYRRADGREAPVLDSAAVGRINKQGYNPAVEARGFTAEEANRVRSKHKTNDFAFT
                     ATLPMMKAAQAKV"
     gene            complement(1148023..1149428)
                     /locus_tag="MYCTH_2311687"
                     /db_xref="GeneID:11506864"
     mRNA            complement(join(1148023..1148281,1148402..1148785,
                     1149111..1149428))
                     /locus_tag="MYCTH_2311687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666687.1"
                     /db_xref="GeneID:11506864"
     CDS             complement(join(1148145..1148281,1148402..1148785,
                     1149111..1149285))
                     /locus_tag="MYCTH_2311687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666735.1"
                     /db_xref="GeneID:11506864"
                     /db_xref="JGIDB:Spoth2_2311687"
                     /translation="MRFAALLTGFLAAAQAEKNYFFRYSGGNDIIDHQRLRSNISIQH
                     TSPGVTLPPYNPKDHFMRLYPNATAHPPAVALVIVPTNPHPPPVPGYYGLSDREGVPD
                     AYRLVYSYRLDEEGPGFKYAGWRLRPAGPGSEPGTLRLRYPIGEGRAAAGEEEEEEEE
                     EEGKGGHGKWRWIAVKEKDGDGDYDKWVPWYVKRCAANGAVLATWDYVNVDLELVEAK
                     GAVNSSAPGGVNE"
     gene            complement(<1150144..1152293)
                     /locus_tag="MYCTH_2097168"
                     /db_xref="GeneID:11506865"
     mRNA            complement(join(<1150144..1150427,1150579..1151379,
                     1151463..1152293))
                     /locus_tag="MYCTH_2097168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666688.1"
                     /db_xref="GeneID:11506865"
     CDS             complement(join(1150144..1150427,1150579..1151379,
                     1151463..1151796))
                     /locus_tag="MYCTH_2097168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666736.1"
                     /db_xref="GeneID:11506865"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Spoth2_2097168"
                     /translation="MQPQFFNVVNDELRSSSNIHRVTDPRTEEELWPCPIATTQDFED
                     AVAAAQEAFKTWSLTTVEERQALLVKLADVIRDNAEELASILMRETGKSKILADIDVQ
                     AGIAQALYYSQNALTDEVQHEDEHQKVVATHIPLGTVAAICPWNFPLILSNIKVVSAL
                     VTGNCVIVKPSPFTPYAVMKWAELSRGVLPPGVFQVLNAGADLGAAMTAHPGIAKISF
                     TGTIAVGKKVLAACAPTLKKVTLELAGNNACVVCPDADLDRAVPAVASGGFFNAGQVC
                     VASKRIYVHESIYDEFLERLVREVETNFAIQEDGQAPSVFGPLDNKAQYEVVKGIIED
                     CKSRGYNVVTGGQTDKVRPKGFWLPPTIVSRPSEDSRLVQEEQFGPVLPILSWSDEDD
                     VIRRANLANAGLGASVYSSDLARAERIARRLETGSVWINQFERPNFAAYFGGIKDSGF
                     GGEMGKQGLLSYCYTKCLHYPK"
     gene            1153183..1158171
                     /locus_tag="MYCTH_2311689"
                     /db_xref="GeneID:11506866"
     mRNA            join(1153183..1153719,1153799..1156003,1156055..1158171)
                     /locus_tag="MYCTH_2311689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666689.1"
                     /db_xref="GeneID:11506866"
     CDS             join(1153538..1153719,1153799..1156003,1156055..1157789)
                     /locus_tag="MYCTH_2311689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666737.1"
                     /db_xref="GeneID:11506866"
                     /db_xref="InterPro:IPR000674"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR002346"
                     /db_xref="InterPro:IPR002888"
                     /db_xref="InterPro:IPR005107"
                     /db_xref="InterPro:IPR008274"
                     /db_xref="JGIDB:Spoth2_2311689"
                     /translation="MTPSAVLPQQPAKVPPGALTTDFDDTIRFYLNGTRVVLDDIDPE
                     VTLLEYLRGIGLTGTKLGCSEGGCGACTVVVSQYNPTTKRIYHASVNACLAPLASIDG
                     KHVITVEGIGNVQRPHPAQERIAKGNGSQCGFCTPGIVMSLYALLRNNDAPTEHDIEE
                     AFDGNLCRCTGYRPILDAAQTFSVRKGAGAVNGCGNAKANGGSGCCMENGNGGGCCKD
                     GKVDGVDDQPIKRFTPPGFIEYKPDTELIFPPALKKHAFKPLAFGNKRKKWFRPVTLD
                     QLLEIKSVYPDSKIIGGSTETQIEIKFKAMQYPVSVYVGDIPELRQYSLNEDHLEIGG
                     NITLTDLEGVCQEALKHYGEARGQIFKAIHKQLKYFAGRQIRNVGTPAGNLVTASPIS
                     DLNPVFMAADAVLVAKTLEKDIEIPMADFFKDYRRTALPADAVLASIRIPLTQEKNEF
                     FRAYKQAKRKDDDIAIVTSALRVRLSLDGVVEQANLVYGGMAPTTVAAKQANSYLIGR
                     KFAELETLEGAMNALGRDFDLQFSVPGGMASYRKSLALGFFYRFYHEVMQSLGADADA
                     EAVPELERDISTGKEDHTVAAAYMQETVGKSNPHVAALKQVTGEAQYTDDIPPLKNEL
                     YGCLVLSTKAHAKLKSVDFTPALEIPGVVDYVDKNDMPSARANRWGAPHFQETFFAED
                     EVYTAGQPIGLILATSAARAAEGARAVKIEYEELPAIFTIEEAIEKESFFEYFREIKK
                     GDPEEAFKKCDYVFTGTARMGGQEHFYLETNASVVIPKPEDGEMEIWSSTQNPNEAQA
                     YAAQVCNVQSNKIVVRVKRMGGGFGGKETRSIQLSSILALAAKKTRRPVRCMLTREED
                     IVTSGQRHPFLGKWKVGVNKDGKIQALDLDVFNNAGWSWDLSAAVCERAMTHADGCYM
                     IPNIHVRGRICKTNTVSNTAFRGFGGPQGMFIAETYMSEVADRLGMPVEKFREINMYK
                     PEELTHFNQPLTDWHVPLMYKQVQEEADYANRREAITKFNAEHKWRKRGLALIPTKFG
                     ISFTALWFNQAGALVHIYHDGSVLVAHGGTEMGQGLHTKMTMIAAQALNVPMEDVYIS
                     ETATNTVANASATAASASSDLNGYAIYNACAQLNERLAPYRAKLGPKATMKELAHAAY
                     FDRVNLSAQGFYKTPEIGYTWGENKGKMFFYFTQGVTAAEVEIDTLTGSWTCLRADVK
                     MDVGQSINPAIDYGQIQGAFVQGMGLFTMEESLWLRNGPLKGNLFTRGPGAYKIPSFR
                     DIPQVWNVSILKDVEWKDLRTIQRSRGVGEPPLFMGSAVFFAIRDALKAARAQYGVEA
                     KVGVDSKGEDGDGLLRLESPATPERIRLACVDPIVEKARVKAKEGEMSFFIAI"
     gene            complement(<1158192..>1164448)
                     /locus_tag="MYCTH_117495"
                     /db_xref="GeneID:11506867"
     mRNA            complement(join(<1158192..1158404,1158480..1158655,
                     1159324..1159706,1159789..1159916,1159979..1160686,
                     1160738..1160878,1160949..1161415,1161685..1161734,
                     1162405..1162592,1162651..1163381,1163446..1163788,
                     1164171..1164193,1164298..>1164448))
                     /locus_tag="MYCTH_117495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666690.1"
                     /db_xref="GeneID:11506867"
     CDS             complement(join(1158192..1158404,1158480..1158655,
                     1159324..1159706,1159789..1159916,1159979..1160686,
                     1160738..1160878,1160949..1161415,1161685..1161734,
                     1162405..1162592,1162651..1163381,1163446..1163788,
                     1164171..1164193,1164298..1164448))
                     /locus_tag="MYCTH_117495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666738.1"
                     /db_xref="GeneID:11506867"
                     /db_xref="InterPro:IPR013940"
                     /db_xref="JGIDB:Spoth2_117495"
                     /translation="MTATESVKRTSGKEDKAPSKPESESKANQQHAPAADNAHRTPKK
                     RRKVNHACLYCRRSERPCTRCIKRNIGHLCHDEPRDHDSKKSKNLAPSTAQESGSQQS
                     DLGQSALNQNAGAMRPPSFDSAMGNGPGQANKAGSFDAAALASRSGNPLQLVQPTPVS
                     GMAANSLGGMGQFPSLSDAWLASQNPYHDMHNFHSNYVISPEVTNEFNLLNDFLQTSL
                     LDDTAILADDQNQADTASGFPSSSNTMLAPSAAQGSSASAPNAEQGKAISRPASVLPA
                     DKTRAYYLQAADPSGNAPEERMRQVLQAKYEAGLLKPFNYIKGYTRLQNYLASHVSAS
                     SKQKILRQLDRFRPKFREKIKDLTDMDLVLVEMWFERTLMDYDRVFASMAVPACCWRR
                     TGEIFRGNKEMAELIKVPVEDLRGGKIALHEILTEESNVRYWEEFGTIAFDPAHDTLL
                     TACSLKSPQGGKPVNCCFSFRIRRDEHKIHSSQSATKSQKIEAAVEFAVRLRKILLSA
                     TTTPDEHDAILLADAPSLIQDAGEHVSQLHVCQQTYVPGVSGDPEIDELATGLWNVCT
                     RLGRALKDDLGDKEDESAEEGGGGGVVEGRDGQGNAEGIRRLGRLYLYGRVLAFHLLG
                     IARPREKGRAGVIVRLMKLGLKVVRDCLKIAGQVVQTTADYKEWLQDMSKNLPDDEAR
                     ECQCLEVEYFIMRTAMCWVENRLDVAEHMYSKAERFRPFLTPAYAERLADVLYEIGKS
                     LSDRSDFTIAVKWFERASDVINSQELEHLSREGLELRLAILQALVTALLGSNTTDGFE
                     KAENYVNLIEAEAGNNFVVSLLKLELLRKSPSEVFDSEAYGDVLRHIIRNFAFSESAF
                     KLIMHHIRKLHDKSPGSGCALLDDFIMTLGNAEKDEWMEKAVVTRMWMITNQRDSVET
                     INAVQNVLGCLGKPLGPEAALLWKKLESNYSQGNYDMAENWCHLSLHDSFRNCGAANR
                     SKLESLDAAASIIHGMSPQSRKEPMTAYLSFKVAVRIEDRALAEDCLETVTQAPDHVD
                     YLGACIAESQKAGDIVCAIAALKKLQEKYEYTEPNPIHLPALFRCTIRLLNLLAERPG
                     VDIDSIVSDLCESFESVLYSTMRKIVNEIWALERFDAVKLAKYTRCLFQATLPLDDGL
                     AMNLLDEACSKAKELRESKASWPEEELEWMATTSFNHAIDCYSAHQAERAKEWATKAI
                     NLAHYCNDGRLEEILQNKYLRLNLDGDSR"
     gene            1167405..1169150
                     /locus_tag="MYCTH_2311696"
                     /db_xref="GeneID:11506868"
     mRNA            1167405..1169150
                     /locus_tag="MYCTH_2311696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666691.1"
                     /db_xref="GeneID:11506868"
     CDS             1167647..1169080
                     /locus_tag="MYCTH_2311696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666739.1"
                     /db_xref="GeneID:11506868"
                     /db_xref="InterPro:IPR001293"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2311696"
                     /translation="MAPPPNTPDEGLTVTFRVSVDDELFRVSSPHPSSAMADTSQNGS
                     CVIKLDYQALEYIDPVDETLLCPVCKTPFYSPITTPCGHTFCAGCINRALETQPTCPI
                     DRQPINKTRDYRRLPLIVKDQLDRLKVKCPNKGCDHQCPRELLEAHYERRCEFSLVRC
                     PDSNCTQLIARRDASPAKGCLHIDVVCEFCEKKTTFAELDGHHNFECDGAIVECPDCG
                     RGIVRHTLVHHRTQECLEGHAQCKWHTAGCKVAGKRGVVQEHEQSGECSFEVLGRLIE
                     KQAEDRKIINELSERLARFEAAQARRREPRVTQLSARGGLSPVAGSSRSAAASNAPDI
                     TLNNNVPVSLDPADDGATGGSPEDYMLAQFERLETQLELLRQQSIDMDARQSHLILQH
                     ATHFSEQLAEIGNKVGIVNMHMSWLMSLQRQQRAGSTAGSSSNAGLSQGTGNGSVRPA
                     SSDDSSVQYPGDNRRHSEGRGESLHRL"
     gene            1169626..1173677
                     /locus_tag="MYCTH_2311698"
                     /db_xref="GeneID:11506869"
     mRNA            join(1169626..1170673,1170732..1170945,1170997..1172396,
                     1172457..1173677)
                     /locus_tag="MYCTH_2311698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666692.1"
                     /db_xref="GeneID:11506869"
     CDS             join(1169865..1170673,1170732..1170945,1170997..1172396,
                     1172457..1173336)
                     /locus_tag="MYCTH_2311698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666740.1"
                     /db_xref="GeneID:11506869"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="JGIDB:Spoth2_2311698"
                     /translation="MDPNEQQPQPPPPATSTPDAPDRETMERIRRRRLEKLGGSPGSS
                     TPAASSPSTETPPAAARQSTSKPADGKLVSKEAEKPAPGDSRPKINVSPAPAPGTPHS
                     TGSASSSRPGSANNAGSRAKRQASDVDEPSASAPPKKQTTPAAQETIEDYADRVLSNI
                     FRCTVDPNRTTDSQGHKLAFLPNLSAELAEEGSPLKLTTGRLEEAIMEAATAVPHDRP
                     LLDYLLPCWKRVVRTLKVLRGPAPEKEALLKEARRLCFSNCIFALTVPELFSREPNAL
                     HDTLVPYLLREVESEDGLCLDFFAEAVARIEDDDSIAPLFTKAMADISAKLATMSMND
                     DYKPCVNALLTYSRFPPLLNALAQHPCFQMAQSAPGIEKNTILGPFFRISPLQPEVTT
                     VYFAGPRTMDKGRIQTSQNALQMTLGAHQADLKTIINAFIRASPEARNKTLDWFAYIM
                     NTNHKRRAMQVDPNEVSSDGFMINVTVILDTLCEPFMDSTFSKVGRIDVDYFRRNPRV
                     DIRDETKLNADQAQSDAFYANKLEGESNFITEIFFLTLAAHHYGSEAANSKLKTLDRN
                     IKHFEKNLAMMEAERQKLVNRPDQLRILDAAIQRHTSVLERSMAMKYSIEGILLEQKM
                     QSRSLQFMRYVAIWLLRVASQTEYTPDKPLKLPLPANQPEAFKCLPEYALQDVVDNFK
                     FVFRYIPQIILSAVGDEMIALCITFLESSEYIRNPYLKSSLVTLLSHGTWPTYHLKKG
                     VLGDLMTNTKFANDYLLHAIMKFYIECESTGAHTAFYDKFNIRYEIFMVIKCIWTNDV
                     YRQQLVQSSKSNRAFFVRFVNLLMNDATYVLDEGLGKFPKIHDLQARLRDPTLSQEDR
                     EKAEEELRTAEGQATSYMQLANETVSMMKLFTTTITEAFTMPEIVQRLAGMLDYNLET
                     LTGPKSKMLKVDNPEKYFFNPKTLLPELVDIYLNLGSSTSFIEAVAADGRSYKPSTMI
                     TTAQILRNKHLKDEKDIRAWEALSAKIESAKEALDRADMDYDDAPPEFEDPIMGILMT
                     DPVRLPSRHVVDRSTITQHLLSDPKDPYTRQPMTIEDVVPDVELKERIEAWKAERRRA
                     KAMGDDAMDTTE"
     gene            1174647..1176323
                     /locus_tag="MYCTH_2311703"
                     /db_xref="GeneID:11506870"
     mRNA            join(1174647..1174898,1174967..1174987,1175111..1175341,
                     1175498..1176323)
                     /locus_tag="MYCTH_2311703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666693.1"
                     /db_xref="GeneID:11506870"
     CDS             join(1174877..1174898,1174967..1174987,1175111..1175341,
                     1175498..1176258)
                     /locus_tag="MYCTH_2311703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666741.1"
                     /db_xref="GeneID:11506870"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="JGIDB:Spoth2_2311703"
                     /translation="MTKVLLTGGSGFIAAHILEQLLAKGHSVVTTVRSEEKAAKIREA
                     YPEKVASGDLVTAIVPDIAQPNAFDEVVKTPDLEVVLHTASPFHFKFSDPKELLDPAV
                     IGTTSILRAVAASAPTVRRVVVTSSFAAIVDEAHVRDPSHTFTERSWNPVTLDEVHKH
                     PSTAYRASKTFAERAAWDFVKDPANGARFDLVTVNPPMVFGPVVHYLASLDAINTSNE
                     RMVDCLRGKWREEVPSAGPVVIWVDVRDVAEAHIKAGLEIPEAGGKRLFVTAGLFSNA
                     ELARIARKNFPEDADRLPTEQTKGGELPAENERFRFDNSETNKLLGIKYRSLEESVVD
                     TIKSLKKYGA"
     gene            complement(<1176389..>1177654)
                     /locus_tag="MYCTH_2071028"
                     /db_xref="GeneID:11506871"
     mRNA            complement(join(<1176389..1176710,1176852..>1177654))
                     /locus_tag="MYCTH_2071028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666694.1"
                     /db_xref="GeneID:11506871"
     CDS             complement(join(1176389..1176710,1176852..1177654))
                     /locus_tag="MYCTH_2071028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666742.1"
                     /db_xref="GeneID:11506871"
                     /db_xref="JGIDB:Spoth2_2071028"
                     /translation="MNRSIEQTLLSLLPTHNSALPQPLTDLASSLLAQSRNRASTLKA
                     EEEVARLYACAHLACDRLKVALDLPPIEPRPPIPPRIYKRLYNHLDKILPASASTPGR
                     HTPSGTPLGSGRIRTPSAKIREQQQQQQQQQLLLNGSPLASKSRTTPSKERSLSDLRA
                     RAGAAATPSKDRTLSSAGGGGGGPPKQRRDDALPPWIRPALRYLLTKLGPAHIGPVVA
                     SGLESVVAPRGRLTDDGWVRAHLVAVLGALYLFVWRGVVWPAGREVERERGWEGWEEP
                     SVREFDAAAVRGARHGWFDMDWVDGVRDLADREEDKRRRAEGGDDGGEGEGEEVVVTQ
                     IRRPDTMFQERYDYLSERKRKAYAEWKEGLLKRIKELEAR"
     gene            1178068..1180979
                     /locus_tag="MYCTH_2311706"
                     /db_xref="GeneID:11506872"
     mRNA            join(1178068..1178172,1178242..1178893,1178963..1180389,
                     1180463..1180979)
                     /locus_tag="MYCTH_2311706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666695.1"
                     /db_xref="GeneID:11506872"
     CDS             join(1178581..1178893,1178963..1180389,1180463..1180963)
                     /locus_tag="MYCTH_2311706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666743.1"
                     /db_xref="GeneID:11506872"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2311706"
                     /translation="MANPLMRRSYAALMAPPLAPFPGLRSMSTYQPSRVQQFPWIKFQ
                     QPSRGFQSRSFGTGGIPRDLLANREAAANRNPHSATAQNSFYQLLLKANMPAIVVERY
                     QSGRFATNEAADEAYQRALAMINGTAGPAASGDAAANASSGLSSSKLQAVGQAVAAHR
                     SGSNMAFSTGSNGSKNGPLHVIVDETFGTAALRWIKFLLWFGLCAYLSLVLVTMVVEG
                     MTSLKRPSKVDGIDPKAENQKARFSDVHGCDEAKEELQELVEFLRNPEKFSNLGGKLP
                     KGVLLVGPPGTGKTLLARAVAGEAGVPFFYMSGSEFDEIYVGVGAKRVRELFNAAKAK
                     APSIVFIDELDAIGGRRNSRDATYVRQTLNQLLTEMDGFAQNSGVIILGATNFPESLD
                     KALTRPGRFDRHVHVSLPDVRGRIAILKHHAKKIKIGSDVNIAAIAARTSGLSGAELE
                     NIVNQAAVHASKEKAKAVMQAHFEWAKDKVIMGAEKRSMVITPKEKEMTAYHEAGHAL
                     VAYYSKDTAGELYKVTVLPRGQSLGHTAFLPTMDKYSYSVRDYLGLIDRAMGGKVAEE
                     IVYGNEFVTSGVSQDLDSATRTAWQMVAQLGMSERLGPVEYLRDYERLSSETRAMVEA
                     EVKKVLDESYARARALLVSKRAELDLLAKALVEYETLDRAEVEKVLRGEKLEGRISVP
                     PGPMAVPKPQKSIEPGLPMPPLSGGDDGESAGPGSPPPPAPPPAPARQITVLGTGEVG
                     NGERDE"
     gene            complement(1181315..1183073)
                     /locus_tag="MYCTH_2311708"
                     /db_xref="GeneID:11506951"
     mRNA            complement(join(1181315..1182261,1182475..1183073))
                     /locus_tag="MYCTH_2311708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666696.1"
                     /db_xref="GeneID:11506951"
     CDS             complement(join(1181422..1182261,1182475..1182570))
                     /locus_tag="MYCTH_2311708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666744.1"
                     /db_xref="GeneID:11506951"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="JGIDB:Spoth2_2311708"
                     /translation="MATSTTGLIPNWFPPNRENYDFILSIWKWMPVVASLQWVIPWYG
                     MGKTSVDSRLNLPGRVGWLTMEAPGFLTLLYTMGTLSAQVEGWEGEVEGAGAAVPYEN
                     KVLAFLFVLHYAYRALLFPFLQPSMSPIHPVVWLSAVAFQLTNGLAIGAWLGGYGPTT
                     RAAWAAQLRLGTPQFAAGLAVFYLGLAANYYHDDELREIRRRAARRAREAARKDGPPR
                     KNKTAGTVVVDKHYEIPQAGLFKVMLYPHYFCEWVEWFGFWMAAGWGCLPARCFLFNE
                     IAAMLPRAVRGRKWYAEKFGEDKVRGRWAVIPGVC"
     gene            complement(1183075..1186971)
                     /locus_tag="MYCTH_2311710"
                     /db_xref="GeneID:11506952"
     mRNA            complement(1183075..1186971)
                     /locus_tag="MYCTH_2311710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666697.1"
                     /db_xref="GeneID:11506952"
     CDS             complement(1183469..1186471)
                     /locus_tag="MYCTH_2311710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666745.1"
                     /db_xref="GeneID:11506952"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="JGIDB:Spoth2_2311710"
                     /translation="MVTRKPLPQSAALDPTVPQQQQAQDASAPSSTENDAIWGNGDEQ
                     YQGQQSTTKPEAGIPGSSKHGATVASSDLGNEGTIWAEGASTLNTVDVSQVPAVLRPG
                     DSHGVQASTAQGGTSETSQDTPPGPAVLLPGGGSRPETNPFKRKMSLSASGTSQGQPA
                     TSSSIPPVPSVPVADFSQLSINDSSTSPWQPALDGGKDVTWPVPRMEEQDSIAGNVWD
                     SAVPSSQPTPRLGSNSLAFTSPPSEDASAGWSEEAKGQPPPRPLITTADDGVLDDTNV
                     WDDLKLSDKGKDVSQPPAIPSNGPAGTDDWNLIDMEPEPEPLSRQSTWENFKDEDTAG
                     KEAPAIEARSEEAPKLPPRNTAERPPAAPPRPVDKSETYQIKNINWHDESAAKNPRTS
                     PILVQNANGPCPLVALVNALVLTTPADKTNTALVETLKSREQVSLGLLLDAVFDELMS
                     ERRAQPDVPLPDVTELYEFLKGLHTGMNVNPRFIPTPEVVSAFKRTSLTYLHPTERAD
                     MIPGTFEHTREMALYSTFSIPLIHGWLPSKDDAAYDAFSRQAGSYEDAQNLLFREEEL
                     EEKLCNSEQGLTPEEQQIYQDVLSIKSFLSISATQLTKFGLEVIKQAMKPGSVAILFR
                     NDHFSTLYRHPQTLELLTLVTDAGYAGHAEVVWESLVDVNGERTEFFSGDFRPVGGAP
                     QGQPGPSRDAVPDHWADAADTDNDGWDTVQTRHGPTVRQGASTEGPLSAKHEQEDRDL
                     ALALQLQEEEDERARAERRRRESLLSEQYIEQQGGGGGGVGQRGGASRGSAGRGGVGG
                     GRHASYSSPSLSSPANAPLAGGRRPTPAQPRLASASTTTHSVSGNISGTGSSDRPRPT
                     TQTVRSLLPPRSSSTAATSTTTVPQTTRMTHRPADQELEEAPPSYEQAARQQPYIPPA
                     GHPAHPGSTNAGAGSTATAAGGRPQPQQEGIGPGGRSGPGRYQYPGADGRGGSQPPAG
                     YRRGVPPPAGSPMPVSGGSGRDRDCVVM"
     gene            complement(1187823..1189535)
                     /locus_tag="MYCTH_2311711"
                     /db_xref="GeneID:11506953"
     mRNA            complement(join(1187823..1188490,1188565..1189535))
                     /locus_tag="MYCTH_2311711"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666698.1"
                     /db_xref="GeneID:11506953"
     CDS             complement(join(1187952..1188490,1188565..1189105))
                     /locus_tag="MYCTH_2311711"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666746.1"
                     /db_xref="GeneID:11506953"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR015399"
                     /db_xref="JGIDB:Spoth2_2311711"
                     /translation="MPDASASGASSSQNDASARNRREHNQGNQERKYTAEQKAAVLRI
                     RRCHPTAFYEILELQKTCTDSEIKKAYRKLSLLTHPDKNGHEHADEAFKMVSRAFSVL
                     GDKEKREKYDRYGTDPDSRFASAQAQAAENPFAGFSGRRAAGGGGGGGTGGGWGAEEI
                     SPEEMFARFFGGGGFGGPFAGFDGGPQFVFNFGGPGVRVHQFGGPRPRGRPRNPGQEE
                     PPSVWSNLVGYLPIILLLFWPVISSIFSGVFSSTPSTPSMVFDEPHPPLYTMERTMPH
                     FKVKYYLNPADVHSYSQSKLSSLDKKAEVVLVQQLRLKCDNEMAHKQQLRNAAQGWFF
                     QDPEKMELANTYDMPACRRLNSLGV"
     gene            1189689..1190651
                     /locus_tag="MYCTH_2311713"
                     /db_xref="GeneID:11506954"
     mRNA            join(1189689..1189907,1190154..1190651)
                     /locus_tag="MYCTH_2311713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666699.1"
                     /db_xref="GeneID:11506954"
     CDS             join(1189841..1189907,1190154..1190521)
                     /locus_tag="MYCTH_2311713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666747.1"
                     /db_xref="GeneID:11506954"
                     /db_xref="JGIDB:Spoth2_2311713"
                     /translation="MAPTDKDAEPRVTVGSQLRAWGTSAIPPMTLTTLIIALHARPLQ
                     PLPLLFPPLLVFSSYLTLAGFQTDGAGMTAAWSGVYALLAARRRPASLRSRFSLRGVV
                     RGAAVGLGVANTVAGLYTYATGDRKKEEEERRELNRWGVYKD"
     gene            complement(1191602..1192671)
                     /locus_tag="MYCTH_2311715"
                     /db_xref="GeneID:11506955"
     mRNA            complement(join(1191602..1191911,1191968..1192671))
                     /locus_tag="MYCTH_2311715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666700.1"
                     /db_xref="GeneID:11506955"
     CDS             complement(join(1191701..1191911,1191968..1192434))
                     /locus_tag="MYCTH_2311715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666748.1"
                     /db_xref="GeneID:11506955"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="JGIDB:Spoth2_2311715"
                     /translation="MTSGEKVVSKRSARHYVEYDMEEQIEDCHEKRLVRTEETRSNGR
                     DRQSPTSTSTAAQSSQSSLEPSPVIHPENLQLEADTLDSALPGRDNVGFRDAFHPPTG
                     QQQFPYSIHELEKSLPTESRPANFGIVVPGVYRSSFPQSEDYAFIEGLKLKTIVTLVQ
                     KESPQGYDDFLHRNGIKHAVFDMKGTKKEAIPVATMKSILRIVLDRRNHPLLIHCNHG
                     KVSAGVP"
     gene            complement(1195006..1196439)
                     /locus_tag="MYCTH_2311719"
                     /db_xref="GeneID:11506956"
     mRNA            complement(join(1195006..1195639,1195783..1196113,
                     1196200..1196439))
                     /locus_tag="MYCTH_2311719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666701.1"
                     /db_xref="GeneID:11506956"
     CDS             complement(join(1195183..1195639,1195783..1196113,
                     1196200..1196326))
                     /locus_tag="MYCTH_2311719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666749.1"
                     /db_xref="GeneID:11506956"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2311719"
                     /translation="MSDRAKRRVEAIGNQLSGSSIPAIHKVAPSGPRVAGKVVIVTGA
                     NSVLGIGRASAHQFAEHGARAVYLCDYDDSNLEAHKREINSLWPKVDVHTRKFDAADE
                     KAVKEVVDDALARYGRLDVFFANAGIVGPHAVFTDIDADDFMNVLRVNSLSVFLAAKH
                     AAPAMQKTSADKPKPSGSIIATASVAGLRSNAGSTPYSASKAAVVSMAQTVAYQLAGT
                     GVRVNALCPGLIETGMTAVVFDAARARGTDGKIGQLNPLKRAGHADEIARVALFLGSD
                     ESSYVNGQAWAVDGGLSAGHPYVRGRLG"
     gene            complement(<1198922..>1199766)
                     /locus_tag="MYCTH_2130669"
                     /db_xref="GeneID:11506957"
     mRNA            complement(join(<1198922..1198985,1199039..1199286,
                     1199456..1199589,1199712..>1199766))
                     /locus_tag="MYCTH_2130669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666702.1"
                     /db_xref="GeneID:11506957"
     CDS             complement(join(1198922..1198985,1199039..1199286,
                     1199456..1199589,1199712..1199766))
                     /locus_tag="MYCTH_2130669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666750.1"
                     /db_xref="GeneID:11506957"
                     /db_xref="JGIDB:Spoth2_2130669"
                     /translation="MRDILNFKVGGALGHGGANKSALQHHEGAPSNTPPDGGPTRGGV
                     KRSPPNTAPRIKYNGDTWDYISFSLRARRDTRVTRPLHLPVQPHDFFSLKRQREEWGA
                     LRRPPATFHLPGTRQETERTKKTPSCKCPHQAPLMPFFVVVIFRERRLQVTSIPVTSS
                     RPGTAR"
     gene            <1200043..>1202665
                     /locus_tag="MYCTH_2113417"
                     /db_xref="GeneID:11506958"
     mRNA            join(<1200043..1200337,1200389..1200422,1200479..1201973,
                     1202207..>1202665)
                     /locus_tag="MYCTH_2113417"
                     /product="uncharacterized protein"
                     /note="Has EST support. very weak"
                     /transcript_id="XM_003666703.1"
                     /db_xref="GeneID:11506958"
     CDS             join(1200043..1200337,1200389..1200422,1200479..1201973,
                     1202207..1202665)
                     /locus_tag="MYCTH_2113417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666751.1"
                     /db_xref="GeneID:11506958"
                     /db_xref="JGIDB:Spoth2_2113417"
                     /translation="MGQTKENAKTDGGVGCPCYVNAAEIQQAKQSDAHECLANCRAQF
                     LRGVLNGWEGSNGWAEGCGSLNRGVAAQEFWSLYWCDSTFCGVAIDLDGGLGQDPSVD
                     LIINTCQNIGFYSIFNPGPPPPGFKCSTEADDMSSICSATVMSASQATPGRQPDPAVP
                     ATSASMTKLTTTTTTAQPSSTLVIQASHSESASSVATASPAPSAASTTSGTNITGQGR
                     AAIAVCSALALMLLVCFAFVWLRRRKQRKESFDRALRSRHDHLPGAGLAGSPTPLISP
                     VGLAVGTRGALTPPLRLRDRKFLPSILRPGSRSPSPPLTPLTPAYTPQLSGGGGGSGG
                     NGGGGSAGVGAVSPSSPNCSLATNKVISRSEHRTGASTPRTDPADESASLLFTKAIPV
                     PGSTSGGNNSNRGSGRSASSSSSSSSYTADGDGYGRGCGWSDGGAQAMRPPRSRLGTS
                     TAMPSQPGTGQAPTETETGRGRHQRDATASPLPPPPPPPSRRLPLSPPYPPTPRSPSS
                     PCRPPRPHEGMLEIPGLVTPAGSASGHGDGCGGGSSGGGSGAGGNGKGDAPGFVKVVA
                     RRFVGDGSASTPPPPLSPPPSRTLPQTPKGAGMSLPPPSPSSDGWTSPPPRLLGTPSS
                     VPLAGNGTDMNAERSYHDHGRPPPSYPPDPGQFPPGDGAAGQSQRQPDSRESWGSWSG
                     TGTVVGSGSCHGDSVCRNADADADADVTARAGTEVVVSRRTSKSSNATATEDTMVSAV
                     SRTSNVGHGANTGCAESQAR"
     gene            <1203864..>1207019
                     /locus_tag="MYCTH_18938"
                     /db_xref="GeneID:11506959"
     mRNA            <1203864..>1207019
                     /locus_tag="MYCTH_18938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666704.1"
                     /db_xref="GeneID:11506959"
     CDS             <1203864..>1207019
                     /locus_tag="MYCTH_18938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666752.1"
                     /db_xref="GeneID:11506959"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_18938"
                     /translation="SSAAAPLERSISYQSATSIRSHRSTARARKRLTSQPPSSASSIA
                     ASDKSLTSFPSFSPDSPREERSYFFREDDDTTPVTSSRKTSGQSLAVPEQGDTKEPEQ
                     SKGGDGQGQQGNGHQERARPSAIVDHLTATAVVSPARGALFDDAPPPSRNIPGALHLA
                     DDEHIERLIARHGAVNLVRQIAEDLARRDAQISTLRRRADERERALRKIILECGLSSL
                     DLETRLRAVEQQAKANGASRRASGEGISDLVTDAMAEDMRHHPFSSHVFDDATIRSSS
                     VPLPVNTDAELPKGSARGWKDYLWGSSTVKKSGRADSLLREASKQPPAVVKATPAERR
                     PALQEDLFTPPQEDLPVRSPSRASSIGSSNASRKPSLASMALRLVAGGGSTARDGEAR
                     GRTSSAQSGAATRTPSSSSLNAGGSVRAASSQSSGPKALMAMRRPAGPVRPIDVPPPR
                     AFTQDRWDTMAPTPGGDQLASHHQNYGPVEMDTILPAEAQPPTLTQFYNNHVGADLLT
                     DRFGFIYDQRRKKRQREAAQMARHAKKNSRAEMVHGRNGLSPVVLEDNASGNVSVSSD
                     GRPDTPGSSEEPREEAKPKRWQDYLKIATFPTELLSHTPSISALGVEVLEASETPKSP
                     GQSPSIVSEDRGFLPSATTTTAAITPSDSEIQPVSESDQQQHRQQQPQQQSSPATLAK
                     EDAEPVRLLLENLNNLHDTLQREKTVRWNDFLRKVRAERKRDGEAAAAAAEARFQRAT
                     AVMPETRIGDGELIGVASLGIQGKIGRAKASEFRSLVLGGIPVAYRSKIWSECCGANA
                     LRIPGHYASLVARPETSDDPQVVAQIKADITRTLTDNIFFRKGPGVQKLHEVLLAYSR
                     RNPDVGYCQGMNLVVANLLLITPSAEDAFWILCSMVETILPPHYLDHSLLASRADQTV
                     LRQYVREVLPRLSAHFDALAIDLETMTFQWFLSLFTDCLSAEALFRVWDVVLCHPADA
                     GAFLFQVALALLKLNEAALLRCESPAAVYTYINHQMTNHAISIDGLVQASEALRRLVR
                     RDELQARRARAVEGERRAAQGR"
     gene            complement(<1208763..>1210073)
                     /locus_tag="MYCTH_2071270"
                     /db_xref="GeneID:11506960"
     mRNA            complement(join(<1208763..1209098,1209303..1209478,
                     1209581..>1210073))
                     /locus_tag="MYCTH_2071270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666705.1"
                     /db_xref="GeneID:11506960"
     CDS             complement(join(<1208763..1209098,1209303..1209478,
                     1209581..1210073))
                     /locus_tag="MYCTH_2071270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666753.1"
                     /db_xref="GeneID:11506960"
                     /db_xref="JGIDB:Spoth2_2071270"
                     /translation="MAKNHKRDLVTAEAVIGVAELGIIIFGFLYDVNDLRNAALVSKR
                     FYNAAQPYLWAAITIPCLCMHPRWRDQHAFWDRFSSFLKRNTLSLCVDMQKMAPNLYK
                     RFTAGNRRWESHARNSTRSVLKRGVDELFSGLRETLLRAERLRSFSARDVPRVLDLLI
                     LLQRHRAEIQCVNITASKHDTFGLLLLPAHDAPHWRQKVWLNPGLTVPLANSINLGLD
                     IGVAPYGLQWDPNHAMRSLCLQYKRAGGKPLGLRTLTLGYGFEIADNDLNRAITPAGV
                     PHYLAYLTNLKALEGLHLESLHDKNKSHLRRLSDRLGFSLISSVSAPYARCLTGLRKA
                     T"
     gene            complement(<1210458..>1212221)
                     /locus_tag="MYCTH_2071899"
                     /db_xref="GeneID:11506961"
     mRNA            complement(join(<1210458..1211306,1211451..1211660,
                     1211796..>1212221))
                     /locus_tag="MYCTH_2071899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666706.1"
                     /db_xref="GeneID:11506961"
     CDS             complement(join(1210458..1211306,1211451..1211660,
                     1211796..1212221))
                     /locus_tag="MYCTH_2071899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666754.1"
                     /db_xref="GeneID:11506961"
                     /db_xref="JGIDB:Spoth2_2071899"
                     /translation="MPTSTFPAEGDHPNHNPVVSLDPSNPLDPRPLIADILRTRYCVP
                     GSVFLVESVERCIPIPHPDEDGLRGDGDGSGAAAAAAARRRRRQSRRPERTVRLLLGD
                     GELCIQAFVRGEIHGFVDGGSVYEGCYVRLDRFSLGEEELRVVYLVVGDMVTVGWNEE
                     YLGILRREREEREERERREKREEREKREEREKREEREKRQEREKREKEMHSQRLMDVE
                     EGGQASSAVVADEAAKAHAPEISGTVSANPAERERPDESDYLSDSDSAFETLVVSAER
                     VTQRRIAVAAPPDPREELGAAIVKQNQEHGGENESPDHLQPRPHQPQPQSRLQPQQAK
                     PQAVTNPRPWLPTDARQLVKLTPLSQIPHLPYRQNWMVNVLAVVTSLSGVEPSYIGPS
                     FRQRTARLADMSTPKQVHLSVYLDPEEFTPAEGSVVLLLGVKNHLFEGGSLRKYVSDR
                     LASGQSWWVADPGELGWCRAGVERLRAWWREKQRENWGRGRGEG"
     gene            complement(1212719..1214432)
                     /locus_tag="MYCTH_2311723"
                     /db_xref="GeneID:11506962"
     mRNA            complement(join(1212719..1213353,1213417..1213979,
                     1214063..1214432))
                     /locus_tag="MYCTH_2311723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666707.1"
                     /db_xref="GeneID:11506962"
     CDS             complement(join(1213024..1213353,1213417..1213979,
                     1214063..1214183))
                     /locus_tag="MYCTH_2311723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666755.1"
                     /db_xref="GeneID:11506962"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="JGIDB:Spoth2_2311723"
                     /translation="MASVPPATIYPQSHVGFDSITSQIERKLLKRGFQFNIICVGQTG
                     LGKSTLINTIFASHLIESKGRLKPDETIRSTTEIQSVSHIIEENGVRLRLNIVDTPGY
                     GDLINNDRCWDPIVKYIKDQHSAYLRKELTAQRERYIQDTRIHCCLFFIQPSGHSLKP
                     IDIVVLKKLSDVVNVVPVIAKADTLTLEERQAFKQRIKEEFAFHNLKMYPYDNDEFDE
                     EERAINTQIKNLIPFAVVGSEKSIIVNGKQVRGRQNRWGVINVEDENHCEFVYLRNFL
                     LRTHLQDLIETTSQIHYETFRAKQLLALKESSAQGHGSRPISPSAEREMSRGSQRVAM
                     NGY"
     gene            1214612..1215657
                     /locus_tag="MYCTH_2311726"
                     /db_xref="GeneID:11506963"
     mRNA            join(1214612..1215209,1215270..1215657)
                     /locus_tag="MYCTH_2311726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666708.1"
                     /db_xref="GeneID:11506963"
     CDS             join(1214840..1215209,1215270..1215316)
                     /locus_tag="MYCTH_2311726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666756.1"
                     /db_xref="GeneID:11506963"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="JGIDB:Spoth2_2311726"
                     /translation="MALTAPVMRMASSSSFFPRLLAPTLLSTTRIQLRVRQFSLPLFP
                     SLTLAIPVGFQLGLPSLPSILEGIWESILKAVPKKKTSHMKKRHRQMAGKALKDVTSL
                     CKCPACGEVKRMHYLCPNCARKLRDFMNKEARANAH"
     gene            1215659..1217179
                     /locus_tag="MYCTH_2311727"
                     /db_xref="GeneID:11506964"
     mRNA            join(1215659..1215825,1215882..1215918,1215996..1216607,
                     1216711..1217179)
                     /locus_tag="MYCTH_2311727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666709.1"
                     /db_xref="GeneID:11506964"
     CDS             join(1215823..1215825,1215882..1215918,1215996..1216607,
                     1216711..1217114)
                     /locus_tag="MYCTH_2311727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666757.1"
                     /db_xref="GeneID:11506964"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2311727"
                     /translation="MSKQYLTAHTVDEAHPSDIFSLAPTPTCLLSASGSSSLRVHGTT
                     DATFPLQQTIPNAHKLGCHHICTARGGVGAVAASVGFGGEIKVWTYGNPAEDGDNNNN
                     KNNNRNIKDNASSQKEWKLHWELPPSKTDGGDVWAVALSADEGYLACTTSDGRIHVWD
                     IEARERIQTYETGARGGGSFAMAVDLSRDGRLTASGHESGAVYVFNNDAGRMVYSLSG
                     LAKPVRAVAFSPGCKRLAAAGNAGVIAIYDMEHGEHVGNLTTPTSRPAWITSLDWNDT
                     GEYLLTGALDGKVKVWDVARGVCVATHSETESALWSVRWLPKTERALGPGMGKSEMFC
                     AAGASRSITFYREATGS"
     gene            <1218721..>1219462
                     /locus_tag="MYCTH_2121306"
                     /db_xref="GeneID:11506965"
     mRNA            join(<1218721..1219167,1219283..>1219462)
                     /locus_tag="MYCTH_2121306"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666710.1"
                     /db_xref="GeneID:11506965"
     CDS             join(1218721..1219167,1219283..1219462)
                     /locus_tag="MYCTH_2121306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666758.1"
                     /db_xref="GeneID:11506965"
                     /db_xref="InterPro:IPR007218"
                     /db_xref="JGIDB:Spoth2_2121306"
                     /translation="MPITRRSTRSSTGAGKQSTLSFKHKVTKAIQTGKEAYESPSRAK
                     EYIPEPSPEPAASKREPKKEEKEEETPAPSDDEQLQKAQPAAVAAASGASEAEIEAAK
                     ITDRAIERYWNGIENSRKAKAVHRKHTEGLTTGEKVLRYFDVSSQYGPCVGITRLKRW
                     QRAQRLGLNPPIEVLAVLLKEEAKGNTAIEKAHMDELLNSAAVGSVGV"
     gene            complement(1219577..1221350)
                     /locus_tag="MYCTH_2311732"
                     /db_xref="GeneID:11506966"
     mRNA            complement(join(1219577..1219864,1219918..1220278,
                     1220389..1220543,1220698..1221350))
                     /locus_tag="MYCTH_2311732"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666711.1"
                     /db_xref="GeneID:11506966"
     CDS             complement(join(1219692..1219864,1219918..1220278,
                     1220389..1220543,1220698..1221118))
                     /locus_tag="MYCTH_2311732"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666759.1"
                     /db_xref="GeneID:11506966"
                     /db_xref="JGIDB:Spoth2_2311732"
                     /translation="MSDDEPDHELLALLRQHLQGKLTIEEEPETGVLEGAEFVYDNSI
                     DVSIDMRSCKNAAAAIYEQMQQKQYSPATWSTHELHPDRHVIGAEAAVAFVFVMDLLN
                     FSFWSDRSETERFAVEYRGKRWTGYWSLVAGLQRALEEGIPITDPHFWQDEEECTLDV
                     LRHVFRSCTDEEMPLLAERLACLREAGQVLYEKYQCHPVNLVEAARGSAARLVNLLAR
                     DFSCFRDEHHFPGRREPVRILKRAQILVADLWACFEGEDYGEFRDIDKITMFADYRVP
                     QILKTLGCISYSPPLEAAIYRKEEIPQGGSWEMQIRACSIWCVELLRREIVRQHPGTH
                     INAILLDFFLYDSIKQMEQEGTERSPHHRTRSIWY"
     gene            1222308..1224752
                     /locus_tag="MYCTH_2311735"
                     /db_xref="GeneID:11506967"
     mRNA            join(1222308..1222754,1222814..1224080,1224144..1224228,
                     1224282..1224752)
                     /locus_tag="MYCTH_2311735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666712.1"
                     /db_xref="GeneID:11506967"
     CDS             join(1222542..1222754,1222814..1224080,1224144..1224228,
                     1224282..1224591)
                     /locus_tag="MYCTH_2311735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666760.1"
                     /db_xref="GeneID:11506967"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="JGIDB:Spoth2_2311735"
                     /translation="MELGPGLPLTQTKQSRVLMVGAGGIGCELLKNLVLTGFGEIHVV
                     DLDTIDLSNLNRQFLFRQEHIKKSKALVAKEVAEKFNPAVKIVAHHANIKDAQFSIDW
                     FGSFRIVFNALDNLEARRHVNKMCLAADVPLIESGTTGFNGQVQVIKKGVTACYDCSP
                     KETPKSFPVCTIRSTPSQPIHCIVWGKSYLLNEVFGVSEDESAFDHSLDADNAKEIEE
                     LKKESEALRKIRESVGSPEFHEMLFDKVFNTDIVRLRSMEDMWKTRKPPEPLNYKELL
                     EKASEATAAKDAVLKNDQKIWSLEENLVVFNDSLDRLSKRVLDIKNGPDGATQDATIT
                     FDKDDEDTLDFVAASANIRSTIFGIERKSKFDIKQMAGNIIPAIATTNAIVAGLCVLE
                     AFKVLKGEYEKAKEVFLTPFAPARLLASDKSREPNPDCPVCGVFQTRAYVDLSRATLN
                     DLVEDFLKLQLGYGEKDISISNDVGILYDPDETDNLGKKLSELGIGPDSFLTITDEDD
                     EDPFVNVVVAIQEAKEPLEDKPIKRASPEEVKIPTKPKKTPAPECNGQNGHSAQSGSR
                     QQSEAVAEVLPAKRPHPEGTEDAASVKKAKTSASNLEDDGDVVVLDDSAGGAIVIDDD
                     "
     gene            complement(1224696..1225981)
                     /locus_tag="MYCTH_2311736"
                     /db_xref="GeneID:11506968"
     mRNA            complement(join(1224696..1224881,1225128..1225220,
                     1225289..1225538,1225669..1225981))
                     /locus_tag="MYCTH_2311736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666713.1"
                     /db_xref="GeneID:11506968"
     CDS             complement(join(1224730..1224881,1225128..1225220,
                     1225289..1225538,1225669..1225932))
                     /locus_tag="MYCTH_2311736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666761.1"
                     /db_xref="GeneID:11506968"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2311736"
                     /translation="MTVLSLAGKKAVVTGASGGIGFAIASRFAQEGASVVLAGRTRAK
                     LERSLGELQKLGEPPGSDRSSQLHRIHCLDVGEMKEWEGLVKEHKEIDFLVNCAGQSQ
                     HSLFLRTNEEAAQSLLSTNLRSVIFGCKTVAKQMAARRAGGCIVNVSSLLAYKAAIGT
                     SIYAATKAGQLGLTTALSRELAQHGIRVNAVVPGYIDTDMTESLANKTELEKKIPLGR
                     FGTASEVADAVAFLAKNEYANNCILNLDGGLSAV"
     gene            1226381..1228842
                     /locus_tag="MYCTH_2311737"
                     /db_xref="GeneID:11506969"
     mRNA            join(1226381..1226778,1226984..1227200,1227278..1228554,
                     1228630..1228842)
                     /locus_tag="MYCTH_2311737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666714.1"
                     /db_xref="GeneID:11506969"
     CDS             join(1226649..1226778,1226984..1227200,1227278..1228554,
                     1228630..1228712)
                     /locus_tag="MYCTH_2311737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666762.1"
                     /db_xref="GeneID:11506969"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="JGIDB:Spoth2_2311737"
                     /translation="MSPSDNSATSGGARPSEKATPPAIVEPTKENGAVDAGLKSLHHY
                     RRALPKWRYNLRQRLLPIIRWETPYLAALQSSMRTPALDSYFAITANLGTHTFFMIGL
                     PVLFWCGFPEFGKGLVHILATGVFFTGFLKDLCSLPRPLSPPLQRITMSGSAALEYGF
                     PSTHSANAVSVAVYGILMLHRDTNSFSASTTLALEILAYFYAFSIVIGRLYCGMHGFL
                     DVIVGSLMGAAISLIEFYFAARVEAWLYSSSYIAPLTIALIIIVLVRIHPEPADDCPC
                     FDDSVAFAGVMIGLEVGTWRFARYSPFAAVYNGPDATFNLSALGWKRAIARLIFGVAV
                     IFAWREVMKPTLLRFLPHLYRVIETHGLSLPRRFFVPASEYKDVPLHLRDDNVLPNVS
                     DLPKLVRSFRGPGRGRSVSVGPQSAADAYETLAYRERRRRESLESDGGGRGLRGKLSS
                     RSLREKATADGECSQVSGVQSGGRLAEFEKQMGTGTVAASPTSEGSAEAVSGADPCLS
                     QEDELDEREVFSKLVKPRVRYDVEVVTKLVVYAGIAWLAVDGILIAFEALGLGAEPPS
                     TR"
     gene            1230172..1235388
                     /locus_tag="MYCTH_2311744"
                     /db_xref="GeneID:11506970"
     mRNA            join(1230172..1232950,1233007..1234035,1234117..1235388)
                     /locus_tag="MYCTH_2311744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666715.1"
                     /db_xref="GeneID:11506970"
     CDS             join(1230426..1232950,1233007..1234035,1234117..1235203)
                     /locus_tag="MYCTH_2311744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666763.1"
                     /db_xref="GeneID:11506970"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR013129"
                     /db_xref="JGIDB:Spoth2_2311744"
                     /translation="MSIEAIGAAAPAVAMDVEPSTDSTNPIALHSPPDSNNAVDVDGS
                     DSELSDLDEVAGKLDGELQAELKGEFEAEPKVEPKVEPGTEPQAEDDDIGEILPDHWS
                     GTVPVFKPTMKQFQDFKLFVCRLTDRICTGHRPPLTDGMQMEKVDKYGMKSGIIKIIA
                     PEEWKQSLPPIDDLIKRIRVREPIKQDIMGSNGTYRQVNILHQRTYNLRQWRELCEQS
                     EHQPPARRGERRANSDRKPATRSRAAADPSKPSTRTTSTSTRGRKRKGGRATRRSARA
                     AKEESEEPEDRPMTPVSPFPEKEEVIKSVEGELGMDEDDCEDADAPGAVRRMGSARQA
                     KPKTQSVSARRKYIRREGSAMIDEEAFKDWDYRMDTSEFTPERCEELEKIYWKTLTYA
                     PPLYGADLPGTLFHDSVDKWNLNKLPNLLDVLGTKVPGVNTAYLYLGMWKATFAWHLE
                     DVDLYSINYLHFGAPKQWYSISQADARRFEAAMKNIWPTEAKACDQFLRHKGFLISPS
                     HLKQHYNITVNKCVSYPGEFVVTYPYGYHSGFNLGYNCAEAVNFALDSWLPIAKIAKK
                     CQCAQAQDSVWIDVYEIERKLRGEETEYEETEDEEEGEDDEEEETGLPSPPSSHTVRV
                     KAPGRKRKRDTDEKEPRAKTKKVRLRLKPHVEPPCCLCPNDIPGAEIMPTDDGRKAHR
                     MCALYLPETYIETVDGREIVANVAGIDKARLELKCLYCRSKKGACFQCSQKKCPRAYH
                     ATCAAAAGVFVEEQEVPVFGADGTEYKEQAFEFSCRFHRTKRDRKADGDALENDPQLR
                     AAAKALKKNDICQLQYYRGEIFAGVVVENRADEETLLLDIIPNGDRVEVQWKWLLLPD
                     PADFRLPKASPNAIPMPTSRKAQKEINAKRAVDEAPRKDDEFAPGYTWAEFHTGDATK
                     NPDQVKVDLSREQQVWHYLGKTSTEAKAQYTEDPSQRRHNPKSNFLDTIPKPPPPMRA
                     PLVPQAGPSVSGAYPGYPAVAGGVSGAAAGKQDKAYVYKPRTPFGLTTGQQPAPYTSH
                     TFAVSTPSPSPAFQQFQTQQAAPQAQPQSTFQQHLFPLQSQQHMQQLQLQLHQPPPQV
                     KQYQPPALDGQPKSSAPYLSDRFAPVRGSNGFPKLPGLSWPPAHMKSGHIVQPQSRAW
                     PSSTDTAAPMTSSALRSPNVGALQPGGAGRQPYASAYQKDSSRYRTPYGQWGGFTNGY
                     EGNLREFLIKAQKALSGDSSKAPIKQVPASLLQPLRPRLENSAPAHAPYAQILPRPPA
                     TNSQSPSPQPPPSSAPTTQAPPHHNHGYAAPSTPGMPSGQPFEARQPGQGLHPANRPQ
                     YAAPQQQQQQQQQQQQQQQPGQPTQHVWRATSQPPTQIPSQAPKPSAQAKPVFTKQSH
                     SPIPLPPYVRQMATASPSGSKPSPLSQPHEQASQPSPAQEPAPVAAASPRPAPDSGAT
                     QAPAAASPQQGQVTPVGDSHAGSGTTSQRSPQAAIPTPSSTAHQSSDGRRWTPAPEPQ
                     PVQQGTAVSPTEAGQQDNAALVERLMSNLRRASQSFGMMEEDQRMAGQQSQA"
     gene            <1235398..>1236233
                     /locus_tag="MYCTH_2113426"
                     /db_xref="GeneID:11506971"
     mRNA            join(<1235398..1235451,1235503..1235524,1235594..1235598,
                     1235734..1235764,1235923..>1236233)
                     /locus_tag="MYCTH_2113426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666716.1"
                     /db_xref="GeneID:11506971"
     CDS             join(1235398..1235451,1235503..1235524,1235594..1235598,
                     1235734..1235764,1235923..1236233)
                     /locus_tag="MYCTH_2113426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666764.1"
                     /db_xref="GeneID:11506971"
                     /db_xref="JGIDB:Spoth2_2113426"
                     /translation="MGVMSWFGVVFLSFAFAAHWNANRLVYGLCRLITPDEGSSHARL
                     GPARVVVLDDDDGLQRAARQHLEAQPRGAARELETLLWRALCDDPASLRDYYLAHHDC
                     VMTNPLLAPGGSWAPLSKETRPSVVDVLTQPGRRRGGG"
     gene            1242424..1244819
                     /locus_tag="MYCTH_2316511"
                     /db_xref="GeneID:11506972"
     mRNA            join(1242424..1242998,1243207..1244141,1244248..1244819)
                     /locus_tag="MYCTH_2316511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666717.1"
                     /db_xref="GeneID:11506972"
     CDS             join(1242461..1242998,1243207..1244141,1244248..1244505)
                     /locus_tag="MYCTH_2316511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666765.1"
                     /db_xref="GeneID:11506972"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="JGIDB:Spoth2_2316511"
                     /translation="MSSEEKGDAGSHTPEKVTSPPAFDVREGALQPRDQEDFFTRNGL
                     NFRSFQKRDIGGGVVDTLDRSMRTRHMQMISIGGSIGAGFFVGSGKALADGGPGSLFL
                     DFLIIGVMMFNTVYALGELAVMYPVSGGFYTYSTRFIDPSWGFAMGWNYVMQWAVVLP
                     LELTVCAMTVQYWNQEISVAVWITVFFVAILIVNVFGALGYAEEEFWSSVLKLGAIVV
                     FMILAFVLVLGGGPDGSRYDHYSGAHTWYNPGAFAHGFRGFCSVFVTAAFSFSGTELV
                     GLAAAEARNPLRSLPGAIKQVFWRITLFYILGLFFVGLLIPHDDPRLLGSENANPYVD
                     VAASPFVLVGYYANLKGYDSFMNVIILVSVLSIGVSAVYGGSRTLTALSQQGYAPKIF
                     SYIDRSGRPLWSVVAILAFAPLAYVNLHSDGPTVFAWLQALSGLAALFTWGSICLAHI
                     RFRSAWAKQGRSLEEIPFRAVGGVYGSYLGLALNILTLLAQLFVAICPVKGGTNDAEG
                     FFQSYLALPVVIVFWIGGFLWKRTGWLRLDQIDLDTGRRELDWDAINADRAKLAAMSP
                     IKRMFYTLFV"
     gene            complement(1247726..1248897)
                     /locus_tag="MYCTH_2316512"
                     /db_xref="GeneID:11506973"
     mRNA            complement(1247726..1248897)
                     /locus_tag="MYCTH_2316512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666718.1"
                     /db_xref="GeneID:11506973"
     CDS             complement(1248198..1248860)
                     /locus_tag="MYCTH_2316512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666766.1"
                     /db_xref="GeneID:11506973"
                     /db_xref="JGIDB:Spoth2_2316512"
                     /translation="MVSDNSSKPSSSRDMFAVTPDDDEQPPPSYEAAVSNGSNFCPTD
                     TSVTTSATSSTNLTLPRQSSTSTTPIPSPSHPYPRNNGMSPLRIPHIDSHQQGYRPPR
                     PMMSPSASSSSSSPSSSSWRDGRDDDDHDQWKHFGWQMTPEQLAALEGQPGCCFSTRG
                     GCCFSDLGGCFFGDTGGCCFSSNGGCCFSDRGGACFSDRGGCCFADRGGCCFGDRGSC
                     CG"
     gene            complement(1251164..1252225)
                     /locus_tag="MYCTH_2311751"
                     /db_xref="GeneID:11506974"
     mRNA            complement(1251164..1252225)
                     /locus_tag="MYCTH_2311751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666719.1"
                     /db_xref="GeneID:11506974"
     CDS             complement(1251278..1252087)
                     /locus_tag="MYCTH_2311751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666767.1"
                     /db_xref="GeneID:11506974"
                     /db_xref="JGIDB:Spoth2_2311751"
                     /translation="MEDPDLIACLYPFVDGEVVGKKAKKVIEAGEKRHQFIPPRLSEV
                     NEQPQLSRSERESTPLERPREEVPAYFYHPGLELRFSRGPQTPFGFVFGTDENSDIVL
                     PKSISTISFHHFALTFDDHYRPIVKDLGSSNGIEVTYNSRGKGNRSNFIWIIGGHRIP
                     RYTETIVINVNKDLKFQIVVARHDITSPQYIDNVNRFRQGMADAGNLLGRLDLRSRPQ
                     TERASGAHTPGTGPIFLKKKLGEGTFGVVTHLWNVSTAEECAVKEPSARAI"
     gene            1252555..1255049
                     /locus_tag="MYCTH_2311754"
                     /db_xref="GeneID:11506975"
     mRNA            join(1252555..1252776,1252833..1255049)
                     /locus_tag="MYCTH_2311754"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666720.1"
                     /db_xref="GeneID:11506975"
     CDS             join(1252595..1252776,1252833..1254819)
                     /locus_tag="MYCTH_2311754"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666768.1"
                     /db_xref="GeneID:11506975"
                     /db_xref="JGIDB:Spoth2_2311754"
                     /translation="MPSFEPMASNLTVNDIFSFNDEELVQYMKQNRRADGGFDLECEG
                     WENLAKEQRDQLAQRLTAAALKANDEVQSRPVDLDAVTARLREISDNQEALPIATSRS
                     PSYERSPTVICDKFEETKQDETRAYHELVKDGGRPVYPISRLEEVLNNPEGHREILLP
                     WQPNPDLEIPYAEVFVVQLATWKRFRYWQKKNRDIYNVEEEFAAYSKEAWRRETEEIA
                     SLSRSRRKFLEKSEREYLEKLRDKFLRMQEEKGVDDGDAGFSAFLEEEKRRNIEAGVQ
                     WPGMTEHEYRQSLRVYFNRAEYRRNLEHFYWLREDHGRGGFPEYVAEARRRLGKHGFT
                     RDFQLDKDPTRQDKLTTWIEYLNYEYAWYDRYERSINRLRPEYEEAWKKLVESGVLRP
                     GETDENVRTIESAARLQAEEDQARKAVTSAERVAKAALAETEKAKVGRSRLTTEERKR
                     RLVVAHSRLVAAKEARKALVKRGDLITDFVRGTWDYAEEERNIYRQRVRLQWALEQLP
                     LIEAELDESNGLRAGRGAKRSKPHQSDDDTDVGGPTERKKDEPSVPADDTGASARART
                     PKRGGHDDTNHPRPLKRPRNDSNKPTSYATSGMSDISKNCLSRSMETSQSQATGQRSV
                     AEKSINADTRDIAGQTLSRPPGNGHGDTIKLRRSARIAARQGPSGTAVTHPHATDVAC
                     RRSGRKLSKERVPLSPSTRLRGRQPKSTATNVARKRGNKG"
     STS             1253119..1254661
                     /locus_tag="MYCTH_2311754"
                     /standard_name="GDB:182527"
                     /db_xref="UniSTS:155386"
     gene            complement(1255367..1257042)
                     /locus_tag="MYCTH_2311755"
                     /db_xref="GeneID:11506976"
     mRNA            complement(1255367..1257042)
                     /locus_tag="MYCTH_2311755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666721.1"
                     /db_xref="GeneID:11506976"
     CDS             complement(1255638..1256864)
                     /locus_tag="MYCTH_2311755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666769.1"
                     /db_xref="GeneID:11506976"
                     /db_xref="JGIDB:Spoth2_2311755"
                     /translation="MTQEPSHLGALPPELFDKIFFELDTIRDLANFIVTARFVYHRFS
                     ARRQTILFRVLQNELGPALPDARFLFVFPYSDPTDEVLYHEWIYVMAGVYRDMLAGGE
                     GHGVRGYPGPPTVEELTELCRTLHLINFITDTYVTAQLGSFDLAGGGGTPATAPLSRP
                     ERCRVMRAFYRRQIVSNAWASTKRPAHWDDLDSDAFSNTSTEQGRRLGLFAAFDPWDM
                     QQIDHADEFITHLCCALVLRAAEVAAAGGGREISPRQFGNLHARLDHLVRYLRAHRGV
                     AKAAIGDLQSGKSPLYYDERWRKSSYILTSCSLWRTAGRLTGRNPSRTPSSIGRSRMV
                     CRWTTLPGTAPAKYHLAGRMRCGGAMSAGMAPGSLASPGFPPGRAGKRARPISVLSTS
                     GDSPASLCGTGNGSRR"
     gene            complement(<1257668..>1258141)
                     /locus_tag="MYCTH_2130688"
                     /db_xref="GeneID:11506977"
     mRNA            complement(<1257668..>1258141)
                     /locus_tag="MYCTH_2130688"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666722.1"
                     /db_xref="GeneID:11506977"
     CDS             complement(1257668..1258141)
                     /locus_tag="MYCTH_2130688"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666770.1"
                     /db_xref="GeneID:11506977"
                     /db_xref="JGIDB:Spoth2_2130688"
                     /translation="MAPEKHLVFLSPQTRHSQHPNLEDTLASHFPISQASSLSSTRNN
                     PRAAHASHSTRSSSSPRSVTMVRCNKCGKDETEYAVLVDTLVACTSQGCVRGYKKCNS
                     CTYLNGYMVKCCASSDCAGTGKRECVSCSGTGTKIVKIACSGKHRKRTPPPGGYS"
     gene            complement(1378806..1388422)
                     /locus_tag="MYCTH_2316515"
                     /db_xref="GeneID:11506978"
     mRNA            complement(join(1378806..1378826,1387543..1388027,
                     1388097..1388294,1388356..1388422))
                     /locus_tag="MYCTH_2316515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666723.1"
                     /db_xref="GeneID:11506978"
     CDS             complement(join(1387645..1388027,1388097..1388178))
                     /locus_tag="MYCTH_2316515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666771.1"
                     /db_xref="GeneID:11506978"
                     /db_xref="JGIDB:Spoth2_2316515"
                     /translation="MIARTKRCEACVRRGRSCDGSGIPLSSLDRILQEQRRIKDAERR
                     AELELDESQRRLEEAQRELSEKLARLRRLRQQKEFLVEKGADMVARGLSTLDELEEVE
                     RQETPAMPSSQINDAVDAVDWGAVFGSVPGFPLVDPDSAGGTVPVSQGSSNS"
     gene            1396110..1397780
                     /locus_tag="MYCTH_2311774"
                     /db_xref="GeneID:11506979"
     mRNA            1396110..1397780
                     /locus_tag="MYCTH_2311774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666724.1"
                     /db_xref="GeneID:11506979"
     CDS             1396196..1397524
                     /locus_tag="MYCTH_2311774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666772.1"
                     /db_xref="GeneID:11506979"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Spoth2_2311774"
                     /translation="MADHAGGDQELMYCHACHHQWQRAGESIECPVCMSASTEIVCQA
                     PRGLLHPASRPLTALQVSPENDPRQFHNRQPQSIASGATSSTPATASSTPQPTLDQNA
                     PVNSAGNGTSSPADAPNPESGSAQPAPDGQRPRVTVRFTTAELPPVTFFTFVTGPAAP
                     PASEHASPVPAFGMHFFPPVTIVPVAPPPTVNTSPSAEPADQNAANQQNTQQDASTET
                     QVEGTQQPQQPQPQSRPQPEEQQQQQQQQQQQQQQQPQSAYSHAFLATLLHSLLYGPV
                     AAAGAMGTTTFFHPGDAVYSQEAFDRILTQLREQAPPGGPPPASQAALDRLQAHIREV
                     DDQMLGNDNDKNTTRTKCAICVDDMVRGEKAAVLPCEHFFHGDCVLPWLKMHGTCPVC
                     RRSVEVDATGDGKPAKLNAETPLAPGAGAAGAGAAESETRGEDAGAMDCS"
     gene            complement(1398370..1398461)
                     /locus_tag="MYCTH_t193"
                     /db_xref="GeneID:11506980"
     tRNA            complement(1398370..1398461)
                     /locus_tag="MYCTH_t193"
                     /product="tRNA-Ala"
                     /note="Anticodon: TGC"
                     /anticodon=(pos:complement(1398427..1398429),aa:Ala,
                     seq:tgc)
                     /db_xref="GeneID:11506980"
     gene            complement(1398996..>1418472)
                     /locus_tag="MYCTH_117478"
                     /db_xref="GeneID:11510133"
     mRNA            complement(join(1398996..1399565,1399780..1400462,
                     1410183..1410193,1415996..1417654,1417795..1418335,
                     1418438..>1418472))
                     /locus_tag="MYCTH_117478"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666725.1"
                     /db_xref="GeneID:11510133"
     CDS             complement(join(1399057..1399565,1399780..1400462,
                     1410183..1410193,1415996..1417654,1417795..1418335,
                     1418438..1418472))
                     /locus_tag="MYCTH_117478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666773.1"
                     /db_xref="GeneID:11510133"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Spoth2_117478"
                     /translation="MEPERRRRRPAVTCILCRKRKIRCDRQLPCSNCTKSKNATCVYK
                     DDPRVPRKQGTFGETGQTRGGSEAAVVNPRAASSSSEPRPPAATTTTTTTTTTTTTTD
                     ANTTSTAIYGTVGKSACSWSPASKTYVKPTGKPASEQTASAGAGASSANPPVSTLTRN
                     SLVETRTLNFSGNFYFHSEHRLNKQSQSVTRSLDDMIDFVERYLRDESKSRVLHIERR
                     SKELGRIIKKRRAPPWPCPLTPDLPARVVADTLVESYLNTSESVLRVLHIPSFRREYE
                     AVWDPSHAPDPAFLVQLKLVLAIGTTTYDTDFSLRPYAMRWVYEGQTWLTAPEFKHRL
                     GLTAVQNCILLHLAREAAGVGEDMAWATVGMTLRIAMYMGLHRDPAGLGPRTMTPLIA
                     EMRRRLWNTILELALQSSLNAGGPPLIGLDDFDTEPPGNFDDDQLTGQEGETPNVISP
                     KPPDQFTQTTMAIALRAVFPQRLAVVKYLNDLSGCGTYQETLQLDAQLREACKNLTHT
                     LHACQATTTDRGPPTDLGLRIVDLILRRYFLALHLPCFAPAMQDTAFAFSRRVVVESA
                     VRIWRAVFPHPFARSRPDADTEEWDALQRIAINGSGFFRTVAVQGFISIAVELKTLMR
                     EEDGFGLGPVEPRPDLLAVMEDFKAWSWKCLESGTTNTKGYLVACIVCAQVDALRRRM
                     TEEDMFAHVVRVTEEGEERCLELLERIEASTRPAQEALDVGVDGIGSGMGFSPDFGME
                     TWDSMLQPTNHPVLPSRPAAAAHRQQHDRAAAVVTVTPVFPPGDNVVFAHSSFFTRPA
                     PAAGTRHYYSHYSPGLPAPASVRAEVAARLAAARGGTEGSAGGTGGGGASEAKLVPFP
                     ALGLLVKYGPEGTGGGGGVSAAEAKAMLLVRRALMAPSLASGPSPAPVSVSVSAPVPE
                     VFGWRRDAETGERFVYMDLPQGEMLEDRWAALSEVEREAVCAQLRDVVAEWRKLRLGG
                     VEFVGSVDNGPLQDEVFRRCAMAGAPPAGPFPTVAAFHDYFVSMAVAVSQSRYAAGSA
                     GVGGGGQVRYTPHHLFPERVPVVFTHGGLHPRNIVVSAGPRPRVVAILGWEQAGWYPA
                     YWELCKARLECSRRGRLGGWETKYLPWILDSQGLDAEMQGWRLGALTQYWDYFVGLM"
     gene            <1418775..>1419038
                     /locus_tag="MYCTH_2130701"
                     /db_xref="GeneID:11506981"
     mRNA            join(<1418775..1418850,1418905..>1419038)
                     /locus_tag="MYCTH_2130701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666726.1"
                     /db_xref="GeneID:11506981"
     CDS             join(1418775..1418850,1418905..1419038)
                     /locus_tag="MYCTH_2130701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666774.1"
                     /db_xref="GeneID:11506981"
                     /db_xref="JGIDB:Spoth2_2130701"
                     /translation="MPSPNTISDSMKQSIWPRTTTPRNEHSEPTAWSDARMNRVNHKT
                     AAQLSGTSKLSFRDPAIDSNHRGGS"
     gene            <1419303..>1420664
                     /locus_tag="MYCTH_2072063"
                     /db_xref="GeneID:11506982"
     mRNA            <1419303..>1420664
                     /locus_tag="MYCTH_2072063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666727.1"
                     /db_xref="GeneID:11506982"
     CDS             1419303..1420664
                     /locus_tag="MYCTH_2072063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666775.1"
                     /db_xref="GeneID:11506982"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2072063"
                     /translation="MAVASDSNQAGPGLQNHDEKRISNQNDTTTDTESTKANLESAPG
                     ALPGPAGVAGFPPAPDGGARAWLVVAGATCIFFSCLGFMNSFGVFQAYYMSHQLRDHS
                     PDAISWIGSLTAFIQFAGGALTGPLFDRFGPWVIRPAAVLYVFALMMTSICKEYWQFM
                     LAQGVLAGLSMSMLQVPAFASVSQFFDKKRAAALGLVVSGSSVGGVIFPIALSKMLNG
                     TTLGFGWSVRVMAFVITPLLLFASFAITTRFPPRKTNLFIPSAFTELRFLMVIAAAWC
                     AFLGMFMPFFYIPSYAITRGLEATLASYLLAIANAASTFGRIIPGIIADKFGKLNVFA
                     TGSLLTGVVVLCLNSTVSTAGLVVYSLAVGFASGTIISGASSAISVCTSDPRNLGTYM
                     GMGMAVASTASLVGPPVCGVMIDKYGGFLQAAIFAGVACLAGAVVAFAAKLTTPQGLF
                     GRA"
     gene            <1421879..>1423252
                     /locus_tag="MYCTH_2121324"
                     /db_xref="GeneID:11506983"
     mRNA            <1421879..>1423252
                     /locus_tag="MYCTH_2121324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666728.1"
                     /db_xref="GeneID:11506983"
     CDS             1421879..1423252
                     /locus_tag="MYCTH_2121324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666776.1"
                     /db_xref="GeneID:11506983"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="JGIDB:Spoth2_2121324"
                     /translation="MGSQSIDADLPIRVSETHHSNKPPPEDLHRYWRSHQHDGYLERY
                     WPDGNDHNEWISSIRRILSRQFPDFANADIQYFSNGTFNRLYSLTNPSWDKAYLFRVS
                     IPVEPFFKTESEIATMEYVRRHTTMPIPRVVAFSSSDDNELGYEWILMEMMPGEPLRK
                     LWSAMAEDARIAVFAELAVHVKQLVALRFSKFGNLYLADVADKVLPRNVSLPVKGDDL
                     ADAVDRDIGPGGQFVIGRIVAQDFFFDKRVYYPGSRGPFLTTRELVDTRVELLGRRLR
                     HLSPVEGEAWYCENDRELARHKDRVYELFDQLKALVPRLVPPENGPEDRGVLWHDDLS
                     EHNLLLDPATFKLTGVLDWESVSIVPAYETQDARPAWLSDRDWRPTPLVHLARGIPPN
                     DEFIKADKLRRVLEMGPARQAYHRIVGPLYDDSSPETQQRVRNKRGIAKQLEIDAFQH
                     RPWCTAD"
     gene            1423868..1423953
                     /locus_tag="MYCTH_t182"
                     /db_xref="GeneID:11506984"
     tRNA            1423868..1423953
                     /locus_tag="MYCTH_t182"
                     /product="tRNA-Gln"
                     /note="Anticodon: CTG"
                     /anticodon=(pos:1423901..1423903,aa:Gln,seq:ctg)
                     /db_xref="GeneID:11506984"
     gene            complement(1424032..1425649)
                     /locus_tag="MYCTH_2311778"
                     /db_xref="GeneID:11510122"
     mRNA            complement(join(1424032..1424516,1424647..1425649))
                     /locus_tag="MYCTH_2311778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666729.1"
                     /db_xref="GeneID:11510122"
     CDS             complement(join(1424254..1424516,1424647..1425412))
                     /locus_tag="MYCTH_2311778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666777.1"
                     /db_xref="GeneID:11510122"
                     /db_xref="JGIDB:Spoth2_2311778"
                     /translation="MMNTRPGADPVPQAVVSGFVPAPGPIADAVLRAVYVSDQDMYPV
                     ALPYARLRAWPDACGDLSICFRSSSSSSSSSSSSSSTPPLPPPSPGRGAGSAAPGGRD
                     GESDGDGQSGGHGRRTSEEEEKEEGGVAAAEEEEEAVAVAGVVIVLPLRRRFWEDLLQ
                     GRLKEWEIEPRDMFAFPVATTAAAAAAARSASPGDRTSVGEQQGAEEVGLHVYHIERF
                     DSTVSSGQGTKRFSEFALAEVMRRARARPEWKVVGMSALTATPAGKRTFERLGFSSTG
                     YRELFVAKSHEQVTGEAIDKRPLEIVYVYPGEVAEPDGVFEEGVITTVSEMTVRYYNI
                     LIDLGRAE"
     gene            complement(1425625..1425696)
                     /locus_tag="MYCTH_t192"
                     /db_xref="GeneID:11506985"
     tRNA            complement(1425625..1425696)
                     /locus_tag="MYCTH_t192"
                     /product="tRNA-Thr"
                     /note="Anticodon: AGT"
                     /anticodon=(pos:complement(1425662..1425664),aa:Thr,
                     seq:agt)
                     /db_xref="GeneID:11506985"
     gene            <1427631..>1429056
                     /locus_tag="MYCTH_2070700"
                     /db_xref="GeneID:11510132"
     mRNA            join(<1427631..1428422,1428538..1428969,1429003..>1429056)
                     /locus_tag="MYCTH_2070700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666730.1"
                     /db_xref="GeneID:11510132"
     CDS             join(1427631..1428422,1428538..1428969,1429003..1429056)
                     /locus_tag="MYCTH_2070700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666778.1"
                     /db_xref="GeneID:11510132"
                     /db_xref="JGIDB:Spoth2_2070700"
                     /translation="MLILAGPLCLFIIPLLFQKWRAWRLDEWVHEQLRVADFRYAGNI
                     RLEERLRLRATENRRLRAAFGIDNSLTTTSPSDHRAFLKRASWLLKRGDRSWEQLYRT
                     AEDFLGAEVRAAVKEGRYGLHLAESVRCMVLAVVLFDNFGIEPASIPRAHLVTITREI
                     NEQWLRSKRDPVGVAPSSLLYSTIESLNVMSPFANTESVVLSAPEVLSLLMPQYETLW
                     RVVLLTFVTAYHHQPDAYPDAVQRTADVPACLGHPAKEKEALKLAKEGLRLYPSNKHL
                     YRAAPSCLANPEGSTNRRGPARAADISALHRHPSIWGGGAGGGGGALAFRPARFDDGA
                     LTDLQRRAYAPFSRPPHRCPAAGSSSSSSSTAAEAGKNSFGERMIVVLVVALGRALGR
                     DKGRVVLGEEKGGEGGPLPTGRDEMEGWVWVWY"
     gene            1429467..1429558
                     /locus_tag="MYCTH_t183"
                     /db_xref="GeneID:11506986"
     tRNA            1429467..1429558
                     /locus_tag="MYCTH_t183"
                     /product="tRNA-His"
                     /note="Anticodon: GTG"
                     /anticodon=(pos:1429500..1429502,aa:His,seq:gtg)
                     /db_xref="GeneID:11506986"
     gene            complement(<1430282..>1430878)
                     /locus_tag="MYCTH_2071531"
                     /db_xref="GeneID:11510123"
     mRNA            complement(<1430282..>1430878)
                     /locus_tag="MYCTH_2071531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666731.1"
                     /db_xref="GeneID:11510123"
     CDS             complement(1430282..>1430878)
                     /locus_tag="MYCTH_2071531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666779.1"
                     /db_xref="GeneID:11510123"
                     /db_xref="JGIDB:Spoth2_2071531"
                     /translation="DLRTCSHRHEILAAAVETDQGGPVPVTLFHWYPPTVCAKMTTFM
                     SPEVLSAIRGFKSLGTFFLANDLDLSKMLSDYLAATATPPNPEPAPELLTDLIGQLAM
                     PSRGDFVRFFSFPVFSNSPTQVFLDGLLPVWKWVKQDSIYRRGGFWEAKLDKAIEDGE
                     WTGGKQLDLLVRGVMEQTLQKITAGGCKYTSFNRIPED"
     gene            complement(1432778..1434194)
                     /locus_tag="MYCTH_2311782"
                     /db_xref="GeneID:11506987"
     mRNA            complement(1432778..1434194)
                     /locus_tag="MYCTH_2311782"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666732.1"
                     /db_xref="GeneID:11506987"
     CDS             complement(1432825..1434039)
                     /locus_tag="MYCTH_2311782"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666780.1"
                     /db_xref="GeneID:11506987"
                     /db_xref="JGIDB:Spoth2_2311782"
                     /translation="MAESPGAMGDAIGTEAPAVVGGLTPEQEEDMAALPGQHSLEERQ
                     RYGHSHGQQQGDGLLSRQPEQADQPLLDGRQKPNPSSTSDPATTSSVASPGAPSPLPS
                     SFPKKRRGRPPGRPNTTVRDADYEDNPLVQAWNSSKTDRAVPVISIRIRDALTEQSLV
                     HETQRNIFRMPSRETILFVQGWITAKHIASQRPSYVNGLLIHSRGQDAAVSCVQCAEK
                     RAKGALGPFLTCRVLPGSYHNSCSNCKWFDNTSACSLYTGPKPNRKRKAKEQLAPPPA
                     PTAAGVGPPPKTEKLGGEDPGVLTTADEGQEDPPLDPRLRDEPVVSPLQEPPAAVPPP
                     PLPPQQKLQPEADMAPVSLDNGTGEDGQAPTAHSSSSSSSSTSSTTGGGDPSAHPDLH
                     HGSESAEDGDAE"
     gene            1434455..1435959
                     /locus_tag="MYCTH_2316519"
                     /db_xref="GeneID:11506988"
     mRNA            join(1434455..1434762,1434831..1435959)
                     /locus_tag="MYCTH_2316519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666733.1"
                     /db_xref="GeneID:11506988"
     CDS             join(1434566..1434762,1434831..1435599)
                     /locus_tag="MYCTH_2316519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666781.1"
                     /db_xref="GeneID:11506988"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="JGIDB:Spoth2_2316519"
                     /translation="MSNPNALLLLADHIKLSLLEQKRAKALNLRRDSQDGHISRSLDH
                     FREGLESLEKEQWRLEEAGDESKASSLRDTLSSLRKQYDDLSSQFSGNASATSSATLT
                     HPNDPSLAADFAHAQSAHAEHPPALASASAIPESSSSPPPPQAGATTTITTTYNNHPA
                     PAKKAVRFSSPATDLESQTTTRPGIGTANNPLFPYRDEPDDDDDDTAGYAAHIAAQGL
                     SNAQIHAYHQQILSEQDAQLETLSASIARQRQLSMQIGDELEDQVLLLDESERAAERQ
                     AGALGRARRQVGRIARNAAESGEGRQLTAIVVLIIVLVLLIIILK"
     gene            1436033..1436128
                     /locus_tag="MYCTH_t184"
                     /db_xref="GeneID:11506989"
     tRNA            1436033..1436128
                     /locus_tag="MYCTH_t184"
                     /product="tRNA-Ile"
                     /note="Anticodon: AAT"
                     /anticodon=(pos:1436067..1436069,aa:Ile,seq:aat)
                     /db_xref="GeneID:11506989"
     gene            complement(1436271..1437612)
                     /locus_tag="MYCTH_2311785"
                     /db_xref="GeneID:11510124"
     mRNA            complement(1436271..1437612)
                     /locus_tag="MYCTH_2311785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666734.1"
                     /db_xref="GeneID:11510124"
     CDS             complement(1436558..1437439)
                     /locus_tag="MYCTH_2311785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666782.1"
                     /db_xref="GeneID:11510124"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2311785"
                     /translation="MTLLARIAAHTQQICGLAWSKNGDVFGTGGNDNICYLFDALGAL
                     GNHPANRDRSKEDQTGHSTGAHAHTLSEISDAETEIQLLRTAPYHPAKHLGPGNARHR
                     WVHGAAVKAIAFCPWQDSLVATGGGSNDKCIHFFHTGSGAALASISVSAQVTSLIWST
                     TRREIAATFGYAHPDHPVRIAVFSWPECRQIAAIPWAGEHRALYAIPYPCGPDDRASA
                     GLEGARSWRTAARRHSRSRTAKEGCIIVASSDRSVKFHEVWAADKRGTASVAGVLGGS
                     PILEFLEGIDREGMVIR"
     gene            1439857..1441586
                     /locus_tag="MYCTH_2311786"
                     /db_xref="GeneID:11506990"
     mRNA            join(1439857..1439986,1440064..1440955,1441116..1441586)
                     /locus_tag="MYCTH_2311786"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666735.1"
                     /db_xref="GeneID:11506990"
     CDS             join(1439978..1439986,1440064..1440955,1441116..1441501)
                     /locus_tag="MYCTH_2311786"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666783.1"
                     /db_xref="GeneID:11506990"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="JGIDB:Spoth2_2311786"
                     /translation="MADQGGSQHGIARTSRVRTEEQRQRDLERIAKYRELEDQVRAHI
                     GRAEYTPEVFQLTSKLLRLNPEYYTIWNARRRCLISGSFSRPSAGSSCSRASSSTSPS
                     ATTAPSSTSSSSSSSAATHPAPGSPTAGRSGTTADPAATTATASNPAQNEEPSAAEAQ
                     DLSIIKSELTFTIPLLLESPKCYWIWSYRLWILQQAIARLRPALARRIWEEELGLASK
                     MLGKDRRNFHAWGYRRHVVQQLESATLEGSSMVEAEFAYTDKMIFNTDLSNFSAWHSR
                     SKLIPRLLDERGADEAARRAFLDKELSQIRNALNVGPEDQSLWYYHQFLILNIVEPEK
                     HPSMTRGFTREDRVAYLRREIDEIKDLLEDYEDVKLSYEGLFEYTLYLCQLEERQPDE
                     TERADLAAWLGKLKQLDPMRNGRWADLERDCRLKDQ"
     gene            complement(<1441587..1444296)
                     /locus_tag="MYCTH_2311789"
                     /db_xref="GeneID:11506991"
     mRNA            complement(join(<1441587..1443869,1444067..1444296))
                     /locus_tag="MYCTH_2311789"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666736.1"
                     /db_xref="GeneID:11506991"
     CDS             complement(<1441676..1443840)
                     /locus_tag="MYCTH_2311789"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666784.1"
                     /db_xref="GeneID:11506991"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="JGIDB:Spoth2_2311789"
                     /translation="MALAYLSSKIRHTDEWFRVADHPVSSPFGIIVNHDLREGSGAEA
                     ENVAAALRKLGIKSHVLKIMWKEVIPEGVNPNDLPNVETLARYLRYRRLGTFCKNGKM
                     TTLLTAHHEDDQYETVMMRLLSGHGFRGLQGMRPATDIPECYDLHGVYQSGFIDDQRH
                     DNPIYKMVPGDRERKVLKKGLRNEVDPAVIAKEIEAGLKADIATAYLDEYDDMSRGSK
                     RAPPPAPLEFENGGVMVYRPLLGFSKDRLIATCLENNIPWFEDHTNSDRTLTMRNAVR
                     YMHKNHRLPAALQKPSILRLAERCRARVASAEAEAGRFLDRLVIHEFWPNTGTLVATL
                     PRFHFPSVPRLSSASPPARERRIAHYRHIAALLLRRLISMVTPERELSQPSQLSHLVS
                     MLFPSLSSSPPPAKPYVICSVLFTPLPGDGGADNNNNNNDNNAGGREKEKQRRPRRWL
                     LARAPHPSNTPRPSVTFHDLAFGKRRGKPASAWKTTGWSGTRLFDGRYWIRLLHRLPC
                     RLRVAPLEPEHLKPFRDALDCGGEKEKKRELMAMLARYAPGKTRWTLPAIYATVDVRR
                     LLATGEWWPEECRGGGGDNDGNAAAVSDDGGEEEGEAGAGEEQEEDMEERELVERIRS
                     HQLSGVRLSQWEWERELKSREQQHLLALPTLGIGLPGLEDWLRWDVRYRKVDHDLLRL
                     SKLGGRRIGRREMRHRLRCLYRWVRLGRAKEAPRRRRMA"
     gene            <1444924..>1445856
                     /locus_tag="MYCTH_2113446"
                     /db_xref="GeneID:11506992"
     mRNA            <1444924..>1445856
                     /locus_tag="MYCTH_2113446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666737.1"
                     /db_xref="GeneID:11506992"
     CDS             1444924..1445856
                     /locus_tag="MYCTH_2113446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666785.1"
                     /db_xref="GeneID:11506992"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2113446"
                     /translation="MATSPQPPPFQTALLAGALAGTTVDLSLFPLDTLKTRLQSSEGF
                     FASGGFRGIYRGVGSALVGSAPGAAFFFCTYEATKSHLGPLLRDVSRSHSHSPSLSSS
                     SAAAALEHMVAASLGEIAACAVRVPTEVVKQRAQAGRHGGSSLRSLLHILGQRDRRGL
                     VGVWRELYRGWGITVMREVPFTVLQFPLWEALKAWGRERKVRTGTGLFGDASAHSGGE
                     VGAAESALYGSIAGGFAAAVTTPLDVLKTRVMLSAQRESMASIVRTTLEENGIRPFFA
                     GIGPRVMWISAGGAIFLGSYQWAVNALEKSKLVI"
     gene            complement(1446051..1449949)
                     /locus_tag="MYCTH_2311790"
                     /db_xref="GeneID:11506993"
     mRNA            complement(join(1446051..1446286,1446387..1447606,
                     1447694..1449210,1449288..1449418,1449580..1449949))
                     /locus_tag="MYCTH_2311790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666738.1"
                     /db_xref="GeneID:11506993"
     CDS             complement(join(1446119..1446286,1446387..1447606,
                     1447694..1449210,1449288..1449418,1449580..1449582))
                     /locus_tag="MYCTH_2311790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666786.1"
                     /db_xref="GeneID:11506993"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2311790"
                     /translation="MTPLDFRNPSLTCSFVPVLEAPNSSPGGHRLGVNGLAIDRDNAI
                     LYSGGRDGVICAWDVNRNAATSPNGHSAVVDAAPANGRPKSITRFRAQTHAHTHWIND
                     ITLAQQHSALVSASSDLLVKVWRPLASDIQEPVTIGQHADYVKCVATPSQSTNWVASG
                     GLDRKIYLWDLSGAGKTLEIDVQGEEVPQKGSVYALGVTHDILANGGPESIVRLWDPR
                     SGQRITKFVGHTDMIRAILISESGDMVLSASSDQTVKVWSVTAGRCMHTLTMHDQSVW
                     ALFSDDPGLNVFYSSDRSGLVVKTDVRETHGDLDNGLSLAVAKEHDGVSKIVAWDDSI
                     WTATATASINRWKDVDTGGSIRLPEAYKQHRASMVTVRSKDSAVPAAWESDSAGPTIS
                     AKSILRISNTASFPLVIGRDGDNSSSGFTRKGSELSEQVASIVEPIYHLPEETIEGHF
                     GLVKHKLLNDRRRVLTLDTAGDVLMWDLIQCRPIKSFGKRNLEDVEPEVNTREAVAPW
                     CSIDISSGNLTVVLEPYNCFDAEMYADELVLDEPVEFREDQRINLGKWVLRYLFAELI
                     DEEIRRDEAFRQKLNQGATTKRNVGGRAARPLAISIPSEPGWGPADPSSATPRPSGSQ
                     YPPMTPGFGIGLATPGSPVPPALEGLTTPLSPIVDRRFSQVSRPSQEREDYFSDAIQS
                     PDGAPKPAQTPAAEVPPVEDKSTKTAGETAGKESEAKDKDKDKDKENGKSPGTMFGKK
                     FRMGMSFGSKKLGRSMSTAAAEKPAVLDEKAEESESSSNNEKEEFDDSFLGVIQRIRS
                     EYEKQMAENPDQPVETKITPSLANDTPVLKLPPATKVIIQEETSGGSAEMYRGTVASV
                     GADASVIEERAPQWLGDVLLLNVLPPKDPVKISFVLYPWKDTLPPIASADGNNRLNAN
                     RMLRVKKILAYVAERIDPVREGEDSGPDALKPEEYLELYCNDQLLPIKMTLATLRTHI
                     WRGGNDIVLHYKANGRKEIPMPPPAEAKEAEGPEAVPGAA"
     gene            complement(<1450312..>1452898)
                     /locus_tag="MYCTH_2113448"
                     /db_xref="GeneID:11506994"
     mRNA            complement(join(<1450312..1450327,1450393..1450403,
                     1450599..1450921,1451036..1451296,1451353..1451412,
                     1451466..1451759,1451868..1452089,1452143..1452211,
                     1452272..1452369,1452858..>1452898))
                     /locus_tag="MYCTH_2113448"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666739.1"
                     /db_xref="GeneID:11506994"
     CDS             complement(join(1450312..1450327,1450393..1450403,
                     1450599..1450921,1451036..1451296,1451353..1451412,
                     1451466..1451759,1451868..1452089,1452143..1452211,
                     1452272..1452369,1452858..1452898))
                     /locus_tag="MYCTH_2113448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666787.1"
                     /db_xref="GeneID:11506994"
                     /db_xref="JGIDB:Spoth2_2113448"
                     /translation="MASVPDNRLPWKRVEPSSILDSESPFSSGLESEISNRMDNKAAS
                     TSYQESRILSAQAIQEIENELGDVGRGADFPMSRARGSSTSSRDSGNGVPPPPTRPPP
                     VPHIPNEHRLATRRSDVGGGGGDSLPLPRVRPSRPRCASTPITSSTTPAVRSRQRESQ
                     EQVPCETARPVSGGGLCPARAPSTPAPSTAPKCSLFPPVQSFPVSPAAPSCSSSSTAE
                     PSAVLSYRSRCFSPFWLDEFSRPLRPQDLDPESPYGYPAPPAFLHNWETPNRACAKGA
                     VNAATAHRAGKIGPPVGSRPRPIPAVAVASTAPVYDPVPLHSSLDFPSVPTLVTGGFA
                     YSSMMSPYEAQTSLDWPGPAAGVRCPPDNPRLGRRNGAREGGEKGGRGGQGESAQAQA
                     CRFPRLEHELLSAEEAAAAITAAAGVRNTIFIDRGIDLGGTNGASSCYGNEDEVGRER
                     RVREDERKEKQGSM"
     gene            complement(1453378..1456670)
                     /locus_tag="MYCTH_2311792"
                     /db_xref="GeneID:11506995"
     mRNA            complement(join(1453378..1455311,1455477..1456670))
                     /locus_tag="MYCTH_2311792"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666740.1"
                     /db_xref="GeneID:11506995"
     CDS             complement(join(1453683..1455311,1455477..1456445))
                     /locus_tag="MYCTH_2311792"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666788.1"
                     /db_xref="GeneID:11506995"
                     /db_xref="JGIDB:Spoth2_2311792"
                     /translation="MPYSDDLYASLEEEEAHIELIGETLTQDGIQGFDLTSEHVRPDT
                     STTDAVVASVDHDTGVAGEEEDPHVFSPTDGYFGTAPGASSGTLAPASSNVPHVPNVL
                     VEDPSLQRDDAEGKAAEAARERLRNDREAPGSDDGDASASASHTPAPSHNGVSSASAV
                     TPTPTSHSAATYYAPSSSSRFPGVATLTSYTTFSTQRRSAYPSEHFPFIPNEAPPAYS
                     PSPPVPSNTQQRFEGYRTVTQTRDAAIINMGRPEETQGLLARQPESMRDHNAHDVEEM
                     SPTWWTRMRRAREHASWRSCKFVLIALVLFVVTAGFLTSIITGPPGRTGSDNPASDEP
                     QTDPGQPNMSYPDVDGDFAWDSTSFCKDAKIHRRVQTFVANLGADKQLTLLERTVDED
                     GRRGWGEVHVQGAVVFRRAGPDTPQSAVTLEVAVTDERLDVTSSWDAEAGTLEVLVPH
                     RVEWSKDRPRACVNVKVTAWIPENSKLEHLNTDVVHLDIKLLDNLSLTVEKGTALTST
                     VGTITSASSGTAARDDKLVDTTNPPPSYDFHSRIIDVHTTAAPITGVWPLYDYLGLHS
                     TAGNVRVAINPKEADADFPKPAILYVKTLSGDVKVREPIHAAQATFHIAQHTFSAGSA
                     DRRRAEAQAEAYLPPREYRVDVHTSSGDIDAAVAFGLSGGFKSTSGTVSLELLPVLDA
                     TQAEPGARTVELSTASTSGATDVKVLEPLWVDSFPAAAATQGDGGGSSGKPRYVDLSR
                     PSSSPSSSSARRTGGAKDEDDGDSAPPPLRCLHSTHMTTTANIKLRYPASWEGDISLG
                     TLTGSLQVGGDGVKLIKAGSDWPGINKFLLARKGEKGEGGRLTAKSTSGDANVWIGGE
                     SAALSTERM"
     gene            complement(1457677..1459689)
                     /locus_tag="MYCTH_2311794"
                     /db_xref="GeneID:11506996"
     mRNA            complement(join(1457677..1458477,1458535..1458581,
                     1458661..1459689))
                     /locus_tag="MYCTH_2311794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666741.1"
                     /db_xref="GeneID:11506996"
     CDS             complement(join(1457806..1458477,1458535..1458581,
                     1458661..1459381))
                     /locus_tag="MYCTH_2311794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666789.1"
                     /db_xref="GeneID:11506996"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2311794"
                     /translation="MPNKHDESPLEAALSFYSSIVTLNSEGDSLVSDETLEGLGTVGF
                     LIQALFGSLLRIANPDLVLSPRRPSLVASTIPDSQSPDFPYSEQISRIPTEMAASAAN
                     ARYGPAVPITASQSLAETAVKRPILQYEGAQQSGAQDYSDIIEEEEDAAGLTTRLTDL
                     LPEPGYFLAGAVSGGVSRTATAPLDRLKVYLLVNTSTRTTVAVAAAKSGRPLAALRNA
                     GGPIIDAIVSLWKAGGLRTFFAGNGLNVIKIMPESAIRFGSYEASKRFLATYEGHNDP
                     TRLSTVSKFVAGGIGGMTAQFCVYPIDTLKFRLQCETVKGGPQGTALLLRTAKNMWAD
                     GGLRAAYRGLGAGLLGMFPYSAIDIGTFELLKKSYTRAVARYYGIHEEDAQIGNVATA
                     VLGATSGALGATIVYPLNVLRTRLQTQGTAMHPPTYTGIVDVAQRTVRNEGVRGLYKG
                     LTPNLLKVAPALSITWVCYENMKSLLSLN"
     gene            complement(1459723..1460541)
                     /locus_tag="MYCTH_2316520"
                     /db_xref="GeneID:11506997"
     mRNA            complement(1459723..1460541)
                     /locus_tag="MYCTH_2316520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666742.1"
                     /db_xref="GeneID:11506997"
     CDS             complement(1459903..1460244)
                     /locus_tag="MYCTH_2316520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666790.1"
                     /db_xref="GeneID:11506997"
                     /db_xref="JGIDB:Spoth2_2316520"
                     /translation="MEESQNQRDRRVEELWKQLDPAGHGELDLKGLQRGLRRIDHRKF
                     PPPFPLFPLFRAQGYRTHNLAQALKNADQMLKTIISIVDTSGDGKIQYEGGFGETGKS
                     RVEPETETMRT"
     gene            1461521..1462917
                     /locus_tag="MYCTH_2311800"
                     /db_xref="GeneID:11506998"
     mRNA            1461521..1462917
                     /locus_tag="MYCTH_2311800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666743.1"
                     /db_xref="GeneID:11506998"
     CDS             1461743..1462762
                     /locus_tag="MYCTH_2311800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666791.1"
                     /db_xref="GeneID:11506998"
                     /db_xref="JGIDB:Spoth2_2311800"
                     /translation="MATSQVYLKRFYTRTAIRQTNPYLVMATALYLACKMEECPQHIR
                     LLTQEARSLWPSDLHGHDAARVGECEFSLISEMHSQLIVHQPYRPLLALQDEFGLTQD
                     EMSLAWTIINDHYMTDLPLLHPPHIIALTAVLLALVLRPSSTSAGGGGGGGGGGSGSS
                     SGGAGGGSNNNASSSAPAAAAAAAAAAGAGGVAMAASALAQAQAQVQAQAQAQAKAGA
                     MAAGGGGGGGGGGGGGGSQSSQQQQQQQQQQQQHQQTCFSQGSSQQGAGEGTVAEPKK
                     ATDPRLAKVQRFAAWLADSNIDIEAMVDCTQELISFYECHEQYNDKHTREQISRFIKA
                     RNLDK"
     gene            complement(<1463810..>1465219)
                     /locus_tag="MYCTH_2130717"
                     /db_xref="GeneID:11506999"
     mRNA            complement(<1463810..>1465219)
                     /locus_tag="MYCTH_2130717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666744.1"
                     /db_xref="GeneID:11506999"
     CDS             complement(1463810..1465219)
                     /locus_tag="MYCTH_2130717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666792.1"
                     /db_xref="GeneID:11506999"
                     /db_xref="JGIDB:Spoth2_2130717"
                     /translation="MTDRKSSEDAGHAAGMNRGSGGAGNSSASRRVSLPADFALSPST
                     SGNHPASRRAGARVDNAGNARQPTRLEQQPSAPRPPTGTTSPSADSNGSTLRTTTEHR
                     RLHITPVVFRSRRVRSTRFSRYRGSRPPAPPHDSPVEEWSPDSDDWEDVRTSKQRARS
                     ATPKRAKRATEAEESSDSSDRVGVHPSIYHARSVARRRNTDQSGRRYSGNDSPRTNPR
                     ITDSIAPSPTNQSSASSEEGGQNADDEAVDDVVYDGPPEHPADRRASQASNPRLHLAL
                     QRPTPTSLMNRTAAERATAAAPSIAEAANRAAAALAGASPQQSTPAAVSNSNLPPGVV
                     RAIGPNTRNHGYRISSGHTRKNKRGKDGNLSVHLRWRPDGYVTLSEGSSTNTTPGILT
                     PLPRDDHPQHQQQRQQQQQEVLRLGPGVREPSPPPPPPPPRRPSGQEEKPEDKEEERA
                     EEEEETGKIPYQDGDVYYP"
     gene            complement(<1466121..>1467151)
                     /locus_tag="MYCTH_2121336"
                     /db_xref="GeneID:11507000"
     mRNA            complement(join(<1466121..1466562,1466707..1466973,
                     1467069..>1467151))
                     /locus_tag="MYCTH_2121336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666745.1"
                     /db_xref="GeneID:11507000"
     CDS             complement(join(1466121..1466562,1466707..1466973,
                     1467069..1467151))
                     /locus_tag="MYCTH_2121336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666793.1"
                     /db_xref="GeneID:11507000"
                     /db_xref="JGIDB:Spoth2_2121336"
                     /translation="MTDHGQSTQSGRNMGAQSASQDLQSLDSWLTDRIVTITVGPEEK
                     RWVVHEKLLVSQSDFFRNYFSEGHDEMKLPDDEPRLFALFIRWLYGTAFLPSGGTRNF
                     RFLPPDGVSVSVRDYLGVYVLGGKFGIVGVRNAVLDVLYAYYGEGSGADEHRSPDMHD
                     ITYIFEHTTHDAPMRRFLIAHALFYLFSRGRRGAPLPLDWEQVLSRSAEVGYEMIKML
                     GEWNWVMGANAPRMTIKARTEFHERAPLPEVVKQEADDEEEASPI"
     gene            complement(1468611..1471050)
                     /locus_tag="MYCTH_2316522"
                     /db_xref="GeneID:11507001"
     mRNA            complement(join(1468611..1470415,1470512..1471050))
                     /locus_tag="MYCTH_2316522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666746.1"
                     /db_xref="GeneID:11507001"
     CDS             complement(join(1470113..1470415,1470512..1470787))
                     /locus_tag="MYCTH_2316522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666794.1"
                     /db_xref="GeneID:11507001"
                     /db_xref="JGIDB:Spoth2_2316522"
                     /translation="MSTFYHFTAHQQHPTPAAAAAVSHSHHGGRNRRAPRLSVAQNQQ
                     KQFRGIKSMRELTDTANLSAFRMRFEAGRSFDLEDDMEFCPNLLTESDLVSIHSSASE
                     RSSLASNSPQGSPTQQPTQVASGFMLHSASPAFVPPPYQTQQPALKLHQPSATRPRNA
                     IPIVNPATGISVSSPSPSASPARMQQSVGRRW"
     gene            1475604..1476478
                     /locus_tag="MYCTH_2311805"
                     /db_xref="GeneID:11507002"
     mRNA            join(1475604..1475973,1476067..1476478)
                     /locus_tag="MYCTH_2311805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666747.1"
                     /db_xref="GeneID:11507002"
     CDS             join(1475841..1475973,1476067..1476302)
                     /locus_tag="MYCTH_2311805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666795.1"
                     /db_xref="GeneID:11507002"
                     /db_xref="JGIDB:Spoth2_2311805"
                     /translation="MSARALLSTSNKPFRPSTIFSLTSSTARRSLSQTPRAFLKESAS
                     TDLDPDSLERHKQDSLEKQKRGQGHWKPELASVSEEIVKADRLGPRESGAAAMKRLQE
                     QTKDRAEETSKNRTSMSDGL"
     gene            complement(1476777..1481543)
                     /locus_tag="MYCTH_2311810"
                     /db_xref="GeneID:11507003"
     mRNA            complement(join(1476777..1480998,1481061..1481543))
                     /locus_tag="MYCTH_2311810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666748.1"
                     /db_xref="GeneID:11507003"
     CDS             complement(join(1476941..1480998,1481061..1481331))
                     /locus_tag="MYCTH_2311810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666796.1"
                     /db_xref="GeneID:11507003"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR013129"
                     /db_xref="JGIDB:Spoth2_2311810"
                     /translation="MRTAQHPQAKFDPIPPDLDLHALVERTPNFHWVLRVSAAQIRNI
                     GPQEFERLVFLHVVHGGKPLVIEKWNDRLPKSLFSAEWLERTYNKKPENVRDLTGQTD
                     IPMTLGHYLRSMKILTNQWTPTNFRDERRQRLYLKDMDCPPEWQQYLQRIIPPNLFYM
                     NESIDERSGKGRGDSDMDIFQEGRSIAPAGDLMSSLPEEMRAQNLMCYVGHEGTYTPA
                     HREMCASLGQNIMVDASGDENGEKPGSSIWFMTETKDREVVREYFLSMLGHDIEIEKH
                     FAQINAWKKATFPVYIVEQKVGDFILVPPLAPHQVWNRGTRTIKVAWNRTTVETLQLA
                     LSEALPKARLVCRDEQYKNKAIIFYTLEKYYKEMVEMEKTADIGLLGFGQDLIKNSTR
                     MKQMAADFKALFQLYTRILVDEMFATREKEVEYIEYDSNITCSYCRANIFNRFLTCKH
                     CIRQLVNGDEDTYDICMECYAMGRSCFCVSNLSWCEQWRWSYLVDRYETWRALIIKND
                     GYINLESSPLPLELARKRSGKKSVAQICQEQLRMRPWKDITQVKEPSDREESDVEVDD
                     NGRPVKKRRKRKAKKGDVYRCHVCQHKDYTYKLAFCSNEGCTDAYCYGVLYRAFDLMP
                     QDVMQNEHWQCPKCLKICNCAACRRAGNGVPYIPKTTLLGHDTRRIADDRSVETLVDF
                     RVHNLMWLKSVGDESRSLSSKRMQRLQQAAEAEKAKQAELANQIPALPDGALAETLDA
                     AMQQPVANGFSHQDGTQASGPTPVGDYIAAPGAPDGHHQQNGDHGVPPAEVADMSMVV
                     AEDQSSYPDPSVLGRERMLGMGYYEQDDSPDKILFDPYQAPSADSMLLVDDQPEMSEY
                     FRKQIRIAKRRARQEGDDDPDFQVPRSHHRKRPKLGPEPQRDEQEIALSNMDPALFDG
                     DRTVNDVPTEDQEARPVQSEAPAEAPQQTSEPVESAEETAEVQKPRAYSPNRPALRHA
                     RPKIGYQDDENGEEEFNELVVPRSPRAPEGIASYRPEDANKDPLDLASAAIFTMTSGA
                     TSAAQDSGLAAPPKKRGRPRKSDVSGAQSNAPPVPEPEKPARRRGRPPRARPSLDAEP
                     EAEDDADLDAQLAQQLDAFDETGEVIIRTETTPPNEPVASTGPRKRGRPRRNPPPEAP
                     AKKSEITIELPSQSLVSMADKMRLKGKKFRIGRRENLESAKPQTSPKHDTRGSSTHEA
                     QPQPAAEERGKPGKEQATRSGRDCENEDQDEDFDPNAEEEEVVSDEAGSPSPPPTSSA
                     SARVQPEMLPESDGAFAPSKPDTPPSASSMAAREAPRSTSPPQGSVAGSEGENEPEPG
                     VKLEPSSAAAAVEPTPPSEPSPPPSQPRVPSGPTIVRLGDLDEEEEDSSYGEGGSPSP
                     SGSTSGSDEEEGGVTGAQEPSDSDSDDDEDIPARPTLASRGRGGLRGRGRGRGRGRGR
                     GRGRGM"
     gene            1481607..1483610
                     /locus_tag="MYCTH_2311811"
                     /db_xref="GeneID:11507004"
     mRNA            1481607..1483610
                     /locus_tag="MYCTH_2311811"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666749.1"
                     /db_xref="GeneID:11507004"
     CDS             1482019..1483257
                     /locus_tag="MYCTH_2311811"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666797.1"
                     /db_xref="GeneID:11507004"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="JGIDB:Spoth2_2311811"
                     /translation="MSACRMRLALPLRRAFSFSSQTANAHKPWRPSSLPSSTRGSQCV
                     STPRRLALDLYTGSSRTSPRALVAYHTSTKLLSTATTDPSDPIPGPEYTPPQTGLLSL
                     LPRSWVPYAELIRLDKPTGSYYLFFPCVFSTLLAAPLAAPVTPPPTVLGTSLLFLAGA
                     VVMRGAGCTINDLWDRNLDPHVARTRLRPIARGAVTPFRGLVFTGAQLLAGLAILLQF
                     PPACFFYATPSLLLVATYPLAKRVTYYPQFVLGLTFSWGAIMGFPALGVDLLHNGAAQ
                     AAAALLYSSNVAWTVLYDMIYAHMDIKDDAKAGIKSIALKHDKETKQVLTGLALTQVA
                     LLAGAGIAAGAGPAFFVGSCGGALVTLGVMIKRVNLKSVKDCWWWFVNGCWITGGVIT
                     LGLAADYLVRYAESDGEELA"
     gene            1484630..1485898
                     /locus_tag="MYCTH_2311813"
                     /db_xref="GeneID:11507005"
     mRNA            1484630..1485898
                     /locus_tag="MYCTH_2311813"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666750.1"
                     /db_xref="GeneID:11507005"
     CDS             1484857..1485840
                     /locus_tag="MYCTH_2311813"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666798.1"
                     /db_xref="GeneID:11507005"
                     /db_xref="JGIDB:Spoth2_2311813"
                     /translation="MSHILKAKSKPRDPLQHPSGSPVSPLGASGPGARPPSSSASPFT
                     SKSAGGRKGGAGGEGTANNAPTTTPQAGSSRPSTGAAPGGLNFNLSVPVPVPSVPSFH
                     SRESTRTTTDRTDALWAEMQATLEAVELSAGGTTTTTTASAAAAAATGSARVFGPDHE
                     RKLDELRAAQIALAQAWARSEADEAIETTAGAGAGCGSVAGGKAGEVGAGVSEGRRSV
                     VTDAGGGGAGGRSTVGTGSAARPGSSGLGMAGAGGGGQGGEMEEETEADILLARKRRE
                     ANDRYFQRVSQGVLDVVAKLEDVAIAMRAVEQESKELWGDEDESIQQSAKT"
     gene            1487004..1488605
                     /locus_tag="MYCTH_2316525"
                     /db_xref="GeneID:11507006"
     mRNA            join(1487004..1487314,1487386..1487438,1487515..1487669,
                     1487752..1488605)
                     /locus_tag="MYCTH_2316525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666751.1"
                     /db_xref="GeneID:11507006"
     CDS             join(1487161..1487314,1487386..1487438,1487515..1487669,
                     1487752..1488217)
                     /locus_tag="MYCTH_2316525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666799.1"
                     /db_xref="GeneID:11507006"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="JGIDB:Spoth2_2316525"
                     /translation="MGYLDDEVKRLQGIIANIESRVQALENKQFGASQTKTAEEIRMI
                     LIGPPGAGKGTQAPKIKEKFNCCHLATGDMLRSQVAKKTPLGREAKKIMDAGGLVSDD
                     IVIGMIKEELDNNKECKGGFILDGFPRTVPQAEGLDKMLRERNKELQHAIELKIDDEL
                     LVSRITGRLVHPASGRSYHTTFNPPKVPMTDDITGEPLIQRSDDNAEALKKRLATYHK
                     QTAPVVDYYKKTGIWQAVDAAQPPNQVWNSLLAIFDGDKAKAKSAGSGILNKLASSS"
     gene            complement(1489520..1490226)
                     /locus_tag="MYCTH_2311822"
                     /db_xref="GeneID:11507007"
     mRNA            complement(join(1489520..1489979,1490055..1490226))
                     /locus_tag="MYCTH_2311822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666752.1"
                     /db_xref="GeneID:11507007"
     CDS             complement(join(1489728..1489979,1490055..1490219))
                     /locus_tag="MYCTH_2311822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666800.1"
                     /db_xref="GeneID:11507007"
                     /db_xref="JGIDB:Spoth2_2311822"
                     /translation="MILCRSSRYRFRPSAYDQDVNGLSRQQLEKSEQEKYDLQRRLKL
                     AESGGAFAAHKAATDQIIKNLQRENAMITTAWYDLTSRLQSNHVVLQRRHDAPRSWLN
                     KQRQMVNGRQRITDPPPFSSSSPLLFFLYHALDAEQ"
     gene            complement(1490227..1491099)
                     /locus_tag="MYCTH_2311824"
                     /db_xref="GeneID:11507008"
     mRNA            complement(join(1490227..1490814,1490899..1491099))
                     /locus_tag="MYCTH_2311824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666753.1"
                     /db_xref="GeneID:11507008"
     CDS             complement(join(1490285..1490814,1490899..1491016))
                     /locus_tag="MYCTH_2311824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666801.1"
                     /db_xref="GeneID:11507008"
                     /db_xref="JGIDB:Spoth2_2311824"
                     /translation="MRRNLLDTTRDLEKARKRMQELEREAADRERELLRLKTDLDAIG
                     QDQTAALAALKSSDELISESLRTELEATRKQLAQRAFELEQMKDQLMGALVSKDKVQK
                     RLDDALASSAADQSHGAQAESSQAKGKKEDAEKIEKLRAALKQKIEVSNGAVPTLDSP
                     YMASFLGTSFPDKAVWRPTPASCVPRCCEEIKPEKERTRCRREGWLGRLLRAKAS"
     gene            complement(1493526..1494245)
                     /locus_tag="MYCTH_2311826"
                     /db_xref="GeneID:11507009"
     mRNA            complement(join(1493526..1493720,1493805..1494245))
                     /locus_tag="MYCTH_2311826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666754.1"
                     /db_xref="GeneID:11507009"
     CDS             complement(join(1493594..1493720,1493805..1493986))
                     /locus_tag="MYCTH_2311826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666802.1"
                     /db_xref="GeneID:11507009"
                     /db_xref="JGIDB:Spoth2_2311826"
                     /translation="MRLFTFLVATLTLLSGAFAADIQKSVLVTYPPETPDSVVEQAKK
                     AVVEAGGVITHEYTLIKGFAAKVGEKVIDSVSALGKQYQVLVEEDQEVHHMNGGSVGL
                     "
     gene            1494508..1496052
                     /locus_tag="MYCTH_2084627"
                     /db_xref="GeneID:11507010"
     mRNA            join(1494508..1494841,1494907..1495178,1495240..1496052)
                     /locus_tag="MYCTH_2084627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666755.1"
                     /db_xref="GeneID:11507010"
     CDS             join(1494652..1494841,1494907..1495178,1495240..1495827)
                     /locus_tag="MYCTH_2084627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666803.1"
                     /db_xref="GeneID:11507010"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Spoth2_2084627"
                     /translation="MPATTAETLSLVTRNVSVAPLVLLSVVDHYNRTEAYKSKTKRVV
                     GVLLGQNDGKNVRVSNSFAVPFEEDDKDPSVWFLDHNYVESMNDMFKKVNAREKLIGW
                     YHSGPKLRASDLEINELFKRYTPNPLLVIIDVQPKESGVPTDAYFAVEEIKDDGTTTS
                     KTFVHTPTIIEAEEAEEIGVEHLLRDIRDVAVGTLSTRVTNQLQSLQGLHLRLRDIQA
                     YLQKVLDGQLPVNHAILGNLQDVFNLLPNLSTPKPGASANGAKGDTELNYAMSVKTND
                     QLMAIYLSSLIRAITAFHDLIENKIQNRQQQEEKEAAKKESENGAKEGSPAGNGEAKE
                     GGGDKEKEGSKQKKK"
     gene            complement(<1496112..>1497224)
                     /locus_tag="MYCTH_2130730"
                     /db_xref="GeneID:11507011"
     mRNA            complement(<1496112..>1497224)
                     /locus_tag="MYCTH_2130730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666756.1"
                     /db_xref="GeneID:11507011"
     CDS             complement(1496112..1497224)
                     /locus_tag="MYCTH_2130730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666804.1"
                     /db_xref="GeneID:11507011"
                     /db_xref="JGIDB:Spoth2_2130730"
                     /translation="MTPPPDPSNLASNPPTITTDKANSTKRLPTPRTLLTTLLNAISA
                     IPLAPPPPPPPPPPPPSSSSLSSSSLPPGAATAVNAATGETGRRGRRDENPLRRVPPS
                     HRHLITTLHALFPGLVLPALDLLERGLVAGVVRPHDARREGHGSGGSSSSGGGGDGGG
                     ATGGIEGLPRRARVQGEGEGEGEDGGSEGTGRCSGPRSGKRYAFFIVQSAAAAEARER
                     GRRRKRGGEDGGGEDSRGGLCASALNSGNASIVRLDAWHCNCAAFAFASVQGDGAGSR
                     GCRGVRGDTGMCHDNEHGAALAADEDHVERGAEGPWSFGGLSLDGTGAGAGEGIPVCK
                     HLLACLLADRWHTALGSYVIEKTMQREEMAGILAEI"
     gene            complement(1497393..1498887)
                     /locus_tag="MYCTH_112612"
                     /db_xref="GeneID:11507012"
     mRNA            complement(join(1497393..1498522,1498613..1498887))
                     /locus_tag="MYCTH_112612"
                     /product="Coproporphyrinogen III oxidase-like protein"
                     /transcript_id="XM_003666757.1"
                     /db_xref="GeneID:11507012"
     CDS             complement(join(1497494..1498522,1498613..1498831))
                     /locus_tag="MYCTH_112612"
                     /codon_start=1
                     /product="Coproporphyrinogen III oxidase-like protein"
                     /protein_id="XP_003666805.1"
                     /db_xref="GeneID:11507012"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="JGIDB:Spoth2_112612"
                     /translation="MTSRRPALRLWAQCKARSQLSSTRAVNVSPISRRALSSSSGAGA
                     SDQTSTSLGRYLGWAVVGLFATASLTYKMTINEPLKMDTATLAERDQRLKTEQGVSDV
                     SPMRLRMEKFVKEQQRAIVRALEEVDGTSFRVDEWQRKEGGGGITCVLQDGKVFEKAG
                     VGVSVVYGTLPKPAILKMRANHKNIADENNIPDSLEFFAAGLSMIVHPKNPMAPTVHL
                     NYRYFETANPDGSPGAWWFGGGCDLTPCYLFDEDAVQFHRSLKEVCDKHNKDYYPRFK
                     KWCDEYFYNKHRGEARGVGGIFFDDLDETVSDKENLFAFVRDALESFVPTYIPIVNRR
                     KDMAFTEQEKEWQQIRRGRYVEFNLVHDRGTAFGLNTPGARVESILMSLPLTASWKYM
                     HEPEPKSREARLVEVLQNPKEWV"
     gene            1499869..1501069
                     /locus_tag="MYCTH_2311835"
                     /db_xref="GeneID:11507013"
     mRNA            join(1499869..1499964,1500067..1500226,1500369..1500586,
                     1500689..1501069)
                     /locus_tag="MYCTH_2311835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666758.1"
                     /db_xref="GeneID:11507013"
     CDS             join(1500137..1500226,1500369..1500586,1500689..1500746)
                     /locus_tag="MYCTH_2311835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666806.1"
                     /db_xref="GeneID:11507013"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="JGIDB:Spoth2_2311835"
                     /translation="MRSKFKDEHPFEKRKAEAERIRQKYSDRIPVICEKVEKSDIATI
                     DKKKYLVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDED
                     GFLYITYSGENTFGNFETA"
     gene            complement(1502794..1506000)
                     /locus_tag="MYCTH_2311839"
                     /db_xref="GeneID:11507014"
     mRNA            complement(join(1502794..1503497,1503580..1503894,
                     1503949..1504251,1504306..1505073,1505165..1505433,
                     1505496..1506000))
                     /locus_tag="MYCTH_2311839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666759.1"
                     /db_xref="GeneID:11507014"
     CDS             complement(join(1502970..1503497,1503580..1503894,
                     1503949..1504251,1504306..1505073,1505165..1505433,
                     1505496..1505805))
                     /locus_tag="MYCTH_2311839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666807.1"
                     /db_xref="GeneID:11507014"
                     /db_xref="JGIDB:Spoth2_2311839"
                     /translation="MMASMGPGFSPHPAGMQQHPGAPPGHPMAPSMAHNPSQPGTTAG
                     AMPHQLVGHMAVSGPGPQMNAATLMGGMPPGNPNAHAAMQHLNPAQVQQMFHHPQMNQ
                     MYAANSPAAQQMQQQQRLQALQQQQQARAALIAQHAVYQNLGSAQMGVPMSQMSPAQA
                     AHMAAMSRRMPVAPPFHLQQAQLAQHQQGQPMNTNMLAQQIALQQQQRQQMQMGQQGG
                     NPNQHQMNPQHINLQQAQIAAIQAQQAQHAQQAQQAQQQQQQQQQQQQHQQQQQQQQQ
                     QQQQHQQQQQQQQQQQQQAQQQAAQQAAQAQQAQQQQGQAQPQQQQQQPQQPQQQQQQ
                     PQQPQQQQPPPGQPQQQQSQPGQPGPGASTPAPTPGPPGQTPQPNPQQQPQVPPQTPQ
                     TSQPQHQAQLVAQMQAQVQQQQQHAANMANLAQQQRNLRGMYLLKLMQFSEHLNGFPG
                     SKGRDDLEYWHNFVRMFFSPKGVFKHSILIRDGDDQTQQKHYEIAYPAIPRYFHTHFD
                     SGVKSMQLIMDKGTIDRIMPNDCHMIWNDKTSLVYWFEDGAHLVATGTLRVHFDSEQK
                     FDIFEFETTGHEEYVSRRLVIQAARPSHNWVKEWRNLNAQDPKQSPEMSKKGKPKPAK
                     APPGPPPDIELPHSVVKSNMGITEAVYQFLEMVEIMGQMGPLFGYYHAHPGLAPYAAL
                     DQYLNQINASAQAQSMNGQPMSQGGPRTPGFGQFQGVGASPAMANAMLPGSPHVSGSP
                     APAQMSAPMMQLQASQQGTSSSGPSANTSPAQNSNKRRRPSTVKAEEDTPASAPTPGQ
                     VGTPQLNGVQIKGGKPPTPRMPKRHKTGNNPV"
     gene            complement(1508658..1511914)
                     /locus_tag="MYCTH_2311840"
                     /db_xref="GeneID:11507015"
     mRNA            complement(1508658..1511914)
                     /locus_tag="MYCTH_2311840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666760.1"
                     /db_xref="GeneID:11507015"
     CDS             complement(1508785..1511694)
                     /locus_tag="MYCTH_2311840"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666808.1"
                     /db_xref="GeneID:11507015"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="JGIDB:Spoth2_2311840"
                     /translation="MQPSRPPPRAPGSFSPLPASNSASAADLSRATQTRQGSVSGDEP
                     PPLNVPKTRNPQGPSPIPSSTNLGSGSNNSTTNPQTVSRPTVSTAVSAARSVTGPQSP
                     SDTLPRNGPSPLTLPPAGTSSPVTPTSSSRGFSHSRKHSQNAGLFEPTLPSTSISNLS
                     HVGLGNQSPKRAPAPHRDMSASQIAAQAAVMQHQNQQQQAQQQVQQGVHARQRSQTAA
                     PDEADDAPPNKRASAGSVTLNPPILSLTEASVPRDNAFGGQTYHNGLAGNHTLAAATA
                     ANLVFPRSTQASPGLPTQSITPPPPPPPPASEKPQKPEKSKVKLFSRPVKIGSSRSDN
                     KEKPLPSPGKVGHALANLQRGNFSTTSLDSTSQSFYNFSNSSAATIRPADMAPEKEGK
                     EKEKKHHFLSRQKHKLKDDHHLPLSSAMSNSRPTDPNAPSSLYSFSLPQSPVPNSTSF
                     KSALDLRHGGRAFREKRKEDKSSGFDDVSTSGVASEWPGSSSVTSGSAAQASALYLNE
                     PFDSHKYGLNNMTHDDAWPFLKAKLLVVFEAEDLRLPVEDLNRVVTMHIQYCIARRSP
                     NIIVDDLRDLLVTGFSSLDQTLRKTPEERLIPALVELWIFTFTSILPYMQAVFLPLDL
                     EFSGHGTLMSPEQARDFWGGVPVTTSSADASSGSQKPGRSQSVTVAPASSVLEVRRFV
                     LLAFRDVVILPRYETLKAMFSRLSLEFLPQSLASMALASPPLPIPSPGHHNQSINQQL
                     SGSEPHASTSLPTTLGQYRPGTATSLDPSVASYNSTGSNPFGDSSGSGNRSRAISNVS
                     FGSDSAAHPLRPFTPSSLQHNTISAAASSTLNLALTTTMSNTTTTSHGASSLRDQNVE
                     DSKQVTDMVGRMLQCMSVLASVGVTPLVVAGQSGAGAAAVGRADDSDEANKKIEELNK
                     LLKLNWLGRGRTGRNRRGMVGGRATKRGGSTGVQPPPPTLVPSSWAESGSGAGAG"
     gene            <1512463..>1512765
                     /locus_tag="MYCTH_2121350"
                     /db_xref="GeneID:11507016"
     mRNA            <1512463..>1512765
                     /locus_tag="MYCTH_2121350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666761.1"
                     /db_xref="GeneID:11507016"
     CDS             1512463..1512765
                     /locus_tag="MYCTH_2121350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666809.1"
                     /db_xref="GeneID:11507016"
                     /db_xref="InterPro:IPR014849"
                     /db_xref="JGIDB:Spoth2_2121350"
                     /translation="MAHQQPTLSATYTSTTNEDFDVRLPVTAPADSTTVESKAKYLSE
                     LRQSVTSLQDRINKELTARMEEDKAREASSAVGNGTKVVDDEKEEENYGEEVQEEE"
     gene            complement(1512787..1516642)
                     /locus_tag="MYCTH_2311843"
                     /db_xref="GeneID:11507017"
     mRNA            complement(join(1512787..1513632,1513702..1513810,
                     1513862..1516303,1516368..1516642))
                     /locus_tag="MYCTH_2311843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666762.1"
                     /db_xref="GeneID:11507017"
     CDS             complement(join(1512963..1513632,1513702..1513810,
                     1513862..1516303,1516368..1516449))
                     /locus_tag="MYCTH_2311843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666810.1"
                     /db_xref="GeneID:11507017"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="JGIDB:Spoth2_2311843"
                     /translation="MLSAFTARPIIELKQRDKSKIESILAYGDRVLVGLNTGSLRIYR
                     VNDPSTPPPTDSQPSENPSASQAAPEDSGRATTTTAAQDGQPAPKPAAAKPTDLLREV
                     ERFSTRAIEQLAIIKEANTLVSLSNYAVSLHDLQTLEPIEAPLARTKNASAFAVTSNI
                     IKDPATGIPEIISRLAVSVKRRLLLWSWHESELSPDVTEIVLPESIRSITWANATRLV
                     CGMNSGYAMADVETGNVEDIVGPGAIGGAAGGQGRFGAVSAAGMGYMGLGGYMPKPLS
                     AKLANGELLLAKDINTLFIDDSGKALEKRQIPWQAAPDSIGYSYPYILALQPPAKGSL
                     EIRNPNTLTLLQSIALPGAAALHFPPPTVSLAHAGKGFHVSSDRVVWKMDATDYDTQV
                     EELVRSGKLDEAISVLDMLEDALLKNKRDTLREVKMQKAELLFRQKKYRDSMDLFNED
                     EVDAPPERVLKLFPKIIAGDLSGAEEEKHDESEQESANGKTSSEQEAKPDAAEIASPS
                     RAGGFAKYLMGSRKLNPETASIASSKKGSDDDTASIKGKPQDDQSQAEKDLMASVLAL
                     NSYLAGARTRLQRVIDPTTGKLKPRKSQSGSTEEAFKTLLLSSPDEGDEQLERALQST
                     FRIIDTALFRAYMYSRPTLVSSLFRIPNFCDPDVVNERLLEHNCFNELVDFFYGKKLH
                     SQALSLLRRFGSPDEPDEAAPGLHGPRRTVMYLQGLPPEMIDVILEYSEWTLRKDPEL
                     GMEVFLADSENAETLPRDRVAAFLGGIDPKLEIQYLEHIINDLNDRTPNFHDRLVELF
                     IKQLVGKEERGEERDALMERLVSFLKESEQYGLGKARALIPKDDPPFYEAQAVVLSKM
                     GQHRQALMIYVFKMQDYAKAEEYCNRIHKTQQPPQQTATADRHNVTQDPRTNQPATAE
                     EQPSIYHTLLSLYLKPPPEYSPNLAPALDLLSKHGSRLPATSTLSLVPETLPVAQLES
                     YFRGRMRSANSAVNEARVVAGLRKTALFASQSLLYLGDGIPGGQGGRNRRVVIGEERV
                     CGVCHKRIGGSVVAAMPDNAVVHYGCLGRSAAATASPGVNGVRHGSSRAMSPAGESVR
                     SGYGQWGGRVSG"
     gene            1518192..1521608
                     /locus_tag="MYCTH_2311845"
                     /db_xref="GeneID:11507018"
     mRNA            join(1518192..1518696,1518758..1521045,1521183..1521608)
                     /locus_tag="MYCTH_2311845"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666763.1"
                     /db_xref="GeneID:11507018"
     CDS             join(1518614..1518696,1518758..1521045,1521183..1521325)
                     /locus_tag="MYCTH_2311845"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666811.1"
                     /db_xref="GeneID:11507018"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="JGIDB:Spoth2_2311845"
                     /translation="MKFSHSIQFNAVPDWSNHYIAYSNLKKLIYQLEKAIHLPAGDAE
                     SRPLIRNDDPEAVFSRALDVELEKITSFYVLKEKELLDEVEILLRDVDEFEQEAGVTD
                     DVRPPTRASDRTNNERHRRPSSTHSRHSTEDGRYEDSDDEGDEGAGLTAKRRSISRGR
                     RTSAWHPRLASTDMTASTELTRSMRRMSATYDDYAEQAVLYSSGIMLKKRMINLYVQL
                     CELKSYIQLNRTGFSKVLKKFDKIIDRNLRPRYMETYVETAYPFRPETTKGLEERISQ
                     MVQAYTVIVTNGDAEAAIRDLRSHLREHVVWERNTVWRDLIGLERRAEAASLGHTLLG
                     VDADAQRTRLQGDDEIVLPVMKITTPLGRFALPVWLLSSTTLTLVIIVALFFAVMYVP
                     IMERPEQQNCLAMLVLVSLLWATEALPLFVTSLIIPFLCVVLRVFRGADAPHARLGSK
                     ETTAAVFAAMWTPVIMLLLGGFTLAAALSKCGIDKRIATFVLSKAGTRPKTVLIANMG
                     VAAVASMLISNVAAPVLCFGIIEPMLRNLPAGSPMSKAVIIGIALASNIGGMLSPIAS
                     PQNVVAIGIMEPEPTWGQWFFIAIPVGLLSLVLIWLLLLLAFKPGRSTTIVPVRPVRD
                     PFTGIQWFVSAVTVVTIALWCASHSLEGVFGDMGVIAIIPIVLFFGVGILTKEDFNNF
                     PWTIIILAAGGLSLGKAVNSSGLLHTATKAITHRVEQYSLYGILVVFSSLILVIATFI
                     SHTVAALIILPLVFDVGKGLEEPHPNLLVMAGVLMCSAAMALPTSGFPNMTAIMKEDP
                     AGQRYLKVKHFIRVGVPSSLISLVVTVTVGYVVMRVTGM"
     gene            complement(1522444..1524773)
                     /locus_tag="MYCTH_2311847"
                     /db_xref="GeneID:11507019"
     mRNA            complement(join(1522444..1524187,1524573..1524773))
                     /locus_tag="MYCTH_2311847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666764.1"
                     /db_xref="GeneID:11507019"
     CDS             complement(1522458..1523993)
                     /locus_tag="MYCTH_2311847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666812.1"
                     /db_xref="GeneID:11507019"
                     /db_xref="JGIDB:Spoth2_2311847"
                     /translation="MIFSDLVKSPRTTFTKFRNSFPHGVQPPLDFDPDLVSRDKVKNR
                     EAVNRYLAERVRNDWEFTWPPVVNSASASAEPAASAQDEKAQTANGDPQEAGDGAAAA
                     VEDAPRDPGAEADPESDAESVYSTISEDTTRFRPRAEWTSDLSDDDEPCPSASPFRFG
                     SPDAVGAAVRESIEMKRARRRRAVREEMKWNPGLACFEARRNAWTGAKTVRVKPKPPS
                     PVSPSSARRLFWRHHRTQSSISHSAVVASGSPPGPSSPVSPTATRTSTTTASDSDSGA
                     VQRTVSRDSTAPRVLHPVQTVVPVAPPLLPPQNPMRASVQPAMYSSLYDKVVTQSLQP
                     ACPVNLSDMLRACVVGWKRDGEWPPKSVYPAPAPVEASNAQVLAVRQQKAQQQRNKNA
                     AAAEAAASKGRRLSLVGLFGTGGGTGGGNKTASRTTTTPAATQEANGANNKESKEDEL
                     RRSQSNDDVAGSSGKTLFRRSLQRVLSLGQHGHAHGAVSGNGVEGPLSPTSPTTKEVT
                     AAT"
     gene            complement(1526147..1527536)
                     /locus_tag="MYCTH_2311848"
                     /db_xref="GeneID:11507020"
     mRNA            complement(join(1526147..1527091,1527145..1527536))
                     /locus_tag="MYCTH_2311848"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666765.1"
                     /db_xref="GeneID:11507020"
     CDS             complement(join(1526291..1527091,1527145..1527399))
                     /locus_tag="MYCTH_2311848"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666813.1"
                     /db_xref="GeneID:11507020"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="JGIDB:Spoth2_2311848"
                     /translation="MGETEKETKQDVPAEAAAAEPVPEQSTSQDATLEQARKFLQDAQ
                     VRNTTPERKTEFLKSKGLSENVIQRLMNEVAQDAREESPVSKHTEEERIEPPIPKKED
                     RPPIVTYPEFLTKPARPPPLVTVNGFLNTLYAFGGFSTLVYGASKFVVEPMVQTLTEA
                     RISLHDTANQDVAKLVSKLETVVSEIPPTKSKDIRPLSAASARHDGDESDAASSYGDP
                     TELFHRDVGVQTSPDLEAQSRFHSQQQQQQQHETPTDHQSKRLARLIGSLKSLNDSMT
                     DQTETLGDVRTVMDVLQQDVDKLNAAAATDFVGGYSLYGAASKNEPDDEIKRARENIR
                     RVKGVLLSTRSFPVATR"
     gene            1528916..1531134
                     /locus_tag="MYCTH_2311850"
                     /db_xref="GeneID:11507021"
     mRNA            join(1528916..1530486,1530548..1531134)
                     /locus_tag="MYCTH_2311850"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666766.1"
                     /db_xref="GeneID:11507021"
     CDS             join(1529083..1530486,1530548..1530799)
                     /locus_tag="MYCTH_2311850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666814.1"
                     /db_xref="GeneID:11507021"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="JGIDB:Spoth2_2311850"
                     /translation="MSSRPRRSAAQRATAAITDMADRDRETSEPQHYHQQQQQRTMSS
                     RSSRRSGGGNGIASVARGAPSSSPPSSTGAGDGGVGGQGIDDDQHIHLTLKLPSNKLR
                     QATGGSSTSAGTGTSNGKRKLPGSATATGGASGDKGRAGVADAGSKRARGGKKNYVID
                     SSEEEDDEQGEEDEEDEAEDDEEEEGSEIEVEVAPRNFAKGRGEEEEEEEDGDERMED
                     PGEDDAEGDDDGDEMDVDAEGDEDDDQNPDADGDVDMDVTPTPKLPAIKVTKPSKNPS
                     TPSKVKGAHVTKPTAKGSVAAKKPSASNDDEDGEAEEDEDEELSELESEPEDVTVQVA
                     NGEEDAEGDEEEDVDAEGEEEIEVADEDAEGDEDDGLESDEEEGTSRADTPDLSKLTA
                     RQRAKLGDVSHEYMKLSDGKRPPLTSSPLYGSRLLTYRFPEVQAKKHFTAEELSMRRA
                     EMARRRRNLSEKRNEEVKMETINKLLKKQAPKTNRKTAALMAAEETPETDTQRVDPML
                     IRWVNNKNGSIVAVPDELLSGPVGKVFVTGGTGPRGKMVEEVS"
     gene            <1532955..>1536605
                     /locus_tag="MYCTH_2071057"
                     /db_xref="GeneID:11507022"
     mRNA            join(<1532955..1533872,1533975..1536211,1536341..>1536605)
                     /locus_tag="MYCTH_2071057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666767.1"
                     /db_xref="GeneID:11507022"
     CDS             join(1532955..1533872,1533975..1536211,1536341..1536605)
                     /locus_tag="MYCTH_2071057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666815.1"
                     /db_xref="GeneID:11507022"
                     /db_xref="JGIDB:Spoth2_2071057"
                     /translation="MPSKPDTPLADQLRADFWAWYHRDMQHLLLYKKTFREWAAFTKS
                     DTSKAKPDHDSIAERLKAAAIDAQVAWAEHHAEFERWKAANPAVGPIIANAHQDTKAI
                     RAAEKQKAERADFVRNDLRGKSEKQQQQELARYDHFTRLMAQSREREMWRTRVEAQIK
                     AQAMIEEQNCIAAAAAAAAAEEERRKAEAEELERQRKEAEAEEQRKLADARAAEEERL
                     LREKPAAAAAQAAEKEKAEEQARREATAQRLADESLLLQMLGFPEVNRSGSLGSNTPH
                     DWNGDLFAGVTTDIAAQQWAQENYMSDKICGDPDNFDHQFQEAFQFADDLLLPSNEPL
                     DFDATFAEQDAVLPTGDLLGIDVPTLMQLDTAPAHQVAHLQFSLGGGSRDVMAQKKDI
                     SAERFLPLVQPQIPSVPAAMSSNEAGQPVTTRTQVSAESSTGKKRPSRKRVNPKTQPN
                     ATANPKSIPTAMSSEEAQHQLSEPSFGLGQVMALDPFVTSANTHELPSSGQGTFSLNK
                     PATELTPRDDPAAVSPAGHMSHVADTTAPDQMEHKSFRAQEYSGPSSPKIQQQMSQMS
                     QMPAMDLTSHGTAGPIVQKPPQDPSDYTIFMKRPSQASSPASLSSVQMPSAHISAHAA
                     ATLSLDNNKRKASVSHGAETPTKRRQTVNRQAAVVPIPQSPPVPVSSQGLQTPARTAQ
                     LPAQGLQTPQQQVPIDPALHYGISPPSGGVLFGTSIKAGVCAAIAHIVMEAKLGTVFS
                     QVLLDGPIADFGCPEISGHIKQATKSHLIAVSAAGPEDDRQAFLSGAFKVLQGILHEI
                     EERGSVFGKALLDGPMSGPALMPARKAMSTVYKAVMAEYRSPPRFEGDSVRPTQVQQT
                     PTRMSLARSRISSRSSMGNGSAVAGSPHLPTRPGGPDTFIHGRTTSPQTNGHAASSSP
                     MQPFPMLSAEDGGYPSSNHAYPSPPSLMTGYTVPDCQQPAVSKPAAAQRSSHTHDDVP
                     EPTNYYPQEQQQVLEQQQAGQAPQKSKRASARRKSRARKSSTPAVMPNSQPPTDDNTA
                     TTTMSTTATAAAAATGDTTPSPGGQCIPKLYYRFADGAFYMQLQTASGEVTHHRIGAK
                     GTTAAEAALGRFLAEAGARLGGVAECPAGFVFRAWEGVEENLRALERALSS"
     gene            1538035..1540796
                     /locus_tag="MYCTH_2311855"
                     /db_xref="GeneID:11507023"
     mRNA            join(1538035..1538311,1539137..1539206,1539497..1539630,
                     1539731..1540415,1540476..1540796)
                     /locus_tag="MYCTH_2311855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666768.1"
                     /db_xref="GeneID:11507023"
     CDS             join(1539505..1539630,1539731..1540415,1540476..1540678)
                     /locus_tag="MYCTH_2311855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666816.1"
                     /db_xref="GeneID:11507023"
                     /db_xref="InterPro:IPR000173"
                     /db_xref="JGIDB:Spoth2_2311855"
                     /translation="MTIKVGINGFGRIGRIVFRNSIEHSDVEIVAVNDPFIEPKYAEY
                     MLKYDSTHGIFNGTIAVEGNDLIVNGKRVKFYTERDPANIPWRETGAEYIVESTGVFT
                     TTEKASAHLKGGAKRVIISAPSADAPMYVMGVNEKTYDGKAQVISNASCTTNCLAPLA
                     KVIHDKFGLVEGLMTTVHSYTATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGK
                     VIPELNGKLTGMSLRVPTPNVSVVDLTCRLEKEATYDDIKAAIKEAAAGPLKGILDYT
                     EDDIVSSDLIGNPASSIFDAKAGISLNKNFVKLVSWYDNEWGYSRRVLDLLAYVAKVD
                     AGN"
     gene            complement(<1541320..1545532)
                     /locus_tag="MYCTH_2097277"
                     /db_xref="GeneID:11507024"
     mRNA            complement(join(<1541320..1543237,1545449..1545532))
                     /locus_tag="MYCTH_2097277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666769.1"
                     /db_xref="GeneID:11507024"
     CDS             complement(join(1541320..1543237,1545449..1545465))
                     /locus_tag="MYCTH_2097277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666817.1"
                     /db_xref="GeneID:11507024"
                     /db_xref="JGIDB:Spoth2_2097277"
                     /translation="MDRSRRYEDGEVRRYGAGESYRPFNRDRDRSPPPRVRSPLRDRA
                     RSPPPVTSDSYVPARSPRRRSRSADRFRRERSRERIGGESWRRSRSRARSPPRRSSPR
                     RSPIRRTPPRFVSPRRDDRGLDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDD
                     RRDDRWDDRRDDRRDGRRDDRRDDRRDERWDDRRVDRRDDRKDDRWDDRWDDRRDDRD
                     ERPRSPMRRQFEIRDNRRRSRSPFDRDRLPVHRDRSPPRRSPPPGPRGGGTYRPRSRS
                     PDWRDRDRDDRYVGPSYRRPSPPPLRDSVHSSALPSRSASGRSSPRPASVRRDDRSVP
                     QSPAARSHVSNAPTPTSAAPPARDTPKPAAPPPQPSQPPATSQTVPKAPAADANPTPV
                     KSPPKGPAALRAPPTGPAAARNFTSPVAPQAAPSPRHLPSGPSGPSRHGATSPTVPPA
                     GPRGYVPPRAPSFTGRGGARGSWSAGPPRHSISGGGSQTGSPTISQGGSSVGGIPTGP
                     RAQSASSASASASASPSLGGAKPFNPPTGPSGHMLASHSARPSLAQSLLNTMPPIIPG
                     GKIDPTALPVEMDPHHKRMRDEEERLREELRVKQDKLRKSLRIWDKLERESKGFELKS
                     DLSERSLKNIAGEGLGGAAF"
     gene            complement(<1546295..>1548904)
                     /locus_tag="MYCTH_96869"
                     /db_xref="GeneID:11507025"
     mRNA            complement(join(<1546295..1546635,1546744..1546918,
                     1547041..1547133,1547196..1547259,1547313..>1548904))
                     /locus_tag="MYCTH_96869"
                     /product="histone deacetylase A-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666770.1"
                     /db_xref="GeneID:11507025"
     CDS             complement(join(1546295..1546635,1546744..1546918,
                     1547041..1547133,1547196..1547259,1547313..1548904))
                     /locus_tag="MYCTH_96869"
                     /note="Contains conserved domains
                     Hist_deacetyl[pfam00850], pfam09757: Arb2 A second fission
                     yeast Argonaute complex (Argonaute siRNA chaperone, ARC)
                     that contains two previously uncharacterized proteins,
                     Arb1 and Arb2, both of which are required for histone H3
                     Lys9 (H3-K9) methylation, heterochromatin assembly and
                     siRNA generation."
                     /codon_start=1
                     /product="histone deacetylase A-like protein"
                     /protein_id="XP_003666818.1"
                     /db_xref="GeneID:11507025"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="JGIDB:Spoth2_96869"
                     /translation="MDIIENDVVMDGEDRRMTDGSSAPNGFLDVTTTGESSIPDATNG
                     QGTSGMSRDEDQDSDPTAYPEHLRRRGLLPTGCCYDDRMKLHANADFGPNPHHPEDPS
                     RIEYIMRTFKKNGLVFTGSDAELIRIIQTEPTKYMWRIPAREATKEEICMVHHPGHFL
                     WVEALSRKSTQELRELSTRMDQGRDSLYVGSMTYEASLISAGGAIETCKSVVAGVVKN
                     AFAIIRPPGHHAEFDAPMGFCLFNNVPIAAKICQADYPDLCRKILILDWDVHHGNGIQ
                     NLFYDDPNILYISLHVYRNGEFYPGKPDNPMTPDGGLEHCGAGPGLGKNVNIGWHDQG
                     MGDGEYMAAFQKIVMPIAHEFNPDLVIISAGFDAAAGDELGACFVTPSCYAHMTHMLM
                     SLAGGKVAVCLEGGYDLEAISKSALAVARTLMGEPPPKMEIPKISREAAKVLAKVQAY
                     QAPYWECMRAGIVDVQEMQAQESSRLHDVVRRAQRQVLSEKHGMLPLYIQRDVLFKSF
                     ENQVLVTRGIQSARRILVIVHDPPELHAQPDPLDNTVEAHNAWVTDGVTRYIDWAIEK
                     GFGVIDVNVPHYITHPEDTDAFIPRADERTLQAQVQELMCYIWDNYLQLYDSVEDIFL
                     MGVGNAYLGIKVLLINRLDVKSRVAGVVNFVNGSLRPVKSDVDSDLSSWYKEHSQVYV
                     ANDHACWSDPDLTRKVMKRRFGNVIRAQVNGLTPMMAEYFADVQQFIMERVTSDEGGR
                     DEGEETEEEESGGR"
     gene            complement(1553009..1554558)
                     /locus_tag="MYCTH_2311869"
                     /db_xref="GeneID:11507026"
     mRNA            complement(join(1553009..1553975,1554042..1554259,
                     1554316..1554558))
                     /locus_tag="MYCTH_2311869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666771.1"
                     /db_xref="GeneID:11507026"
     CDS             complement(join(1553368..1553975,1554042..1554259,
                     1554316..1554446))
                     /locus_tag="MYCTH_2311869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666819.1"
                     /db_xref="GeneID:11507026"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="JGIDB:Spoth2_2311869"
                     /translation="MAAVYKSLSKSGSKAEKDTENNGTVERKNKQRVLILSSRGVTYR
                     HRHLLNDLAAMLPHGRKDAKFDSKSKLYQLNELAELYNCNNVLFFEARKGKDLYMWFS
                     KVPNGPTVKFYAQNLHTMEELHFTGNCLKGSRPILSFDGAFESEPYLRVIKEIFLQIF
                     GVPQGARKSKPFIDHVMGFSVADGKIWVRNYEIREVEKVKGDGGGGDDDNGEGEEKHS
                     GRKGKGGGRDTDISLVEIGPRFVLTPIVIQEGAFGGPIIYENKRFISPNKIRAELRRA
                     KASRHVARMEQQRDTLARKRNLGLIDGQKKDQTGLDTRELFA"
     gene            complement(1554754..1556193)
                     /locus_tag="MYCTH_2140896"
                     /db_xref="GeneID:11507027"
     mRNA            complement(join(1554754..1555312,1555380..1555460,
                     1555540..1555929,1556016..1556028,1556105..1556193))
                     /locus_tag="MYCTH_2140896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666772.1"
                     /db_xref="GeneID:11507027"
     CDS             complement(join(1555176..1555312,1555380..1555460,
                     1555540..1555929,1556016..1556028,1556105..1556125))
                     /locus_tag="MYCTH_2140896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666820.1"
                     /db_xref="GeneID:11507027"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_2140896"
                     /translation="MANDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGV
                     EFATRSIQIDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDISKSLSFENVTR
                     WLKELRDHADSNIVIMLVGNKTDQRHLRAVPTEDGKNFASENGLSFIETSALEATNVD
                     LAFQNILTSIYQIVSSKSLAEEGADVGKKFDPREGNNISLSQEGAKKEDKSCC"
     gene            <1557516..>1562167
                     /locus_tag="MYCTH_109232"
                     /db_xref="GeneID:11507028"
     mRNA            join(<1557516..1558493,1558634..1561267,1561400..>1562167)
                     /locus_tag="MYCTH_109232"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666773.1"
                     /db_xref="GeneID:11507028"
     CDS             join(1557516..1558493,1558634..1561267,1561400..1562167)
                     /locus_tag="MYCTH_109232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666821.1"
                     /db_xref="GeneID:11507028"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="JGIDB:Spoth2_109232"
                     /translation="MFQVNPKASFRPAASDKDDSDDSISVTSTVSLHDPDQEYVVEAI
                     LAERQHTNGTMYYLIKWEDYPLHESTWEPESNLGPELKALWEEEKAKHATGELEPFDI
                     RIFEEAQKQARKEKLERHHRRNRKRKRLGLPLTSPFNTDSSDEEAEEESGIETSGADE
                     PVKEALRQSQQRARKRAPSPKPASVSAAGPLIGSSRRLSEGGRPSSVVWEAQTDLSSA
                     VPERRQPVPSRTGYQGSSNKSASTATPDTAPKSNGRPAIALATTTAPPPRPSGTSSRK
                     TFTAKKSAAQPTGNIFTSGKTRKPRASLKDSMSDPTKDPKLFRKHRQRWQAYKRSRDK
                     EDLPPLDVSRLELYDLRRTQSLSAQSPGGFAMSPARVLPSQQENDHGPPLGHSQALTA
                     TIDDPMPAVPGAEAAHQKKKRKSVRFQVSDDSENLYAFVQESEQADHDSPVAQGRSKP
                     SPLPCQLQEPGSDGSAPVPDSQDSDKTLVLGKLLVEATFTGLPRESSSELSWLPDFLA
                     RKTLDFSHTCFSGNAAAKFNSLLKDRLASGTITSKDTDQAIIARVADNLTVRLLALYY
                     GQTEYNVLVYPTKCDEWKSILSGLVPAGPSEAMLGYLIFASPEDCRRMLPSPIPSLQF
                     QSQIIEQPRPNAGVQNGLSARELLLKRLFDFDYNKLLPTVLLERPLAEHYFFLAIPKT
                     RKEIEYTLCHWLRARNPKCQIFTSQQSGGWDAFRSVVETIPGVVIIHEMLAWSLRRFP
                     NLARYLVSRNDEYWCISEPVDGLPLYPSISVAQCPAPPGDVRLTRLFPYRTVFLLTPS
                     FLVSEPRRSLEFFEWFTSQWVGKFAYRLVTAYNIHEYLSELAEDKYRAREEMLKCPGN
                     TQPDIEANLRGLTRDDCSCRYAVANMAADLHLTRLLHAGAEAQDEDNSSLIYADPSID
                     PNDEQSLVNWFGWWATLRADQFRKFHVIGSSQSMKLHGCGRGERFVRIPKYSKVTLND
                     PDAVLEVVQEMNDQADTAKASTHNHDESSLQMPSDRVSRPRFRDGPWSFRSNLIRTED
                     SECFADYLSSLTRLPGGKSLWGLYKFPVSWFDLEMATHFGDFSARYSRIHDWFKFTFP
                     FGRSATDSAAQKWGEKYNTYVGFFYTIIDREWDYPDVVPPQKPLERHPWIAVYRPVNP
                     HRTPYTRCEVIIWDPAARTRYPNGQAPAEKDLIFMQRQLIQHVRYHCDEKNHGTWLDQ
                     ARGWKRVALGPPFDPSPEPSRQQSDSRSFPSDNTSDTDSSSLFVDQHHHQTNDEHFAM
                     DLADVRPSISGNGGKANSEEGEDAEIDLAEYDDEQIRVIFHPPRGNNHSQSRLRNACS
                     SRGAPPFRSRCINRLYEEARLARARNGGGGGGGDGDEGVTHMRYTFVPTLDWYREQQA
                     EGRGFAHVNVDSWEGIFGLLKIGNGGSKGKGAGGGSATATATATASGGGGKSSSRGDA
                     GVDGASTRTRGGADSGWESAGSG"
     gene            complement(<1562952..>1564047)
                     /locus_tag="MYCTH_2070906"
                     /db_xref="GeneID:11507107"
     mRNA            complement(join(<1562952..1563113,1563224..1563275,
                     1563365..1563828,1563910..>1564047))
                     /locus_tag="MYCTH_2070906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666774.1"
                     /db_xref="GeneID:11507107"
     CDS             complement(join(1562952..1563113,1563224..1563275,
                     1563365..1563828,1563910..1564047))
                     /locus_tag="MYCTH_2070906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666822.1"
                     /db_xref="GeneID:11507107"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="JGIDB:Spoth2_2070906"
                     /translation="MMPAIANFKLLSKSLAVLLFSLSLITSSAAGIIPPRIESQSREN
                     GNPSKPSPRRFGFVLPRAFDAVDIFGPIEILQALSRQTHLELALLGRTLEPVTTEPAN
                     AAMNKFNSSFWPRIVPTHTFADSPALDVLFVPGGAAARSPDLGPEIAYVRDVFPSLRY
                     LITICTGAGIAAQAGVLDGHRATTNKAAWDEITAMGPNVKWVSPARWVEDGKVWSSSG
                     VASGIDLTFEFVKQKYENGTAIAQMIAGRIEHVIVSDWRDDPFADQFNVPPSN"
     gene            1565373..1566806
                     /locus_tag="MYCTH_2311879"
                     /db_xref="GeneID:11507108"
     mRNA            join(1565373..1565778,1566032..1566806)
                     /locus_tag="MYCTH_2311879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666775.1"
                     /db_xref="GeneID:11507108"
     CDS             join(1565579..1565778,1566032..1566680)
                     /locus_tag="MYCTH_2311879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666823.1"
                     /db_xref="GeneID:11507108"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="JGIDB:Spoth2_2311879"
                     /translation="MSGATHTHTHAHDGPHSHSHSHDHFNPAEHGHSHEILDGPGSYL
                     AREMPITEGRNWADRAFTIGIGGPVGSGKTALMLALSRALRGSYSVAAVTNDIFTRED
                     AEFLTRHRALPAARIRAIETGGCPHAAVREDISANLAALEDLQATFDTDLLLIESGGD
                     NLAANYSRELADYIIYVIDVSGGDKVPRKGGPGITQSDLLVVNKTDLADAVGADLAVM
                     ERDARKMRDGGPTVFAQVKKGEGVEHIVNLILSAWRASGAEEHRKSVGGPRPTAGLDE
                     LEEGSA"
     gene            complement(1566806..1569611)
                     /locus_tag="MYCTH_2311881"
                     /db_xref="GeneID:11507109"
     mRNA            complement(join(1566806..1569288,1569360..1569611))
                     /locus_tag="MYCTH_2311881"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666776.1"
                     /db_xref="GeneID:11507109"
     CDS             complement(join(1566932..1569288,1569360..1569477))
                     /locus_tag="MYCTH_2311881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666824.1"
                     /db_xref="GeneID:11507109"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="JGIDB:Spoth2_2311881"
                     /translation="MPGAVGGGHHHSHRPTTKVTHKPFKSRHATKGQLRDAAKGRIAG
                     EKGQRKTPHQQVMSKLDRRNQAKQRQLEKAREHQKETSIFSGRDGAPRNVAVIPLCAD
                     TDAAAAIRSLNGSIDIEAEIRDGCFRVPVDRFKQKLQYIPLKRDLAACLDAARVADFI
                     ILVLSAEVEVDALGELILRSVESQGMSTLFTVVQGLNKIEPAKQRLSVVASLKSFITH
                     FHPEQEKVYSLDNRQECSNLMRSLCSTTPKGIRWRDERSWMLVENVEWARAGTAPTVL
                     TGVVRGKGLNVDRLVQVCDWGTFQIEKITAAPLVTRKKRGEDAMEETTEEVLAEPTED
                     QDGLDDLAPEEVVMDDDEDMDAATTMTGPKQGVLLDDHHYFSDDDQVQELPMPKKVPK
                     GTSKYQAAWYLDDDDLSDSGSDLVDLDMQDAQDEEDEARPEDGMEGLAGDTMTEAGPS
                     EYPQSVAFEEPDADEDARALEAYRKSKRTEAEDDLEFPDEIELHPNVLARERLAKYRG
                     LKSLRSSPWLEEEDKAYEPEEWQRLLRIPDYKASRIRAAREALVGGVAPGTRIHVYLK
                     GVPVAIQKSYDPGRPVTLISLLRHEHKRTAVNVLINLGSDYPTSIKAKEELIIQYGPR
                     RFVINPLFSQGGSTPNDVHKYCRFLHPGQSAVATFMGPVVWGSVPALFFKRTVPGSET
                     DAGKEDGEGPALPLTLIATGTTLPPSTSRVIAKRAILTGHPYHIHKKIVTIRYMFFNR
                     EDVEWFKALPLWTKRGRSGYIKEPLGTHGYFKATFDGRINPQDTIGVSLYKRVWPRNA
                     RPLDGPLLDPALLQESREDAMEDDME"
     gene            1569789..1571880
                     /locus_tag="MYCTH_2311884"
                     /db_xref="GeneID:11507110"
     mRNA            join(1569789..1570548,1570609..1571880)
                     /locus_tag="MYCTH_2311884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666777.1"
                     /db_xref="GeneID:11507110"
     CDS             join(1569856..1570548,1570609..1571583)
                     /locus_tag="MYCTH_2311884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666825.1"
                     /db_xref="GeneID:11507110"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="JGIDB:Spoth2_2311884"
                     /translation="METTDAVEAPLAGVEQPNGALTVKNVRTEFRSKAELDRIRRQRQ
                     AQKAYGRGRQIDVKTVRDKKLRRTLSNLENKYKTAVLKAKEAEILLENTAGFLEAETE
                     LERTYKVRQEDIQKEVGIEVAQKKFELKLDALGPYVCEYSRNGRDLILAGRKGHVATM
                     DWREGKLGCELQLGETIRDARFLHNNQFFAVAQKKYVYIYDANGVELHCLKKHVEVSH
                     MEFLPYHFLLATLSISGQLKYQDTSTGQIVAEIPTKHGTPVSLTQNPYNAILHIGQQN
                     GTVTLWSPNSTDPLVKLLAHRGPVRSLAVDREGRYMVSAGQDNRMAIWDIRNFKEAVS
                     SYFTRSPASSVAISDTGLTAVGWGTKTTVWKGLFSKEKPVQEKVQSPYMTWGGDGQSV
                     ERVRWCPFEDVLGIGHSEGFSSVIIPGAGEANYDALEVNPFETKKQRQEGEVKALLNK
                     LQPEMIALDPNFIGNLDLRSEQQRKADRDLDAPPVDIAQEIRNRARGKNGALKKYLRK
                     QRKKNIIDEKRLKVEEIYKELQQKKDEKHKERQAELGPALARFARKD"
     gene            complement(1571895..1573005)
                     /locus_tag="MYCTH_2311885"
                     /db_xref="GeneID:11507111"
     mRNA            complement(join(1571895..1572279,1572423..1573005))
                     /locus_tag="MYCTH_2311885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666778.1"
                     /db_xref="GeneID:11507111"
     CDS             complement(join(1571954..1572279,1572423..1572780))
                     /locus_tag="MYCTH_2311885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666826.1"
                     /db_xref="GeneID:11507111"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="JGIDB:Spoth2_2311885"
                     /translation="MSELNSVVVVTTSIVAFITGFGLGVYAIRGYLISPDLAAQRHAY
                     LNDPVESEESDVDEEETLLDHAPNWANGPEADRRQGLRVGGAGPATRGRAAGLQVSGN
                     EECKLVLVVRTDLGMTKGKIAAQCSHATLACYKSLFRAAQQDALSPEAKILRQWERMG
                     QAKIAVQVKSEDELLELMGKARSLGLTAEVIADAGRTQIASGSRTVLGVGPAPKSLVD
                     QVTGHLKLL"
     gene            complement(1573785..1575981)
                     /locus_tag="MYCTH_2311886"
                     /db_xref="GeneID:11507112"
     mRNA            complement(join(1573785..1575020,1575081..1575981))
                     /locus_tag="MYCTH_2311886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666779.1"
                     /db_xref="GeneID:11507112"
     CDS             complement(join(1573852..1575020,1575081..1575888))
                     /locus_tag="MYCTH_2311886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666827.1"
                     /db_xref="GeneID:11507112"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="JGIDB:Spoth2_2311886"
                     /translation="MDAASIEELNKVRLAMGMKPLPVPGKAPASKEPTPERELGDDGK
                     PLNTLEAREAAAYENFRKVREAEEAKRKREAKAAAIKKARELAQRNAVVEGKGLADDD
                     DEDVDVKSWLKNQKKRQKKIEAARKAEEEKAAAEAKAAEHTAADLAGVKVAHDLAAFL
                     DAEDQILTLKDTGVLENEEEGDELENLALREQEKLQERLELKKKKPVYDPNDIDETGQ
                     GGILSKYDEEIYGKKKKTFTLDAAATSTELADILAAPAQKRKHQTVDLDELEDAPAPT
                     SDYLDPSEVKVKKPKKKKSKATRRRREDDDDVLFPADAPEGDEPAQDVDMDVDSAAPT
                     FTKKPKVVDDNFVDDEDLQSTLARQRKEALKKRKKLRPEDIAKQVRETSEIPEGEEGP
                     EGNGIVMDEVSRFVDGLRAEPDEDRKPRRPKSEEPPAAAVTAMQDESSEDEEMHDADH
                     QPSASREATPLADVPATGVEEEKTVSQGLGATLALLRDRHLIEEGKGAELNEKFRQRQ
                     RFLNELHRRMALFDQEAKAQRERDRASGRLDRMSAREREEWQRQQNALRDQHQARVLD
                     QLFREGYRPEVELKYVDSTGRRLDVKEAFKELSHQFHGKGSGKGKTDKKLKKLAEEKR
                     RMAQSMLDASQNVGMSSAASHQTKKRKEAGVRLA"
     gene            <1578424..>1580831
                     /gene="gla1"
                     /locus_tag="MYCTH_72393"
                     /db_xref="GeneID:11507113"
     mRNA            join(<1578424..1578646,1578718..1579087,1579184..1579257,
                     1579317..1579448,1579514..>1580831)
                     /gene="gla1"
                     /locus_tag="MYCTH_72393"
                     /product="glycoside hydrolase family 15 protein"
                     /transcript_id="XM_003666780.1"
                     /db_xref="GeneID:11507113"
     CDS             join(1578424..1578646,1578718..1579087,1579184..1579257,
                     1579317..1579448,1579514..>1580597)
                     /gene="gla1"
                     /locus_tag="MYCTH_72393"
                     /note="CAZy_ID 268088"
                     /codon_start=1
                     /product="glycoside hydrolase family 15 protein"
                     /protein_id="XP_003666828.1"
                     /db_xref="GeneID:11507113"
                     /db_xref="InterPro:IPR002044"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="JGIDB:Spoth2_72393"
                     /translation="MHALSSLAVLGAWAVQTVLGRPATLSKRATDSFIETETPIAWEK
                     LRCNIGANGCAASGAAAGVVIASPSKSDPDYFYTWTRDAGLVLTGIVDALSQNYSAAL
                     QTNIQDYIIAQAKLQGVSNPSGSLSDGTGLGEPKFNVDLTQFTGDWGRPQRDGPPLRA
                     IALIRYAKWLASNGYKDTANSVVWPVIKNDLAYAAQYWNETGFDLWEEVPGSSFFTIA
                     STHRALVEGAALAAQLGTECSACITVAPQVLCFQQSFWNPSGGYVVSNINGGNNRSGK
                     DLNSVLASIHTFDPAVGCDSVTFQPCSDKALSNHKAYVDSFRSVYAINSGIAQGKAVA
                     VGRYSEDVYYNGNPWYLANFAAAEQLYDAVFVWKKQQSIEVTQLSLPFFKDLLPGIST
                     GTYTPSSSTYQQILDAVSAYADGFIDVAAKYTPSDGSLAEQYTRDSGQPISAKDLTWS
                     YAAFLSAADRRAGIVPAGWSAEHGKTLPGSCSAVQVAGTYTQATATSFPPGQTPNPTS
                     DTPAPFPTACADSTQVFVTFRAEVTTQWGQSVKVVGSSSELGNWDVSKAPRLSASAYT
                     ASDPLWAITVPMKAGQSVQYKFVKVNGDGSIQWESDPNRQFTVSSSSTASGCAWQTIE
                     ATWR"
     gene            complement(1580884..1582595)
                     /locus_tag="MYCTH_2311889"
                     /db_xref="GeneID:11507114"
     mRNA            complement(join(1580884..1581880,1582097..1582202,
                     1582274..1582595))
                     /locus_tag="MYCTH_2311889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666781.1"
                     /db_xref="GeneID:11507114"
     CDS             complement(join(1581080..1581880,1582097..1582202,
                     1582274..1582413))
                     /locus_tag="MYCTH_2311889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666829.1"
                     /db_xref="GeneID:11507114"
                     /db_xref="JGIDB:Spoth2_2311889"
                     /translation="MDPPRTITIGISGCSSSGKTTLARLLRDMFPETFILHEDDFYKA
                     ESELPIKDGFADWDCPESISIPDLEAALAHVRATGTFPPNVNSLEDLNTVGPCPATPD
                     QIAACAAKVRAWLSPNRPGALIFPPKPPSSSSSPPPPPSSSSSLLPSSSSSSDATRPP
                     KTRVCILDGFLLYSPPPSTPTPTSTSTAAAAAAAVSSPLRGVMAQLDVKLFLKASKAK
                     ALERRGARDGYVHVDGFWKDPPGYVERVVWPNYVEAHRWLFERGDVEGGRLDRAVLER
                     EGILTPGLDPDPDGGEAGGESGGGGGEEGGVGVGVGGNQDIEFGKILEWAVEVVMREL
                     ERLCLGEKDGVGKE"
     gene            complement(1582824..1583408)
                     /locus_tag="MYCTH_2316540"
                     /db_xref="GeneID:11507115"
     mRNA            complement(1582824..1583408)
                     /locus_tag="MYCTH_2316540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666782.1"
                     /db_xref="GeneID:11507115"
     CDS             complement(1583120..1583332)
                     /locus_tag="MYCTH_2316540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666830.1"
                     /db_xref="GeneID:11507115"
                     /db_xref="JGIDB:Spoth2_2316540"
                     /translation="MPRGYFSPYAPRRRRSPRLVLIWVSIFLFLLWITWYITTRHKEE
                     AAPYVEEFIHPGRMPRRAKEAAGNAE"
     gene            complement(1583644..1588193)
                     /locus_tag="MYCTH_2311890"
                     /db_xref="GeneID:11507116"
     mRNA            complement(join(1583644..1584097,1584170..1587591,
                     1587709..1588193))
                     /locus_tag="MYCTH_2311890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666783.1"
                     /db_xref="GeneID:11507116"
     CDS             complement(join(1583983..1584097,1584170..1587591,
                     1587709..1588002))
                     /locus_tag="MYCTH_2311890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666831.1"
                     /db_xref="GeneID:11507116"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="JGIDB:Spoth2_2311890"
                     /translation="MNTDEKIYPSGQHYSGSNRIPSIKQFVESLDRQKKDRDAQIDAQ
                     LKANHHHGEVRDHLPADQRKPGKNRRTVRDPTTGKDVEIEDIGSHHMKAADEPMITVP
                     NANLGKETTRQTTSSQSGEEYRVAQDVTAPPDPVAEGATSDVPIHGEKTNVLFHPTPS
                     VSYEPMFASIEARANVLCAFVFLAIVFLGKALGGGSLWALVPLGAAVVSGVFLWAKDL
                     IRQGRAAEWSAEQKRGETAVVNLIPESVEWLNTAVGLIWGLVNPDMFAAVADTLEDVM
                     QASVPRVIEHVKVNDLSQGTNPLRILSLRALPDRHVQDLKEEIHKRDAKVKDPQELAA
                     EEESGDFYNLEAAVAYHSLPSSADVSSKAKNMGMQLVFYLGIKGLFGLPFPIWVELNR
                     LVATVRLRVALEPNPPFVKTLSFTLMGLPKVEASCVPLVEKGANILNLPLISNFVNWA
                     IATAASMYVAPKSMTLDIGKMLVGDNIKKDTNALGVLFIRIHKAVGLSKQDRRGSDGG
                     GSDPYICVSFSKFGKPQYCTRVIQDDLNPIFEESCALPITVDVIKADEQLSLELWDSD
                     RSSADDVVGKVEMSIQKLIQHPGRMFPQVSKLKGVKAGSTMPGELHWEVGYFGKTQFR
                     RALRTDGLDPNLPLALRDRKEMQDDKGSLDTAEEDAVAHTPPDPLWPSGVLSVVVHQI
                     VNLELANIKGSKGGKRSGGREYEPARPEAGEIKEEEGKKLPSAYCTVLINDELVYKTR
                     TKVVSSRPIFEAGTERFIRDWRSCIVTVTVRDSRNREHDPIIGVVPLRLSDVLQTSSQ
                     STRWYPLDGGIGFGRIRLSLLFRSVELRLPPTQLGFGDIGTFEFTSDALTATGGHHPS
                     QHTKIRIRTGGSSATVKAHACRRSDDGTGLTWDISGGAHHPRSSRRVRLPVRFRYRSP
                     VFFEFRPSSSGGPRRRKKADAAFASLWLQDVPDGEERDFDLPIWRCDNGMRLSQNYIT
                     PDNVGSVPDLRVEEVGRLRFRGRFKPGTDRDHLRFVSDNDSRETIESWEACFAEGVRA
                     EHVRPEVPPAVQRLHEESLTHGRDVLAMAPEEEKKKWLAKDGTDWTGAFGEDPAALLK
                     RKKQLDGEAGSVDERGEPTTHGRVVDGVEVENGEGEEDSSGDEVEEEEEEEEEDEVDL
                     GIDDATHDRAKQQRNSVGGPSDEGGEGNYTWRKGGEGGGGSSSRKSTDSKATGATDAT
                     GQPGSSSSKNPIKQYKDYRTRSRDLHRKHRGLMQWKPMRNIQFAKDEAVFATRRLMKV
                     GSLSGRKPDVETEV"
     gene            1589063..>1590598
                     /locus_tag="MYCTH_2311893"
                     /db_xref="GeneID:11507117"
     mRNA            1589063..>1590598
                     /locus_tag="MYCTH_2311893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666784.1"
                     /db_xref="GeneID:11507117"
     CDS             1589603..1590595
                     /locus_tag="MYCTH_2311893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666832.1"
                     /db_xref="GeneID:11507117"
                     /db_xref="JGIDB:Spoth2_2311893"
                     /translation="MSDPRKYTVGWICAITTEAVAARAFLDEEHDGPSTVAKHDNNSY
                     VLGRIGAHNVVIAVLPDAEYGIASAAAVARDMLHSFPNVRIGLMVGIGGGAPSPKRDI
                     RLGDVVVSSGNAGESGVFQYDYGKTIQNQSFQETAFLDQPPMVLRTAVSTLRGTYEMK
                     GHQLVDNVNEALKKIKRRNKYTRPPPESDRLYRPDFVHPAHSTDRCDVTCGNDEANLV
                     IRGERDEEDDDPAIHYGLIASGNQLMKDARLRDKLADDKGVLCFEMEAAGLMNHFPCL
                     VIRGICDYSDSHKNKEWQGFAAMMAAAYAKDLLHQIPVNKIIEERRISEVLGSS"
     gene            complement(1593177..1595767)
                     /locus_tag="MYCTH_2311896"
                     /db_xref="GeneID:11507118"
     mRNA            complement(1593177..1595767)
                     /locus_tag="MYCTH_2311896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666785.1"
                     /db_xref="GeneID:11507118"
     CDS             complement(1593583..1595442)
                     /locus_tag="MYCTH_2311896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666833.1"
                     /db_xref="GeneID:11507118"
                     /db_xref="JGIDB:Spoth2_2311896"
                     /translation="MSSTSSQSPPKRPRLSLQIKALANGPSVRTSRCLAAAVDVTSPT
                     SFNTLSNVYATAIDRSTPIQEVPPTAIPCRRPMLKLQTQDVAASNGAAHNTPYLGPYL
                     DTPVTSQAVSPAVAKQVFFPSAMTATPPLSAQPHEQGGAQVFFTSDGTTPVTALSRGV
                     NPPAQQQSTQNSSNSNKRRTTMPVGSGAKLPYIHPRSLRSILRNSPLPPSSAKSPESP
                     RRQSRRLQEKALRRVAYNSPLEQEITTSRYTKSHIDLLAEEATPISPSASSSDDGDSL
                     DQAMADAASGDNTRDGGQTPGPFEEMRRRMAGMHASSPTALSPTGGGIRKRGSKRREK
                     KRRWVWTIGQDEDGEDAEGADAAPAVADENVPAPPSVPLLSIPAPRPRTRSQQAQLAK
                     AVAAATGGQPQQQQQQQTQVPLLAVPVAPARAATANPPAQPPTPAPEAPPSPAPQESQ
                     PEPQPQPHPLPQQQHQQQTARELTPIPASLVPTRPSTPDTGDRVPSCATDARHATPEG
                     MIEPPTPGMESTTSACSSQHSGREEEEEGEDGDVDMSDASSFTSVEDVATAAPTARDF
                     HHHHHPYTHKKGTADVLRGDADVEMDDGTPTMTARPVGAGGGRGWVPWRDAAP"
     gene            1598049..1600184
                     /locus_tag="MYCTH_2311897"
                     /db_xref="GeneID:11507119"
     mRNA            1598049..1600184
                     /locus_tag="MYCTH_2311897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666786.1"
                     /db_xref="GeneID:11507119"
     CDS             1598252..1600027
                     /locus_tag="MYCTH_2311897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666834.1"
                     /db_xref="GeneID:11507119"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="JGIDB:Spoth2_2311897"
                     /translation="MPIAQAKKVCPDLVLADGEDLSPFRDVSKRLYALLRSYSWNGKV
                     ERLGLDEMFLDVTDMVSYNLELLNRNALPQSYFCLSRSDPEVGFEYDATSFAGCVHGN
                     RSSSSSSGGGGGGGVDGDDAIQPQESVLYMRLLVASHLAFYLRMKIEEQGYTTACGIS
                     TSKLLAKLVGNRNKPRNQTTLLALCQEDVQSFMDEHSLRKVPGIGGRITRLLEGFVLG
                     REPDPDTHTMECSTTVGQVRTHPGISPSSLSRLLSGRGLEKNVGPKVWALLHGVDDSE
                     VQPARDIPTQISIEDTYRGLSSLSEIRRALLAVTVSLVRRMHADLLEGEDEDVDDGDH
                     DDDDNKPPDRAAATATPSSRRRRWLARPRTLRLTTRPYTAPQDEKPYNWGRASRSCPL
                     PSFVFNTSLPREERAARLVNETLLPLFHKLNPPSPPLPPPPTAVARAGTGPSAPGPPE
                     PGGWNIGLLNVCVTNMSAGAVDGGGGDISQLFRRQQGGLPSRESPPRGPPPPGAGHTV
                     GGNGSLEEELTMEEGGDGESAVAPREWNDFGGDKVVVEEEDEDMWDSDEDTPHEDSAL
                     CPLCDRLLPRFAMSAHERYHSLGDA"
     gene            complement(1601108..1602907)
                     /locus_tag="MYCTH_2311899"
                     /db_xref="GeneID:11507120"
     mRNA            complement(1601108..1602907)
                     /locus_tag="MYCTH_2311899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666787.1"
                     /db_xref="GeneID:11507120"
     CDS             complement(1601126..1602607)
                     /locus_tag="MYCTH_2311899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666835.1"
                     /db_xref="GeneID:11507120"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Spoth2_2311899"
                     /translation="MNQAASQQSYQQPYQEADREDSPGVPGAELLDDYEQRYLNSFFG
                     SVASASNGTPLAAQALGGLCTQDWMKPADVVGHVVRFGDPDNALLSEAFGMFDFSPST
                     DLGIAASTTPGFPDNYQSQNGSAFQQFQQSQQSEQTQSYYDSLHTPDAVAAAATLVGR
                     GSMPFGLYPEVSHSLTTASQTMVSSQPDPFTLGNGRYGTQAQMSMARRTSNAPRTLSV
                     DVQYGSDPNFTDTSFVPPSAKETTEAITAEQLAHLRCLEPSHSAAPTRAASPTSWGAQ
                     YSSNEASRNSVVVPVRRTVSHNPPPPDEPPTRRRRTSKMGEAPVDAEQAMPTPVSPTA
                     PPLTQRKRPSAASPPPAPPSGTAPPQNGDKPSAASASESNGTPSDPTQTKRQRKSGTG
                     KSGAGRKKSPRTTLTPEQRRQNHVGSERRRRDFIGRGYDHLMAIVPGLMNGAAPSKSV
                     SLNLVADWIEELHRGNQTLENMMAFTFGQASGSTAPSASAAAA"
     gene            <1604824..>1605189
                     /locus_tag="MYCTH_58485"
                     /db_xref="GeneID:11507121"
     mRNA            <1604824..>1605189
                     /locus_tag="MYCTH_58485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666788.1"
                     /db_xref="GeneID:11507121"
     CDS             <1604824..1605189
                     /locus_tag="MYCTH_58485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666836.1"
                     /db_xref="GeneID:11507121"
                     /db_xref="JGIDB:Spoth2_58485"
                     /translation="RRVRSMAVSTSQRRRWDSDIPTVFRPLVRAYLFGYASAVGPRLL
                     TLLLQHAARHRRSKQQQTGPTPDPQRDEPFLAGLRRILLGPLSCRSFPTSCAVLIGGA
                     TFLEVCPFQRAFHAPASFQ"
     gene            1605332..1606863
                     /locus_tag="MYCTH_2311901"
                     /db_xref="GeneID:11507122"
     mRNA            1605332..1606863
                     /locus_tag="MYCTH_2311901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666789.1"
                     /db_xref="GeneID:11507122"
     CDS             1605682..1606473
                     /locus_tag="MYCTH_2311901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666837.1"
                     /db_xref="GeneID:11507122"
                     /db_xref="JGIDB:Spoth2_2311901"
                     /translation="MWTWIYLPSRLPRAYNKWIASAAAVDARLITALQRCREGSLVYG
                     KDTGQAPLLGSMCADYGWPAAWGDPAQSVPFPCEMVHMGCGPSCEYHALSRFVRSFRW
                     AMTTYLPLTLLLAARGGRGGAAKALRRALLSASRSSAFLATFITLFYYGVCLARTRLG
                     PRVLGRDAAACQRVDGGLCVAAGCVLCGWSILLENAARRKDIALFVAPRAMATLFPRR
                     YPLDEQWRETLAFAASAAVVMAAFAENRASVRGVAGGVLGWVFRE"
     gene            complement(1607096..1609299)
                     /locus_tag="MYCTH_2311902"
                     /db_xref="GeneID:11507123"
     mRNA            complement(1607096..1609299)
                     /locus_tag="MYCTH_2311902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666790.1"
                     /db_xref="GeneID:11507123"
     CDS             complement(1607149..1609272)
                     /locus_tag="MYCTH_2311902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666838.1"
                     /db_xref="GeneID:11507123"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Spoth2_2311902"
                     /translation="MLTWSWFSAVAVLLLLWLYLYGFGYGFGYGPGRQRVSGPPLDVG
                     KDDAEKPAATTATTATATTTTTKTTATDTVTTTTTAAPTAGPMPTTHKPGGTAAARPA
                     VVLRQGTYIGTTLLASHRFPRALDAFRGVPYAQDTSGPNRFRPPQPLPESTEVFDAVR
                     WGKICPNDGVVLRNMSENCLNANIYRPAGLVDRDGYEKTADGTRRRPRLPVVVYIHGG
                     GFNKGNGTERNMASFAAWSKEPIVSVSFNYRVGALGFLPSDVTAREGLLNLGLRDQQM
                     LLDWVQENIEAFGGDPKNVSVMGLSAGAHSIGHHIMYYSSRSTPPPFIKAILESGATT
                     ARAVFYPTHPRHLVQFREFLIAAGVAGIPESELFDHLRKLPLETIVRASKVVWDKYVD
                     SVTWPFQPVIDSPNHLAQSSHAELDAPRPPLIPDLPIKSWLAGNHLRIPVITGFSTNE
                     GTMFIPHNADTAADFRSFFQTLIPTLTPGDLDELEALYPDPVRVPTSPYRRGIPPGAG
                     RQWARLDAAYSHYAYICPVLQTAHYMSLSGVGPVYVYRYAATSSNGTANHGDEAPAVA
                     HDVMELRGRVGMRAIARAMHGRWARFVASDASSPDIISAHQHPHKKERSGSVNDADDY
                     DEVEWPPFVSPFGPDGDREGTGKIMVFGEGNDEMGGGWHRGVPAKVVEMTELEKEACR
                     FWWPRVWLSEGMGWKDGKRSAEVRL"
     gene            complement(1610630..1613145)
                     /locus_tag="MYCTH_2311903"
                     /db_xref="GeneID:11507124"
     mRNA            complement(join(1610630..1612546,1612626..1613145))
                     /locus_tag="MYCTH_2311903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666791.1"
                     /db_xref="GeneID:11507124"
     CDS             complement(join(1610811..1612546,1612626..1612893))
                     /locus_tag="MYCTH_2311903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666839.1"
                     /db_xref="GeneID:11507124"
                     /db_xref="JGIDB:Spoth2_2311903"
                     /translation="MATTPRPRPCAELDIHDDHSHYTTTALGELSLNKVHNIRRKTSV
                     ESLARRLDNFHIHNSDKENKSRLRSAGAASQDPVFEGAQEPKSPQDFENGNPLALASQ
                     QVRSTKEQLLRHQEGQFEWLLSVPVKTAAKERRPRGDSHGDAELGRGEKTLYFGCNLV
                     NRKPQSDGILEDGESTDIYTLLATRVKAEEDFIIERAPVFDEMEATAADQPRLGDDTG
                     ASKASSVPVAGVNGVVASASDDSGEHSRPLSRIEDSVEALDKLEEEIEAVAEVAQLER
                     VLSPEAASQNSNAASAKSTPVKRATSVRAPPDPAKSKTVGRSSSVRNKTTSSGDDEKA
                     TTSSARKVPRPASLLPPKPLAKSSKPPTTSNFELPGEAVARQLKERRAQRLSQQISAE
                     QAAALAAAYSPSRPHVKSSKPPTRPTFELPGEAISRRKREKREAELRAQEEEERKRRE
                     FKARPIRASLVPTTVPRETLASLARQKARATTEGSADSASTTVTPVSKKRQSATITTP
                     SSTCATRTTTPAGSAAATLPIRGRNPTASAVSDSAGQPAASPAPRAASTSSSAAASTH
                     SRASKVSAEEAAQQKLRGKEVFARDNSLTAEREREKRERERAAKEAREKAAERSRELS
                     RQWAEKQRLKKEAERRKGGEGTGAPASSSSSPSPAAAAAAAAV"
     gene            complement(<1613901..>1614404)
                     /locus_tag="MYCTH_17562"
                     /db_xref="GeneID:11507125"
     mRNA            complement(join(<1613901..1614019,1614071..1614130,
                     1614197..>1614404))
                     /locus_tag="MYCTH_17562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666792.1"
                     /db_xref="GeneID:11507125"
     CDS             complement(join(<1613901..1614019,1614071..1614130,
                     1614197..>1614404))
                     /locus_tag="MYCTH_17562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666840.1"
                     /db_xref="GeneID:11507125"
                     /db_xref="InterPro:IPR013963"
                     /db_xref="JGIDB:Spoth2_17562"
                     /translation="FPSRPLASHVRQPSLSANAGGQSPALVARVNEKKAELENLKELR
                     DLSAAVATQMEALEQKLATLSDGTEAIALVLSNWHNVLRAINMASAKLPKLAAEPGDE
                     DQPPLPQTLVRIPTEHAPALQAHAEGA"
     gene            1614720..1617662
                     /locus_tag="MYCTH_2311906"
                     /db_xref="GeneID:11507126"
     mRNA            join(1614720..1614906,1614969..1615410,1615462..1617662)
                     /locus_tag="MYCTH_2311906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666793.1"
                     /db_xref="GeneID:11507126"
     CDS             join(1614855..1614906,1614969..1615410,1615462..1617304)
                     /locus_tag="MYCTH_2311906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666841.1"
                     /db_xref="GeneID:11507126"
                     /db_xref="InterPro:IPR011515"
                     /db_xref="InterPro:IPR011516"
                     /db_xref="JGIDB:Spoth2_2311906"
                     /translation="MARLNEAPVPAESHLEILRRKFLRQNRDIAKINSDQSQKIRRLE
                     NDCARLLSENLELRSQILRLEKQLEDNSARRIADHALEVKAKLEAQLSEFAALLGSLG
                     VEPPSKRRSSGDRTLPKSRQSMARSPPQRRRRNTSIDLEALAEMEGRLPPIYENKTYP
                     RATMGSDEIMALCAAAEDNNDNDSSDLGPLPVSRYIEDNSATNSPTKAIETHAPESPM
                     QPVTDSLHSQLDQVGQPPESPEPEKETDDVAIEEASPIEQAAPEESAAPEPSPQPARP
                     GVKRKYGDEDGTIQSVTPVVAGKENDVPTEKSFPARAGPKRRSLADLASVKPEKKSAR
                     APLSAKRTPLAAKSTNEDMSSPRKAIKATPLKDAKKERQRIPGDTAMQDEGNAPKPPV
                     EIVIPADHSLLESATSLPSENPSSPTTPPRSAQREMLHDTPPPADISSTGETTRPTRR
                     ARAPISYAEPNLRDKMRRPTKELFDAVTGEGKYAHRIALQLKSDGHQSAPTSVSKAKM
                     EPGSSTGSSSKTSSFSDRAPTAQQAALLSPLAQKDALPDSLQSTVVMERRKRTSAAAG
                     GNRTSLAAQEKPDSASREPSPAIVVGHPEGGTQTSNSRRRTSVAKANNDNQQSRSPPP
                     AAEVDIYDFTASSPAIPSSKAPVPDTSSQLKSTSSHPAITTQIGNPPGSRLRTARKSS
                     MAAAAALRELLDEEENEAESEPQRQSAPPRSRTAHGGRKRASMLVPKKTSMLLEEGLE
                     DDSEAADADTSGTSAEGDIGSGSGIGGGRISRRRSMML"
     gene            complement(1617667..1619065)
                     /locus_tag="MYCTH_2311907"
                     /db_xref="GeneID:11507127"
     mRNA            complement(join(1617667..1618232,1618326..1618757,
                     1618914..1619065))
                     /locus_tag="MYCTH_2311907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666794.1"
                     /db_xref="GeneID:11507127"
     CDS             complement(join(1618110..1618232,1618326..1618757,
                     1618914..1618982))
                     /locus_tag="MYCTH_2311907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666842.1"
                     /db_xref="GeneID:11507127"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Spoth2_2311907"
                     /translation="MAFLILVIGDLHIPDRALDIPPKFKKLLSPGKIAQTLCLGNLTD
                     RATYDYLRSISPDLKLVRGRVDVEATSLPLTQVVTHGSIRIGFLEGFTLVSDEPDVLL
                     AEANRLDVDVLCWSGGTHRFECFEYMDKFFVNPGSATGAMTTNWASGGDGTGQEEAVV
                     PSFCLMDVQGISLTLYVYQLRKGENGAENVAVEKVTYTKPVEPTGAS"
     gene            1620109..1622252
                     /locus_tag="MYCTH_2311910"
                     /db_xref="GeneID:11507128"
     mRNA            join(1620109..1620652,1620725..1621350,1621403..1621761,
                     1621824..1622252)
                     /locus_tag="MYCTH_2311910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666795.1"
                     /db_xref="GeneID:11507128"
     CDS             join(1620342..1620652,1620725..1621350,1621403..1621761,
                     1621824..1621907)
                     /locus_tag="MYCTH_2311910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666843.1"
                     /db_xref="GeneID:11507128"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="JGIDB:Spoth2_2311910"
                     /translation="MVLLPEVSRSLFRRLRVPASMPRQNPPDTGKHPARLSLISRHLA
                     PVYPINTPYTVERLPDTIETSLLPKAQSRKMSSQPPHPTLLIPGPIEFDDAVLQSMSH
                     FSESHVGAGFVAKFGETLSMLRKLFQTTDPSAQPFVLSGSGTLGWDLVAANLIEPGED
                     VLVLGTGYFSDGFADCLRVYGANVTELKAPVGTKPQLPEIEKALSEKKYKAITVTHVD
                     TSTGVLSELKQLSALVHRVSPETLIIVDGVCSVACEEIDFDGWGLDGVVTASQKAIGC
                     PAGLSISMFSGRAMKALENRKTPPAAYFASMKNWTPIMKNYEAKKPSYFATPSPQLIH
                     ALHTALKQILASPLSDRFAAHKTASDKVKKAITDLGLKQVAANPDEQAHGMTAIYLPE
                     GVKGADLLAILAKKGVVFAGGIHKEIATKYIRFGHMGVSVLDPKRNDIDHALKALEES
                     LVECGYKKA"
     gene            1622254..1626462
                     /locus_tag="MYCTH_2311912"
                     /db_xref="GeneID:11507129"
     mRNA            join(1622254..1622551,1622624..1622653,1622748..1622820,
                     1622880..1622951,1623012..1623733,1623795..1624554,
                     1624620..1625090,1625150..1625379,1625438..1625585,
                     1625643..1626063,1626126..1626462)
                     /locus_tag="MYCTH_2311912"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666796.1"
                     /db_xref="GeneID:11507129"
     CDS             join(1622486..1622551,1622624..1622653,1622748..1622820,
                     1622880..1622951,1623012..1623733,1623795..1624554,
                     1624620..1625090,1625150..1625379,1625438..1625585,
                     1625643..1626063,1626126..1626363)
                     /locus_tag="MYCTH_2311912"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666844.1"
                     /db_xref="GeneID:11507129"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="JGIDB:Spoth2_2311912"
                     /translation="MPVSIEELDATVRAFYEGRGEQQKAAQAALNQFKEDPDAWLMVD
                     EILSRATYEQTKFLGLQVLDNVIMTRWKVLPREQCQGIRNFVVQYILQCSSSEEALKT
                     HRTLLNKLNLVLVSVLKQEWPHNWPTFINEIISACHSSLSVCENNMIILRLLSEEVFD
                     YSAEQMTSTKTRNLKTTMCAEFSRIFQLCQEILNSATQPSLIKATLETLLRFCNWIPL
                     GYIFETPLIETLRTRFLEVPEFRNVTLQCLTEIGGLQTGGPGQINSYDEQLVKMFTEV
                     LTSISNIIPLDMDLKTTYPQSNSRDQEFIQNLALFLCNFFSMHLPLIENLPNRDFLTH
                     GHFYLIRISQIDDREIFKICLDYWLKLVQELYEEMQSLPISDMTSMSLGMMGGGAPNP
                     ALLNNYPLRKHKYNEVLSNLRVVMIEKMVRPEEVLIVENDEGEIVREFVKETDTVQLY
                     KTIRECLVYLTHLDVVDTEQIMTEKLARQVDGSEWSWHNCNVLCWAIGSISLAMNEET
                     EKRFLVTVIKDLLGLTEMKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKLF
                     EFMHESHEGVQDMACDTFIKIAKQCRRHFVALQPSENEPFIEEIIRNLGKITCDLTPQ
                     QVHTFYEACGYMVAAQGNRNQQERLLTDLMAIPNAAWTEIIKQATINPAILQDADTIK
                     IIGNIMKTNVSACSSIGPYFYPQIGRLYNDMLQMYAATSQLISEAVAREGEIATKMPK
                     VRGLRTIKKEILKLVETFVDKAEDLQAVRTQMVPQLLDSVLVDYNRNVPGARDAEVLR
                     AMTAIITKLSGLMEDQVPVIMENVFECTLDMINKDFSEFPEHRVEFFNLLRAINLHCF
                     PALLKLDNRQFKFVIDSCLWASKHDNRDVETAGLNMCLELINNIAEKTDVRTCNAFFN
                     QFFITILQDVFFVLTDQDHKAGFKTQSMLLMRLFYFVHPADGTQPKIQGPIYQPDQAQ
                     PGTGNREFLANFVSTLLQNAFANLTPVQITSFVEGLFTLNTQYDKFRLALRDFLISLR
                     EFAGDNAELYQVEKEQQERDARAADLERRSKVSGLLKPSELEEDEL"
     gene            1628029..1632621
                     /locus_tag="MYCTH_2311917"
                     /db_xref="GeneID:11507130"
     mRNA            join(1628029..1629156,1629222..1631228,1631328..1632621)
                     /locus_tag="MYCTH_2311917"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666797.1"
                     /db_xref="GeneID:11507130"
     CDS             join(1628505..1629156,1629222..1631228,1631328..1632331)
                     /locus_tag="MYCTH_2311917"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666845.1"
                     /db_xref="GeneID:11507130"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="JGIDB:Spoth2_2311917"
                     /translation="MFMALRPQRGGGSHVPNRDQRPHLAAPRHQGQAGPATGRYKSAS
                     RVSEIDAWDNMQNHELQNDSSSSDEDLHPRRHQAPSRPRHTRSVSHPFPSFFSSIKRK
                     RSGTMAAGPDESGSDSMGEGPRGGLGGRPLPLQPPQQQQPSGRGHRTGSSVGSRDVAT
                     GNCMTCGSPVEWPRELLVYRCYTCHTINDLQPLDRDARREDSRDEAVIFEEQSSGSKD
                     KTISLGYTKSLVKQCLRSFLASALRDRAGGAATDKELPVVLPTSHLSPDHLRVPPPPP
                     AVPLALRPKASLDFEPRPVPGRPKELGLHRRAPSWAGTMSGTFSTSFPEKEVTLQRDP
                     RSHGTGSRPRRPSPSPGEDVKSIFRPLEDYVVQCFTSFQCLNSSFLTPRSQPAGYSGP
                     EARHRRPSEHTGVRSRETRTTSYPVPEIDPKLLLLGDFAENGTWWTGHEEVRPGRTPS
                     GRNQHSPSIVSSRSPHIDWTELEEWYTTVIDAARFWPGVYESLVAEDPSLAAAPPVLQ
                     DLERRIVAGQEHVQEVLLKASERVLVRPGRRLTEPRDLRFLLIITANPLLHSSYKPYV
                     GRTAPPTQSSPSPRGTGPVSGRHSGIIKRIIGLMSNASEECRNRLVAWFARYPEHAFV
                     QTKDLVAGFLAYRLIREKEKKYQGQIDYTGGLIPDIGPSHSPAALHAALGSRQTQRSK
                     KQQDKKKKKVVYRVDWRIKAAAQVLGLLFAANNMGHVRRGSSGRSGSPGGSHRGLVRS
                     PGQILATSDFYVTLLDDSDLVGDFEAWERKLERFSFCQHPFLLSIGAKIQILEYEAKR
                     QMENKARDAFFDSILTNRVVQQFLVLNIRRECLVDDSLKAVSEVIGSGGEDIKKGLRI
                     NFKGEEGVDAGGLRKEWFLLLVREVFNPDHGMFLYDEDSNYCYFNPNSLESSEQFFLV
                     GVVFGLAIYNSTILDVALPPFAFRKLLAAAPPPSVPTAQPRQPMTYTLDDLAEYRPRL
                     AHGLRQLLEFEGDVESTFGLDFTIDTTRYGAVERVLLCPGGDRRPVTNANRREYVDAY
                     VRHVLDTSVARQFEPFKRGFYTVCSSSGGGSASVSALSLFRPEEIELLVRGSAGASDQ
                     TPLDVPSLRAVAQYDGWKTATPDSYGDGDGDGDGDNDDTKEPTVRWFWEAFESAAPRD
                     QRRLLAFITGSDRIPALGAASLGIRISCLGDECGRFPTARTCFNSVGLWRSTDRERFV
                     STLWRAVWESEGFGLK"
     gene            1634546..1636318
                     /locus_tag="MYCTH_2311919"
                     /db_xref="GeneID:11507131"
     mRNA            join(1634546..1634673,1634895..1636318)
                     /locus_tag="MYCTH_2311919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666798.1"
                     /db_xref="GeneID:11507131"
     CDS             1634929..1636131
                     /locus_tag="MYCTH_2311919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666846.1"
                     /db_xref="GeneID:11507131"
                     /db_xref="JGIDB:Spoth2_2311919"
                     /translation="MSNNTTGGEDDLPTPTDTSPSPTDTTDEPQNPQGPTSTPTDSPD
                     DPTPTPPTTSTTTTTTTRPTTSSPPATTTDRPQPTSTSSSDEGEPPAETTSSSSDNPI
                     PTSSSVPNNPGPSTSTQTRYTTVTTGLPPTSQTSSSSTPSPTSTSGSAIEPSDTPSSG
                     LSNSATIAVAVVVPVVAVALLSLLGIFLWRKRKQRRDAEEQRRKEVEDYGYNPNADPT
                     IPAVAGSAYEMREDDSAGYRGWGSTAAAGSTGRKASTTMSGGAGASYSGATSPTRADA
                     RSGEPLMGDAPPSPEGEILGAMGPSAANNRSDVRRGPSNASSSYSAAGQSDGSGEGPI
                     GVAYGGSNPYYDQYGAGNPYVDNGYGGQPVEAGGSPVIRDVPARRNTRIESSSHYPQP
                     TAGIAQNF"
     gene            1637085..1639495
                     /locus_tag="MYCTH_2311921"
                     /db_xref="GeneID:11507132"
     mRNA            join(1637085..1637294,1637393..1637459,1637562..1637770,
                     1637858..1638448,1638531..1639168,1639275..1639495)
                     /locus_tag="MYCTH_2311921"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666799.1"
                     /db_xref="GeneID:11507132"
     CDS             join(1637270..1637294,1637393..1637459,1637562..1637770,
                     1637858..1638448,1638531..1639168,1639275..1639367)
                     /locus_tag="MYCTH_2311921"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666847.1"
                     /db_xref="GeneID:11507132"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2311921"
                     /translation="MQAPVLVMNTQSGDRQTGRSAQLSNIAAAKTVADIIRSCLGPKA
                     MLKMLLDPMGGIVLTNDGHAILREIEVSHPAAKSMIELSRTQDEEVGDGTTTVIILAG
                     EILAQALPQLERNIHPVVIISAFKRALKDALQIIEDISLPIDVNDDKAMYQLISSSIG
                     TKFVSRWSELMCSLALKAVRTVTWDVGNGKREVDIKRYARVEKVPGGEIEDSRVLDGV
                     MLNKDITHPKMRRRIENPRIILLDCPLEYKKGESQTNIEITKEDDWNRILQIEEEQVK
                     AMCEHIIALNPDLVITEKGVSDLAQHYLMKANVTALRRVRKTDNNRIARATGATIVNR
                     VEDLQESDVGTKCGLFEIEKIGDEYFTFLTKCKSPKACTILLRGPSKDVLNEIERNLQ
                     DAMGVARNVMFHPRLSPGGGATEMAVSVRLAQMAKSIEGIQQWPYKAVAEALEVIPRT
                     LIQNAGKSPVRVLTDLRAKHAEGKSSWGVNGDTGALVDMKDYGVWEPEAIKVQSMKTA
                     IESACLLLRVDDICSAKKAQPGVGTGGGGMDE"
     gene            complement(<1639624..>1640358)
                     /locus_tag="MYCTH_104267"
                     /db_xref="GeneID:11507133"
     mRNA            complement(<1639624..>1640358)
                     /locus_tag="MYCTH_104267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666800.1"
                     /db_xref="GeneID:11507133"
     CDS             complement(1639624..1640358)
                     /locus_tag="MYCTH_104267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666848.1"
                     /db_xref="GeneID:11507133"
                     /db_xref="InterPro:IPR009548"
                     /db_xref="JGIDB:Spoth2_104267"
                     /translation="MTSDTRPPPAKRRRALSPHAAQATQLAALFANPTQEIRIPPAAG
                     PDAGRKPLPPPPEIVTNVQGSSAGAGSGEFHVYKAARRREYERLRRMDEDLARERAAE
                     EFERRRREREREDEERTRRNREKREKKKRRKEQAAKEKSKSGAGSASEGAGDCSGGGG
                     GGGGGGGGGNGGSSGDCNTEAEGEKKSGQCGGTQQGAKDVVGGSGPDNASESKADGGT
                     DAAAVKKQDVPVATAGGPGLVIHDDD"
     gene            <1642046..>1644003
                     /locus_tag="MYCTH_56385"
                     /db_xref="GeneID:11507134"
     mRNA            join(<1642046..1642100,1642175..1642630,1642709..1643580,
                     1643659..>1644003)
                     /locus_tag="MYCTH_56385"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666801.1"
                     /db_xref="GeneID:11507134"
     CDS             join(1642046..1642100,1642175..1642630,1642709..1643580,
                     1643659..1644003)
                     /locus_tag="MYCTH_56385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666849.1"
                     /db_xref="GeneID:11507134"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Spoth2_56385"
                     /translation="MGRPRLIILIRHAQSEGNKNRDIHQTIPDHRVKLTPEGWQQAYD
                     AGRRLRALLREDDTLHFFTSPYRRTRETTEGILATLTSDDPEPSPFKRDKIKVYEEPR
                     LREQDFGNFQPCSAEMERMWQERADYGHFFYRIPNGESAADAYDRISGFNESLWRQFG
                     EDDFASVCVLVTHGLMSRIFLMKWYHFSVEYFEDLRNVNHCEFLIMRRNDENGKYILE
                     NKLRTWSELRRERARQLAEGKGDEDDKSNDLSTLARAGTAEVRRRWGGCPNGCNHDKN
                     FRIRQALADLVKSDSIISNNASGPAVSEGGTGSGTGSGTSSTSTSTAVPSSNGTAAGS
                     AYGITNPSFNGTANSQTIVSRRPAAKRFQSQAADDAGDGSRDKAAGPQIDVDRARDEV
                     VSSPDGTPSFISVDDRLRSRLRSPNVPPRPLGIDNHHVGRDFGGSYSGHNSAVSDDGD
                     SGDDSDGRSGARTLGVPSSTLPHRPKHAYLQHHHQQRSQSRMGRGMRANRLGDHNSSD
                     GEHEADCEHDPEHDDDHSCGGSDDGPDKGCAVDESGSAVVAQEMADEADDVLAREEIE
                     DRSIRGSVY"
     gene            complement(<1655742..>1657511)
                     /locus_tag="MYCTH_2130777"
                     /db_xref="GeneID:11507135"
     mRNA            complement(join(<1655742..1655885,1656066..1656122,
                     1656189..1656500,1657242..>1657511))
                     /locus_tag="MYCTH_2130777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666802.1"
                     /db_xref="GeneID:11507135"
     CDS             complement(join(1655742..1655885,1656066..1656122,
                     1656189..1656500,1657242..1657511))
                     /locus_tag="MYCTH_2130777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666850.1"
                     /db_xref="GeneID:11507135"
                     /db_xref="JGIDB:Spoth2_2130777"
                     /translation="MGGVWHLDGILVDRKRTLREGACTQLRPLFSGMVFTQVKNARKG
                     VLDAQPPPPPSPLPAEMMFARHTEVVHATPAMVAKALQAGSCGGPALWEGIQASDLEW
                     AFPLAALALGMVDGQFFIDELPLNVQLSRCRRKTGASRPHKRPSSVSFRCQSAAGVRT
                     AGEQPIAWCSSKLLSLAIVQYHNVSQRRSVDGRPCSQQAKLSKPLCALSTTISHILNR
                     VDQGDLAPRIAQFFTNPSEIMPAGSLVGLPLPVASGVGSCLG"
     gene            <1657483..1659363
                     /locus_tag="MYCTH_2084695"
                     /db_xref="GeneID:11507136"
     mRNA            join(<1657483..1657572,1658066..1658217,1658282..1659363)
                     /locus_tag="MYCTH_2084695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666803.1"
                     /db_xref="GeneID:11507136"
     CDS             join(1657483..1657572,1658066..1658217,1658282..1658798)
                     /locus_tag="MYCTH_2084695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666851.1"
                     /db_xref="GeneID:11507136"
                     /db_xref="JGIDB:Spoth2_2084695"
                     /translation="MPSRCQTPPMRSQMTRVVPRQAGDLVMLTPPPSSYSHRSSLGSA
                     SAASDTHSLQQLASTTKTQRRIHHTASKPSYLLPHLWRPHTPHTHTHSSPALQSSTNM
                     SFDWEHQFCLGCDKQTDGATYCSESCRLADYERTSPSSPSSVVSSAAGSPASSSFPSD
                     WTLSSSSTAYNNSTKFYLSPAYDFALAQSSSRRGSTQIQTLSPSASHASLCSMRSNSS
                     AGLDATQLSEKAAKELRAYARSFESVRLQRRRSA"
     gene            1665802..1666135
                     /locus_tag="MYCTH_2311931"
                     /db_xref="GeneID:11507137"
     mRNA            1665802..1666135
                     /locus_tag="MYCTH_2311931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666804.1"
                     /db_xref="GeneID:11507137"
     CDS             1665814..1665984
                     /locus_tag="MYCTH_2311931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666852.1"
                     /db_xref="GeneID:11507137"
                     /db_xref="JGIDB:Spoth2_2311931"
                     /translation="MSIGHFFAKLRHFSLYAPGLFCSVLAFLHASKWMPTEELCGLSI
                     PSNLAHIAGPWS"
     gene            1670910..1672600
                     /locus_tag="MYCTH_2311932"
                     /db_xref="GeneID:11507138"
     mRNA            join(1670910..1671400,1671578..1672600)
                     /locus_tag="MYCTH_2311932"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666805.1"
                     /db_xref="GeneID:11507138"
     CDS             join(1671025..1671400,1671578..1672275)
                     /locus_tag="MYCTH_2311932"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666853.1"
                     /db_xref="GeneID:11507138"
                     /db_xref="JGIDB:Spoth2_2311932"
                     /translation="MAHTTHTWKRGELTPQEYFTFRDGAWHPVEAQGSAVLPGRETPP
                     STFQFSVLSWNVDFMAPEGDARMSAALKHLGSLVAGNPNPSVIMLNEMTPPDLALIKL
                     ADWVREGYDITDATADHWESSIYGTCMLVPRALPIKRVARLHYAATAMQRDALFADVA
                     LARGGTLRLCATHLESLRAVPPLRPAQLAAAAAHLRQPQPSGGSGGGGGGGGVVGVLA
                     GDLNAIEPFDRTLHDQCGLKDAYLESGAREGEERGMTWGHMAPRWLRERFGLGRLDKV
                     LFWDGGDASSGDGGGGDDVGGRLLLRLVGFETFGMDVVVEDEAAAARLMKEWGLEKAW
                     VTDHLGVRADFRVEVSESVKIHI"
     gene            1673375..1675979
                     /locus_tag="MYCTH_2311933"
                     /db_xref="GeneID:11507139"
     mRNA            join(1673375..1674635,1674713..1675979)
                     /locus_tag="MYCTH_2311933"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666806.1"
                     /db_xref="GeneID:11507139"
     CDS             join(1673463..1674635,1674713..1675885)
                     /locus_tag="MYCTH_2311933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666854.1"
                     /db_xref="GeneID:11507139"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="JGIDB:Spoth2_2311933"
                     /translation="MAQLVSDFIITPVLRQARRFSTGFAADDPPAIDGPAIRRRRAQS
                     TGYAGSSGTAIREADEHGRRLPTGEAGVGLLDDAAVTPHPSRQDQGHAAAAAAVFQSS
                     GSVGTSDESSGAVQGVSESAAGSSQQPDGTDTAQATTQTTWSSLPEGSRATPLPEDDG
                     MGELRRRIQAIQLLDVPQNVKAQMMHGLFTEKYTKRQLSPKVPHATMRPVSRASTSTL
                     DNRESVEHGGPLQVLKKWNPLGDGSGPLNLPLTEEDLTPTYAPVRQPDDSAEWWSAAE
                     EPGEEEKRLGCEHYRRNVKMQCATCERWYTCRHCHDAVEDHALPRQQTKHMLCMLCGC
                     AQKVSDTCTKCGRPAAYYYCGICKLWNDDASKPIYHCPDCGLCRVGQGLGKDFFHCKK
                     CMACISMSETNHKCIERAVDSNCPICNEYLFDSPKSVTFMQCGHSIHLLCLEELKKTS
                     YRCPLCNKSCVNMEYRFRQLDMHILQQPMPPEYADARAVISCNDCSAKSQTAYHWIGL
                     KCAVCSSYNTTQLQLLNMPGGDHRHQSPEQQQQQQQQQQQQQQQQQQQQQQQPVALDP
                     AVLAEEIRRRNRAARRAQKRQRGQAGNKNNNSGGGGGGGSTTNNGIPGFSLLSTSPTS
                     YSRAFLTRLLNRGGGTSSEAEQASAGDEKTASNLLPAAAAVVPASGSICNSGGEDRKA
                     QEDVDDVDDEDGDDDDDDDDEEDAEMDMLDLFGLHSRDFDRMTGLTSSAASAIGLDDD
                     DDEEEETSEDEDEEGLEEEGEDDDEDDEDDDEDDILLLGHR"
     gene            complement(1676395..1677437)
                     /locus_tag="MYCTH_2311934"
                     /db_xref="GeneID:11507140"
     mRNA            complement(join(1676395..1676810,1677001..1677078,
                     1677181..1677437))
                     /locus_tag="MYCTH_2311934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666807.1"
                     /db_xref="GeneID:11507140"
     CDS             complement(join(1676721..1676810,1677001..1677078,
                     1677181..1677261))
                     /locus_tag="MYCTH_2311934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666855.1"
                     /db_xref="GeneID:11507140"
                     /db_xref="JGIDB:Spoth2_2311934"
                     /translation="MPSTERAEKQAAAQQAVDILHEIATILNCHLDRRTLSICISMIE
                     NGVSPEALANVIKELRKQGQQAQLESAAAAAAAATRRR"
     gene            complement(1677515..1678705)
                     /locus_tag="MYCTH_117436"
                     /db_xref="GeneID:11507141"
     mRNA            complement(join(1677515..1678216,1678312..1678705))
                     /locus_tag="MYCTH_117436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666808.1"
                     /db_xref="GeneID:11507141"
     CDS             complement(join(1677669..1678216,1678312..1678528))
                     /locus_tag="MYCTH_117436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666856.1"
                     /db_xref="GeneID:11507141"
                     /db_xref="InterPro:IPR013255"
                     /db_xref="JGIDB:Spoth2_117436"
                     /translation="MSSAFEPSLSTSRPPIGGPSLADTLPNINFGFDELRDRMAKFTA
                     KFDAFIEQGRKRVLEERNQFHMNVAELQEDQRMKKKDIEILQLKTNSYQQTIAKEAAE
                     KREMQSAIAQLTAQRDRQAAARDALKEQIAATQREIDARLAAQRAHQAQLEAQARFNV
                     PELDFWVTNLCMRIEGAGAEDRLKFVFTHLDEKNWEREAWFELCTGSRDYDVRHCRPK
                     LEREKVERVLERVNETRELVTLLKGMRELFVEAMRS"
     gene            1678867..1682759
                     /locus_tag="MYCTH_2311938"
                     /db_xref="GeneID:11507142"
     mRNA            join(1678867..1679343,1679403..1681350,1681409..1682759)
                     /locus_tag="MYCTH_2311938"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666809.1"
                     /db_xref="GeneID:11507142"
     CDS             join(1679196..1679343,1679403..1681350,1681409..1682513)
                     /locus_tag="MYCTH_2311938"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666857.1"
                     /db_xref="GeneID:11507142"
                     /db_xref="JGIDB:Spoth2_2311938"
                     /translation="MGDRRNAVPPSRAKARRVPADGIIGRLTYIPAQGDEGIGQIRRN
                     RAKDETPRFKQVTPFSQWCAPSRTTTSQPSDMRPSQVARSQKYWLLEHFPEASVGSED
                     VESLLLQEIATAQTTQQPALVDTVSLFSVGEATDLRDSNSTRGHPVLAVASGVSGNVI
                     RLISLGREEWSWTEADLKVRVHIADPKLEGEWLHGGGPISLVRFAIDLRKYDPIRWLL
                     VSNGASITVYEPELRPIPMPAATDPGRLPGRPLPSQLFGNPLFAIPCDRTGGSLQADV
                     CFARHPDADTPQLAIIDQAGYWSLWDVTGRRHRRPKALTPVMKMCGNIVSGFIPKLPS
                     NSMANTQPHQLLWLSLGQNISKSSRRSVSRTRSPPERSRTSADPEPQPSRRILLLRSQ
                     SALHFFDLSTRKMYPVSSLVSQKQKHRILGVAPSCLDPGQVFILTSTSLFWAVVKEDK
                     NDTLTLDILASCPHQKDVNDQTLRLDVSPATYINNFMACFVCVRSAMDTEMTIFWFIS
                     PEPGTPIRYHRDLITLNSPVNFVGLGILPAARRMGAEPTSAAGRAMRSARLRFFQLLT
                     LGQELEVHCALCAWSDDADVSVPLPDRRETLGDGVNRRLKLLQTLTDAFAVPDEFDER
                     AVSGKKELEGLAVTGLKGGIEQRVDFGLVAQRLVAGEPMAGGGDEEMLEDGVDFGFIG
                     EAVEQKKKDDYMPRHSLLDLVTSQRPRGELLELAREWDAQQEALHRRAGEWLFLPEAR
                     RPFIDFGPDDLVGRLQDLFVDSSPSQDASLRHREEVLRNMAAEMFLTSIGVSAVPPSW
                     TTQENQLSSSLPFPSSPSIMPSRPSLSSPHKSKGKATPEQKQGDAVALRLRKYATLDT
                     SPTLNGEPALALSRWELGADPDDISWKPGQDLEAEDAINRRRRKIEARRRKAERLSQR
                     IFGDDSLLMERSSQSFGAPGTQQPPTILSTGASSGSQEQRQSLSQSQQTPRPKLAWGF
                     SSQQQQHVGAFGSPRVFAGSPLRKEYRRDSGMIKVGGIHSSQSQSQSQSQGTPSQPRS
                     QVMPGLFGGRPSFSPFKKSPLKKGKRKSEVRLSGFR"
     gene            1682765..1684201
                     /locus_tag="MYCTH_2311939"
                     /db_xref="GeneID:11507143"
     mRNA            join(1682765..1683266,1683409..1683589,1683690..1684201)
                     /locus_tag="MYCTH_2311939"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666810.1"
                     /db_xref="GeneID:11507143"
     CDS             join(1683001..1683266,1683409..1683589,1683690..1683932)
                     /locus_tag="MYCTH_2311939"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666858.1"
                     /db_xref="GeneID:11507143"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="JGIDB:Spoth2_2311939"
                     /translation="MSHHCHDEHSHSHGGDGGHDHGEHDHSDDITPALQFSLYQHIDF
                     DGITALNEAEYGSAKAIVKKTWAERLSVEPELASDVDEQLLVNVPFTGQVKLHSILIR
                     TSDSDSAPKTLKVIINRDDVDFGVAEETSGTQEFELSRTGEVQELPVRRARFNAVRRL
                     TLFFPDNFGDGEEDVTRISYLGFKGEWMQLGRAPANILYEAAANPGDHKIKGTSVNQM
                     GSGIGGRGPGV"
     gene            complement(<1684210..>1685061)
                     /locus_tag="MYCTH_2070971"
                     /db_xref="GeneID:11507144"
     mRNA            complement(join(<1684210..1684407,1684482..1684585,
                     1684637..1684763,1684806..1684812,1684882..1684921,
                     1684989..>1685061))
                     /locus_tag="MYCTH_2070971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666811.1"
                     /db_xref="GeneID:11507144"
     CDS             complement(join(1684210..1684407,1684482..1684585,
                     1684637..1684763,1684806..1684812,1684882..1684921,
                     1684989..1685061))
                     /locus_tag="MYCTH_2070971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666859.1"
                     /db_xref="GeneID:11507144"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="JGIDB:Spoth2_2070971"
                     /translation="MVYYFTSNVVDPPAFIYVGKDKFENEDLIKHGWEEDVWPWFHVD
                     KLSSAHIYLRLREGQSWDNIPSELLTDLAQLTKANSIEGNKKDNITVIYTPWSNLKKD
                     GSMAVGQVSFKDHKKVKRILVPQRENPIINRLNKTKVEKFPDLKQEKDDHLRELRKKD
                     QAAQLARVGIAVSVMTLLGFIN"
     gene            1685576..1687015
                     /locus_tag="MYCTH_2311944"
                     /db_xref="GeneID:11507145"
     mRNA            1685576..1687015
                     /locus_tag="MYCTH_2311944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666812.1"
                     /db_xref="GeneID:11507145"
     CDS             1685667..1686845
                     /locus_tag="MYCTH_2311944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666860.1"
                     /db_xref="GeneID:11507145"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="JGIDB:Spoth2_2311944"
                     /translation="MAPRLPARCWQQLALRPSSTGLLLLSPPTATSQQRQQLVLSQPP
                     TYTQQRTVKTGWSTLPARGAKPYRFNQTTSGLPAPTTGPAAALRRKERTTPVRAGVLA
                     IKKGMTVFMGRRGARIACTVLQMDRVQTVLNKTRSRHGYWAVQVGMGERQPGNVGAPL
                     LGYYEAKGMAPKEVLAEFRVRDERGLLPVGVQLQPDWFRVGQRVDVRGYSKGKGFAGG
                     MKRHGFAGQEASHGNSKNHRTIGSVGPSQGSGSRVLPGKKMPGRMGGERVTVQNLPVL
                     MVDNDLGIIVVKGCVAGPKGGVVRVQDACKKDPPPQEFIDKTRKLLEERFPDAEAHLQ
                     AARRRHLELKAARREKRIAELMSRGVEGSEEHADAIEQILAAEASKESAAAEQAQASF
                     "
     gene            complement(<1687186..>1687985)
                     /locus_tag="MYCTH_2130787"
                     /db_xref="GeneID:11507146"
     mRNA            complement(join(<1687186..1687670,1687775..>1687985))
                     /locus_tag="MYCTH_2130787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666813.1"
                     /db_xref="GeneID:11507146"
     CDS             complement(join(1687186..1687670,1687775..1687985))
                     /locus_tag="MYCTH_2130787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666861.1"
                     /db_xref="GeneID:11507146"
                     /db_xref="InterPro:IPR014807"
                     /db_xref="JGIDB:Spoth2_2130787"
                     /translation="MLLRSAQQGAGARSALLPLLRRRITPTGGRRFPLNKNNSGARPT
                     QNRMLVSAPKAGDGPLMERRADRELPSLEQTTFRWSRTLPIFAAVIAVASVAIFNYQK
                     LSSPVVGATLYALRTSDKARAVLGDEIYFAQQIPWISGEMNQLHGRIDISFRVKGTKA
                     GGVMRFASFRPTPKGMFETTEWSLETDDGTVIDLLEDGDPFAVTMATPDLPMGDVDVE
                     EEPVPRGFRKMTK"
     gene            <1689215..>1690035
                     /locus_tag="MYCTH_57800"
                     /db_xref="GeneID:11507147"
     mRNA            join(<1689215..1689511,1689613..>1690035)
                     /locus_tag="MYCTH_57800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666814.1"
                     /db_xref="GeneID:11507147"
     CDS             join(1689215..1689511,1689613..1690035)
                     /locus_tag="MYCTH_57800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666862.1"
                     /db_xref="GeneID:11507147"
                     /db_xref="JGIDB:Spoth2_57800"
                     /translation="MGHGRSLLFPIGFTLFLLAVDAAITMGLVSSMVSFLHHNGRGPF
                     AVAPPGGSLFLLAGEPANLVTDHGHTTNAAGGTALVLVGLGGSIALWLEKRERKKWDR
                     SSPAFHLWTLIVFLSWLLTMVALIYTFVETDKTGGQAINLGVARANRPPTKYPDGRWT
                     PENWYASVLNLPLASENQRRIIEGNLTIMRAWRWNLVALFILGFALLALVALEQLRMR
                     RSAQSVRFNHVKEVSGRRDFR"
     gene            1690463..1691610
                     /locus_tag="MYCTH_2311946"
                     /db_xref="GeneID:11507148"
     mRNA            join(1690463..1690607,1690740..1691610)
                     /locus_tag="MYCTH_2311946"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666815.1"
                     /db_xref="GeneID:11507148"
     CDS             join(1690496..1690607,1690740..1691386)
                     /locus_tag="MYCTH_2311946"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666863.1"
                     /db_xref="GeneID:11507148"
                     /db_xref="JGIDB:Spoth2_2311946"
                     /translation="MAKPTPVARLRRTFHYPSSDDDDDDDASTSPAVLDEQEQESLIA
                     DLARQNDRRNQTTHRLLCALPLLSTLPFLLDLFLARAGRALPALGLSSLLATGWMLAR
                     LGVTETGFPALDGMYARGHGHGHGHGHGQLGRSRSRSRSRQRRLGGVGGVGGRGGRGG
                     GGGILGASVSSGAKSPLETHLPWLNVALAALALLTGLLQRLKTGPVAAGVSPLMLGAL
                     PGVVYAVIIGAKVVMAGVDPERELSALKYAYKGA"
     gene            complement(1694586..1695156)
                     /locus_tag="MYCTH_2311951"
                     /db_xref="GeneID:11507149"
     mRNA            complement(join(1694586..1694830,1694961..1695045,
                     1695107..1695156))
                     /locus_tag="MYCTH_2311951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666816.1"
                     /db_xref="GeneID:11507149"
     CDS             complement(join(1694672..1694830,1694961..1695045,
                     1695107..1695108))
                     /locus_tag="MYCTH_2311951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666864.1"
                     /db_xref="GeneID:11507149"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="JGIDB:Spoth2_2311951"
                     /translation="MKFGKQIQKRQLEVPEYAASFVNYKALKKLIKKLSATPVLHSQN
                     DAAERAAAGLIDPQAALQANKATFFFQLVSPTTAITC"
     gene            complement(1696770..1698952)
                     /locus_tag="MYCTH_2311953"
                     /db_xref="GeneID:11507150"
     mRNA            complement(join(1696770..1698695,1698789..1698952))
                     /locus_tag="MYCTH_2311953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666817.1"
                     /db_xref="GeneID:11507150"
     CDS             complement(join(1697307..1698695,1698789..1698803))
                     /locus_tag="MYCTH_2311953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666865.1"
                     /db_xref="GeneID:11507150"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="JGIDB:Spoth2_2311953"
                     /translation="MSAEAIKTPPGPESPTTVRPLEMDDDDVQEQEALGAENATAKPD
                     ATTATTTTTTTTSPAPANAPAAAANDVPPPKPPRPLTEEQRNQQTLKEAFPSVDNAVI
                     KAVLRASGGRIEAAFNALLEMTDPEAAERDQPPPPPPRPVADPVGPTSTGLSQLEADE
                     LYARQLAEHYDNVGAYEARTANRAHQPRSRQQPGLGPYDDPSDREHSFLDDDLPLIKE
                     SLRKGFLETQSKVNTWFNNFKKKLDETFDDDDDDEHHAHGSSSFLGRPTRGQMRRSAD
                     YDRYDADPEVLSDDFAGMKFRSDGSKSNPSRSSYWEELPLSDTWRTAPVHPPRPASGS
                     NPNLFKPPPPSKSPKPGERKVSFRDTVEDIDAYNTSPRVPPKDATATAGTGGAAKSSK
                     WQPLSPVDPNPIVENDPFSLGDSDDERELRDKTAGSKEIKMEDTERLKQATADAMADS
                     LVEDNKSKAEGSSGAAK"
     gene            1699317..1700361
                     /locus_tag="MYCTH_2311956"
                     /db_xref="GeneID:11507151"
     mRNA            join(1699317..1699909,1700024..1700361)
                     /locus_tag="MYCTH_2311956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666818.1"
                     /db_xref="GeneID:11507151"
     CDS             join(1699508..1699909,1700024..1700251)
                     /locus_tag="MYCTH_2311956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666866.1"
                     /db_xref="GeneID:11507151"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Spoth2_2311956"
                     /translation="MGNSSSRITAQDQAILDLKTQRDKLHQYQRRITHLTDRETQAAR
                     QLLARGDKPRALLALRRKKYQESLLAKTDAQLEQLEKLTASVEFALIQKDVLFGLQQG
                     TNVLKEIQAEMGGIENVEKLMGETAEAIAYQQEVSEIIGGRISVQEEEEVEDELAALE
                     AEVAKKEAAVQRLPSVPDTQLPVQKVAEEERHPRPAAKKAQAERQAMLA"
     gene            complement(<1701017..>1703706)
                     /locus_tag="MYCTH_117428"
                     /db_xref="GeneID:11507152"
     mRNA            complement(join(<1701017..1702909,1702988..1703248,
                     1703488..>1703706))
                     /locus_tag="MYCTH_117428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666819.1"
                     /db_xref="GeneID:11507152"
     CDS             complement(join(1701017..1702909,1702988..1703248,
                     1703488..1703706))
                     /locus_tag="MYCTH_117428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666867.1"
                     /db_xref="GeneID:11507152"
                     /db_xref="JGIDB:Spoth2_117428"
                     /translation="MGREKRHAPGPGAGDHAKERHKRDRRGNLIDWTAPLPPGLVARP
                     EKPRISSKHKVWYELVPNTDKKEKKLEFKLANGLSKRLSSHLNRVGYHFRQTIVEQAL
                     ANLGEDGLESVKTAPDLPEPIPERQEDINKQADAAIRDLFPRIPNPDRQAIIEHAFNK
                     SKQVGKDPPVGLAADITLSRRVQLAVLAHIRHNHTRYDQLLKETSYVNARKAVESLCL
                     DILVKWRGDEETGRDQLDEILREVIVISDSESDESDEDEDEDEDESSDTWSEDESPVN
                     GVARDDRPARETLPPAELSPASLTINKTRSEGFRASHAPQKIKKPTREDKRAAKWAHR
                     GFQRYQAARDQAWNQALERQRREIYGTVPSNGPVEDPAGHVPQLWRNGEPTHSSYRPY
                     GSPLPAVGVSREPENRVSESQRAAPMATYNMPQPVHPWEHQRSNRFGPIVGSRAASYE
                     APVVEPVSYHGHDLKDCLVQSIEPAETQAPNPPPPIPVSYRPPVSSPFHDGHTPINRA
                     VHYPPQDAGGVREAHNVHPDFAEGFITLSHRSEPGRMRAAPEPPAEPFILLNPQNGSA
                     IGASTVSTTPRGPSSPRAQGWRDNGAGRDEPHPGSGTRPVWIGHDGALLRSEFRPIVI
                     PDDPLPSRRPRMEPAYPDTNNRRPSPMMWAHPRHISHGWTNGREGRYVDAKHDERVEA
                     LQNDFGEFVRVSNKFPRQYEPRPAPVEEARYYGQSATQRQGAPPQPDDAARYDARQFR
                     GHGQRLERVVERIEGPPSHDEHISFVARQPQGCPRQERVVGIEYVHSYAR"
     gene            1704450..1706881
                     /locus_tag="MYCTH_2311958"
                     /db_xref="GeneID:11507153"
     mRNA            join(1704450..1704930,1704993..1706881)
                     /locus_tag="MYCTH_2311958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666820.1"
                     /db_xref="GeneID:11507153"
     CDS             join(1704709..1704930,1704993..1706783)
                     /locus_tag="MYCTH_2311958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666868.1"
                     /db_xref="GeneID:11507153"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="JGIDB:Spoth2_2311958"
                     /translation="MADFDLGAAFIPALHKPAELLPIAKHREALLYLVETSPVTIVVG
                     QTGSGKSTQIPQFLERAGWCADGKIIGITQPRRVAATTVALRVAEEFGCEVGKEVGYS
                     IRFEDVTSGSTRIKFLTDGLLIREALVDPLLSRYSVIMVDEAHERSISSDILLGLLKK
                     IRKKRPDLRIIISSATLQAEDFRNFFSEPKEQKEGPDGKQNDDIASIISLEGRTYPID
                     ILYLETPTENYLEKAISTVFEIHTNEPKGDILVFLTGREEIDQAVQAVAERSAQLRAG
                     SQSILPLPLYAGLPADQQMYVFEEAPENFRKVIFSTNVSEASVTIDGIVYVVDSGFVK
                     LRAYNPRTGIESLTVTPVSKASAAQRAGRAGRTKPGKCFRLYTEETYQSLPDSTVPEI
                     QRSNLAPFILQLKALGIDNVLRFDFLTPPPAELMIRALELLYSLGALDDYAKLTRPLG
                     LRMAELAVEPMMAKTLLSAPSFGCLSEILTIAAMTSLGGNIWIQHEGEKKKTESARWK
                     FAAEEGDHLTLLNVYQAFVTKGRKESRFCHENLLNFKLMERAVSIRAQLKRYLERFGI
                     NVDESLAPHSTSAPASNKAEQIRRCLTAGYFAHAARMQPDGTFRNVSGTTVLHAHPSS
                     IMFNRKADWVIFHEVVETGNKTFIRDISRIEKAWLLEYAPEFYKSS"
     gene            1708765..1711779
                     /locus_tag="MYCTH_2311961"
                     /db_xref="GeneID:11507154"
     mRNA            join(1708765..1709281,1709345..1711246,1711317..1711779)
                     /locus_tag="MYCTH_2311961"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666821.1"
                     /db_xref="GeneID:11507154"
     CDS             join(1709064..1709281,1709345..1711246,1711317..1711560)
                     /locus_tag="MYCTH_2311961"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666869.1"
                     /db_xref="GeneID:11507154"
                     /db_xref="JGIDB:Spoth2_2311961"
                     /translation="MEGRYVESAYAMGPRIPVRRRAAISTTVSTLGFRVPSRILVARA
                     DSDECKNPNGCTKPIGASTTTIAIVLGIFIPFVVAISVLFYLHRRNVRKQRQEDLHDP
                     HKSLDFGLEGGGPAKESRKNLISREKEGGQRFNRQQMSMDMNLSSPYLLPPDAHNSRE
                     SLNSLAKSLQQNEDPYKPVAQYAGSDVGSIRSFRRGNEAPSVYSRSRQNSIPMSPLQP
                     PEPSHTRPEQPLPESAGSPAGAPTNGPLPPIGTAVSDSPDGQNDKSAIGTAIQEPPAA
                     VPKSLTVPQPSRSQPSPPDSGVAVEYGDAGRNPFEKPVAQEVETPTEPSAVGLGLSSS
                     PPQPQRASIRSSTSSYKSRAASPPPQKEQNAPMSAPVIEEPRPVGDYDFDFAEMPEMP
                     QDRRSPSPSPANHNSSQLDVDEPRGRNMQRTSHLFEQQNTASQGGLGVPQQDNRRLSV
                     GFRPLPPDDIMESEDPEYRANRIRSFYKEYFDDTKAEDRPPVPPMPPMGQNGHQHQHH
                     QSNASYYEDYDANYIQDAPYFDPATNSFVMPYAQPVSRRAMTPPPSGQRFPGPRGPPR
                     GSHGSQASARFPPNMRGPPRPGSSVSNQLGGPSRPGSAASGPYGRVRAGSAMSGSRSG
                     SRAPKKPVPPPADLPTLPTPSKLADDSFALLNAADFAPPETFAERARGRSQSPSGERR
                     PYRMPVPAHSPLASSYDELPALPSPHLLRKSGTFTALDFAPPRKFADPETASDAGSIR
                     SNRSGLSALHVNAIRNGAGRVSRLPGDQVFTQAALSKTLKPQWGMRD"
     gene            complement(<1712815..>1713068)
                     /locus_tag="MYCTH_2130796"
                     /db_xref="GeneID:11507155"
     mRNA            complement(join(<1712815..1712943,1712988..>1713068))
                     /locus_tag="MYCTH_2130796"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666822.1"
                     /db_xref="GeneID:11507155"
     CDS             complement(join(1712815..1712943,1712988..1713068))
                     /locus_tag="MYCTH_2130796"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666870.1"
                     /db_xref="GeneID:11507155"
                     /db_xref="JGIDB:Spoth2_2130796"
                     /translation="MLSLTSTSNEGEFIAEFPPILGYETVGSRGRPLEAVQALLLHYY
                     CPHGEALLCEKANSISQLGGRHRFL"
     gene            complement(1713917..1715407)
                     /locus_tag="MYCTH_72333"
                     /db_xref="GeneID:11507156"
     mRNA            complement(join(1713917..1714489,1714584..1714949,
                     1715143..1715180,1715273..1715407))
                     /locus_tag="MYCTH_72333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666823.1"
                     /db_xref="GeneID:11507156"
     CDS             complement(join(1714435..1714489,1714584..1714949,
                     1715143..1715180,1715273..1715311))
                     /locus_tag="MYCTH_72333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666871.1"
                     /db_xref="GeneID:11507156"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="JGIDB:Spoth2_72333"
                     /translation="MLIPKADRKAIHEYLFREGVMVAAKNYETTHEIGVRNLYVIKAL
                     QSLNSRGYVKTQFSWQYYYYTLTPEGLDYLREWLHLPAEIVPATHIKQQRSHAPPRGM
                     LGEDRGERRFGGRGRGDRGDRDGGYRRRDAGEGKEGGAPSDFAPQFRGGFGRGRGGRG
                     DAPPS"
     gene            1715602..1717121
                     /locus_tag="MYCTH_2311964"
                     /db_xref="GeneID:11507157"
     mRNA            1715602..1717121
                     /locus_tag="MYCTH_2311964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666824.1"
                     /db_xref="GeneID:11507157"
     CDS             1715883..1716956
                     /locus_tag="MYCTH_2311964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666872.1"
                     /db_xref="GeneID:11507157"
                     /db_xref="JGIDB:Spoth2_2311964"
                     /translation="MAPSKLNVLITSFAGSGLPPTLSLALPPTTPVSSLLDELDSRLP
                     PSATTSNTRLLLTTLSGRSVPLNSALPISHFLPTTAATAATAAAQDEHGYGQIQTDLL
                     PLRLSAPLVGGKGGFGSQLRAAGGRMSKRRKGPNGAEENGSSRNLDGRRLRTVTEAKA
                     LAEYLAIKPEMDRREREKRRKRWEEIVEMTERRQEEIKYGSRKVGLDGKWVEDKEEVG
                     ERTREAVLEAMKRGGYRDNLFGELAGESGSGSGSGSGSGSGSGSSADEDGDEAMDDEM
                     DQDESGGSKVTTPPSEPEPVVDAKGKGKEKEVVNGNGNGNGNGNGNGKSHGTATARRF
                     IGFDEDDEFMSSDDESESEEAKK"
     gene            complement(1717095..1718222)
                     /locus_tag="MYCTH_2311966"
                     /db_xref="GeneID:11507158"
     mRNA            complement(join(1717095..1717322,1717390..1717453,
                     1717557..1717670,1717965..1718222))
                     /locus_tag="MYCTH_2311966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666825.1"
                     /db_xref="GeneID:11507158"
     CDS             complement(join(1717288..1717322,1717390..1717453,
                     1717557..1717670,1717965..1718012))
                     /locus_tag="MYCTH_2311966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666873.1"
                     /db_xref="GeneID:11507158"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="JGIDB:Spoth2_2311966"
                     /translation="MSDDERVTKPFKFVTGGVDARFPNVNQTKHCWQNYVDYHKCILA
                     KGEDFAPCRQFWLAYRSLCPSGWYERWDAQREAGNFPVRLDQ"
     gene            1718311..1719120
                     /locus_tag="MYCTH_2311968"
                     /db_xref="GeneID:11507159"
     mRNA            join(1718311..1718526,1718585..1718600,1718717..1718779,
                     1718848..1719120)
                     /locus_tag="MYCTH_2311968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666826.1"
                     /db_xref="GeneID:11507159"
     CDS             join(1718464..1718526,1718585..1718600,1718717..1718779,
                     1718848..1718978)
                     /locus_tag="MYCTH_2311968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666874.1"
                     /db_xref="GeneID:11507159"
                     /db_xref="JGIDB:Spoth2_2311968"
                     /translation="MYATRSLRMFRPTVRMMRPIPKEEQSAHTVSQRLRRLKRIPPEL
                     LPLGVVVAFAVTAAVYSSFRHLATDKNIRLKRQNRAADSHAQEEHH"
     gene            complement(1719190..1720108)
                     /locus_tag="MYCTH_2140924"
                     /db_xref="GeneID:11507160"
     mRNA            complement(join(1719190..1719437,1719580..1720108))
                     /locus_tag="MYCTH_2140924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666827.1"
                     /db_xref="GeneID:11507160"
     CDS             complement(join(1719306..1719437,1719580..1719906))
                     /locus_tag="MYCTH_2140924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666875.1"
                     /db_xref="GeneID:11507160"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2140924"
                     /translation="MTDTTRWKATVYVGGLAPAVTVTTLQEAFLPFGEIADVSLPKNE
                     NPNTAAAEPHRGFAYVEFEDPDDAKEAIDNMDQAELFGRVIRVSAAKPPKSAGQGLGA
                     KTAVWEQEGWLAEHAVSEEDRLAAEQAQNARLDDPMQGLEGLDVAGPKPE"
     gene            1720718..1725088
                     /locus_tag="MYCTH_2311970"
                     /db_xref="GeneID:11507161"
     mRNA            join(1720718..1721173,1721234..1724756,1724836..1725088)
                     /locus_tag="MYCTH_2311970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666828.1"
                     /db_xref="GeneID:11507161"
     CDS             join(1720968..1721173,1721234..1724756,1724836..1724880)
                     /locus_tag="MYCTH_2311970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666876.1"
                     /db_xref="GeneID:11507161"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2311970"
                     /translation="MVRLREIPRTAAFAWSPGPNPILVTGTRSGAVDADFSDETKLEL
                     WDLNLDDPGQGLELQPVASISTESRFYDIAWGAPSDEHPRGVVAGAMEDGSLQLWDAA
                     KLLAGEEALMSRDTKHTGPIKALQFNPVRPQVLATAGVKGELFIWDVNDTSTAFRLGT
                     AAAHDIDCVAWNRRVSNILATGSAGGFVTVWDLKTKKASLTLNNNRKPVSAIAWDPNN
                     STNLLTATSDDNTPVILLWNLRNSQAPEKTLQGHDQGILSLSWCQQDPGLLLSCGKDN
                     RTLVWNPQTGERYGEFPEATNWTFLTRFDPGNPNLVATASFDGKITIQTLQNTNPSAV
                     PTAQASMDDDDFFSKAPTQLQGASFSLPRAPVWFERPVGVSFGYGGKLVTFRKNDTPA
                     SQPRSSKIQISSFSVDSDIGSATEKFEEAYKNGDIAAICDSHVADAKTEEEKADWQVL
                     KTLSESDGRTKIIEYLGFAKDEEPPSAAAADSEATETKEEPKETGLAPPQTNGEDGKK
                     KHKRVTSMWADVDDGDDFLSDLTAAKGAKTDNPFQLLGEGGSAEDQITKAVILGNFEK
                     AVDLCLKEDRVADAFILANCGGKELVDKVQKSYLAQKKGSPSYLRLINSVIGKNLWDV
                     VYNADLSNWKETMVTLCTFADPSEFPDLCEALGDRILEVGPRKDASFCYLVGSKLEKV
                     VDIWIAELEEAEQAGLQEASNDSTFSIHARSLQHFIEKVTIFRHVTKFTDTEKDLSEG
                     WKLASLYDKYTQYADIVAGHGQLSVAQRYLDLLPTNYPAAEVARNRVKLATQKSASQP
                     AQRQGAAAPGARVSSRGPTPVGYRQPASIPPAAASNPNPYAPPAPIQPASATSSNPYA
                     PPTATSQYAPSGASPYVPAAGFAPSQPVGAGYGPSGASVPPPPRNTGPPPKINKDVGN
                     WNDVPMVTKPPVRRTTPSVAPITSPFPGQTSPAGPYQRSAPTPPPPPPKGSAPPRNVT
                     SPPPPPPPSGPPRSGSVTSSNASNPYAPPPPAATGLASPMAPPPAPRTASPYNPPPAG
                     PPPSNRYAPAPAPSAQPYNQGPGSTPLAPPPANLYAPPPSFQAAPPPPPSSHPSSQQP
                     SSVPPPPQGSRPPVGPPPRAGPPPAAGGPPPAAQAPASQSPTSPKASAPSQTNRHPPG
                     DRSHIPPNAQRMVELLSQDMQRVASKAPAAFAPQVKDTQKRLNLLFDHLNNEELVRPD
                     TIEQLTTIAEAITGKNYELASKLQTEILRDKMEECGQWMVGLKRLISMSKATP"
     gene            complement(<1725078..1725957)
                     /locus_tag="MYCTH_2311973"
                     /db_xref="GeneID:11507162"
     mRNA            complement(<1725078..1725957)
                     /locus_tag="MYCTH_2311973"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666829.1"
                     /db_xref="GeneID:11507162"
     CDS             complement(<1725301..1725805)
                     /locus_tag="MYCTH_2311973"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666877.1"
                     /db_xref="GeneID:11507162"
                     /db_xref="JGIDB:Spoth2_2311973"
                     /translation="MRPASSSTGRGSFRGTAAPAPCAAVSPCTPPLRDAMNVLAEREP
                     SLFARWDAGLVPPYPQLYRNRVRMRELVGEVLDGGGGRRARGGSTDPAAAGTARKVRF
                     EGAESVVTLLVVDYQNEWRAKLGRAQRTQARTLVVNREAPVLPPRRKPGAAKSPFRGT
                     EWGRLVRM"
     gene            1726725..1728118
                     /locus_tag="MYCTH_2311974"
                     /db_xref="GeneID:11507163"
     mRNA            join(1726725..1727031,1727121..1728118)
                     /locus_tag="MYCTH_2311974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666830.1"
                     /db_xref="GeneID:11507163"
     CDS             join(1726878..1727031,1727121..1728112)
                     /locus_tag="MYCTH_2311974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666878.1"
                     /db_xref="GeneID:11507163"
                     /db_xref="JGIDB:Spoth2_2311974"
                     /translation="MTETLTPDEEAAAARAAEQARLRKARREAKIKAGAENRLNKITG
                     LGGGFQRATSPAPATTTPSTASSNGAATAASTAATATDAARPQHADPEEVDISEHFYQ
                     PRTTPRVAPANKIATTTGSGTISDAQLRQTMFGLDPPGPASPTPSMPGMPGVPPAMED
                     DPMMRLMMQMLGGGTTTTTTNNNNPFGGGAPFPAQQQQQQQQQQQQPTASPDRYASLW
                     RLLHALIALALGLYIALYTPFTGTKLSRDRAAAAAAGSAEERARLLRSQLGQPDTADD
                     TTTAAAAAAAGGDLNLTRTFFWAFATAEALLLGTRYLLFGRGQSPLDSTAGGGAGGIL
                     GLVASFLPPGPRSKVELAMRYVQVLGTVRHDLLVCVFVLGVAAWLRG"
     gene            complement(1729217..1736929)
                     /locus_tag="MYCTH_2311976"
                     /db_xref="GeneID:11507164"
     mRNA            complement(1729217..1736929)
                     /locus_tag="MYCTH_2311976"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666831.1"
                     /db_xref="GeneID:11507164"
     CDS             complement(1729305..1736681)
                     /locus_tag="MYCTH_2311976"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666879.1"
                     /db_xref="GeneID:11507164"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2311976"
                     /translation="MDPAAAAWPLDDQVPESPGRIFERLRQIAGYTWDDAQPPVHSTY
                     DNWHVFGTRFVSPSSTPPQSSANALTSSAPYHAAGPPVVSHLSSCGRTFPADTRSHAS
                     LSETESISDRSTGSLPPPTLSTAATDAPVIEQRVVARVSYHVLREERAFYISKSLVSN
                     VDPKAERMVRPLDVMRLPPAPGDRGPIVVAIYEDLGPNSLFGLLDFGPAFYFARREGD
                     RWEPCPGDAPALGPPISLQNFLDFAIGAAQCLEIVHHGQGIVHGEIRADAFHYNAEKN
                     KVKLVSFGSGLRSFEHGLTSTGWSAFSKALGAKHKLQYISPEQTGRMPAEPDTRTDIY
                     SLGVLFWTLLTQQPVFPGETPLDVVQAVLGRRIPNVTAIRMDVPEVVGRIIQKCTAKN
                     VADRYYSAGGLRYDLVAVQKMLSDGDSAALKDWPIASRDVSSSFRLPTTVLGRDRERA
                     ELVRIIEKFAKSHPVAPSGALARSSEGSSLGGTETNDFADASSDGGSSTGGANRHSPS
                     APQPDNRPKSGPYPSPPLGPGSTAASASTSTVSSNTSTLSGGARFPRASDRHSFVDGS
                     HPGDNHYSEPSRHGATVGTDTSSTSLARQLGSAKFRRHGHCEIVLIEGAGGLGKSSLV
                     QSVLWEARRRGYCATAKFDRARKTPFGPPLKLLSSLFRQAQGERNTETAFHQSLRHHV
                     RPVWPMLHKALGLPDFLLPPADSPLIRSQTPNKADPQMRASSPEMSAPSVLRPSSGAP
                     VQKPRDFFRAGASTKTNRLINTFLDVLRLFTQHKFICLCLDDLQYADDESLELISQII
                     SVRLRLMLIITYRPEDMPYEEVRKILTPLKSDDLPRGGGPNTTRITLEPLSEEVIVEY
                     VSATLSLAKERVHPLALVIQSKTAGNPFYMREMLSAGYRKKCIWYDYIAGHWTYDLDK
                     LFDQFQGEQDYDVLDTAFITRRLSELPPASRSILAWAALLGQTFSFDLICKLMSGKQE
                     VDDCCPESLGEPLIAATSQEDVVSGLEAAIQAFIIIPCDRDDHFRFAHDRYIQAAAAL
                     KECNARVMHFVIAQVLLKHYPDNLALKDNAASHICESVDIIKKRVSHREAFRKLLFER
                     AHEAIESGARPTAAKYLSNAVALLQADPWNEDAEDVSYDETLQIYLQAAECYLFMGHQ
                     SAAKVLLQTIFDRAKTAIDKAPAWVLQSRIFSQSGDSHQALASLKQCLAALDVSIDDC
                     PTMETCDAQFERLSRKIQATDREEVVSPPAESDPMLASVGAVLAETTSAGWWTGSAAF
                     YQLTLLMVETHFRRGAYPQSGLAFLYMSVIALSRHDDVKLATELGSICLELLDKSRDP
                     SILSRGYMIYANFVGHVQSPIGQSASQIEGMLDYSMVAGDRTATILSFALAAQLKFYA
                     GENCADLEAFCQYVCEDIPGWHLDTRGGTLLIAVRQVCRALQGKTRTADPLDVMSDER
                     HDAVTYKKWLLANTNNGGRSLLVYETLEIVALFLYGHYGHAIELGKAFLERAELLWSA
                     RNTRLAMLFYGLALAGAVIRQQGDPLSPGDEGLKDVVDEAVRKVEELSRRIKDWQVVD
                     NVNYLAWSKLLDASVSEMLGNHGTAIRLYEEALDHASEHNFMFEEALGNYLMANIFIR
                     IAARRSARSALRDAVSLFRQLGATGIADRIESDHSILLQRAMRNPRTVDQGVQTDFSG
                     DAVTVQYRNVDDNSTEEEAQQASQAAVAALKGERMSAWRGSMQAEAGAGLPALDMIDL
                     HAILVSSQVISSVLRIDELLKTMCDVILQTCSGSATLAAIVVQDEGSSDWCVAASGDP
                     EKGAEAHIPGIPLSVTDLVAENVVLYSTRFRESIFLQDLLSDERFGNVSDQWLRRNPG
                     SKAVIAIPICHGSKPLLGVLYLEGAPGSFTDRNLSVLQLLVNQIGISFSNALAMKAVE
                     KVSAENISMVELQKRALAKAIEAETKAKNAEAEAIRNVKLAEDATKAKSIFLANVSHE
                     LRTPLNGVIGNSELLRDSNLNKEQLEMADSIRVSADLLLTVINDILDFSRMEADKMKL
                     YIIAFNPEEMVREVVRAVSYSNREKTSKKNVKIIQDINLPPMLIYGDPIRLHQVLGNL
                     IGNSLKFTEDGSITIGARIDKETEDNATLTFWVKDTGIGISPQQLENLFQPFSQADVS
                     TARKYGGSGLGLSICKSLIETMMQGKIRLESQENVGTTAWFTVTFDKARPEVVAGDEK
                     LASRSLPEPVRPYPARQQSAASNRELTASSTNNAASATGAPASAISDLSKIPKNELRI
                     CIAEDNAINARIALQYMQRLGYPNVDTYENGLKAVEGLRDKARQGKPYHIILMDVQMP
                     VLDGYEATKLLRHDELESVRKVLVIAMTASAIQGDREKCLAAGMDDYLAKPVRSEVLK
                     KKLDAYLLGGGGGGAGAGAAGGGGGGGATGQVTNGSLQTEEPNGSSQAQAAQQQDERQ
                     KGEEKAPAVAPQTSTDAPALAPASAPASEQQQQQQQ"
     gene            complement(1738824..1741253)
                     /locus_tag="MYCTH_2084736"
                     /db_xref="GeneID:11507165"
     mRNA            complement(join(1738824..1739804,1739876..1740301,
                     1740355..1740705,1740775..1740855,1740913..1740982,
                     1741052..1741253))
                     /locus_tag="MYCTH_2084736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666832.1"
                     /db_xref="GeneID:11507165"
     CDS             complement(join(1739193..1739804,1739876..1740301,
                     1740355..1740705,1740775..1740855,1740913..1740982,
                     1741052..1741062))
                     /locus_tag="MYCTH_2084736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666880.1"
                     /db_xref="GeneID:11507165"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="JGIDB:Spoth2_2084736"
                     /translation="MADINVDVLVIGAGPTGLGAAKRLNHINGPSWLILDANEKAGGL
                     ASTDVTPEGFLYDVGGHVIFSHYKYFDDCLDEALPKEDDWYHHQRISYVRYKGLWVPY
                     PFQNNISMLPKEDQVKCIDGLIDAAMAAQVSTTKPKDFDEWILRVCGEGVADVFMRPY
                     NYKVWAVPTTKMQCEWLGERVAAPNLKLVTKNVILNKVAGGWGPNATFRFPARDGTGG
                     IWIAVSNTLPEEKKRYGEKGEVTKVDAQKKIVTLKDGTTIGYGKLINTMPVNQLVEKM
                     GDQELINLAKGLYYSSTHVIGVGIRGERPERIGDKCWLYFPEDNCPFYRATIFSNYSP
                     YNQPQADVKLPTLYYADGSKPKSSEPKEGPYWSIMLEVSQSTMKPVDEENLLKDCIQG
                     LINTDMLKPEDEIVSTYHRKFNQGYPTPTLEREGVLKQLLPKLQDLDIWSRGRFGSWR
                     YEVGNQDHSFMLGVEAVDNIVTGAVELTLNYPDFVNTRQNNERRLAQNFYSAGSSSNL
                     PSRPAPKA"
     gene            1744543..1746250
                     /locus_tag="MYCTH_2311983"
                     /db_xref="GeneID:11507166"
     mRNA            join(1744543..1744782,1744845..1744912,1744981..1745204,
                     1745261..1745668,1745728..1746250)
                     /locus_tag="MYCTH_2311983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666833.1"
                     /db_xref="GeneID:11507166"
     CDS             join(1744646..1744782,1744845..1744912,1744981..1745204,
                     1745261..1745668,1745728..1746090)
                     /locus_tag="MYCTH_2311983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666881.1"
                     /db_xref="GeneID:11507166"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="JGIDB:Spoth2_2311983"
                     /translation="MGVEEKTRASGEQSREQNEPVLPTVNPQVEKPQPPKPALHPAFY
                     VTVWIALSSSVILFNKWILSTLGFAYPVLLTTYHLGFASIMTQLLARYTTLLDGRKTV
                     KMTGRVYLRAIVPIGFFFSLSLICGNLTYLYLSVAFIQMLKATTPVAVLLSSWALGVS
                     QPNLKVFLNVSAIVVGVIIASIGEIKFVWIGFIYQIAGIIFEALRLTMVQRLLSSAEF
                     KMDPLVSLYYFAPVCAAMNFVVALFWEIPKVTMSEIYSVGLFTFFLNGLCAFMLNVSV
                     VFLIGKTSSLVLTLCGVLKDVLLVVASMIIWGTEVTVTQFFGYSIALCGMIYYKLGYE
                     AIKGYAGEAGRQWADFGNRRPVLRRISTILLVLLVVFAVLNELAPSVDPSVYLDEAKS
                     KMGLSKL"
     gene            complement(1746833..1748183)
                     /locus_tag="MYCTH_2316558"
                     /db_xref="GeneID:11507167"
     mRNA            complement(join(1746833..1747316,1747388..1747724,
                     1747956..1748032,1748120..1748183))
                     /locus_tag="MYCTH_2316558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666834.1"
                     /db_xref="GeneID:11507167"
     CDS             complement(join(1747309..1747316,1747388..1747724,
                     1747956..1748018))
                     /locus_tag="MYCTH_2316558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666882.1"
                     /db_xref="GeneID:11507167"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="JGIDB:Spoth2_2316558"
                     /translation="MKFLKTSRVCLVTRGRYAGKKVVIIQPVDNGSKTHPYGHALVAG
                     IERYPSKITRRMSKSRQEKRSKVKPFIKVINYNHLMPTRYTLELEGLKSVITADTFKE
                     PSQREEAKKTVKKVLEERYTSGKNRWFFTPLRF"
     gene            <1748481..>1748719
                     /locus_tag="MYCTH_2130809"
                     /db_xref="GeneID:11507168"
     mRNA            join(<1748481..1748626,1748689..>1748719)
                     /locus_tag="MYCTH_2130809"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666835.1"
                     /db_xref="GeneID:11507168"
     CDS             join(1748481..1748626,1748689..1748719)
                     /locus_tag="MYCTH_2130809"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666883.1"
                     /db_xref="GeneID:11507168"
                     /db_xref="JGIDB:Spoth2_2130809"
                     /translation="MAPPVYIISRVADPIFAVFIGVSAAALRINREEKEKGRTTQETL
                     QAVRRRLGLEKRSQ"
     gene            complement(1748755..1749915)
                     /locus_tag="MYCTH_2311992"
                     /db_xref="GeneID:11507169"
     mRNA            complement(1748755..1749915)
                     /locus_tag="MYCTH_2311992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666836.1"
                     /db_xref="GeneID:11507169"
     CDS             complement(1748871..1749671)
                     /locus_tag="MYCTH_2311992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666884.1"
                     /db_xref="GeneID:11507169"
                     /db_xref="JGIDB:Spoth2_2311992"
                     /translation="MAYVELSRRDINVLGKIKDPESDPSLMVQVDPTLPKDPHVSNPE
                     EYQKVSQEERDIIMSIQKLEMRQAEQQTSGTADVDIAGEYRECVSRLGQLIQNYPQYA
                     SARNNRAQALRRLYGDSMLVADAPRNPQALLQELGDSERLEAAKTALSDLDHAISLLT
                     PKVAYSRLSPQVARTLSNAHTQRAAIYLMTSKLVGSKSVSVDAARPEGGWSKLDFEER
                     ASRDFAMGGRYGNEIAKALAVSTNPTAKLCGQMVREAMRKEYGPGLAP"
     gene            <1751098..>1752336
                     /locus_tag="MYCTH_85068"
                     /db_xref="GeneID:11507170"
     mRNA            <1751098..>1752336
                     /locus_tag="MYCTH_85068"
                     /product="4-hydroxyphenylpyruvate dioxygenase-like
                     protein"
                     /transcript_id="XM_003666837.1"
                     /db_xref="GeneID:11507170"
     CDS             1751098..1752336
                     /locus_tag="MYCTH_85068"
                     /codon_start=1
                     /product="4-hydroxyphenylpyruvate dioxygenase-like
                     protein"
                     /protein_id="XP_003666885.1"
                     /db_xref="GeneID:11507170"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Spoth2_85068"
                     /translation="MSPSAISDNHSSSGASDYAVQSPSPNFSGYDHVTWWVGNAKQAA
                     GFYNTFFGFKTIAYRGLETGSRYFASYVVTNNDVRFVFTSPIRSAKYLPEDEPISPED
                     RRLLQEMHEHQEKHGDAVKDVAFEVDNVDGVYEKAVAEGAVSVQPPLTTGDKEHGYVR
                     TAVIRTYGDTTHTLIARQNFRGAFLPGFRAVKGGAGAAPDALPEVPLARIDHCVGNQD
                     WNQMVSACAFYEQCLSFHRFWSVDDSQICTEFSALSSIVMASPNNVVKMPINEPAPGK
                     KKSQIEEYVLFNSGPGVQHIALLTPDIISAVSALRARGVQFIDVPKTYYDTMRVRLKT
                     ERRDWELKEDLDTIERLNILIDYDERGYLLQLFTKPLMDRPTVFIEIIQRNDFDGFGA
                     GNFKSLFEAIEREQAERGNL"
     gene            complement(1752598..1754977)
                     /locus_tag="MYCTH_2311995"
                     /db_xref="GeneID:11507171"
     mRNA            complement(join(1752598..1754030,1754123..1754977))
                     /locus_tag="MYCTH_2311995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666838.1"
                     /db_xref="GeneID:11507171"
     CDS             complement(join(1752860..1754030,1754123..1754721))
                     /locus_tag="MYCTH_2311995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666886.1"
                     /db_xref="GeneID:11507171"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="JGIDB:Spoth2_2311995"
                     /translation="MADSDGEYVEDLSDDDLDHRADSAGKGSSYGTRSKGGRANGKSG
                     DGRKGARSKAAWEDIKRSWENVVETEDGSITIEALIEAEKRRRLMRDTTPFQRGIIRH
                     LMLVLDMSFAMAEKDLLPNRYLLTLNYAVDFVREYFEQNPISQLGIVGMRDGIAVRIS
                     DMGGNPAEHIEKLRTWAEQQEPQGNPSLQNALEMCRGALFHTPSHGTREVLIIYGALL
                     SSDPGDIHDTIAKLLNDRIRVSVVGLAAQVAICEQLCTRTNGGDPSSYAVALHEQHFR
                     ELFLAATTPPVTQSTPPPPGAGDGTNNNNNSQQQSQQSQQASLLIMGFPSRALASKDH
                     VSLCACHNRPTREGYACTRCRTKVCRLPAECPVCGLTLVLSTHLARSYHHLFPLRGWV
                     AVSWAEAARAKSGVCFACLAPFPPVPPTATAGGGGGAGAGGAGAGAGGTSLDDKADGK
                     KKKTSKSAAGPGSGEAKTPAAAVVAAAGVSESGRYACPVCGNHFCIDCDVFAHEMIHN
                     CPGCQSDTRGAAAAAAAATGAQRENGESGGGSGSGGGGGGGGGGGDDGETRVNGQSQS
                     QGQGQGQAQAQGGEGGEAMVVDS"
     gene            1758890..1765441
                     /locus_tag="MYCTH_2311998"
                     /db_xref="GeneID:11507172"
     mRNA            join(1758890..1764933,1765010..1765441)
                     /locus_tag="MYCTH_2311998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666839.1"
                     /db_xref="GeneID:11507172"
     CDS             join(1759027..1764933,1765010..1765228)
                     /locus_tag="MYCTH_2311998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666887.1"
                     /db_xref="GeneID:11507172"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Spoth2_2311998"
                     /translation="MSCGPVSNAEGSHPSSGPGSGPRPTRSETVAFKDQIEPATAGEP
                     TAPADYQQQQQQQQDLLLDGATPAGSRSGAPSPVARNDKARPWGTRETESEPRDAQRQ
                     LNEYCENPARQMENKESVPTPRGEQPAPLGSKRVSPIQEENSPSSQPSSSSPASDPLH
                     TSASTTSTGSGHTVRAGSATPGPMASTPSYPFPRMAPSTFLPPSVHRPFTTLSPTVPP
                     DGHRPPPDALGGQDALASNPSTPASNLTFLPPGSSRAVPDHPDFPSPNLYELALMLTA
                     EPGLDAWWQTVVQIMVDVYKAERVTLAVPADSTDIENVPWGQKATYNAHREDDLSMAY
                     LARGSSLMPSSTDETPDRSSQTTAEPSAKQAPARPVLQSRHSFTSYEQNRQAAEDERA
                     VPPPRRPQVLSRSKSHHPTTTHGGPDSGVHGDRLTGASLTSLNREALEQHDAREEQQE
                     IPSWEAPFSAPRRGHGKVLNVLQALDYEADPLIDHNGILRILDRGRVVALTRSYPYLN
                     QESGGRKSVDARASPGARSPEGPRKRARKPRSDSLSKLSSILGNATFSPTSSRSPRPQ
                     ALERKFTLGPRMEEDETPKPPTPRYEEYEQAPPSPWSQSPAPSPAVRADPAENPFFTD
                     AVVDEESFNPSASPADYSAMVPPEAIGVDNSWTILHVPLTHVLLSRPNPSFKLDPSVM
                     EQKISARKSGDPPPTANLSPERTVKEKHAPIAILSILSPIIPYPSNLRQSLEYLAPHL
                     ATSFSLCRHYTNLETELNGLQKRRPQTAGFGALRPDGRPLADPTALGSFSHMPAEDPA
                     SRDSMAGSMTSPSDYSGPARSAAGSPGGTPNWDPSSLSGVMDGKRGHTSSPAPVHVDS
                     YFSSVTKGPTHAGQRPRTNSRDTPLSEKRSSLRLSGGKAQLHEPATASPTAAESRRSN
                     ESARHEPVEEYPWVGAQQRQLGAAREKTDEGPGEKESSMAPPPLAENQKATAGTPGSA
                     PHRHTQLHSYGADFASIFQSLPPSSTISLGVPHPAPSRSGSMTQTDMTPPSDKLKGLI
                     LDSLPAHVFVALPQTGEIVWVNSRFLTYRGQTSAELAADPWGSIHPEDREGYLREWSH
                     CVRTGGQFAKKVRIRRFDGAYRWFYARAVASKDKRGVIMQFLGSYMDIHDQHMAEVKA
                     ARQEEVLASEAKHRLLANLIPQIIFTATEDEGITFANEQWLSYTGQVSDDVLGLGFMD
                     YVHPDDLAKCRIPPTEQSNHDSKRGGTSSHDRSFSADYTAPRQSEKHSSLPDGDGHGS
                     GQQNNSRNGSNDATTNHLSSANLSELAKKGVIKVSTDSSGRISYTTEIRLRSKSGEYR
                     WHLIRCVEIDNVDFGNGASSYFGSATDINDLKLLEAKLKEAMDSKGRFLSNMSHEIRT
                     PLIGISGMVSFLQDTTLNEEQRDYTNTIQTSANSLLMIINDILDLSKVDAGMMKLNYE
                     WFHTRSLIEDVNELVSTMAVAKRLELNYVVEEDVPAWVKGDKVRIRQVLLNVIGNAIK
                     FTPKGEVFSKCRVFVPEDARLRPDEIMLEFSIIDTGRGFTQEEAELIFKPFSQIDGSS
                     TRQHGGSGLGLVISRQLVELHGGKMVGTAVPGEGSTFTFTARFGLPTEDDHPESWVPQ
                     PTPGSMQATPFPAALPPASIDVRERPSDSPPTAIPHFVSPAAASSGSSELSTTSSHSR
                     ATDRSSVTSVNTGIVHFSQAARASGQDLSQMKLEMPSDRGSPESAPTTTPEDLTTGKQ
                     QHQQQNQQQQHHHHHLSPPMFSILIICPQNHSREATTKHIEMTLPKSVPHQITAVASV
                     EEAHSFFGGEDPVRFTHIVVNLPTPEEVISLMDKISQSASTTLGNTTILILSDTVQRQ
                     AVSKLVAGTKYEAMLSESNVTYIYKPVKPSRFAVIFDPAKERDLSIDHNRSTAQRLVE
                     DQRQSYLEMERRMGGKGYKVLLVEDNPVNQKVLQKYLKRVGVAVELAADGVECTEMVF
                     SKGWGYYALILCDLHMPRKDGYQACREVRAWEAERGHGSLPIIALSANVMSGVQEKCV
                     NAGFNDYVTKPVDFIDLSRALSKFF"
     gene            <1774565..>1775849
                     /locus_tag="MYCTH_56561"
                     /db_xref="GeneID:11507173"
     mRNA            join(<1774565..1775258,1775350..>1775849)
                     /locus_tag="MYCTH_56561"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666840.1"
                     /db_xref="GeneID:11507173"
     CDS             join(1774565..1775258,1775350..1775849)
                     /locus_tag="MYCTH_56561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666888.1"
                     /db_xref="GeneID:11507173"
                     /db_xref="JGIDB:Spoth2_56561"
                     /translation="MRAWLAAKTEEDKRRQEEEKTRQEGYRLEQRRIEHEMLRTSLQG
                     GIPPPLVPVVFAGMGGGALSPAALDWAQQFMASHAPLQHPPALMPPGAMSSEHPRRDS
                     QTHPYGQYPAPGGGGVPSTPGSAQGVPGGYTSGYPGSPTRPRGLSMPGAMAGRPLAGA
                     SANLSNLNTNIPSVSGHQPGLTQSQPQPQPQQQQQQQEAQRSPSIYFHHWQPPTTQAG
                     GGRGGAEQPATPSGESPRKRKAPGPQQPAPPPSTTTHRHRSPPFLQATRLSNPPPGRR
                     RGHSRQRSDLGLYRSGAGRGRGEMSDPGRESSPMHTSGTDSARDGGNPPSSAPQQTQV
                     LQPASAPAQAPSGPRTGAHSVSSLLSEDPQSPRATARNFASGTHWEARQQQQQQQQQQ
                     QQQQQ"
     gene            complement(1783276..1788013)
                     /locus_tag="MYCTH_2312007"
                     /db_xref="GeneID:11507174"
     mRNA            complement(join(1783276..1784816,1784923..1786237,
                     1786369..1788013))
                     /locus_tag="MYCTH_2312007"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666841.1"
                     /db_xref="GeneID:11507174"
     CDS             complement(join(1784058..1784816,1784923..1786237,
                     1786369..1787909))
                     /locus_tag="MYCTH_2312007"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666889.1"
                     /db_xref="GeneID:11507174"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_2312007"
                     /translation="MALPKFGSMRHRRPSGAAARLTHFRDDTGLVALRYEETKLAEPP
                     IPLPPPRNPRRLARASSTIASSTTASATPITVNPPLVPPPPEEHPLFRAQRQSHQAHQ
                     TCQACQAQAQAQVEERKRDSGAPTWSTVTLREEHAEGPAHSKILHDAADTPSVYSYDD
                     EEDPAIVHQRQQQQQHHHHHHHHQLAPPPLTVRIPPRPGNPESAGGPPSSCSPTPPKS
                     PSSPSPPSSPSSKSPSLRRTSLGERFGKAIGIGSDGSRRIRKRVLGADRAAAQAKPPE
                     MEPERGSARPPKSPKSPKSPTCNKLSPQVPGPGPASADRAPYAAPPLTSAATPSANAK
                     SFAPIITTPIPDDSLWEDLPAVSFSKRGSIMFCGKNKNNRFKSMMTMSAPDATAPAPA
                     PAPAPAPAPSGADESATAARSSTEHQQLPPTADDHDAAAPRQETCTGKAEETASRHVS
                     ADAPSVPSIRVSSMDVERESQKVRSLYESGDDLNWEDGGRVSYPERLGLEPTTEVPSE
                     EEENAVSLRSSDPLSASAPRSQSARLNPPTSTTTTPAPANSLSPPRDSQVRREYERAG
                     GTEDWADLDGVEVDRYGFITPKRPVSSAGTAVPRSSPFSSRRKPVLTKRPSTSYATSL
                     PGGFIRPPSRKVSARSLNTYASELSTASRRSTRSSIRSATNRLPHNRERRWMDEAGEM
                     LSLQAGLTSISDDEKMGKTVEAQKRKEAERSEKWRKMATVVRPSVTTVTTTTTSSSST
                     PGGGGGASASFDHSTPALSQPAPKYPQGQGMSYTFDTTSPKLIDRVWKGIPDCWRSAA
                     WWAFLATSAASHDHNHSSKTPRETEDYLIAEFRRLQAVASPDDVQIDMDVPRTVNGHI
                     MFRRRYRGGQRLLFRVLHAISLYFPHTGYVQGMASLAATLLCYFDEERAFIMLVRLWR
                     YRGLERLYQPGFAGLVSALAEFEGKWLTGAGKDVAEKLNELDINATAYGTRWYLTLFN
                     LSIPFPAQLRVWDVFMLLGDCPPEPAAVATTTPPPDAAPATATDGAPPPPRSSRTADE
                     TPPKGLDILHATAAALIHALRDVLLDSDFENAMKALTAWIPVRDEDLLMKVARAEWRR
                     HQQGRGGAKLWDWDWDRGVKGKEGKEGKDNKEGKERTEHAKTEKGKDKEKKEKGKGLG
                     MGMGMGMGKLWERGSDKEKAKDKDKQHQQQHHHQQRQQQQQQQQPQSQKSGKEKDGTA
                     "
     gene            complement(<1791768..>1794469)
                     /locus_tag="MYCTH_2113540"
                     /db_xref="GeneID:11507175"
     mRNA            complement(join(<1791768..1793315,1793380..1793775,
                     1793832..1794205,1794310..>1794469))
                     /locus_tag="MYCTH_2113540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666842.1"
                     /db_xref="GeneID:11507175"
     CDS             complement(join(1791768..1793315,1793380..1793775,
                     1793832..1794205,1794310..1794469))
                     /locus_tag="MYCTH_2113540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666890.1"
                     /db_xref="GeneID:11507175"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="JGIDB:Spoth2_2113540"
                     /translation="MDLGDSEGGFDAGTPGQPPKPRTLPDDLPRSLDDRRRVPTELMP
                     EAEMYDGWQGQSQFLTSPIVAKPMTFSDLTLEDNYGDDLTKGGPESESRLMEMLAAQA
                     AHAASAAFEDEDAIAADDKRSEDEKKDILQKTFIMAASNGNLESVTKILEGKARKYVD
                     IDAPDDEGTPALIYASCFGHESVVQALIDAGVDVNKQDRNQWSALMWAMTNRHKGIAK
                     LLLDNGASTEAKTSTGRTAFDFVAPDSDMSFYLSGYGIGTAGTTDDFYNPGFDQDKLE
                     EELAENEMRRRMMMESARDLEVDLGNVGIDDQPESLDDFEEEQQEFDWSRCLHDQMFV
                     FQENELERILDIVITNMTPQRSPSQKPVPANMIFLAARYAHYHSSPELLAKLLITALN
                     KINAVVEKHQWDMTILAFWMSNATLLLHYLKKDAGLVEATTEFQAQLAELINEIFILI
                     VRDAERRLDKVLDVAMLDHETIPGFEDITFQNEWKIFKRRKEVKEEPLEKRLRPPSPK
                     RRAKPSPRNVTSLLSSTLFVLDLYDVHSVITAQVISQLIYWLGAELFNRIMSNRKYLA
                     RTKAMQIRMNVSTLEDWARQNNRQPEHYEKGEMKSSGETTVEAARRHLAPVIQLLQWL
                     QCFSSLDADDLEALVATLQQLKALSPQQLIHAATHYRPEVGEKGLPKSAMKYLVSIQK
                     EAALRRERNRAAAAAAASPPGTPGRKEGGKTSNGAAAGGTSRPDTAGGGEGDAGGRAR
                     DDEEDEAPPNLLLDPALMLPFTLPSSTDMLVSYGAGFGGLNRERERKYIPTIPPEFLE
                     KLESSGTGSSSGRGALYGQANWDDEDD"
     gene            complement(<1795170..>1796323)
                     /locus_tag="MYCTH_2113541"
                     /db_xref="GeneID:11507176"
     mRNA            complement(join(<1795170..1796143,1796233..>1796323))
                     /locus_tag="MYCTH_2113541"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666843.1"
                     /db_xref="GeneID:11507176"
     CDS             complement(join(1795170..1796143,1796233..1796323))
                     /locus_tag="MYCTH_2113541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666891.1"
                     /db_xref="GeneID:11507176"
                     /db_xref="InterPro:IPR015908"
                     /db_xref="JGIDB:Spoth2_2113541"
                     /translation="MEDIEYQLEAVPATRVPADEIDNTFRSSCIDLVSQSLGGKVLGF
                     SDEWFADAANLINPAAPIRQVGKYVHTGAWYDGWETRRHNPEPFDWVVIRLGVASGTV
                     EGVEVDTAFFSGNHAPAISVEGCFSQNDDEVLSWKGTRGGWETILGIQECGPSQRFGW
                     KLDNPTKKQYTHVRLNMYPDGGIARFRLFGHAVPVFPEDKEAIFDLAAAQNGGVAVSC
                     NDQHFGTAANLILPGRGKDMGDGWETARSRTKGHFDWAIIRLGAPGYIQSFLVDTAHF
                     RGNYPQQVRLEAIEWNGDSEPPADAEGWVNMAEPIKCGPDAEHPAESLVKDRPFTHAK
                     LIMIPDGGVKRLRVFGKRAV"
     gene            1796916..1798473
                     /locus_tag="MYCTH_2312016"
                     /db_xref="GeneID:11507177"
     mRNA            join(1796916..1797411,1797471..1797679,1797801..1798473)
                     /locus_tag="MYCTH_2312016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666844.1"
                     /db_xref="GeneID:11507177"
     CDS             join(1797279..1797411,1797471..1797679,1797801..1798223)
                     /locus_tag="MYCTH_2312016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666892.1"
                     /db_xref="GeneID:11507177"
                     /db_xref="JGIDB:Spoth2_2312016"
                     /translation="MASAESTLPTHGDAPAPTESEPLLGRPGDATQRPDAPMIYNLFL
                     GTGKLAQAGALLLLAIIWASVFTNPTLPLVSPHPLLQSLGVYTVIQAILILQPTNTPH
                     TKLLGQRAHFRMHILSLSLFVAGTTIIEVNKATNHLAHFHSPHAFLGVITLSLLLLQY
                     LFGLTIWAVPALYGGEDPAKRLWKYHRWVGYAALLLLLATVAAAVETDYTKSVLRIRL
                     WAVLVAEALIVAGVFPRVHLRKLGLRSPRASSSSSS"
     gene            complement(<1799236..>1800429)
                     /locus_tag="MYCTH_2070984"
                     /db_xref="GeneID:11507178"
     mRNA            complement(join(<1799236..1799781,1799839..1799932,
                     1799985..1800072,1800124..1800193,1800304..1800339,
                     1800400..>1800429))
                     /locus_tag="MYCTH_2070984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666845.1"
                     /db_xref="GeneID:11507178"
     CDS             complement(join(1799236..1799781,1799839..1799932,
                     1799985..1800072,1800124..1800193,1800304..1800339,
                     1800400..1800429))
                     /locus_tag="MYCTH_2070984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666893.1"
                     /db_xref="GeneID:11507178"
                     /db_xref="JGIDB:Spoth2_2070984"
                     /translation="MGSTKFGNFDEFCRDTTLPVCNSGPWGGCQLKGISLSNDRHLGN
                     LGSILLAGVAIVVSVWLLYRSERKRAAVGRREMQAFLLGYILISICEIFSVGDFPLNS
                     DVRMAFSAIHIGAIAATTWILFLNGIVGYQLMDDGTPLSVGLFFVSSLVFLIGVGYIA
                     LDTGFSFTGYWDSSYSLPNRNIALYVLYLLIPLLWIVLFFVLESVLVLKVLGEIRPMM
                     FLVSAAVAFAAGQVFNFVVSPYICDGTSGAIDGALFQTLFTLVSVVLVWFFWSSITED
                     DWPMDPVHPYP"
     gene            <1802914..1806275
                     /locus_tag="MYCTH_109194"
                     /db_xref="GeneID:11507179"
     mRNA            join(<1802914..1802927,1803411..1803938,1803992..1804069,
                     1804137..1804619,1804685..1805397,1805484..1806275)
                     /locus_tag="MYCTH_109194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666846.1"
                     /db_xref="GeneID:11507179"
     CDS             join(1802914..1802927,1803411..1803938,1803992..1804069,
                     1804137..1804619,1804685..1805397,1805484..1805884)
                     /locus_tag="MYCTH_109194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666894.1"
                     /db_xref="GeneID:11507179"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_109194"
                     /translation="MFSVPPITTKIPVPNPARLPSNIPLRTLPGHNQRQHPGHDREQT
                     SRLLGSSHGYGHPVDEPGYSESEDDSSWTDTGDIAEQLADDDPLRQRATQTLGDDAFA
                     GSLKKRHHGGRSSKRVRYSEPLSPGSSRSASQHIDAISKEAIQVPTVGNRKAPRAERL
                     LAAIMTGGTSSIHGLTGKPLLYFTSIFVSLGVFLFGYDQGVMSGIIVGEYFRKYFHDP
                     TPVQIATMVAILEIGALISSLMVGRIGDIIGRRKTIFYGSCVFFVGGALQSFAVNMPM
                     MLVGRVLAGLGVGMLSTIVPVYQSEISPPHNRGHLACIEFTGNITGYATSVWVDYFCM
                     FIEGDLSWRLPLLMQCIMGGLLGLGSLIIVESPRWLLDNDHDEEGIVVIANLYGGGDI
                     HNPRARDEFRDIKMNVLLQRQEGERTYGEMFKRYSRRVFIAMSAQALAQLNGINVISY
                     YAPYLFERAGWIGHAAVLMAGINGITYVLSTIPPWYIVDRWGRRPILLSGAIAMCLSL
                     SSIAYVQYLDIPLTPKLVVILVVIYNAAFGYSWGPVPWLYPPEILPLKIRSKGASLST
                     ATNWAFNWLVGEMTPILQELIAWRLYLVHAFFCALSFVVVYFLYPETCGVRLEDMDAL
                     FGDSTRALGTPVSSSTPAMRAESDALLRPESPVPPLDAAGGARSRHAASAVIPGLNIE
                     PPVDVEADGKSRTAPTRASAEGRSGGLGGWFSRIIGRGSNGEGSSGGYAPVQQRED"
     gene            1806493..1807259
                     /locus_tag="MYCTH_2312024"
                     /db_xref="GeneID:11507180"
     mRNA            join(1806493..1806906,1807114..1807259)
                     /locus_tag="MYCTH_2312024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666847.1"
                     /db_xref="GeneID:11507180"
     CDS             join(1806563..1806906,1807114..1807204)
                     /locus_tag="MYCTH_2312024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666895.1"
                     /db_xref="GeneID:11507180"
                     /db_xref="InterPro:IPR013884"
                     /db_xref="JGIDB:Spoth2_2312024"
                     /translation="MAAAAPATTELLHAYRRLLRAGLRAVQFSQPSRSTLTAKLREGF
                     RDPRGTFDAERVRRTVWFLNAAAQQRGLEHRILKNLCRVHWERAREASRTAWRMRVRH
                     DEAEKNRKEAKKKDPDVIKGTEYEHFERTIAMLNDTMGLCLR"
     gene            1808705..1810586
                     /locus_tag="MYCTH_2312027"
                     /db_xref="GeneID:11507181"
     mRNA            join(1808705..1809734,1809799..1809987,1810115..1810267,
                     1810347..1810586)
                     /locus_tag="MYCTH_2312027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666848.1"
                     /db_xref="GeneID:11507181"
     CDS             join(1809080..1809734,1809799..1809987,1810115..1810267,
                     1810347..1810555)
                     /locus_tag="MYCTH_2312027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666896.1"
                     /db_xref="GeneID:11507181"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2312027"
                     /translation="MPPSSSSQQHDGQQQQKQQQQQQQEPQKRDRNLREQRHTNRNLD
                     EDISPDPRLATAAAAAAALSRESSAPSSAPASSGVDAISSYQRLVKRYRVEVAASASS
                     VLSTLTTFPLDSVKTRMQTYRYAGFLDCVKHTYSTEKFRGFFRGVTAPMASITLVRTV
                     SFSIYQRSKHAYCDWVKRNLGVDVMAHVSSPGSLPSFWSVATFGAAGATAGSCITVIA
                     CPFELTKLSAQVSVLLADKKNYPKPGSHAIAASYQNKGTLKTLGNIIKHRGFGGLYTG
                     FRLHLMRDTLGTATYFMTYESSKQLLTTFGGDGTHSNPLVVVVAGGLCGIVSWALIYP
                     VDSAKSIYQRNSLMYSKGEKVEPVKIRFFQRNMYRGLGVSMGRSCAVNAVFFSSFEFL
                     KKRIKAWDQ"
     gene            <1811825..>1812900
                     /locus_tag="MYCTH_2121454"
                     /db_xref="GeneID:11507182"
     mRNA            join(<1811825..1811875,1811957..1812380,1812878..>1812900)
                     /locus_tag="MYCTH_2121454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666849.1"
                     /db_xref="GeneID:11507182"
     CDS             join(1811825..1811875,1811957..1812380,1812878..1812900)
                     /locus_tag="MYCTH_2121454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666897.1"
                     /db_xref="GeneID:11507182"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2121454"
                     /translation="MTLARRGEGSILPTLNHPHIIRTFGSEGWGTSHVEIVLNLMDGN
                     LASLAEGMARPRRVLAKHVLCQMLQALDYLSVRGYVHRDVKPDNIFFVLAPGYGGRDK
                     DRGGDDWDSDWDRGTGASPFPFHFRLGDFGLCEHESRIDAGTVRGTTAFMAPELFPRR
                     PRGKC"
     gene            1813622..1816456
                     /locus_tag="MYCTH_2312029"
                     /db_xref="GeneID:11507183"
     mRNA            1813622..1816456
                     /locus_tag="MYCTH_2312029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666850.1"
                     /db_xref="GeneID:11507183"
     CDS             1813816..1816212
                     /locus_tag="MYCTH_2312029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666898.1"
                     /db_xref="GeneID:11507183"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2312029"
                     /translation="MRLGLDRDVYQIVLKLEEEGEDGRKPRLTVGSVYESIKRSNSSL
                     ARQKKRPLEDSIERVLAIRREQTKADEQEDSDDLLEAQEQERIKAAKAERDQNLLNRQ
                     IAKSWGFASQKAAGTGATTTPAETPATTPGAQPPPQPEATPAVAGMDTPTAAGDRQPN
                     GEPRPKKRKSAPKEVDRSPPTGVSILDIAGVDDTLDRLLDEVWFPLCAGEACEKMGYR
                     YDNGVLLHGPSGCGKTTLAHAVAGSIGVAFIPVSAPSIVGGTSGESEKNIRDVFDEAI
                     RLAPCLVFFDEIDSIAGRRESANKGMESRIVAEIMNGMDRIKQQTPLGKNVVVLAATN
                     RPDFLDPAIRRRFSAEIDMGMPSEKAREHILRSLTRDLSLADDVDFKELAKLTPGYVG
                     SDLQYVVKAAVSGSCRSKLEDLLQKARAQSAPDYLGSASERQRDWILLQEHRAAPWEE
                     SRITMAQFRAAVSRVQPASKREGFSTIPDTTWSHVGALEDVRKKLEMSIIGPIKNPDL
                     FSAVGIKPAAGILLWGPPGCGKTLVAKAVANESKANFISIKGPELLNKYVGESERAVR
                     QLFARAKSSAPCILFFDEMDALVPKRDDSLSDASARVVNTLLTELDGVGDRSGIYVIG
                     ATNRPDIIDEAIRRPGRLGTSIYVGLPSPDDRVDILRTLYRNTVAEARKETTAKAKAA
                     ATAAGDVDMPDASSPAPGGATAPIGTDEAVLEKVARDVRCTGFSGADLGNLMQAAAQA
                     CLERAYLMRKRGPAGAGAGAAGTAAALEPVITMEDWEKALTEVKPSVKDADKYMLEGQ
                     "
     gene            complement(1816423..1817745)
                     /locus_tag="MYCTH_2316564"
                     /db_xref="GeneID:11507184"
     mRNA            complement(join(1816423..1816773,1816845..1816939,
                     1817002..1817192,1817595..1817745))
                     /locus_tag="MYCTH_2316564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666851.1"
                     /db_xref="GeneID:11507184"
     CDS             complement(join(1816749..1816773,1816845..1816939,
                     1817002..1817192,1817595..1817610))
                     /locus_tag="MYCTH_2316564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666899.1"
                     /db_xref="GeneID:11507184"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="JGIDB:Spoth2_2316564"
                     /translation="MGFSAGDAKKGANLFKTRCEQCHTVDANGGNKIGPALHGLFGRK
                     TGSVEGYAYTDANKQKGITWNEETLFAYLENPKKYIPGTKMAFGGLKKEKDRNDLITY
                     LKEATA"
     gene            1818315..1819567
                     /locus_tag="MYCTH_2312033"
                     /db_xref="GeneID:11507263"
     mRNA            join(1818315..1818809,1818937..1819567)
                     /locus_tag="MYCTH_2312033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666852.1"
                     /db_xref="GeneID:11507263"
     CDS             join(1818408..1818809,1818937..1819440)
                     /locus_tag="MYCTH_2312033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666900.1"
                     /db_xref="GeneID:11507263"
                     /db_xref="JGIDB:Spoth2_2312033"
                     /translation="MTPAPAAPIIPRFLLPQTGLIWRRAAPAASAPASVSTRSRVFLR
                     LARNSSSSSSSSNAGTPSGQRVLAKPERFNPPSHGSRLPKKSIPRHYGGDLSFEEASA
                     QASRDYPGLPPPPNTFAHWFLHSRWIHVVITVGTLTGLAIYTFALSFQRTSPFADMLP
                     PASEYLYHPIGSVRVLIEVLRLHEAHKAERINEKRRRNVEDVAKRAAYRKAHGLPDEM
                     GLFNQPMAKIRTAEDGGGGSDAAQKEVEAAAPVEEEAPVEASGHGDAGEGGVDGPKGS
                     EVKRLTEEERKAVVEKTKGKWLGIF"
     gene            complement(1819569..1821299)
                     /locus_tag="MYCTH_2312035"
                     /db_xref="GeneID:11507264"
     mRNA            complement(join(1819569..1820436,1820568..1821299))
                     /locus_tag="MYCTH_2312035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666853.1"
                     /db_xref="GeneID:11507264"
     CDS             complement(join(1819723..1820436,1820568..1821101))
                     /locus_tag="MYCTH_2312035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666901.1"
                     /db_xref="GeneID:11507264"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="JGIDB:Spoth2_2312035"
                     /translation="MASSQHVLLSPAELAYLHSSLSLTPPIRPDGRSPTQFRPLVAET
                     GILPGTNGSARICFADGTEAIVGVKAEVERTAQRPGDETVFLEEGGASGDGDDDDGGE
                     EGEGGEEEDGRKGTGVDRRKGEASWVEMTVEIPGLRDDDSGTTFLSALLSEALLADGE
                     FVKKLWINRRFHWKLYLDIILISPPLSYPLPLLSLTTHLALLSTRLPRLKSEGDEDPF
                     FDDDWAAAPYLFPRSTSSTTAAAKQTVIATRPPITLLVMAVGNNIIFDPSKEELAVAD
                     VALAVSVTSGGGGGGGGGGGGGRQGRNNDDAAGADMDVDGIAAGGRNLRLLSIRTIDP
                     PSRLTPPGVPNAANAAYGAAAPGTQKMLEARTAETEAVEGVWKPPRGGAKRMVLGALV
                     QKVLERGGVVDEVLDALEGVELG"
     gene            complement(1822438..1826388)
                     /locus_tag="MYCTH_2312036"
                     /db_xref="GeneID:11507265"
     mRNA            complement(1822438..1826388)
                     /locus_tag="MYCTH_2312036"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666854.1"
                     /db_xref="GeneID:11507265"
     CDS             complement(1822556..1826263)
                     /locus_tag="MYCTH_2312036"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666902.1"
                     /db_xref="GeneID:11507265"
                     /db_xref="InterPro:IPR012317"
                     /db_xref="JGIDB:Spoth2_2312036"
                     /translation="MGFKKFKADVSTAGQKAASGEIPGVRSITTGDSDGEVVIKYHHE
                     SLLADVRIQALAQDVGEYPDGNMFMLWTDDPDPPTPVAAAVKAAREYLLGMSVYEMVT
                     ELVRRLEKEIGRALDGEVGSPGDVTEEDEVDDYDVAFDTDYPSDGDEFGLPSLPAQRS
                     HHNLNSSVNQKDLLRRIRRDLREVREAGYRVGFLDGFGKDSTTGTIALSIRLDKLALS
                     NEAMEAWDVKPTEYVVLLVRFDRKYYPLEQVFNQAAARTEVTFRIGKCSKHKPSIEQA
                     SRAFAKPNRSVSTEGSEPVKSTERDSDETRFEKLLVSNSLDSFMCESFISLLKIREAH
                     GCSWEKANDVLLSRIGLVAEESWGYNPHSDADSNNTAPEPEPVRVPGADHLLQGGNDS
                     ERSFPLIAVQFAMRYFVRCTEYCLRCHRRLEKGFEALRPYVCSDPLCLFQYMAVGLGP
                     SIEHEILTEPYVVDLLVSLCYAAVQPASIHLANNPSNTRPKFPIRSFPVGLRLRVPDL
                     TNPTAVTFKARLEAGDKHIVFEDEAAKSLGGRLAPGAWLAFPNPTTRLIRNARVKEVY
                     SSPKTAVIEVIGESVVSWSFSQYSPQYLPNQPGPSPATGSMTPSAATDDADMVDIYLY
                     DTDFDSLDDFSKAAAMRHLLDTLPPILEIEEWLASHPGHSFRAMGRISPAAASLLQWI
                     VSSNRSCILQVDRSRAIARRAKGPIERGKPAPGAKKKNMGPPETAGVAGRGRNREHER
                     ILGMDGWVQFRFAQGAPDKELRFNRALQEVAARKHIGHNPTIFAWHGSNLANWHSILR
                     TGLDFQNINSGRAFGHGVYFSRWKETSVGYASKGQSWPNSDLGITNCLSLNEIINAPD
                     EFVSSNPHYVVSQLDWQQCRYLFVQTAAGRTQELAQDQAANGGTTTSPAFYPQARGGE
                     AFGQGYQPLKIPLCAIPLRTIGPAPATPPDSAKRTMHLLEESEDEDAEDASRLMSDDE
                     DDDFYIPPSKKPASPASSVGAASIQNISHVSRGGPPSPASSSVGRGLTEFEPGALDLS
                     TLPRLQPPSFATDGATRALSRELRDLQALQAKTPLHELGWYVDFDNVSNLYQWIIELH
                     SFDVSLPLAQDMKLAQATSVVLELRFGSDFPFSPPFVRVVRPRFLPFMEGGGGHVTAG
                     GAMCMELLTESGWSPANSMESVLLQVRMALCNLEPRPARLDPRLLRKTGARPGYKGDY
                     SIGEAIEAFTRAAKSHGWTVPKGLKVTALGG"
     gene            1827388..1829030
                     /locus_tag="MYCTH_2312038"
                     /db_xref="GeneID:11507266"
     mRNA            1827388..1829030
                     /locus_tag="MYCTH_2312038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666855.1"
                     /db_xref="GeneID:11507266"
     CDS             1827653..1828951
                     /locus_tag="MYCTH_2312038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666903.1"
                     /db_xref="GeneID:11507266"
                     /db_xref="JGIDB:Spoth2_2312038"
                     /translation="MAWDSKAARRRKSSAASGTRSIAIHARQQSRRVAQPRSQHVADP
                     FLQDFLSPSFDAASYLNATLPPLQTSSRTSGSQGSAREAVPLAELSIQTQELLSQLNA
                     HTTRLTNTLTELTNDILRSGSRLAYEVELLRGETLSLAEALSEGLEHDISRFVPGGVR
                     DIMAEPKAGVDSHGTSAHQRRKSILMAAPGATAGATRAAAEGTAAPAPAPAPAEGPAG
                     QAETSSAPSEPPYITQLRTLTLVRSRLESVIKTFGDAMEFVFPPSELSVSSSFLSVSA
                     PDADGGGRHSTEEKGQQVLRKLRDEISGLLSGNDGGDPIKGIEDAARRVEELKELTTV
                     WKGTAEEKGRTKFVESLAKMVEDRHRELLREVEAQQQQQQQQQQQSSGRRDGAGRPQA
                     EASGKAAGGVEVADGPGQTETKGYGAYGLISQLQRLRNGL"
     gene            complement(1829699..1832250)
                     /locus_tag="MYCTH_117406"
                     /db_xref="GeneID:11507267"
     mRNA            complement(join(1829699..1831030,1831228..1832250))
                     /locus_tag="MYCTH_117406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666856.1"
                     /db_xref="GeneID:11507267"
     CDS             complement(join(1830537..1831030,1831228..1831285))
                     /locus_tag="MYCTH_117406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666904.1"
                     /db_xref="GeneID:11507267"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Spoth2_117406"
                     /translation="MAASGNNRSMESRTGRSNQRYNSKGERLVAGVVPLTEDKAYVML
                     IQSTRRKGWVLPKGGWETDEECHEAAAREAWEEAGIFVQIDYDLGDIHETSPRKKASP
                     SSSSSSSKSSGKDSTKDGKDSPKEKPRSLYRFYEVTVTSEEADWPEREKRERKWFTFA
                     EAKDMLKDRPELQTALERSTMKR"
     gene            1834233..1836549
                     /locus_tag="MYCTH_2312042"
                     /db_xref="GeneID:11507268"
     mRNA            join(1834233..1834421,1834789..1834851,1835077..1836549)
                     /locus_tag="MYCTH_2312042"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666857.1"
                     /db_xref="GeneID:11507268"
     CDS             join(1834370..1834421,1834789..1834851,1835077..1836383)
                     /locus_tag="MYCTH_2312042"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666905.1"
                     /db_xref="GeneID:11507268"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="JGIDB:Spoth2_2312042"
                     /translation="MQVPGEVAAQHSFLFPIGYDNSSECGYCRRSRGGQFAKRYSYYA
                     IATSLTPAFYQKIVDRCWRRSGTLLYRPNPRHSCCPHYTLRLDSTQFKPTKDQRQAVN
                     RFNRHIIGDTYVREAARLHPRSRAEVRRRHNVFDLVERIHEPEAQALKTPPTPDHDFT
                     VTLEPDTFTEEKYEVFENYQRVVHREPPEKISRNGFKRFLCNSPLSRGVMVGPDGRER
                     QLGSFHQCYRIDGKLVAVGVLDLLPDCVSAVYFLYHESIHWLNPGKLGALREIALARE
                     AGYRWWYPGYYVHNCAKMRYKIEYKPQYVLDPEDLRWYPLDKEALARFDKAHYVCFSR
                     DMREHEQVSHDDGIHDGTAEPPLPEAAGTCASGAGPPEEADEDDVDEYEEGEGEEGTF
                     LLSSSMPGIPSLAEMEQVNMDGLVLRSDFSDNLIVASHLVSWDTEKISDFGTLKSRIA
                     ELVAAVGPDLIGEICIDFRRRSS"
     gene            <1838367..1839439
                     /locus_tag="MYCTH_2084777"
                     /db_xref="GeneID:11507269"
     mRNA            join(<1838367..1838507,1838562..1839439)
                     /locus_tag="MYCTH_2084777"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666858.1"
                     /db_xref="GeneID:11507269"
     CDS             join(1838367..1838507,1838562..1839371)
                     /locus_tag="MYCTH_2084777"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666906.1"
                     /db_xref="GeneID:11507269"
                     /db_xref="JGIDB:Spoth2_2084777"
                     /translation="MASLLDIAFRKVIGVKGATTGIKTIKSLASPSLLEIAPAVWDMQ
                     YLQAIYVHSQLIPSIAAGIGRLRNAHSATLRRKLDNFARPITPAKDDQELADPRSDVT
                     DEVRQRLWLLCQTRIRAGLVRRPFATRQAERKTVEQPRVQLGLAGTRWENTPTHETDV
                     GYLPTTEHHDLAESFDLSGGFSEVLSEPAVHEIGVLEETSDSYTLEDGVPSSDNLTLS
                     SEGDYFYTDGQGNVYPIAREAVAEDGQSEWLSTQLTDPYDFSQTQGEELEEHWLGNPG
                     QTFIMYQGNGTTDPVGHINTNAAAENFFPPPYPEDAPLGS"
     gene            complement(<1839720..>1839941)
                     /locus_tag="MYCTH_57543"
                     /db_xref="GeneID:11507270"
     mRNA            complement(<1839720..>1839941)
                     /locus_tag="MYCTH_57543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666859.1"
                     /db_xref="GeneID:11507270"
     CDS             complement(1839720..1839941)
                     /locus_tag="MYCTH_57543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666907.1"
                     /db_xref="GeneID:11507270"
                     /db_xref="JGIDB:Spoth2_57543"
                     /translation="MGQFDWFGKIGATPEAVAVLNDQPHLFTILIIVLIALILQCVLH
                     WYIHYATMKPEQKKKKEKKGEKKGPEQKR"
     gene            1840821..1842599
                     /locus_tag="MYCTH_2312046"
                     /db_xref="GeneID:11507271"
     mRNA            join(1840821..1842258,1842373..1842599)
                     /locus_tag="MYCTH_2312046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666860.1"
                     /db_xref="GeneID:11507271"
     CDS             join(1841028..1842258,1842373..1842593)
                     /locus_tag="MYCTH_2312046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666908.1"
                     /db_xref="GeneID:11507271"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="JGIDB:Spoth2_2312046"
                     /translation="MSIARPAARRLVSGCLAAAAASPSPGAACAAPATTTAPCHHGRL
                     VLSNQFHSSPQLSARRRPRFASVRAADMGIMDDKQIDQFTKEKFPKYTPEEIEHLKTK
                     YSPEQIAALEAGEAAIDPRDLTVQGRLRSDPYTLPYIDDFAETQPIVDKRARHKEAPD
                     PHARFMNMDEFTEDLIRWADKFQTGDVTGTLKTLVDFVPDKYKKTPEGQWPGDVREEA
                     HRAFQRYLEAEVSRQAAKDPDDTSGPTDADVLQYILERSAMTDGNRTTDTSLAHGLPG
                     KVPGVAGLYKNAIDPEDKGLDDTGVYQDLKRRTGLSVAEILNLQSKRIVQRFVANQTR
                     LGKVRKASVMFVVGNGNGWLGIGEAKSTEPTVAALKARLMAIRNMQPIRRYENRTIYG
                     SVTSKVSGTVVKMEARPPGFGLRVPHRIFEMCRAAGIHDLAARIPRSRNPMNTVKAAY
                     WALTHQPDPDEIAMGRGKKLVDVRKVYYGGDVY"
     gene            complement(1843150..1844051)
                     /locus_tag="MYCTH_2312047"
                     /db_xref="GeneID:11507272"
     mRNA            complement(join(1843150..1843588,1843771..1844051))
                     /locus_tag="MYCTH_2312047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666861.1"
                     /db_xref="GeneID:11507272"
     CDS             complement(join(1843340..1843588,1843771..1843884))
                     /locus_tag="MYCTH_2312047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666909.1"
                     /db_xref="GeneID:11507272"
                     /db_xref="InterPro:IPR013965"
                     /db_xref="JGIDB:Spoth2_2312047"
                     /translation="MDPPPRPQSALLASPPELSPLEQEVLEEYERLAENMKNLAAILD
                     DLAGAPASDILDGLRALERQTSLVFTLLKASVYSIVLQQEIDWGSGDQQGQGQGQGHG
                     HHGQEEQQGGEEDEGEEG"
     gene            complement(<1844421..>1846488)
                     /locus_tag="MYCTH_2145572"
                     /db_xref="GeneID:11507273"
     mRNA            complement(join(<1844421..1846173,1846280..>1846488))
                     /locus_tag="MYCTH_2145572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666862.1"
                     /db_xref="GeneID:11507273"
     CDS             complement(join(1844421..1846173,1846280..1846488))
                     /locus_tag="MYCTH_2145572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666910.1"
                     /db_xref="GeneID:11507273"
                     /db_xref="JGIDB:Spoth2_2145572"
                     /translation="MSCCPLPHVNTHAAASPFPSSSPRPNDTNTNTISSGRFSLPFRQ
                     PPTVLEIIRGDPDEGDGPDPRTASVTPSSSSSSSSDHHYNQHQAVVVVRGLPRDVVEA
                     ALAEGLVPAGWADRFVRKCLARRRPWRPVVIRGRGGGDGAGGNDGGGAASGSGGRNGS
                     ETRGQRLGGYVWEYPEVVELEGGGIAFGGGVRDGDVDGALPPPVMPLLPRGGAGEERE
                     GRETGNKRLGVVFCRAGLWFGKERSVLFLDRDPRDGQGQGRRRARRSAGVAAGAASAA
                     DADADAAGEAKTETGAEGEVKEDLEDMVTEMLRSNPHAVDMLPTVVAEAAYHQWLVLF
                     DFLEPHPRVLDEATMACYLRMLRSLELNDEADDGDTVWRRLLVRLLGRIQLLSSASPV
                     ASLSTPRAPTVSGTTGEMANISKRRITSQPSTTGEFCLVPCRHGPIAQRALDENRKAL
                     DRLGYLAGILSPLPIVSGILSMGNGFGPYGDKFFVFWAVAVPLAGLVLLLIHADTIRK
                     AEVWVEIGSDRVVPISPGKTRDGEDRPSPGLLRHHAVPFVVDHEAEERNLDMPTMTDG
                     SAILAGEPEDGDRPRRRRWSTGWEQVPAVILERPADGSKPRAWKREQLSWYGAIMAIL
                     LFRRLRDGSHVPEGVAACEKAGRCRTKSC"
     gene            complement(1847621..1850301)
                     /locus_tag="MYCTH_2312051"
                     /db_xref="GeneID:11507274"
     mRNA            complement(join(1847621..1848179,1848307..1848688,
                     1848789..1849088,1849196..1850301))
                     /locus_tag="MYCTH_2312051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666863.1"
                     /db_xref="GeneID:11507274"
     CDS             complement(join(1847834..1848179,1848307..1848688,
                     1848789..1849088,1849196..1850105))
                     /locus_tag="MYCTH_2312051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666911.1"
                     /db_xref="GeneID:11507274"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Spoth2_2312051"
                     /translation="MIITTPTSRMPSITKNTNGDIHFHQKVKGWFTRNSANRDRAVAD
                     TVAPQNAGTGNGAPRTDSGKSTFRQTKFWTVGRLRSATTASEGNPLETETMSPTAHAN
                     PYFAHQGQPGLRHHNEGSVPPSPPDTPTVSVNPPDDDHGVPPEKATSATAAAELARKL
                     RRVASAPNAQGLFAKGAKSGGGVVGGSSSSNGSGSGGDDGGNGQRAVSDEPTKEPFEE
                     GEGSGTAAADGGLAVPSETDGIGSLPPPSQSALAFRRTYSSNSIKVRDVEVGPQSFDK
                     IKLIGKGDVGKVYLVREKKSSRLYAMKVLSKKEMIKRNKIKRALAEQEILATSNHPFI
                     VTLYHSFQSEDYLYLCMEYCSGGEFFRALQTRPGKCISEDDARFYAAEVTAALEYLHL
                     MGFIYRDLKPENILLHQSGHIMLSDFDLSKQSDPGGKPTMILGKNGTSSSSLPTIDTK
                     SCIANFRTNSFVGTEEYIAPEVIKGSGHTSAVDWWTLGILIYEMLYGTTPFKGKNRNA
                     TFANILREDIPFPDHAGAPQISNLCKSLIRKLLIKDENRRLGARAGASDIKSHPFFRT
                     TQWALIRHMKPPIIPHQGRGIDTVNFRNVKESESVDISGSRPMKPGVPPDGSTPGAET
                     PDPFEEFNSVTLHHEGDDWRT"
     gene            complement(<1852066..>1853478)
                     /locus_tag="MYCTH_2121442"
                     /db_xref="GeneID:11507275"
     mRNA            complement(join(<1852066..1852379,1852476..>1853478))
                     /locus_tag="MYCTH_2121442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666864.1"
                     /db_xref="GeneID:11507275"
     CDS             complement(join(1852066..1852379,1852476..1853478))
                     /locus_tag="MYCTH_2121442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666912.1"
                     /db_xref="GeneID:11507275"
                     /db_xref="JGIDB:Spoth2_2121442"
                     /translation="MPYDPDWDLEEGDGYKADTLQAEADHGSLSSGHASNGMGAVGEG
                     DKQGQETSGHEDGPDNVKSEDGMEVELPDRDRHHFGNAQHDRHTTPRSRLPFPGAEAI
                     ARLPHVEVVLHSSPRRSSFTALEDEMMERIDGEMNLVTSDIVPDQRRHQERPPAKAQA
                     VPPKTQTSAVPAPILTPQPKKRGRPVGWRLGYGSYTAMRSGLPPGSSTPRPKPQRPTS
                     EQKARRRPGRKPAPTARETYLKLNPRFISFRCEWENCPAELQNLDTLLKHLLVVHGRP
                     SSSASSSESGQPLPCKWSNCTAMPLPSRDSFAAHVETAHLIPYLWHAGDGPRNSTPTP
                     PTTSTTTAAEPLPSYLFNERGEQVTPSIAGQQVENEEERKKRQARVNRVLLQRDQNAP
                     EEPDYTPRELEMITELMSAKRARQEMFREYARRVYSSAEMAGWKPY"
     gene            1854452..1855779
                     /locus_tag="MYCTH_2312054"
                     /db_xref="GeneID:11507276"
     mRNA            join(1854452..1854811,1854906..1854987,1855076..1855382,
                     1855475..1855779)
                     /locus_tag="MYCTH_2312054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666865.1"
                     /db_xref="GeneID:11507276"
     CDS             join(1854535..1854811,1854906..1854987,1855076..1855382,
                     1855475..1855564)
                     /locus_tag="MYCTH_2312054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666913.1"
                     /db_xref="GeneID:11507276"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2312054"
                     /translation="MASTKAFYAVVAGVGAGTGRSVALRFAKAYPVVLIARNPSNYTD
                     IVAEIKQQGGEARGISADTSDPAAVASAFETIKAEFEKGKGLKLAAAIYNVGAGFAIK
                     PFLEVQASDLDASLNSNARGLFNFAQATLPSLLDAVPTSPHPPTLLITGATASVRGSA
                     RFATFAAGKFAVRALGQSLAREFGPQGVHVAHVIVDGVIDIPRTRGYTVNDGKEDGKI
                     SPDAIAESYWHLHTQHRSSFTQELDLRPYVEKF"
     gene            complement(1855753..1857330)
                     /locus_tag="MYCTH_2312055"
                     /db_xref="GeneID:11507277"
     mRNA            complement(join(1855753..1856445,1856512..1857152,
                     1857250..1857330))
                     /locus_tag="MYCTH_2312055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666866.1"
                     /db_xref="GeneID:11507277"
     CDS             complement(join(1855995..1856445,1856512..1857125))
                     /locus_tag="MYCTH_2312055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666914.1"
                     /db_xref="GeneID:11507277"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Spoth2_2312055"
                     /translation="MPPKKNEKGGKKDAKKIVEDKTFGMKNKKGAVARRQIAQLEASS
                     LAQQKRKEAEKKAREQEKKAAEAAKRETEALLNKPAQVQKVPFGVDPKTVVCIFYKKG
                     NCEKGKKCKFAHDLEVERKVEKKNVYQDTRAEEEEKKRQETSADWDEEKLRSVVLSKK
                     GNQRTTTDKVCKYFIQAIEDGKYGWFWVCPNGGDKCMYKHALPPGFVLKTKEQRAAEK
                     ALLEKSPLKTLTIEEFLESERHKLTGKLTPVTPETFAKWKKERLDKKAAEEQLQKAKE
                     ATGRALFESGKWRMDEDEESEDENDGTWNLEKLRQETEALRMKKEEERLAALHGIPTA
                     NSEPSGVPEDSAEPEAVPNT"
     gene            1857633..1858467
                     /locus_tag="MYCTH_2316572"
                     /db_xref="GeneID:11507278"
     mRNA            join(1857633..1857668,1857736..1858467)
                     /locus_tag="MYCTH_2316572"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666867.1"
                     /db_xref="GeneID:11507278"
     CDS             1857820..1858002
                     /locus_tag="MYCTH_2316572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666915.1"
                     /db_xref="GeneID:11507278"
                     /db_xref="JGIDB:Spoth2_2316572"
                     /translation="MITDTELYRLAIVLGSAAMVLIILYHFFEVNSGEEQSEALKEKA
                     SRKGAPQNTQGSTKTR"
     gene            1859041..1861346
                     /locus_tag="MYCTH_2316574"
                     /db_xref="GeneID:11507279"
     mRNA            join(1859041..1859652,1859713..1859742,1860667..1860831,
                     1860928..1861346)
                     /locus_tag="MYCTH_2316574"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666868.1"
                     /db_xref="GeneID:11507279"
     CDS             join(1859422..1859652,1859713..1859742,1860667..1860831,
                     1860928..1861266)
                     /locus_tag="MYCTH_2316574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666916.1"
                     /db_xref="GeneID:11507279"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Spoth2_2316574"
                     /translation="MSGKLDQSLDEILSSQRRNQQGRRRSARRSAGAAKPAATAPAGG
                     IQKNSKPARGANKPTPAKGVGLTGESKIVVSNLPKDVSEGQIKEYFQQSVGPVKKVEI
                     SYGPGGVSRGIAHVTFHHADGASKAFSNLNGLLIDGKPVKVEIVVASADLIPQPPSLA
                     QRMTQPKPQPKSAATVKKNTTKDGKGGAAGGKGGKKGGRGRASRPKKTAEELDLEMAD
                     YFENRNNENNANGAAPAAAADGAAAGGDAAMEEDVL"
     gene            <1863035..>1864780
                     /locus_tag="MYCTH_2072383"
                     /db_xref="GeneID:11507280"
     mRNA            join(<1863035..1863957,1864162..>1864780)
                     /locus_tag="MYCTH_2072383"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003666869.1"
                     /db_xref="GeneID:11507280"
     CDS             join(1863035..1863957,1864162..1864780)
                     /locus_tag="MYCTH_2072383"
                     /note="CAZy_ID 270018"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003666917.1"
                     /db_xref="GeneID:11507280"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Spoth2_2072383"
                     /translation="MLKSALPAALALLLTAANGHPSRTPAAAAAGGWAPLANGTFRNP
                     ILYEDFPDNDVSVGPDGAFYLSASNFHFSPGAPILRSYDLVDWEFVGHSIPRLDFGAG
                     YDLPPTGERAYRAGTWASTLRYRESTGLWYWIGCTNFWRTWVFTAPAPEGPWTRAGDF
                     GDGVCFYDNGLLVDDDDTMYVVYTHDGGKRVNVTQLSADGLSAVRTETVLVPEQAGVD
                     ALEGNRMYKIDGRYYILNDHPGTTAYVWKSDSPWGPYEGKALADNVASPLPGGGAPHQ
                     GSLVPTPSGAWYFMSFTWAYPSGRLPVLAPIDNYTLGGNGAAGLILRAATVAPDDDLY
                     SARNTLTHRAHGPFPSATLVLDVADMADGDRAGLAAFRDRSAYIGIHCSSSSDEKKKK
                     TYEVVARFNMTLDEWGSGETLDLGEVVERVELASGVTRVWLRASMDARPDGERTARFG
                     YSVDGGETFAGLGPAYQLYAGWPFFVGYRFAVFNYATKALGGSVTVLSLETDSGEGER
                     DAEQA"
     gene            complement(<1865671..1867292)
                     /locus_tag="MYCTH_2312065"
                     /db_xref="GeneID:11507281"
     mRNA            complement(join(<1865671..1865724,1865815..1866008,
                     1866179..1866765,1866965..1866998,1867097..1867292))
                     /locus_tag="MYCTH_2312065"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666870.1"
                     /db_xref="GeneID:11507281"
     CDS             complement(join(<1866369..1866765,1866965..1866992))
                     /locus_tag="MYCTH_2312065"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666918.1"
                     /db_xref="GeneID:11507281"
                     /db_xref="InterPro:IPR017447"
                     /db_xref="JGIDB:Spoth2_2312065"
                     /translation="MADTKVTPEVLWAQRSSNTDAEKNFIYLTIKVPDVPKENIKLEL
                     EPTKLSFEGHSDTLKKTYHVDLEFYAEIDPAESKTHHTARDVELKLRKKELNESYWPR
                     LLKDTKKAHFLKTDFDKWVDEDEQNEAADDDFANFGGMG"
     gene            1868374..1869799
                     /locus_tag="MYCTH_2316579"
                     /db_xref="GeneID:11507282"
     mRNA            join(1868374..1868605,1868781..1869799)
                     /locus_tag="MYCTH_2316579"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666871.1"
                     /db_xref="GeneID:11507282"
     CDS             join(1868558..1868605,1868781..1869488)
                     /locus_tag="MYCTH_2316579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666919.1"
                     /db_xref="GeneID:11507282"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Spoth2_2316579"
                     /translation="METLRNMFSKPDPQAQYRKCNALLRANMRKLDRDIAALKQTEIK
                     TKNLIIAANKRAQRGDPSRQRQAQREVRDFARELIRTRKASDRLVTGRAQLASVQMQV
                     SEAFALRRIEGSIRAGVGIMKDVNALVRLPQFAQAMQELSVELVKAGIIEEMVGDVLP
                     EDADALAADLEEDEEAEGEIDKVLGEILKDRLVTAGTLPSVPPPQKQVPAQQQPLQQQ
                     QQQQKQQVEEEEDEEDTEAMMDQMRNRLEALRS"
     gene            1871767..1872065
                     /locus_tag="MYCTH_2312073"
                     /db_xref="GeneID:11507283"
     mRNA            1871767..1872065
                     /locus_tag="MYCTH_2312073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666872.1"
                     /db_xref="GeneID:11507283"
     CDS             1871873..1872052
                     /locus_tag="MYCTH_2312073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666920.1"
                     /db_xref="GeneID:11507283"
                     /db_xref="JGIDB:Spoth2_2312073"
                     /translation="MSDKLIAGAGRERKTPTKVSPWDPAENPPSVQPSELLKRNLRGF
                     STLRTPTLESGDPFK"
     gene            1877606..1878647
                     /locus_tag="MYCTH_2316580"
                     /db_xref="GeneID:11507284"
     mRNA            1877606..1878647
                     /locus_tag="MYCTH_2316580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666873.1"
                     /db_xref="GeneID:11507284"
     CDS             1877763..1878314
                     /locus_tag="MYCTH_2316580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666921.1"
                     /db_xref="GeneID:11507284"
                     /db_xref="JGIDB:Spoth2_2316580"
                     /translation="MFGSYSSSSSPGSSLDSFTSSSPYSSSMSAPMDIAPRSSSSSRR
                     GPDPECAYPSWPRRSSLGEGDSEERASSYITDDELYMDVFDDDACSVSSSQGSASPAR
                     SPAVVPAAPVMTEAEFLQLQREQLAYQREMRRILLAEKELRRRQAEADAQRRRPGPKR
                     RTSSSRKATKSKLSAMTTIVEAE"
     gene            <1886396..>1886895
                     /locus_tag="MYCTH_2130846"
                     /db_xref="GeneID:11507285"
     mRNA            join(<1886396..1886557,1886737..1886780,1886853..>1886895)
                     /locus_tag="MYCTH_2130846"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666874.1"
                     /db_xref="GeneID:11507285"
     CDS             join(1886396..1886557,1886737..1886780,1886853..1886895)
                     /locus_tag="MYCTH_2130846"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666922.1"
                     /db_xref="GeneID:11507285"
                     /db_xref="JGIDB:Spoth2_2130846"
                     /translation="MAGGEMLTQRRKKGDEERALCAHPPPQPPLDHKRRHSCRGADIP
                     PADRCNLTVKGRATPPPLGPETGPAARGEVDEVDKVNK"
     gene            1888116..1894266
                     /locus_tag="MYCTH_2312075"
                     /db_xref="GeneID:11507286"
     mRNA            join(1888116..1888461,1888630..1889125,1889186..1889312,
                     1889410..1889721,1889794..1894266)
                     /locus_tag="MYCTH_2312075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666875.1"
                     /db_xref="GeneID:11507286"
     CDS             join(1888768..1889125,1889186..1889312,1889410..1889721,
                     1889794..1894261)
                     /locus_tag="MYCTH_2312075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666923.1"
                     /db_xref="GeneID:11507286"
                     /db_xref="JGIDB:Spoth2_2312075"
                     /translation="MAQLHGYAMAPPKPSNVGRYFEPCAATASMFLYAQGTSVVCCHY
                     DTLAIERRFARHSEEVQLLAVDNHSDIGAGRLVVSYDAGQTAIVWDLLTGDEVARFAS
                     YENLTCAAWMRNGNVAFGNTQGNVILFEPTTSEHLSARTIDQIPITAISPAADCRTFA
                     IGYQNGSLLIATLQPRFTILHNLSTSRGPSPIVTLAWHASSSRSKSDMLAVQTNDGDL
                     RVWSVSKTHNAEDGAKVVRILKRTENYIPGPKWMGWSKNGRIIQYSEGETISWDVRTK
                     HVTYDTIPTFETVRGLAVYGPGATLFTLGANNTVQQFDLNAPAMLVQNVQHPANLLPP
                     SPPISLEAEDKSQPSNASESESQVEIAFRPSDISDQEEDGRSPLARYLQNESDTEMYR
                     PATPTSNISRSTVSISSSTSQMAQRRYPASTVSRTMTENTYISTGSSLRSGTQPRERR
                     EGESLSTTSSMSMGSSHYHSARKPSRLRNEVPRSPEDTRAVDLFKFTKSRLADVPYKA
                     PSSDHGRLTNDDLRRQMLSTIFGWHKEVDELVRDEMSRHPLGSTSRILLAKWLGDMST
                     DIMAMGSENMTSSDWMILALSGIGGQASQYKLGRAYVQRLLESGDVHTAATIMVGMGD
                     HHDAIEIYVSHKKYMEALILTCLFFPSAWERQEQIVKKWGEWAVQHGQQQLAIRCFAC
                     TGRQSTEPWTSPSAQQLTFPSITQTVPELASPPLSPPVVNHGPQRSIAKNSSLKLITS
                     FDGQVKNKFTRNVDDGRTPIAGGATPILDSALSPGGADPTTAILRGNRSQFNTPATAR
                     PAHGFGRERLPSIGEAPDSGGGGGRDLLTSSVTRKPEDPHANALRSMEEAQDGAIRRL
                     EQTRPNTASPRLVKDKAKGHPPPSPSPAAVAALMEGGRSKRNGSRNRIPEGVDLSLPS
                     FKDSLLEDLTSPEPSANSSIRYHWPSRRKGPGSVASSVSMASAASSAARSQRGHHREH
                     GRSLDEYIHSLDAAQTRQKTRGGSRDGRHARDASLSRNDGRDKSLDRGRATTRNYTPK
                     GGKRSPKSPVPMSPEDLINLVTPKEDQHQHQDQNQDQHQHQHQARQGGSGNGPMYDSN
                     DELEPSSQPSTVRKVGYANRDGSRVRGSSRRTASRNGRGSSRARSPGKRHLPPSLELR
                     GRSASRGPPSNRSPSSPQPMSASNLQHHYASDDAPDDDDDYDDDDDEEDYRRALEDQE
                     RFRQRNNRSNSSARRGEAIASPVSARSSAWSTRESGRERSDIRRTTSHAGSESSSRRN
                     KAGVPMQTPAPAAVQLVTDSSGDLKVIKDERQLKKEAAARELEARRKSLARRPSAPPI
                     LHPSEITPGPGTNNNGSTNNSTRPTLMELPSTTYVPPKKEDLPSRSASVDANAGRSMF
                     ANRNGPAAIGLPATPRAMRLVMESEPSRKKVPVPPMPTSFSQAPPAAPAPSQSESQSE
                     SQSRRSPGTAEKERKDEDIPLLLPSTVYTPPPPANSRVAAQIGRSMSAPPADLVQPQG
                     HSRRPSAMNPTPTGRRPSHDANAAAPSRRPSHDANIPPPPPPPPPAPPVLKELQHLAQ
                     PPPPPPAPLPHVSGPKPVVYGGSSGLIEIVMDDDQPEQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQHQQPPPPPPPPIPAAIPVSESTVPIISPPNPRQNHNRGRSSVDNSIGARITR
                     ATERMRSASRSRASSSAAVKSPPPPPEMMTMGTAPPYESVQIQPPHVSMMNYRAQNQV
                     VYQQVQAQVAQQEGRNEYRTGLHQSEMI"
     gene            <1896096..>1896995
                     /locus_tag="MYCTH_2113569"
                     /db_xref="GeneID:11507287"
     mRNA            <1896096..>1896995
                     /locus_tag="MYCTH_2113569"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666876.1"
                     /db_xref="GeneID:11507287"
     CDS             1896096..1896995
                     /locus_tag="MYCTH_2113569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666924.1"
                     /db_xref="GeneID:11507287"
                     /db_xref="JGIDB:Spoth2_2113569"
                     /translation="MLTTAPRLYIRRPSPTTAEFTVTTCPPLTVPLRLLLLAIHLLRV
                     VLVSASVLALYSRFFFTEGPPTITTTTTTNTANTTVTGHQQLGHATSHHGTNNGNGNG
                     SGDGNEAGPLALLLGGDLVACAAAVLTAARQSRAGALLAEATAPLADWALAAACAGTA
                     CAAACRFRLHKTESVLVLRGLGIQTCASGGGGGGGFGGGFGGFLSRWWWGGWGTQTRF
                     IPTEKIRDVLINEAFRGFEVRYYLCVVVEDEEDVVVLFPGTLPRRKIVEAVWRGIRGC
                     LMEGEGEEEGGGGGGGGGGEEKG"
     gene            complement(<1897115..>1899160)
                     /locus_tag="MYCTH_58299"
                     /db_xref="GeneID:11507288"
     mRNA            complement(join(<1897115..1898335,1898489..1898890,
                     1899107..>1899160))
                     /locus_tag="MYCTH_58299"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666877.1"
                     /db_xref="GeneID:11507288"
     CDS             complement(join(1897115..1898335,1898489..1898890,
                     1899107..1899160))
                     /locus_tag="MYCTH_58299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666925.1"
                     /db_xref="GeneID:11507288"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="JGIDB:Spoth2_58299"
                     /translation="MTDNRNYQDWSRDQLLERQPQQQQQQQQQQQQQQQQQQPLPPSL
                     PASTPAASSSTAPPAGPNPYPPKEKKKKAKKASKIDPSKYSTRLVALKLAYLGKRYGG
                     FEYQAGVTVPTVEEELWKALVKSCLIWPDDPARVDFGPWEYSKCGRTDRGGEGEGEGE
                     GEGEGEGDGGKPAWDPIADEINYPRVLNRLLPPDIRVLAWAPTLPAGFSARFSCWERQ
                     YRYFFTQPAFTPLPASLDPEGKRGGKEGWLDIGAMRQAAKLFEGVHDFRNFCKVDGAK
                     QITNFTRRVFEADIVEVKDTGSALPYLDLPDFKADGSADGTAYPKVYYFHVRGSAFLW
                     HQIRHMVAVLFLIGQGLEKPSLVTDLLDVEKYPRKPNYTMADEVPLVLWDCIFPREDE
                     LKSKKAALDVHNPDAQVDTNLQDAIDWVWLGEDRPSNLHGPNGLVDNLWEGWRERKMD
                     ELLANQLLDSVARKANLGRRLAESGLPEKPSSSQRVFEGGNTARATGTYVPVLKKQLL
                     ATPEEVNDKWAQSKGFANAEELAKTKNWRSVIKANKTGGSSSAVDSSMDE"
     gene            <1899751..>1900551
                     /locus_tag="MYCTH_72245"
                     /db_xref="GeneID:11507289"
     mRNA            join(<1899751..1899822,1900028..1900183,1900268..>1900551)
                     /locus_tag="MYCTH_72245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666878.1"
                     /db_xref="GeneID:11507289"
     CDS             join(1899751..1899822,1900028..1900183,1900268..1900549)
                     /locus_tag="MYCTH_72245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666926.1"
                     /db_xref="GeneID:11507289"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_72245"
                     /translation="MEEHTVTILLLGDEGCGKSTFLSSPFVFDIRTRKGQYRFEFYDT
                     SSPENWRLLRPDLVIICYDISQRLSLINLQRVWIKEVRSTFPTSDTLPVVVLGLKRDL
                     RSEDDPNGIIYPQEGYRVAQEMRADKYIECSAVSGELMIEAFDDICSTAIKTTTAAGG
                     QSEGSCTVM"
     gene            complement(<1900600..>1901186)
                     /locus_tag="MYCTH_2070655"
                     /db_xref="GeneID:11507290"
     mRNA            complement(join(<1900600..1900968,1901055..>1901186))
                     /locus_tag="MYCTH_2070655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666879.1"
                     /db_xref="GeneID:11507290"
     CDS             complement(join(1900600..1900968,1901055..1901186))
                     /locus_tag="MYCTH_2070655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666927.1"
                     /db_xref="GeneID:11507290"
                     /db_xref="JGIDB:Spoth2_2070655"
                     /translation="MKVLESQNALLSNYEVYQHILDQRQRNKAQNRRVPANAHQIMTE
                     VMTYLTTKPSPLEKQQETRAYSAAAINRLFEKLREANLPSELTKSELLSILNQRPSST
                     ALLSTAIEDMEERFSDEDQNRIVDIIAEVLGRDEPEEAADEAADEEGGGDEMDADVAP
                     TVENGC"
     gene            1902202..1904266
                     /locus_tag="MYCTH_2312083"
                     /db_xref="GeneID:11507291"
     mRNA            join(1902202..1903117,1903224..1903253,1903424..1904266)
                     /locus_tag="MYCTH_2312083"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666880.1"
                     /db_xref="GeneID:11507291"
     CDS             join(1902388..1903117,1903224..1903253,1903424..1904043)
                     /locus_tag="MYCTH_2312083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666928.1"
                     /db_xref="GeneID:11507291"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Spoth2_2312083"
                     /translation="MVRNIVVLGGNSHPALVESVCNILALPPCNRILTKFSSGESRCE
                     IQDSVRGKDVYIIQTGFGGNGSTLNDHFMDLCIMISACKTGSARRVTAVLPLFPYSRQ
                     PDLPYKKAGAPLFKAGSESGRKDYTFESVPATPAPGVPRTAGLVSATDITNRLTKETL
                     PNGTSSMSPVKQANGHINGEAYSGANGQSFATPTSGVIGSYTTHDYENVSHLGVFQAK
                     PGYKQWVAQAGTLVANLLTCAGADHVITMDLHDPQVQGFFDIPVDNLYGRPLLKRYIQ
                     MNIPNYKDAVIISPDAGGAKRATAIADSMGVEFALIHKVTSPCFPSRPLTNPSLLQER
                     RPTKITDRQNASMMLVGNVTDRVCILIDDLLDTGNTITRAAKLLKKEGATKIYALLTH
                     GVFSGDAINRVKASAIDKLVVTNSVPQDEHKALLGSRLDVLDISPIFSEAIRRVHHGE
                     SISVLFNYD"
     gene            1906192..1907410
                     /locus_tag="MYCTH_2312085"
                     /db_xref="GeneID:11507292"
     mRNA            join(1906192..1907005,1907137..1907410)
                     /locus_tag="MYCTH_2312085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666881.1"
                     /db_xref="GeneID:11507292"
     CDS             1906386..1906943
                     /locus_tag="MYCTH_2312085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666929.1"
                     /db_xref="GeneID:11507292"
                     /db_xref="JGIDB:Spoth2_2312085"
                     /translation="MAAKGTISRPAPPGRLPTSGSTSSGRALGSGYETPMGVEGMPWP
                     DTPLSAPATAAVPGGSGGLAATTAGGLRRARTDLGGGAVSGGPGPASLSARLQGLATG
                     SGAGNGPSLRGVHSPAESLNGVVTRARGTGRKVGWRDRVACFQWTWFTMTMVRPSLAF
                     FFTFFLAFGWGDRGARRRERKKKLV"
     gene            1907412..1908873
                     /locus_tag="MYCTH_2312086"
                     /db_xref="GeneID:11507293"
     mRNA            join(1907412..1907643,1907753..1908054,1908268..1908503,
                     1908651..1908873)
                     /locus_tag="MYCTH_2312086"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666882.1"
                     /db_xref="GeneID:11507293"
     CDS             join(1907772..1908054,1908268..1908503,1908651..1908794)
                     /locus_tag="MYCTH_2312086"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666930.1"
                     /db_xref="GeneID:11507293"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="JGIDB:Spoth2_2312086"
                     /translation="MTPVWVFPAYPLLLSAPFGGNLISAAGRAGRPDGINTVPVALAA
                     ITAQGTGFLISFMICAAFLYRLMTQKLPRDHQRPGVFISIGPSAFSSAGLVQLGSLSH
                     SIFPSDFMGTEHAVHILRLLAYMAGLWLWGLSIWFFLVSVGSLWKYLRPESKGKLHFQ
                     MTWFSFVFPNTALVAATEALGSAFDSPGLQIFGCVLAGCLVLVWILVFTKMLRCLWRR
                     EL"
     gene            complement(1909526..1913325)
                     /locus_tag="MYCTH_2312088"
                     /db_xref="GeneID:11507294"
     mRNA            complement(join(1909526..1909716,1909807..1911629,
                     1911805..1912008,1912080..1912407,1912598..1913325))
                     /locus_tag="MYCTH_2312088"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666883.1"
                     /db_xref="GeneID:11507294"
     CDS             complement(join(1909621..1909716,1909807..1911629,
                     1911805..1912008,1912080..1912386))
                     /locus_tag="MYCTH_2312088"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666931.1"
                     /db_xref="GeneID:11507294"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="JGIDB:Spoth2_2312088"
                     /translation="MEPINIAVIGAVGVGKSTFIQHLRRAPRPSSSNITTLRHELDGV
                     NHLVTIVELDLEGIELDPNQPVHWPKQIGGHSVPRMDGAMILYDAVNEASMREVPPIM
                     AALANSSLPTVLVATKCDAPDDLRHPDLAGLASAFATCAGHFRTASNAPASARECLQA
                     MLRAALANRRDKSEGSGPRRRAASTANLDALTDFHNGRPISQHSKHSRASSDFSLLRG
                     FPQPPHESQHRGPASRSPRPDYQSAASGSNLSSGSAAAITEDGKQQTLSSMLRTPGIR
                     LDGGGESFLDVDESDGDQFSEGASTRRRSDDGSDRQAKVAGVTFDELVDRLLAPKMSK
                     ADHSFADIFLCLYRKFAAPSALLTAIRARLDQLRNDRTMEYLIKVEAQMRTIEVVAKW
                     LSLYPGDFARSATRNSLEELIQQLAREPVFLAAAQQMRMHLDQKVTVDDDTGWANSDP
                     PDENESKEPASAAGQRVRGMTESMSSLQLDEPGAAAAAVAPSQRRASQSSDLSGIEGR
                     GPPRGPARLQFHSVEDYEAEAATLVPAPVLPLNKFRYHQFMELDVEEVADEMTRIDWV
                     MFSSIRIRDMVRHVSLSHEQKEKCRQLRNMNRMVAHFNHVAQWVANMILIRDKAKHRA
                     PCLEKFMQVAQKLRQMNNYNGLAAVLAGINGTSIHRLAQTRALVSPEVQKRFAGLVLL
                     MGTQKSHFAYRLAWENSPLPRIPFMPLHRRDLVSAEEGSKTFVGPGGDRINWKKFEVL
                     GEVLLPIMKSQGQPYPNLQRHEACRELILDCRISTDEEDLYQRSVQVEPTTGGGAAES
                     AKKKFAWLANR"
     gene            1916059..1917912
                     /locus_tag="MYCTH_2312089"
                     /db_xref="GeneID:11507295"
     mRNA            1916059..1917912
                     /locus_tag="MYCTH_2312089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666884.1"
                     /db_xref="GeneID:11507295"
     CDS             1916470..1917723
                     /locus_tag="MYCTH_2312089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666932.1"
                     /db_xref="GeneID:11507295"
                     /db_xref="JGIDB:Spoth2_2312089"
                     /translation="MNYTRGAAPGGHGLGAKSYKAPTSVPEGHFDPDELTRRLYLVLA
                     EQKAQAERRRKARSDAATRRDGREHASGARHREARQKHAEPSADTVAEPRRTELAEDQ
                     PLAGAVRASDVQPGAYHHVPKEAARQFTRTTTVGSMRDGNLVNRLSKHALKFRLEGGP
                     PLATRPGAAGNSAHEPAPTPPPQQTDTQREGLLLERDSQSPRGPAPGGAPARPDRVWG
                     QPTRRQPPAAAAAAARRRNSTGNAADPSASSSAADERAGARRSLLAAAAAPDTLVMDT
                     LLEDVPPPFPPAEYGRVDWTQSDEPPAPPPAPLSPTHVIPADGGGDDNANRNIHHAIA
                     TARSGPRLLLLSPLLRKADSLWTLKGRRRESKDSSGSGGTGGGGGGGGDGRLEDTREA
                     GQSPTTPTTPTAGKGGKGFFGRFKR"
     gene            complement(1917913..1919261)
                     /locus_tag="MYCTH_2312091"
                     /db_xref="GeneID:11507296"
     mRNA            complement(join(1917913..1918649,1918706..1919261))
                     /locus_tag="MYCTH_2312091"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666885.1"
                     /db_xref="GeneID:11507296"
     CDS             complement(join(1918103..1918649,1918706..1918974))
                     /locus_tag="MYCTH_2312091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666933.1"
                     /db_xref="GeneID:11507296"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="JGIDB:Spoth2_2312091"
                     /translation="MSLGQEGNSNPSLSDMPVAEGSNPALQSTMLGASSPERTAPPAS
                     DPAATDTTPGPEADPFPPQKRPGPKVCGVCGTQPGKYKCPRCSMPYCSVACNKQHKEN
                     HPPDPPKPERPSAPNNAQPPDSDSADPYSILLEHRDTFQHLFKKYSSLAAELTRIQEM
                     TLPPSDAPDPPGGNAANMGRNRQQPWIKDGGNMARNRQQPWTKDVGLRRGVEALRKAR
                     TDPSDTGDGVREFCELVKLLLNKRTESIDKVREEVVAEETKQIERLLREEGGR"
     gene            1919471..1920794
                     /locus_tag="MYCTH_2097429"
                     /db_xref="GeneID:11507297"
     mRNA            join(1919471..1920360,1920446..1920794)
                     /locus_tag="MYCTH_2097429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666886.1"
                     /db_xref="GeneID:11507297"
     CDS             join(1919506..1920360,1920446..1920601)
                     /locus_tag="MYCTH_2097429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666934.1"
                     /db_xref="GeneID:11507297"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="JGIDB:Spoth2_2097429"
                     /translation="MPSSKLLRGCTPLASRPTRALKPTTCLRPQRSTAASVRQAHTGQ
                     GRLLSPSTSSSLRPRLTPSQPQPWRALLPKTARRTIFIQTENTPNPDALKFLPNHRIL
                     PESVSSPFIEYLNPRSTIAPPYPSPLAAQLMNIDGVTSVFYGADFITVTKAADANWAH
                     IRPEVFALITEAITSGQPIVNVAERREGSAASSGGAGAAGGAREGAEAAEQDSLAYDE
                     NDSEVVGMIKELLETRVRPAIQEDGGDIEFRGFENGYVLLKLRGACRTCDSSTVTLKN
                     GIEGMLMHYIEEVKGVHQVLDQEEEIAMQEFAKFEEKLKAQKGEVPPSTSGNGSLDSA
                     SG"
     gene            1925166..1928831
                     /locus_tag="MYCTH_2312095"
                     /db_xref="GeneID:11507298"
     mRNA            join(1925166..1925572,1925745..1927239,1927294..1927978,
                     1928037..1928831)
                     /locus_tag="MYCTH_2312095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666887.1"
                     /db_xref="GeneID:11507298"
     CDS             join(1925856..1927239,1927294..1927978,1928037..1928631)
                     /locus_tag="MYCTH_2312095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666935.1"
                     /db_xref="GeneID:11507298"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="JGIDB:Spoth2_2312095"
                     /translation="MSSGTIKPGGSSKPAQGTIPAGPPSSQTILLDKLNRRSTPDSEA
                     LASSDDEPENHRQDSHPPPVQPQQPVRRSSWLNDTSQQSLPRQSQRKGSFASTSMSPT
                     SSHPATPSGETGVAGWGSHTGSAGVLGRTHSGTGSFPWGTGIWNNDRKDPPSRLTEVL
                     PSPTSTVAPGGSSSSFFGDNSLTQTSPAQRDAPSSQIPFAIPLHPTPKTYRSQSYSVG
                     QLEPEAIGTSMAPPSSILGNRRTMGHPGLQHRPSRPSMLSEMSNDGSLLGKVNEDDDD
                     ASSGSMHGSQHQDAAKTIEMLTRENMLLRQQQQYQNARLRPRASTASAFGLSSSYLQE
                     TVPEESDYAVDEHDELNDGSDAATRRGPARRMSEYGVGPYKTPYLVENRKLENVKKAF
                     WQSSLGFGGLGDISQSRRHSFADVPTRQASISSIGDTVQAHEPAGQDLAHAHDYPAAF
                     SDNHSYSVNNQVSPYFAGAAGLGGAQQGHPQAAYSNHLPSPYTGMPGSYSHRPASPHR
                     GMYGMAQPRHNQPLHIVLFKCARADVFYIQEGTGLTVKPGDLVIVEADRGTDLGTVAR
                     DNVDWQTAKELKEHYAEEQYRWLMMYSQNAAAAHEGAGAGLMAASNGLQGSAIGGMGP
                     PSQHHHIQEPGSGELKPKLIKRLAQSHEIHALREKEGNEAKAKRVCQQKVKEHGLNME
                     ILDAEFQMDWKKLTFYYFADTYINFNSLVTDLFKIYKTRIWMSAINPASFASPTLGLQ
                     APSGVGPGAVVPRSSAPPRQQEHQQESQLAYSGSGQSGRGAPPSFATQFNADRAVVAG
                     SNYPASNYPYHPYGAFANTGRAGAGPYATGVMQGLDTFGAYPQAGDFAARGRYPSPQS
                     ATGSQHDQAVSPLGSQADLLGSFQGLSLNSR"
     gene            <1929989..>1931061
                     /locus_tag="MYCTH_2121463"
                     /db_xref="GeneID:11507299"
     mRNA            join(<1929989..1930057,1930275..1930405,1930557..>1931061)
                     /locus_tag="MYCTH_2121463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666888.1"
                     /db_xref="GeneID:11507299"
     CDS             join(1929989..1930057,1930275..1930405,1930557..1931061)
                     /locus_tag="MYCTH_2121463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666936.1"
                     /db_xref="GeneID:11507299"
                     /db_xref="JGIDB:Spoth2_2121463"
                     /translation="MPPKRTAKDCAPRGRQALSRTRSPSTIEEHLMDQNDKSKEFIQG
                     FKEQVAGVRQRTHNALAKLKQDFTQLETISAAAQSTTPSTKDNPLFEQTQHLLRLSRA
                     VLACHRTADRDSRTHQELLALPREMWKQDEEGMRKLLSYGKTFGEKAVEGWITPHCTV
                     GVGDGVGEEQSDGAVDENGEEGLSEAENLARGLFEWRRRGRGLSREGEESWGVAARKQ
                     MVALAGVVRTLPSSKG"
     gene            1931430..1933028
                     /locus_tag="MYCTH_2312102"
                     /db_xref="GeneID:11507300"
     mRNA            join(1931430..1931613,1931739..1931830,1932008..1932164,
                     1932264..1933028)
                     /locus_tag="MYCTH_2312102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666889.1"
                     /db_xref="GeneID:11507300"
     CDS             join(1931744..1931830,1932008..1932164,1932264..1932631)
                     /locus_tag="MYCTH_2312102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666937.1"
                     /db_xref="GeneID:11507300"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="JGIDB:Spoth2_2312102"
                     /translation="MGALKYLEELSKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSR
                     PDKARRLGYKAKQGYVIYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKATA
                     EERVGRRCANLRVLNSYWINQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHRE
                     ARGLTSTGKKSRGLNKGHRYNKTRAGRRKTWKRHNTLSLWRYR"
     gene            complement(1934887..1939094)
                     /locus_tag="MYCTH_2312108"
                     /db_xref="GeneID:11507301"
     mRNA            complement(join(1934887..1936629,1936708..1937605,
                     1938094..1938295,1939074..1939094))
                     /locus_tag="MYCTH_2312108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666890.1"
                     /db_xref="GeneID:11507301"
     CDS             complement(join(1935230..1936629,1936708..1937605,
                     1938094..1938279))
                     /locus_tag="MYCTH_2312108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666938.1"
                     /db_xref="GeneID:11507301"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="JGIDB:Spoth2_2312108"
                     /translation="MPVTRSRTYLSDIGLEDSNNTTGFLFGDEDSNSAENRTTPTAQV
                     GNTDPFPSLFRQQAYPSMTSASSAALDLALSQQTSGPEQLSNGWNSINRHHHKQNMST
                     MGSNQHNGGAPLGSPSEASTIGSTRPANVRHSIDGIKLFPETTTSALDTPATSVVAPP
                     NSHILASPPTLHQSYSANDVPTVKPNGTTIIGSNANNHAQQHFHNHNASIGRIPVGAM
                     PSRHNRELSSDGSSGNGRDAATYPSITSTLQASAPPFGPSSTQPQQASSAAAPAMTAP
                     APTMPYPFYPANPGYNAMGAPPPAGYNALPMLMQNMSVSNGNPPAMYPQQNYTGYNPL
                     YNQPSAPRPHQDSQARVIQSRRQMDSEAMARFNNLPLEQVGGTIYSLCKDQHGCRYLQ
                     KQLENRIPEQIHMIWLETNQHVVELMTDPFGNYLCQKLLEYCSDDERTVLIQNAAPSM
                     VSIALNQHGTRALQKMIEHVTTQVQINLIVEALRNQVVELIQDLNGNHVIQKCLNKLS
                     AADASFIFDAVGKHCVEVGTHRHGCCVLQRCIDHADGNQKVWLVECITEHAVTLVQDP
                     FGNYVVQYIIDLNEATFTEPLVKQFEGRIAQLSKHKFSSNVVEKCLRCASDESRDMIV
                     SELLAPGEIERLLRDSFGNYVIQTALDYSTPISKHRLIEAIRPLLPSVRATPYGRRIQ
                     AKIQAYDNRTGPNNAGQVLPTDPAGGQISIRSAHNRAMPNGASVLSTGTYANGANTNH
                     GAGMNGGHAPGPVYPSSAAIAVPPSQNQTAAQQQQQQQQQQQQQQKQQQQQQQQQQQH
                     QQQQQQRPQQFQPQYNPVGNAENGEPQWV"
     gene            1944354..1948418
                     /locus_tag="MYCTH_2312111"
                     /db_xref="GeneID:11507302"
     mRNA            join(1944354..1944848,1944936..1948418)
                     /locus_tag="MYCTH_2312111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666891.1"
                     /db_xref="GeneID:11507302"
     CDS             join(1944722..1944848,1944936..1948276)
                     /locus_tag="MYCTH_2312111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666939.1"
                     /db_xref="GeneID:11507302"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="JGIDB:Spoth2_2312111"
                     /translation="MGAIDDGFEALLEPFYNGKKLTDPISTKEDKYQLLPAFLKVKGL
                     VKQHIDSYNFFVEHEIKDIVRANRIIRSDQEKDFWLEFTDIRVGTPTRNDYSDFKARD
                     EVTPMECRLRDMTYAAPVVVDIVYSRDRKKIVRKDIPLCRIPVMLKSAKCCLSGATNA
                     QMEIMNECPLDPGGYFIINGTEKVILIQEQLSKNRVIVEADEKTGGVSASVTSSTHER
                     KSKTYVILKKDRIVLNHNVLVEPIPIVIVLKALGGLSDYEIMELVAGGDARYQDDFLI
                     NFDEATKAGVFTQQQALEYVGSRVKMGGPKKGRSMAAPRRSPVEEGLDALANVVVAHV
                     EIQDLDFYPKAIYIAMMVRRVLMASHDPKLVDDRDFVGNKRLELAGQLLSLLFEDMFK
                     MFVGSLKGNMEYFFKKPNRTSAYDPVGPISSQGQYITQGLNRAIQSGNWNVKRFNMNR
                     AGVTHVLSRLSYIAALGMMTRISSQFEKTRKVSGPRALQPSQWGMLCPSDTPEGEACG
                     LVKNLALMTHITTNAEEEPVKNWIFSLIPGVEPIRMFTGTEMHRPGSYIIHLNGTPFA
                     LTRHPKQFAARFKTMRRRGHISPFVGIHINEHFSAIHIATDEGRICRPYIIVKDGKPR
                     LKKEHLRLLQLGKATFDDFLKNSVIEYLDVNEENDALIAIREEDVNQSTTHMEIEPFT
                     ILGAVAGLIPFPHHNQSPRNTYQCAMGKQAIGAIAYNQFNRIDTLLYTLVYPQRPMVI
                     TKTIQLIHYDKLPAGQNATVVVMSYSGYDIEDALVLNKASCDRGFGRCQVFRKYTAEL
                     QQYPNGRKDRLGGIQKDEEGRTIAKHACLDKDGLAVVGYRVHSGETMIMKETPIDQTS
                     TGIGSDRGSDEFRPAPINYRIPDPAYIDKVMVSNTEKNTAIIKVQTRQTRRPELGDKF
                     SSRHGQKGVVGIIVDQEDMPFSDSGLVPDIIMNPHGFPSRMTVGKLFECLTGKASVVA
                     GRRDYGFGDAFRSHPVEEMGRVLIEHGFSWEGKDYFTSGITGEPHEAYLFNGPIYYQR
                     LKHMVQDKMHSRSRGPRAILTRQPTEGRSRDGGLRLGEMERDCLIAYGASQLLLERLM
                     ISSDGTQVDICERCGLLGYKGFCQTCGSTSQVTQMTMPYAAKLLVQELISMNVGVRMQ
                     LEDKFPHPR"
     gene            complement(<1948885..>1950684)
                     /locus_tag="MYCTH_96765"
                     /db_xref="GeneID:11507303"
     mRNA            complement(join(<1948885..1949744,1950429..>1950684))
                     /locus_tag="MYCTH_96765"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666892.1"
                     /db_xref="GeneID:11507303"
     CDS             complement(join(1948885..1949744,1950429..1950684))
                     /locus_tag="MYCTH_96765"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666940.1"
                     /db_xref="GeneID:11507303"
                     /db_xref="JGIDB:Spoth2_96765"
                     /translation="MTDLLHVLPHFPAGQFARLIPVLEKHGLSTSDLLTLEAADIGKR
                     TRLPLLDVKRLCSAVLDALHADLGVANPAPEAHLGPLQPEPDRFTGASSADFGTPASS
                     LQYHHQHHHYHSLQSGPRPTQESPLATRSRRLPPISGNSNNNSTALADILPPSSVPLP
                     SSSHPQSDEPEQTAPPPPPPPPTDPDPPRPSHPALLLDHQQRWFTGWGDDPSSNLALK
                     TPALGLVWTTQIAGRIALFRRPVPLRRRRPVRDHHHHHHPHSQQHHDDSSSHRQAAEL
                     SGSGIATGWERLMKVVFAPHVAGTGPGLDGAVRFEVWMGGLRGLGGAAAAAAAAELGT
                     EKEGKGEEEDDDDHGDDNKDEKEQKEEEEEENEADYR"
     gene            1951649..1952205
                     /locus_tag="MYCTH_2312112"
                     /db_xref="GeneID:11507304"
     mRNA            1951649..1952205
                     /locus_tag="MYCTH_2312112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666893.1"
                     /db_xref="GeneID:11507304"
     CDS             1951880..1952116
                     /locus_tag="MYCTH_2312112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666941.1"
                     /db_xref="GeneID:11507304"
                     /db_xref="JGIDB:Spoth2_2312112"
                     /translation="MGRQLLYGAALLGASVQAFAFLPLPTNRYQALPLEDGWNPKPTQ
                     PPDAHLVRRQMSRPSSYLVAPDNTCGFIEGNSSE"
     gene            1952207..1953997
                     /locus_tag="MYCTH_2312114"
                     /db_xref="GeneID:11507305"
     mRNA            1952207..1953997
                     /locus_tag="MYCTH_2312114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666894.1"
                     /db_xref="GeneID:11507305"
     CDS             1952398..1953888
                     /locus_tag="MYCTH_2312114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666942.1"
                     /db_xref="GeneID:11507305"
                     /db_xref="JGIDB:Spoth2_2312114"
                     /translation="MSVADHGHAGLCSLTAHSTGLLQRYCNTVAFPGGVTDYYCALTK
                     GSVLTAQTAAKGDKSRSFSEVKPTSTSTKKTTTTTTSSTTSKKTSSSSSSSSTSTSSS
                     TTSKSSTRSTSETSSEVLPSTTEPTITASTTDADRAGAATSSTPPEASTTQSTPVGAI
                     VGGVLGGIALIALCIFGAIFLRQQRKKSQAMAEMPPSQPFMAEPTLPSTQPPVPPYGQ
                     GMGSSGMTGYPPSSAAGTSPQMFATPTAAAAGATAGAVAAAAASARGASGPYHNRPPS
                     TLTTTTTAANNTYYDPSPLTTPGGSPQMQYAHQMHPPPPLPTPAYYNHPSQDAYQGGD
                     GAWAGGGSTNAGAAAEPPDRHSTSTPVSTYNGATPVTPASALGPMPGEPQQHAPAGGG
                     GGGSGSDGNGVPLILQPGMGYRPYRPPGAGGSSSTRSAGGRNATASASGSESPTVRTA
                     TVAMVVPRKVVPASSAPPSTEQSRSQGQSQGAAAPGDQQTAAVELP"
     gene            complement(1954483..1958060)
                     /locus_tag="MYCTH_2312115"
                     /db_xref="GeneID:11507306"
     mRNA            complement(join(1954483..1954713,1954905..1957163,
                     1957332..1958060))
                     /locus_tag="MYCTH_2312115"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666895.1"
                     /db_xref="GeneID:11507306"
     CDS             complement(join(1954568..1954713,1954905..1957163,
                     1957332..1957752))
                     /locus_tag="MYCTH_2312115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666943.1"
                     /db_xref="GeneID:11507306"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="JGIDB:Spoth2_2312115"
                     /translation="MSTQVRTFTPPRSLGETLNEAPLELSSSTPRSVPELPRLSKPAI
                     APSLKAPHFAMSDPYRDEKRKGGVTYAHQDSLPKLPIPDLESTCEKYLAALKPLQSPR
                     EHAETKRAVESFLKNEGPELQEKLKKYAEARTSYIEQFWYDSYLNFDNPVVLNLNPFF
                     LLEDDPTPARNNQVTRAASLIVSALEFVRAVRKEELPPDTVKGTTLCMHQYSRLFGTA
                     RVPTDAGCQIEQDPDSKHIIVMCHGQFYWFDVLDDNSDLIMTERDIAVNLQTIIDDAA
                     QTPIQEAAKGALGVLSTENRKVWSGLRDVLMREPGSNNADCLNFVDTALFVVCLDYSE
                     PTTAAALCQNMLCGTSEIEKGVQIGTCTNRWYDKLQIIVCKNGSAGINFEHTGVDGHT
                     VLRFASDVYTDTILRFARSINGKAPTLWASTSPDPSKRDPESFGDVSTTPHKLEWDMT
                     PELRIAVRFAETRLADLIEQNEFQCLDFNAYGKNFITAMGFSPDAFVQMAFQAAYYGL
                     YGRVECTYEPAMTKMYLHGRTEAIRTVSEESVNFVQTFWADNPAEKKIEALRKACQRH
                     VATTRECAKAQGCDRHLYALFCLWQRTVDGDAGSYLSGTNGYSSPIDNFSDRGTGGGG
                     DGSVSSSPPREPAYLLDGSTATTATTNNNNAIHSTSINGNDESSHPTKPTATTSRARN
                     DSIQSSTGRTSPSLATSNQLPAIFADPGWDKLNTTILSTSNCGNPSLRQFGFGPVSGD
                     GFGIGYIIKDEGISICVSSRHRQTRRFVDTLESYLLEIRRILRIAANSGSAGRAGPGV
                     WARGGPTSRAREVEGLRAGYGTKAEAGKVAGGQGGQGGGATAASSHGSASGSRARLRG
                     RLITSGSKAGSEGGVNGSISSPTDESLALSEDDELGGYGFFDAGMLLQALKARGDNNS
                     GESKPSERAAVQARRRGIGKKLRLVDY"
     gene            1966664..1968010
                     /locus_tag="MYCTH_2312118"
                     /db_xref="GeneID:11507307"
     mRNA            join(1966664..1967215,1967329..1967397,1967547..1968010)
                     /locus_tag="MYCTH_2312118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666896.1"
                     /db_xref="GeneID:11507307"
     CDS             join(1966958..1967215,1967329..1967397,1967547..1967924)
                     /locus_tag="MYCTH_2312118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666944.1"
                     /db_xref="GeneID:11507307"
                     /db_xref="JGIDB:Spoth2_2312118"
                     /translation="MAPIKPHWVQPSHPDIQEVIVNEAAFTTKSISKISLPPFGLFAK
                     LEFPPCTMAPKPTYATVQMDRDKHFDLNSDLLYINHSCEPSLIFDTSSMTVIAGPKGL
                     KPGDELTFFYPSTEWYMAQPFDCLCGAPTCRGRIAGARDMTSAQLEGMWLNRHIRDLL
                     EERDAGLKAKQEANGTDGTDGTNGTDGTDGTGRVNGVDAAPKADPAPAPAGAQRRGPT
                     SRELSGEMGGDTAVQV"
     gene            complement(1968037..1969762)
                     /locus_tag="MYCTH_2312120"
                     /db_xref="GeneID:11507308"
     mRNA            complement(join(1968037..1969146,1969270..1969762))
                     /locus_tag="MYCTH_2312120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666897.1"
                     /db_xref="GeneID:11507308"
     CDS             complement(join(1968377..1969146,1969270..1969615))
                     /locus_tag="MYCTH_2312120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666945.1"
                     /db_xref="GeneID:11507308"
                     /db_xref="JGIDB:Spoth2_2312120"
                     /translation="MCAPARVVCRPLRGSAARLSSAAAGGAPSFPQPWGSSPGIERLC
                     CPAAPAVHISTTAQPPRTSSLPAKSLSTFREPVADPTTPPELTLFTSHPPLLSPESGN
                     NKPPDERKVKLGKTLRILQAHLPTLLQSPPPQQILSPSITLHLFPSTHPHLPTVSGRV
                     AYTAALWSSPIAWNRVPLVGNVRLEILSERMVDTPVYYPSGGRGGRRPEGAMPEQLIV
                     RWRTVGGGGGKLRKWWLGFGSGSESGSKGAKEAGKTASGDEMAGGKGKHEAIDGARHG
                     GSTAAEHSETEVKAPVGMAQPVGSSKEFTGLFIFDFDNEGRILSHTIEHVQEGGQWEK
                     GVGAKVVGLTDWLLGGIKGGDTPCPAFARTRFRKGGP"
     gene            1970787..1972731
                     /locus_tag="MYCTH_84992"
                     /db_xref="GeneID:11507309"
     mRNA            join(1970787..1970905,1971000..1971178,1971378..1971501,
                     1971559..1971606,1971703..1971930,1972004..1972731)
                     /locus_tag="MYCTH_84992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666898.1"
                     /db_xref="GeneID:11507309"
     CDS             join(1971168..1971178,1971378..1971501,1971559..1971606,
                     1971703..1971930,1972004..1972204)
                     /locus_tag="MYCTH_84992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666946.1"
                     /db_xref="GeneID:11507309"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Spoth2_84992"
                     /translation="MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVD
                     FKIRTIELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGICVVYDVTDMDSFNNVKQW
                     LQEIDRYATEGVNKLLVGNKSDMADKKVVEYTVAKEFADSLGIPFLETSAKNASNVEQ
                     AFLTMARQIKERMGSSIATNNTKANVNVAPGHGVSNNQSGGCC"
     gene            complement(<1974323..1976513)
                     /locus_tag="MYCTH_2312129"
                     /db_xref="GeneID:11507310"
     mRNA            complement(<1974323..1976513)
                     /locus_tag="MYCTH_2312129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666899.1"
                     /db_xref="GeneID:11507310"
     CDS             complement(<1974476..1976297)
                     /locus_tag="MYCTH_2312129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666947.1"
                     /db_xref="GeneID:11507310"
                     /db_xref="JGIDB:Spoth2_2312129"
                     /translation="MSIPQRRAGHIVALEGPPELVSTQLRLLPDSSKILVLPGLQYYL
                     EDEVSKERKPFDARELIYRYHAAAQARRAEALEFLRPSTSTDETRLVFTHGGTMSAQV
                     SCLSAIMEHETDGNIEEAHATFIRLASNGHARLSLARLSLYEAEESPLRNREAEAIPE
                     PPASNEGQTQQLLSWRAYAGAGDDTIEDPIIRAMKAADALDRETEFLQPSSTPEADLT
                     VKLVDIPPSKKRPRSTAVQASDIPRVPRPPPPSHCQTGLSEEPVPGISPDSSLGTQPS
                     SAASQRPSLRIHIPSSPIAWTGEVAVGGDQSKVHHSHTPIPDAFDHRRSQTAELNLSP
                     KQIPAPGGKTEEQATLPESGSDPLFLSKESGSVKRTSAQITESNEEPFEALLPLLEDL
                     VVFFTPETPNGLHGFVFRRLSEGYGAPRKSLSLARVSRYDFWQSESPLATKDEREIER
                     GRSEEEDPTGVATWPRKDLVHGLPTPNNSPSSFHDTSAAVPRLDTRLYSISVGQEAAV
                     PIQNFLRSLLGSQFPLRDRRFSTADGVEISMEAGLWRPLECDAQVGSPSGERRLDLIL
                     AVGSESGVSKSRLSEVVGQIEKLGSKTSGLSRGGRLDIRYV"
     gene            complement(1978962..1980608)
                     /locus_tag="MYCTH_2312133"
                     /db_xref="GeneID:11507311"
     mRNA            complement(join(1978962..1980069,1980135..1980303,
                     1980372..1980608))
                     /locus_tag="MYCTH_2312133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666900.1"
                     /db_xref="GeneID:11507311"
     CDS             complement(join(1979086..1980069,1980135..1980303,
                     1980372..1980409))
                     /locus_tag="MYCTH_2312133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666948.1"
                     /db_xref="GeneID:11507311"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2312133"
                     /translation="MQSADPEHFFETDAAQEKRQRRAAKAGNKYGDPILLKSKILAAV
                     PDPRSPGSAVLVAESAGAVRLVNLNDPENLKTAYRGPTAPVCCVAVGGPGSGTLFAGS
                     WDKNIWSWDLNSKAPGRKYVGHTDFVKALACATIGGKDLLISGGADKKIMVWDVATGA
                     RLHTLQDSAVNMLSIQDLVVDHASSTADEISLISASSDPHIRRWRIRLDKWEQVVEAS
                     PDAPGTDRRTILEHETTVYKLVLDHDGDDVDLWTSSGDGTAKCLSRLRNFACEDTFHH
                     GDHVRAVAVTEQWVVTAGRDEDIKFWDRSSGNLYCSLVGHYDEVTDLVVLRDPSGSSQ
                     RICSVSIDGTVRTWPLDKAAVDAAVKEQEKPAEEGGKEVAGEGLLSPEEEAELAALME
                     DDDE"
     gene            1980802..1983825
                     /locus_tag="MYCTH_2312134"
                     /db_xref="GeneID:11507312"
     mRNA            join(1980802..1982808,1982890..1983825)
                     /locus_tag="MYCTH_2312134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666901.1"
                     /db_xref="GeneID:11507312"
     CDS             join(1980949..1982808,1982890..1983714)
                     /locus_tag="MYCTH_2312134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666949.1"
                     /db_xref="GeneID:11507312"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2312134"
                     /translation="MASVIASRPRPRPAHTQGTTRCAYTPDGSRLVTVGSNNTIRLYK
                     TGFDGEPTNIDDCQEQNLAVASSNDFFVAGAEDGTVSYYSLATNMFDKFLLRTSLPVR
                     DVALSPDNKWCAVASDELTVKLVHIEDNTKLLTLKEHGKPTKHLSYDLKGSMLALSCT
                     DGIIYVYSLTAEHPELIRKVDGVIGRTETESDASCRAIWHPDGRAFAVPTPTREIQVI
                     SKNDWEKQRVFSKGHDGDITALAWSPNGALLATAGKDRRLLLWQTKDQTVIARYEYPN
                     VIDIAWHPSKNLASFTTSDGEVFICDDFVPEQFASLLRLPKQPAPFIHDPLEEFGAHG
                     RRSEPNGAGGLPSRPRRGSVDSLDDLLDDDDLADEDDGFVVDDDGAGYTLNAARKRAA
                     DDDGLYGQRPSKRGNFVQPQLHPPFQPGSTPWRGNRKYLCLNLIGFVWTVDQDSHNTV
                     TVEFYDHEFHRDFHFTDTFLYDKACLNEKGTLFSCPPKDDAPAVVFYRPHETWTQRND
                     WRIELPKGEAVVAMSLSDTFITVTTTANYVRIYTLFGIPYRVYRPKSTPIVSCASWRD
                     YVLTMGNGPVGADGMCRLLYTIENIKRDEICQNEDTVALPEGATVKSVFFSDNGDPCI
                     YDSTDTLLTLLHWREPSRAYWVPLLDTKLLPRLASGRKHENYFPVAVADNKFHCIILK
                     GGDQYPYFPRPLLSEFDFSIPLTSAPSSKKKSKKQSRASGSRNKPDDEDEEMLSSPSA
                     EESDADADGEEEGQEDAAESEALALAQGYLLKSLRSAQLADQLAHTRSTASQRALLAR
                     LELDIDKTLIQMLAAECRAGGEERGMRALEVVRLMRDRSGKMIEAAIKVAERYGRELL
                     AGKIREWGERRIAGGGGGGADGDGGEDEDEDNDDGYGF"
     gene            complement(1984688..1985330)
                     /locus_tag="MYCTH_2312137"
                     /db_xref="GeneID:11507313"
     mRNA            complement(1984688..1985330)
                     /locus_tag="MYCTH_2312137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666902.1"
                     /db_xref="GeneID:11507313"
     CDS             complement(1984740..1984904)
                     /locus_tag="MYCTH_2312137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666950.1"
                     /db_xref="GeneID:11507313"
                     /db_xref="JGIDB:Spoth2_2312137"
                     /translation="MATIRHIEQVQEGRKKKERKTYNTEDSLVVTDPTTDSALTSLTK
                     GERTGSRIFW"
     gene            1988365..1989211
                     /locus_tag="MYCTH_2312138"
                     /db_xref="GeneID:11507314"
     mRNA            join(1988365..1988865,1988927..1989025,1989113..1989211)
                     /locus_tag="MYCTH_2312138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666903.1"
                     /db_xref="GeneID:11507314"
     CDS             join(1988501..1988865,1988927..1989025,1989113..1989200)
                     /locus_tag="MYCTH_2312138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666951.1"
                     /db_xref="GeneID:11507314"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="JGIDB:Spoth2_2312138"
                     /translation="MAAATESAPATQTAQGSDSSMGVRTIPIIAPTIQMSTPSPGEPM
                     DITTPTGSSAPASATKSPDRDVKPNGASNDRLQPPPSQNEQPPQENNMPAPSSTTTST
                     STPAVHQPKVQTAFIHKLWSMLEDQKIQHLISWTANSDSFVIQPSHEFSKVLAQYFKH
                     TNISSFVRQLNMYGFHKGTRRRT"
     gene            1989246..1990941
                     /locus_tag="MYCTH_2312142"
                     /db_xref="GeneID:11507315"
     mRNA            join(1989246..1989665,1989740..1990941)
                     /locus_tag="MYCTH_2312142"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666904.1"
                     /db_xref="GeneID:11507315"
     CDS             join(1989284..1989665,1989740..1990554)
                     /locus_tag="MYCTH_2312142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666952.1"
                     /db_xref="GeneID:11507315"
                     /db_xref="JGIDB:Spoth2_2312142"
                     /translation="MWEFKHGNGNFKRGDMMGLREIRRRASRHALVHREYNNQRPQAS
                     QPGTPSEPAASSHDATNPRLTNIEHTLYDLSARLQRHEEHAQLMQVKHQAIMDTVGRL
                     LQFNQELSRAVLALNPNPDNPIHRDVSALQSEVQRHMEYFRSLEEPHDQLFASTRPYF
                     SNVENAPVSPRQLPQDDPRRANVAAPQARQPNYYRPSVPSNLSIGTRRPYGSIGGNSV
                     QSSPSSIRVQPPPPPPPGPHPLANVELPPSSLARRHTSADIRAHGWQPNPPPFTSGGP
                     SSSQWPSSPSRLAPGDDQRHRDSFSHYSLQPPSQPHSRPATPPLPHLSNGGPPPAVDT
                     FGSWSWNSANRSDNRNLTVKDHSAPPTRRGSMAHILNPTDTAEHPDEDGLDPRGDDDR
                     KRKRLQ"
     gene            complement(<1991640..>1992746)
                     /locus_tag="MYCTH_96755"
                     /db_xref="GeneID:11507316"
     mRNA            complement(<1991640..>1992746)
                     /locus_tag="MYCTH_96755"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666905.1"
                     /db_xref="GeneID:11507316"
     CDS             complement(1991640..1992746)
                     /locus_tag="MYCTH_96755"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666953.1"
                     /db_xref="GeneID:11507316"
                     /db_xref="JGIDB:Spoth2_96755"
                     /translation="MAAEGESARRPPSAADFNQIFNRIALARAKHQRVLSLAGHRPIT
                     PPVTPPASSSSTTTTTTTKATAAKAEGGFSSLAASSSSTSSSTRSQTPTTTTTTTTTP
                     DPRLADDLDPALPDNVGIGYIPPPSSSNNPLAAAQEDRERALLRRKVLGRNAARQLAE
                     REQQQQQQQSGDRGRKRGAAAAVDGSESEEDVGKGALVKGKRRPVVAAAAAPVAGAGG
                     GGARTGDESAQGGEEESRRRRKKKKRIRVEGPDGPGTGAGAGSDSHSRAPGGTGAEDD
                     EDEKERGRGAVTSQTDAGAAGEGGDVLMGDVGAGEEGQEQQVADVPEQEGGTEEKKKK
                     KKKKNKNKKKKKRERELSKEANGDAESEASGGED"
     gene            <1993219..>1994422
                     /locus_tag="MYCTH_2130877"
                     /db_xref="GeneID:11507317"
     mRNA            join(<1993219..1993290,1993961..>1994422)
                     /locus_tag="MYCTH_2130877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666906.1"
                     /db_xref="GeneID:11507317"
     CDS             join(1993219..1993290,1993961..1994422)
                     /locus_tag="MYCTH_2130877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666954.1"
                     /db_xref="GeneID:11507317"
                     /db_xref="JGIDB:Spoth2_2130877"
                     /translation="MLVIALNFGCPSVLERLSRSEPSLIAKVDPEDVPNCLALNRHAN
                     LIVELNHERAQLTHTRMRAWKERCARLAASTSPYSNCPDADIACEEYDALVQVGPSII
                     AHVMLEYSKDQSGPWYKLMYQLVREKAMTSAAREDRWAEANSYSLWRDWFEHRKHHEA
                     CENGFTPSYLTNAVQLR"
     gene            1995121..1997215
                     /locus_tag="MYCTH_2312147"
                     /db_xref="GeneID:11507318"
     mRNA            join(1995121..1995329,1995415..1995507,1995624..1996773,
                     1996942..1997215)
                     /locus_tag="MYCTH_2312147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666907.1"
                     /db_xref="GeneID:11507318"
     CDS             join(1995276..1995329,1995415..1995507,1995624..1996773,
                     1996942..1996985)
                     /locus_tag="MYCTH_2312147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666955.1"
                     /db_xref="GeneID:11507318"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="JGIDB:Spoth2_2312147"
                     /translation="MYRLGRSRALASAFAAPKVSPSPRLQSIAQQQRRALSIHEYRSA
                     DLLRQYGIDIPKGAVATTAAEAEAVAKSIGTDDMVIKAQVLAGGRGKGSFDNGLKGGV
                     RVIYSPTEAKMFAEQMIGHKLITKQTGAAGRLCNAVYICERKFARREFYLAVLMDRAS
                     QGPVIVSSSQGGMDIETVAKENPDAITTTYIDINVGVTDEIARGIATKLGFSEQCIED
                     AKDTIKNLYRIFLEKDATQIEINPLSETSDHKVMCMDAKFGFDDNAEFRQKEVFSWRD
                     TTQEDPEEVRAAEAGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGQPANFLDVGGG
                     ATPAAIKEAFELITSDPKVTAIFVNIFGGIVRCDAIAHGLINTVKSLDLKIPIIARLQ
                     GTNMEQAHQLINDSGMKIFSIDDLQSAAERAVQLSKVVKMARDIDVGVEFTLGI"
     gene            <1998653..>2004776
                     /locus_tag="MYCTH_2136046"
                     /db_xref="GeneID:11507319"
     mRNA            join(<1998653..1998894,2002175..2002753,2002845..2002904,
                     2002973..>2004776)
                     /locus_tag="MYCTH_2136046"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666908.1"
                     /db_xref="GeneID:11507319"
     CDS             join(1998653..1998894,2002175..2002753,2002845..2002904,
                     2002973..2004776)
                     /locus_tag="MYCTH_2136046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666956.1"
                     /db_xref="GeneID:11507319"
                     /db_xref="JGIDB:Spoth2_2136046"
                     /translation="MDSVMCPCTACFAATRGYPAVVGPQQHANRHYYLRPNLDFFRGK
                     KGRMFGRLRRVRTIESTTSTLVGLTAHAQPMAVLDREGVDEKKSSDTLCGTEIFEGCD
                     KGEEEEEEDEDGADYWAGGDEEGQGEEDDEEEYEQDGSGLPRAARHVWLSDEERLRVA
                     FRRARASAEKVDLDRSPFFPRTVAEYVGLKADMLAARAARLRAKVRERERMLRARTTA
                     RWKRLFVVGRSGEIEEVMVPVYFGDREEREGAVPARARPRSTAEDGKPASHQSRARTG
                     QANAGCPRIPKNLSPGPTSTPGIFAYSAAPDVVAPRGRDFAIWEAIHLQKVDEENPGR
                     SGDAAYPAIKPKGTDSFSPGSLLPAGPIGAATGHGRTSSATILREVAAHAASRRGNPE
                     GSSVQIQADDGLKTQSSPFEDDVYDSDSSFTPSDYRPGLRHATSVMSRAGMESSDEVG
                     SSSGSSNGSTPTGYVTYLTALVETEVDMRSEIEPRSKTDEHHLGDIGSGQDEIREGPD
                     GSSSPCFALNNTLAHKLQVHKTPSGKVGSRQAEEMEGEPGHLDNGSVQTHNMRDHVKG
                     TKNNNNNNTKTREQHALLGDDDTYDTDDLVDTHRHEAAGLPVPAAHSRRTELFPPLPP
                     PPPMVPQLATLALSARDGLTAVFARRGNPFSPAPPECDWPGVAELTAEGDGRVKRWDP
                     NCYRRRRRRHHDHHDHHDHHDLLSSSTTTTTTNNNTIPRQSDPGLGRFLPVPRLRDVV
                     DPRLGPGAAATAAAALAAAAAAAARDTQTHPEHQAHQAYQAAAVLPWEVRAMAGERRW
                     DLHGERRIWEMWGWPFDDDDDEEEEEEEEEKNGGWDHLRLVGAASDDAADDDDDGGGD
                     REEEVVVNAGFAAGVAMAERLIQDDNDDTNDAAEQEDS"
     gene            2006778..2010034
                     /locus_tag="MYCTH_2312153"
                     /db_xref="GeneID:11507320"
     mRNA            join(2006778..2007096,2007217..2008761,2008850..2009791,
                     2009888..2010034)
                     /locus_tag="MYCTH_2312153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666909.1"
                     /db_xref="GeneID:11507320"
     CDS             join(2006917..2007096,2007217..2008761,2008850..2009791,
                     2009888..2009950)
                     /locus_tag="MYCTH_2312153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666957.1"
                     /db_xref="GeneID:11507320"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="JGIDB:Spoth2_2312153"
                     /translation="MSASEETVKQEQPPETREMGETGKVDETHKTQDAEETPAADKGA
                     GGEQRPPSQDGSERDTDSFEDAVETGSLRSLTKRQQPVNPLPLPAEEQTGAGHEEGEE
                     ASQPAAANGDVDSQEATAERKIPRPLSQLSTGSLDNVNLDDDDATATTAESRQGTSQQ
                     LKLNARGPYQHANSLPVKSPPPEKASKTMSFSSITNALPPMPWSPPATESRSKSPPAA
                     AAAAAAPAPAPAPAPASTGRKFNSPFSWLSRSSSKEPPAAQAAAPSTRRNTASSVATL
                     TSNPEMMLSKLEEERAGEDGTRNSLKDRFKALRLKEEAVAAPAEDGKTLAVAGDGSET
                     AVAAQPPASPLPPNPDKNLAPGTASGVTAGPSSIADAPVDWDLWQKVVNEGPAAVARS
                     SPEELNKAIATGIPNAIRGVIWQVLAQSKNEELEAVYRELVARGTDKEKKDKNRQSSG
                     TTISATMNGSAKGSASSASSVHSDGSGSNGVPSPTDKDSDSINKKAPALSAAERQKKE
                     KEDLAMLQKLEKTIRRDLGARTSFSKFAAAQGLQEALFGVCKAYALFDEAVGYAQGMN
                     FLIMPLLFNMPEEEAFCLLVRLMNQYHLRDLFVNDMPGLHLHLYQFERLLEDFEPALY
                     CHLRRRGISPHLYATQWFLTLFAYRFPLQLVLRIYDLILSEGLSAILKFGIVLMQKNA
                     AALLAIPDMTQLTNFLKDRLFDVYIDSAPSSNSILENGFFGSSSSSIDKEVYRADQLV
                     RDACEVKITPEMLKAYQAEWEEKTRAEREREAELEALRASNASYAIRMRKLEERLQQV
                     DAEQASLATELVHTKVENDELRDENEGLKIQVQELRIVIEKQPAELEMAWQQERDDLM
                     KRNEKVHEENQRLEKELSELEEELVQTKMRYAEINSAHETLTRKWTDLKRQFQ"
     gene            complement(2010454..2012234)
                     /locus_tag="MYCTH_2145592"
                     /db_xref="GeneID:11507321"
     mRNA            complement(join(2010454..2011411,2011474..2011656,
                     2011867..2011874,2011955..2012021,2012201..2012234))
                     /locus_tag="MYCTH_2145592"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666910.1"
                     /db_xref="GeneID:11507321"
     CDS             complement(join(2011050..2011411,2011474..2011656,
                     2011867..2011874,2011955..2012010))
                     /locus_tag="MYCTH_2145592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666958.1"
                     /db_xref="GeneID:11507321"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="JGIDB:Spoth2_2145592"
                     /translation="MGISRDSRHKRAATGAKRSFYRKKRAFEAGRQPANTRIGPKRIH
                     VVRTRGGNHKYRALRLDSGNFAWASEGCTRKTRIIVVAYHPSNNELVRTNTLTKSAVV
                     QVDAAPFRQWYEAHYGQPLGRRRQQKQGQAPEEVKKSKSVEKKQAARFAASGKVDPAL
                     EKQFEAGRLYAIISSRPGQSGRCDGYILEGEELAFYQRKLHK"
     gene            complement(2013115..2025866)
                     /locus_tag="MYCTH_2312159"
                     /db_xref="GeneID:11507322"
     mRNA            complement(join(2013115..2013258,2013314..2013658,
                     2013719..2017423,2017559..2017714,2017763..2018473,
                     2018531..2025662,2025729..2025866))
                     /locus_tag="MYCTH_2312159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666911.1"
                     /db_xref="GeneID:11507322"
     CDS             complement(join(2013164..2013258,2013314..2013658,
                     2013719..2017423,2017559..2017714,2017763..2018473,
                     2018531..2025662,2025729..2025776))
                     /locus_tag="MYCTH_2312159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666959.1"
                     /db_xref="GeneID:11507322"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR010309"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="JGIDB:Spoth2_2312159"
                     /translation="MGKITKTMQSKHRENLSPWVKDYVLAAASTPLPLIPKKLDEFPT
                     RWPFPRGDLYHWIPLLNRFDSILEAFCATYKLQDGFQMRDFGCDLLLNQGAPVEYADE
                     QPFSKERLVQLGYKEDGDRQLIVSILTFTRVLLQHCGNRSIYASSPHLNDLLNSTDLS
                     VIYHTLEVGLELAQRYQASIKRVGTPNRQVSSALLANHYNIDLERVQYLAQPFVKTPL
                     SPGPRFSDLPPTTPGSASKSKEKASGPSHRNAASVYANDLSAIIAPGPADDARWAGWG
                     DVKITYYPKTETSGSTASEAQPAEAGSTSIPTTPTPLRRGSTGLSQTPRSSKTHGAED
                     SPLSRSHRVSGDDHPVSGPRFFELRQVKVQSTSIYELLKLCPSDMPKASRYEFLNRLR
                     ICKALLGSSEDRQLALAVRLLAITNLAYIHPEATFVEKVLKQDNDEPRRYQLVYQLAE
                     LIHPSADGTPDTPLKLQAIALAALESITVMPTKYPEVVAALNANVNHGVLLYVIRKAV
                     ASMKDDSAEADDGKVTDADHWRASLFALTLQMAMASRIGQEMSSAGLLEIMVEILNIR
                     SRTATRNYSMVLAFLDTIIYGFNGAFTVFSNAGGLDAISNLIIDTVARSKEEVAAGQG
                     MKPEFHSHTVDYEIPFYHQQALKWLLKFIHHIMTNAFSFGTNIDRLLRNLVDNSALLG
                     SLRTITENMHVFGSLVWTNAAGLLSDFINNDPTSFAAISESGLIQSFLETLTGRPVTL
                     PKPSETPNPEQEGEGRDSPAFTNESVNLESDERPHPPTQEMLEAPRERLAPGVLASTD
                     AISIIPSILNSISLNNLGLKMVDSSHAIEIYLEIFESPNHVQVLSESDLANVVGGSFD
                     ELARHHPALRPAISNAILDMVARVLHLAKTKSISAGWGAKLSVLDANGKAITADESLL
                     ASLEAAPSTAKGKEKAAPEDADVEMVDASSTAAQSHTSHGNSAAEDQKPSGPFHEITP
                     YIGAVSSFLNAIFHNSSLKSSFIRDGGIELLLQLSEVPSLPGDFESTSASRSLAHALA
                     TVIEASPILGLPSLLNRAHAAIDDLEPLVSKKGAQPFFAPFVVPNLSVQNDQAEWDQG
                     LVRKVAGGTRVVKALVRLQTLLKTLYQSFPYSSRQATVSMPAVNVFDYFISLINRLGS
                     LLRDAATEDMAIAALVPSHWLGNRSFTQDGVEVVASPSAPTATEESKPEDAGQATSAD
                     KAAEPSKLPKEPTKEERASPRFQNYFVISRLLNSLTPSTLPFFQTIGKVLLSRRGPDS
                     YLRSHHLSIAQTLAETILEQLSLPQEQSLTVRDLRYWDVMFDALNQMLIDPTRQPDRT
                     SVQLILPVLVAFKDRGGIEFLNTMLRKFADELCNDAPERQDAQKLHLVTAGMRKILDI
                     YHVIVSGKNVYESVGQTSLFPRSSDRSRDRGHQLIVELRLAILPTARKLWESDFAEKA
                     PTPVLSRVIDIIKTIAAADLETNAWRKTDKNSPVPLFGDRPTIRFDWRLYADQIKNLT
                     RMGYDEELAREAVYRANGKVDDSAEYCRAHSKGLAGKRNPVPEQDAYRGPPSPQSQAT
                     RDEAVAAPANPTATDPMSLDSMNNFIRDAIGEAEEHSDDGSSDESHDDESRESESQEQ
                     AGASSAPTRAPIPPSTPSEISPTPPPITKDELDRERAEVQTDLIDRCLDVVRTHPELV
                     FEVCDLIQTTILKSDNEDKRTEVGEVLANALMSFAPNDADEKRANGRGIAAFAHLLSL
                     LLQNRSFFKTTLPTLKQNAGEYLGFLRVSPGSSHEELPSWIPYILLIFEILLSDDEQP
                     VEVEWRMPAKEDDVVEPPVWVTKDLIISAEDRTKLLNAILDILPRIGKEEALAISVLR
                     ILVILTRDHGIAKIVGEKRNLQRLFVMAKQLCSGGSARLNQAHITDNIMIILRHIVED
                     EDMVRQMMETEIKQYLSSTRNPRGYHDLQSYLRHLSHVALRSPKLFVDVTSDLTKLNG
                     WSTYDPAIRTYNLSLKEKPAEQETSPKEGSVGPAVQATEGLTIEDVKPSTEIVDKEMA
                     DAPKTPFELKRPVLENPDGVIHFLLSELLNYREVDDKEPSSHSPKGLTAESESPGASG
                     EATPAPDQHLSEQKEKERKAPRPTFKAEDHPIFVYRCFLLNCLAELLQSYNRAKVEFI
                     NFKRSVPIQTNTPIKPRSSVLNYLLNDLLCLGPAGIPMDSTIIRKKAATSNHAQAVLV
                     ALVARTPEKPVDRTRNSFEYDDDSDLLFVRRFVLETVLRAYKEASTPGEPVEVRYGKM
                     MCAAELMSLMIGEKDKEAQQRDARASDPAVLRSQMQLKRLMYEKGYIAALTASIADID
                     LTFPNVKRTIKYILRVLRALTKTACLLSQSDVIPVTATDQPEDDFASASSLSDLDDDR
                     EETPDLYRNSTLGILEPGREEDFSDEDEDDDHAMFDDEPYDDELEYGDEMSQDDEENP
                     SDEDDDELGEMGQVEGMPGEPGVVEVIMGENEDMDDDMDEDMDEDDEEEPSDDEEDED
                     EDEDEDEMGSEDMEDIEDRIEIVDEEGNPVDDEGASGWESETDEEEDEAEEELGFEAG
                     GAHDIHDALMHGHGIDQLGHIPDILRNVVEGGDEIDAEDMQEIDEHYIDDGVDDDGKY
                     SLPGFPLCAQLTRPDEEEEDEGEEDEVYYDPGHHLLDDDHPPPTMPSGLGWDVSQIEP
                     HHRLRHGGNRSPFPAPFMAGHHRDPLGPDFRSYFRHGQHRQPPNPTDDGVNPLLLSGN
                     RAGQDASRVTGQHMIRLGFPGSLVGHGLDAPLAFINDLMQSIPFPRGAGPSFSLQLRS
                     EGPAGEVRQLSIPVSMTQSGREPRWEPRREVYQEPHQAVTFFPESTAERWQGEAKMIF
                     GFNHNEKTKLLATAILGMLTPAAIQREKEARARQEEKRKREEERKKREEEERKEREAK
                     EAEERAARERKEAEEREREERERAEAEAARAAEEAVAVEEVSAQEPQAMEGVETHQET
                     QEAAPEPARARERVVTTIRGETVDVTELGIDPEYLAALPEEFREEVIAQTVSSRRSQA
                     REQAANEGENTEVFQEFLEALPAELRMEIVQQERQERRRREREEQRRHATATGQDLGP
                     VEMDTASILLTFPPALREQVLLEQGEDIMDQLPPELAAEARALAQRHHLHRVPPPGSR
                     SREAARRSEAAAEAKPQRRTIVQMLDKAGVATLLRLMFITQQSSIRNYLFDVFAHVCE
                     NRQNRLEVISTLLQILQDGSTDMDAVERSFGQLSLKAKQPKDKDPKTPQSLKRTYTNA
                     GANNQMSGNSEVSPLLIVQQCLDLLQELATKNPHVPSLFLTEHETVASTLKRSTSRKG
                     KGKDVSTKAQKYAINSLLALLDRDLIMESSSVMQLLADLLNKVTYPLQALERRRKEAE
                     EEAKKKAEEKEKEKTGEAGTETAQSSGEQPPAAQTAESTAVAATGEQPPAENMEQPEA
                     ESSTAREPKTEEKKVRQLVPPTIPDYNLKLVINVFVARECSSKTFQNTISTIKNLSNI
                     PGAKKVFGEELVSQARALSENIVSDLEDLLPHILKAETGTEIQGIALAKFSPGASEQN
                     KLLRVLTALDHLFDTKGKKSSGVGEGGEATDETKEDLLSSLYWNPTFGTMWDKLSACL
                     SAIRQRESLLNVATILLPLIESLMVICKNTTLSEASASQVATGKEMLLSSPPPDNRIA
                     SLFFTFTEEHRRILNELVRQNPKLMSGTFSLLVKNPKVLEFDNKRNYFNRSVHAKNGQ
                     QRQQYQPLQLSVRRDQVFHDSFKSLYFKSGPEMKFGKLNIRFQGEEGVDAGGVTREWF
                     QVLSRQMFDPNYALFIPVSSDRTTFHPNKLSGVNDEHLMFFKFIGRIIGKALYEGRVL
                     DCYFSRAVYKRILGKPVSVKDMESFDPDYYKSLVWMLENDITDIITETFSVEDDEFGV
                     TKVVDLIENGRNIPVTEENKHEYVRLIVEHKLLTSVKDQMENFLKGFHDIIPEDLISI
                     FTEQELELLISGLPEIDVDDWKANTEYQNYTPASQQIQWFWRAVRSFDKEERAKLLQF
                     VTGTSKVPLNGFKELEGMNGINRFNIHRDYGNKDRLPSSHTCFNQLDLPEYESYEVLR
                     SQLLKAITAGSDYFGFA"
     gene            complement(2027450..2028916)
                     /locus_tag="MYCTH_2312170"
                     /db_xref="GeneID:11507323"
     mRNA            complement(join(2027450..2027756,2027813..2027980,
                     2028110..2028472,2028592..2028675,2028792..2028916))
                     /locus_tag="MYCTH_2312170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666912.1"
                     /db_xref="GeneID:11507323"
     CDS             complement(join(2027661..2027756,2027813..2027980,
                     2028110..2028472,2028592..2028675,2028792..2028797))
                     /locus_tag="MYCTH_2312170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666960.1"
                     /db_xref="GeneID:11507323"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="JGIDB:Spoth2_2312170"
                     /translation="MKLNISYPANGSQKLIEVEDERKLRHFYEYMGAEVPADPLGDEW
                     KGYILRITGGNDKQGFPMKQGVIAPNRVRLLLSEGHSCYRPRRTGERKRKSVRGCIVG
                     PDLSVLALAIVKQGEQDIPGLTDTVHPKRLGPKRATKIRRFFGLSKDDDVRKYVIRRE
                     VQPKGEGKKPYTKAPRIQRLVTPQRLQHKRHRIALKRRQAEKVKDEANEYAQILAKRV
                     AEAKAQKADLRKRRASSMRK"
     gene            2029023..2030842
                     /locus_tag="MYCTH_2312174"
                     /db_xref="GeneID:11507324"
     mRNA            join(2029023..2029530,2029587..2030842)
                     /locus_tag="MYCTH_2312174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666913.1"
                     /db_xref="GeneID:11507324"
     CDS             join(2029353..2029530,2029587..2030743)
                     /locus_tag="MYCTH_2312174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666961.1"
                     /db_xref="GeneID:11507324"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="JGIDB:Spoth2_2312174"
                     /translation="MEDDRVLVDVGIAAEIEEKQAHENATKQPKKRFVGRRAAVEAAK
                     AGSGPTSIEDSGAIQVAQPRRASRLVNQVPPEILNDEALKAAIALLPANYSFEIPKTI
                     HRIRSLGAKRVALQMPEGLLMFATTISDILTEFCPGIETLIMGDVTYGACCIDDYTAR
                     AMGCDLLVHYAHSCLIPVDVTKIKTLYVFVDISIDTSHLLATIERNFSPGKTIALVGT
                     IQFNATIHGVRSTLEKAGFKIIVPQIAPLSKGEILGCTSPNLSTCTDSPVDLILYLGD
                     GRFHLESIMIHNPDIPAYRYDPYSRKLTHETYGHEEMQDIRRDAIRTAKKAKKWGLIL
                     GSLGRQGNPHTMALIENKLKQMGIPFVNLLLSEIFPGKLAMMSDVECWVQVACPRLSI
                     DWGYAFPRPLLTPYEALVALEEREDWGKGPYPMDYYGKEGLGRTKPVAIGTS"
     gene            complement(2030843..2031582)
                     /locus_tag="MYCTH_2312176"
                     /db_xref="GeneID:11507325"
     mRNA            complement(2030843..2031582)
                     /locus_tag="MYCTH_2312176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666914.1"
                     /db_xref="GeneID:11507325"
     CDS             complement(2031004..2031543)
                     /locus_tag="MYCTH_2312176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666962.1"
                     /db_xref="GeneID:11507325"
                     /db_xref="JGIDB:Spoth2_2312176"
                     /translation="MSTPTKAIPLHPRPHNPSGPFQNRPSPQSPLPPLLQTPSGLALL
                     ELQGTINLPPLPPETAQDPASATTPAIPIGRLHFPDYDGSADSTAWTNRVWMYVGEHQ
                     RLQGQVKKLPRAVAVLRKRRGGRSGLGTGGPGPDEGEGAGRRAETEAGTEELEVVDIV
                     KWKIVFSSRPEPVGSGAAS"
     gene            complement(<2032445..>2033770)
                     /locus_tag="MYCTH_57502"
                     /db_xref="GeneID:11507326"
     mRNA            complement(join(<2032445..2032839,2032924..>2033770))
                     /locus_tag="MYCTH_57502"
                     /product="aldose epimerase-like protein"
                     /transcript_id="XM_003666915.1"
                     /db_xref="GeneID:11507326"
     CDS             complement(join(2032445..2032839,2032924..2033770))
                     /locus_tag="MYCTH_57502"
                     /note="Aldose epimerase-like protein"
                     /codon_start=1
                     /product="aldose epimerase-like protein"
                     /protein_id="XP_003666963.1"
                     /db_xref="GeneID:11507326"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="JGIDB:Spoth2_57502"
                     /translation="MRLLLSLYGAALFLKGALATPPHTPHGESPDEDGKYWIYGEGIA
                     AAFIPYGASITNLIIDDKNGIPRDLVMGFDKASDYPKDKSHPHLGGVPGRYANRIKNS
                     TFEIDGKTYRVTANENPTRKHPDGLDTLHGGVEGWDWRDFDVVSHTDESITFSIVDPD
                     GKEGFPGEVISYITYTMGNLTWDAKMVAIATTKKTPIMLSSHTYWNLDGFANDETDTI
                     FDHTLHLPYSGQRIDVDNILIPTGKILPNPEGSVNDFWSAPKQIGDGFKDPEIHGNCG
                     FDCTGYDNCWLVNRPGPHDWRADGAYVASLYSAWSGIRLDIYSDQDAFQMYSCNGQDG
                     TFPLKSTQGVDGRNADKRHPHKPAQTVPQYGCVVLEVEDYIDGINHPEWGRLGKQVFG
                     PGSDPYVLQISHRFSVDTDDA"
     gene            complement(2035111..2037525)
                     /locus_tag="MYCTH_2312181"
                     /db_xref="GeneID:11507327"
     mRNA            complement(join(2035111..2036321,2036375..2036700,
                     2036749..2036910,2036963..2036998,2037056..2037075,
                     2037132..2037216,2037269..2037525))
                     /locus_tag="MYCTH_2312181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666916.1"
                     /db_xref="GeneID:11507327"
     CDS             complement(join(2035514..2036321,2036375..2036700,
                     2036749..2036910,2036963..2036998,2037056..2037075,
                     2037132..2037216,2037269..2037367))
                     /locus_tag="MYCTH_2312181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666964.1"
                     /db_xref="GeneID:11507327"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="JGIDB:Spoth2_2312181"
                     /translation="MGDPRESSSYRVVPRIRYNTVGGVNGPLVILDNVKNPSYNEIVT
                     LTLPDGTQRSGQVLETRGSRAVVQVFEGTSGVDVKKTRVEFTGESLKLGVSEDMLGRI
                     FDGSGRAIDKGPKVLAEEFLDINGSPINPYSRVYPEEMISTGISAIDTMNSIARGQKI
                     PIFSAAGLPHNEIAAQICRQAGLVQREGVTNKGVHDGHEDNFSIVFAAMGVNLETARF
                     FTRDFEENGSLERTTLFLNLANDPTIERIITPRLALTTAEYYAYQLEKHVLVILTDLS
                     SYCDALREVSSAREEVPGRRGFPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPND
                     DITHPIPDLTGYITEGQIFVDRGLHNRGIYPPINVLPSLSRLMKSAIGEGMTRKDHGD
                     VSNQLYAKYAIGRDAAAMKAVVGEEALSAEDKLSLEFLDKFERTFISQGPYESRTIYE
                     SLDLAWSLLRIYRKDMLNRIPAKILNEFYHRSSADRKGKAKAPTKDTRDTAAPEEPNL
                     IDA"
     gene            2037972..2039855
                     /locus_tag="MYCTH_2312184"
                     /db_xref="GeneID:11507328"
     mRNA            2037972..2039855
                     /locus_tag="MYCTH_2312184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666917.1"
                     /db_xref="GeneID:11507328"
     CDS             2038186..2039787
                     /locus_tag="MYCTH_2312184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666965.1"
                     /db_xref="GeneID:11507328"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Spoth2_2312184"
                     /translation="MSSIYNLEPQPTASAIIHTTQGELAIELFAKQTPLTCRNFLQHS
                     LDGYYDNTIFHRLVPGFILQGGDPTGTGHGGESIYDGGAFGGDLDPWPMDQRRGQNAG
                     PTGVNFKDEFHSRLKFNRRGLLGMANEGVPDSNGSQFFFTLGKAEELNNKNTVFGRVA
                     GDTIYNLAKMGEAEVAEGTERPLYPVKITHIEILVNPFHDMKKRERKVRQEIPQQFPL
                     EKKQKKRKGGKQLLSFGDEEGDVEDLPVLKKPKFDTRIVMDVDEETNQVAIPVRASVK
                     KEKKAPDKEVQTSDSRSESPQRSSGVPEPVPVKKPSPSKIDDNKLSSPEPEEPPKESL
                     LERTNEEIAAVKASMKRTIHVEPVKEKMKSALELMVPETATRGRKRRPGASNHSSKEE
                     QEALEFLKAFQEKLRQAPPERKTSQPTGTEAEGRDDQDEEGEVCDLHFIANCQSCKAW
                     DKEQREESDDEGWMSHTLSFAADKLGKDLSYRKKAEEELVVIDPLEKARTLKEEKRAT
                     RHPHGGLSSRGSEWHRDRDRERRGR"
     gene            2041153..2044472
                     /locus_tag="MYCTH_2312185"
                     /db_xref="GeneID:11507329"
     mRNA            join(2041153..2041861,2042017..2044472)
                     /locus_tag="MYCTH_2312185"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666918.1"
                     /db_xref="GeneID:11507329"
     CDS             join(2041446..2041861,2042017..2043970)
                     /locus_tag="MYCTH_2312185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666966.1"
                     /db_xref="GeneID:11507329"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="JGIDB:Spoth2_2312185"
                     /translation="MAPLPQMPQSYSPVQTDPMFRWNGVDTNGFVDAGTPGMNSFSML
                     PTSTPYGQAISAPSNVLARRQNSRALVPTTPRAPFDRGADGWNGFGDDSSYLQAANSS
                     VDEHDNIERLEELAQRAKREAQAKRKQIPPFVQKLSSFLDESRNTDLIRWSDKGDSFI
                     VLDEDEFAKTLIPELFKHNNYASFVRQLNMYGFHKRVGLSDNSMKASERKNKSPSEYY
                     NPYFRRGHPNLLWLINKPKSGNSKKKGKKDEVDVESEEEGVEETYSSQNLTAPQAARG
                     AVSHEIGPLQKKDLLQVKTQIERIQQQQVAISNMLTKMRQDQNQLYQQALLFQSMHER
                     HENSINAILNFLANVFRKSLEEQGGTQAVQDLLASIIPNTQGHGQSQISPGSGVVDLG
                     GFVNQRPQNVNTVGTPKRQQRLLPPIPLHQANKAGSVSTTGATPPAPQAPHQAPQMGT
                     VTELFDTSPSDTASQSYIKNELRSNPQEGMMKIIQDTNAVNNTSGFDLPDVAAKTPAS
                     MSDDQRAQMLNIMAGNSTVSATTTSGIPAVTPTAPATTPATVTVTATAPAPAPAPAPA
                     PAPAPAPTPAPAAPSSSAPAPSAGLALSPSLSSIQMPSLQEIQSTQAELEALQRLQAE
                     QADQIDALTNLLGPLSPSGRIPGLDDEGNPNANYFDSVDYDQFLHNSAFSDPNFEAGG
                     LDGVGLAGGAADGADFNFSLDGSNSAAAGTGDYAPGAAGGSTTGNGTQVTREKAGGSG
                     GAGGAGVGSNGRPFETNSMKDTPSPAGTEEIARAEFESPERGTKRRRKG"
     gene            complement(2044956..2045845)
                     /locus_tag="MYCTH_2312186"
                     /db_xref="GeneID:11507330"
     mRNA            complement(join(2044956..2045500,2045576..2045845))
                     /locus_tag="MYCTH_2312186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666919.1"
                     /db_xref="GeneID:11507330"
     CDS             complement(join(2045075..2045500,2045576..2045653))
                     /locus_tag="MYCTH_2312186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666967.1"
                     /db_xref="GeneID:11507330"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Spoth2_2312186"
                     /translation="MSVTLHTTHGNLKIEVFCESVPKTAENFLALCASSYYDGSPFHR
                     LIPSFMVQTGAPAHPNPPDNPKGGRSIYGATFEDEIRPGLRHHERGIVSMANKGPNTN
                     GSQFFITFAPAPHLDGLNTVFGKLLGDESLATLAKIEAVEVDKKNRPVEPIRIEKVTI
                     HANPLAK"
     gene            2047622..2049424
                     /locus_tag="MYCTH_2312189"
                     /db_xref="GeneID:11507331"
     mRNA            join(2047622..2047935,2048082..2048966,2049031..2049424)
                     /locus_tag="MYCTH_2312189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666920.1"
                     /db_xref="GeneID:11507331"
     CDS             join(2047843..2047935,2048082..2048966,2049031..2049273)
                     /locus_tag="MYCTH_2312189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666968.1"
                     /db_xref="GeneID:11507331"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="JGIDB:Spoth2_2312189"
                     /translation="MNAANVPATVRISGPPNSSFLVGYPGISATLPRIVGKVEIRPGA
                     GFSAPVNISMVRICLQRRETIHPAAENVARRHLGTPRRETVDLVGKEVLLFRCMSGKE
                     AESVIAMDLPFQIFIPFGRSGEETNRRIPPASLQLPSRIAETYYELVVTVQQGSSMQN
                     RYSFPIPLQRYDTLSTFGMYNRPETRAATADHIVTLGISLPKWSYGPLDPITVYVKLS
                     PNPDYLNKARRVTIQKLTLTIEEEITFNPEGDEPTKKVNKIAKHTQPVGTKLPENGYM
                     TNLGLVLPARDLRDPDGIIRRGKPAFPMYEVTSFTTTSTLYKIEFFLSIKAHMTSARD
                     ITLRQPIVVCPMDQQACKEEMDAIEQAAKDASHVDPNNPILPDRTIILATEKEAIRHL
                     GLCEVGGVKKMLIE"
     gene            2051345..2053420
                     /locus_tag="MYCTH_2312192"
                     /db_xref="GeneID:11507332"
     mRNA            2051345..2053420
                     /locus_tag="MYCTH_2312192"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666921.1"
                     /db_xref="GeneID:11507332"
     CDS             2051679..2053286
                     /locus_tag="MYCTH_2312192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666969.1"
                     /db_xref="GeneID:11507332"
                     /db_xref="JGIDB:Spoth2_2312192"
                     /translation="MPLDDDDNPALAPAASAPSSSFPSSRPADDPAAAAVAATDDLTA
                     EDLIEDEGAASQDFRAFATSLQQQKHHQYRKTTGVSAQTIRKGEKDFESHGTRAQADA
                     LEQSRAAMHDVLSYTRVHPAGKNMVRGWYFPGWWEGYREEEQVDVSEGAVAARGDGEG
                     KEKKPFGFVRDRVVVLEGSSVATQSLGRAVTGQAKDRPARGKDWLLPEEALYLVERGS
                     LDLWWPLKGLEEIFPPDGAAPVEKEGRETGEVDEYDKGFPLSLQAAYALLIGDDGERG
                     KISLQKFQVYSNLKRCGYNVLRAPPTTTTNHAVAPTTTTATTQTITTTIWQWFSSLLS
                     AAHQHPPPYGPLVRPGLYRSYASIYRQMALLPRHDPSAAATTTTTPAPPPREPFAIHY
                     HIWKAAQKWTKLRHPPPDFYLAVADAQDSSVPTLAEISALLGATPPAPGKPEWTGPGR
                     LYARLKHGHRNVLIAVVDHGVINYMRFAEGRFGGEELYDRFDARVAGGGVGGKKGGGR
                     NNGRGGKSGRGGGGGGGGGGRGRGRGR"
     gene            2056016..2059352
                     /locus_tag="MYCTH_2312196"
                     /db_xref="GeneID:11507333"
     mRNA            join(2056016..2056054,2056313..2056342,2056623..2056694,
                     2056937..2057020,2057098..2059352)
                     /locus_tag="MYCTH_2312196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666922.1"
                     /db_xref="GeneID:11507333"
     CDS             2057247..2059094
                     /locus_tag="MYCTH_2312196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666970.1"
                     /db_xref="GeneID:11507333"
                     /db_xref="JGIDB:Spoth2_2312196"
                     /translation="MEETMSQASSVLPSAAQDEIVVGTNAHKRSSPAQPPEPEDVVMG
                     DTDEKPSIINPSKRKRVSGVYAESVGEKDSSPAPTEDLESRRSNRPTKAQNVGGVKGV
                     LLGYWRDSPAEREEDKHAVVGFIDVRDRLRTRIQPTTRSGQPMDPRYPIPPGPGGSWV
                     TFDKVAFDPHLVGHNHHVIKEYVKIRTEDNRKDETPEERARLDVEAVELAAERVRTNP
                     PPDAAVAPLVAYGPQIPANAVVPNRPENKKRRLAGSFGVPFDSPKSTQNPLDDIPGTR
                     PTRVPIGVWKLSSEKELKDKHAVFGVLGGNDMFRVKLTRETRDGRTVIGNFPNGAGAL
                     WIHWDEVEFDPHLKGLSRNEVKEYCRIRQRQLDLGEAPEDVAANETKAVLEAQQRVAQ
                     SLAMGTPTRREDSDLLPIAMKGSAATNGNGSNPGCPTSSFTPSRPNEEVRQSRRLENG
                     PRAAATAAGRHPLPDLEYRAANRTPPGPSSAALERTNMLARREIARLEAAQARADLRA
                     ANRETSIAPAAAGLGSNSNNSTASSNGISNIPDHFQDNVSRLNKVWEAQEANRLRVGS
                     EDAKIYMGVKYQRKQSGPFQGKLVSQGMIITIDGEDYVEYRVLTKPTFF"
     gene            complement(2060551..2062379)
                     /locus_tag="MYCTH_2312199"
                     /db_xref="GeneID:11507334"
     mRNA            complement(join(2060551..2061879,2061943..2062379))
                     /locus_tag="MYCTH_2312199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666923.1"
                     /db_xref="GeneID:11507334"
     CDS             complement(join(2060647..2061879,2061943..2062089))
                     /locus_tag="MYCTH_2312199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666971.1"
                     /db_xref="GeneID:11507334"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="JGIDB:Spoth2_2312199"
                     /translation="MPELFNPIGQKVEKVEKVAPATGPNGTTDDDDDKVVEEIESLCM
                     NCEENGTTRLLLTKIPYFREIIIMSFSCDKCGFTNNEIQPAGTFQLKGVHYELRLTSL
                     DDFQRQVIKSDTATVKFIELDVEIPAGKGRLSNVEGLLSSIIEDLAFGQEKRKEEAPE
                     VYAKVEEIITKGRKMLAGDAFPFRVAVDDPAGNSFIVPDPRDGVGKWEKREYLRTPEQ
                     NAALGLADTSATGDLDADGNIIPDQVYSFPASCPGCLHPCTTNMKMVDIPHFRQVVIM
                     NTTCEDCGYKSNDVKTGGEIPEKGRKVTLRVRNAEDLARDILKSESCALECPELNLSV
                     NPGTLGGRFTTVEGLLTQVRDDLHNQIFEADAEAGEAARKNDSLSPGERTRWEEFFTN
                     LNAAIKGEKEFTIVLTDPLASSYVQSLADDPSQPDEQIIVEDYDRTDEEEEDLGLKDM
                     KTEGYEQDV"
     gene            complement(2062381..2064233)
                     /locus_tag="MYCTH_2312201"
                     /db_xref="GeneID:11507335"
     mRNA            complement(join(2062381..2063462,2063533..2063655,
                     2063753..2063818,2063875..2063989,2064051..2064233))
                     /locus_tag="MYCTH_2312201"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666924.1"
                     /db_xref="GeneID:11507335"
     CDS             complement(join(2063319..2063462,2063533..2063655,
                     2063753..2063818,2063875..2063989,2064051..2064085))
                     /locus_tag="MYCTH_2312201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666972.1"
                     /db_xref="GeneID:11507335"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="JGIDB:Spoth2_2312201"
                     /translation="MYALTLSAELAGVTNLRPKDTQENNFFYTFKVQCTSCREIHPKP
                     IAISRFEMNEISGSRGEANFVWRCKNCKREASATINAAPTAYEQTEPAKAQKILEFDC
                     RGLEFTEFIPEGEWLADGVESNTKFEGIELTEGEWFDYDEKAGEEVSIKDLKWEIVRA
                     "
     gene            2065054..2067637
                     /locus_tag="MYCTH_2312204"
                     /db_xref="GeneID:11507336"
     mRNA            2065054..2067637
                     /locus_tag="MYCTH_2312204"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666925.1"
                     /db_xref="GeneID:11507336"
     CDS             2065172..2067505
                     /locus_tag="MYCTH_2312204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666973.1"
                     /db_xref="GeneID:11507336"
                     /db_xref="JGIDB:Spoth2_2312204"
                     /translation="MLGLWSMAAQLRACHCRACLRATRTAARQVTTSATGTASNPRRR
                     KVLASDVFTACYSAIMATAAVIDAGRKDRRRRELDRKIAEAKSRLACLLEESAGRDLA
                     KLTESPYPDVPYSRPLEKADVLNDICKLDADFLRDLQQKRKDRLIAAQHVRTMLGLSW
                     NPTLPETRKTTLAKCEEVVMAEKGRNLDRREPQTETHMAKITDMVTDLVDRLMAEAWW
                     SSEIEAPGSHPALNSPDSASTMIRMLRSDGYPSYAHPDLDPAATIEQRERLNDVNVSI
                     LSDWVPPLRERYAAKICYNFLVCGVPPGIQNYNMLILGFSLLGEHNLSQAVVDSFLYL
                     SHMKPSEATYLCLLHHYRLKGDIVGFQGVIKRMFGYDPRGIGLMRRTADYVERRPELQ
                     AWAATQDVAVVSGHYVQRAPFTHNVAEAMMEGLIDFGMLREGAKLLAVCLREQWTISK
                     DLLWRLFHSCLTLLDTTAAKLVVRALLDNIDQASLLLLGPDPVGPGSVRQLRHLLNIW
                     QATVLPGNESTQEQGPQVGNLTGEVEKAKLNHLAAAVWIREAWHHTSMMCWWLRRAER
                     KLSDHSVPLLERLDMVLSVLNFAAERPRLELEKSEHIQRVAKMDWLMAQTVSMDFHIR
                     SAETVICKALAKQMPRQLQTRSHFKSTIPLEQRISRALLYTTPGTVEYHVATLFNLSN
                     ELELQIKRALINALPKTYAQGLQQTQNDSGDVSFGRIVAYFKHYLAGLKDLQTKEAET
                     ASRPDPFARLFEALPKPISFWKRKAASAAPSPGHIGW"
     gene            2074400..2076672
                     /locus_tag="MYCTH_2316607"
                     /db_xref="GeneID:11507337"
     mRNA            join(2074400..2075006,2075172..2075513,2075571..2076672)
                     /locus_tag="MYCTH_2316607"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666926.1"
                     /db_xref="GeneID:11507337"
     CDS             join(2074635..2075006,2075172..2075513,2075571..2076020)
                     /locus_tag="MYCTH_2316607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666974.1"
                     /db_xref="GeneID:11507337"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="JGIDB:Spoth2_2316607"
                     /translation="MAGPPSPGGEGPTFAPPPLPPGWIAQWDASSKKYYFVQLSTGVS
                     QWETPTEAAPAGGTPAARTDHPYGLPNQENESAEIIVHPDGTQTARYPDGRLEPVHPR
                     EDGGYGEGTRGIGGGDSDRGLGSFLGSTLSSLNGKQSGGGSHGGGSGLGGIAGQVVTG
                     LLSPGSSGGHGGSHSSSGGIGGKLASQLASNLFSSGSKPSSQPQNYHGGQSSGHSSSG
                     GLGGIVGGVANMLGGRPHGSSHNNFGYSNTGQTGGYSGPEPPISYQAPSQPGTTPSFY
                     GTASSYHAPAQHQTPHSQYTPSYGSSAGHHQQQPSHAQGYASPHQSQPQQPYGQPSYG
                     APPPVPAPYGRPHYSQPHYASGAGYSPYPPQPQYATGQHHHGYGAGSSSSHYH"
     gene            complement(2077526..2078780)
                     /locus_tag="MYCTH_2312211"
                     /db_xref="GeneID:11507338"
     mRNA            complement(join(2077526..2077580,2077730..2078195,
                     2078288..2078780))
                     /locus_tag="MYCTH_2312211"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666927.1"
                     /db_xref="GeneID:11507338"
     CDS             complement(join(2077731..2078195,2078288..2078581))
                     /locus_tag="MYCTH_2312211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666975.1"
                     /db_xref="GeneID:11507338"
                     /db_xref="JGIDB:Spoth2_2312211"
                     /translation="MRAALVSAAVVISFFAAALANTEKTIFLGPEAVNVPLAHPTLSD
                     LRLRTLTPTNNTLRTRLPARFPSADQPQGPATWLLLDHLTPKQRYEVRVCWPATQPTD
                     FTVSTFPLATVWDTPELMASLRAYSVSREQSLAPEGGPPPPGSGNGSGNGSDSGPSER
                     EASVLLLRILAAADYYTTDASLMSSVPPVDVDIILDPFLFNLLPRSLAGTACYIVAVA
                     VAAYLLSRRIVSGIHRLIASADADVRQEAIKKRQ"
     gene            2079375..2082008
                     /locus_tag="MYCTH_2312214"
                     /db_xref="GeneID:11507339"
     mRNA            join(2079375..2080296,2080368..2082008)
                     /locus_tag="MYCTH_2312214"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666928.1"
                     /db_xref="GeneID:11507339"
     CDS             join(2079544..2080296,2080368..2081771)
                     /locus_tag="MYCTH_2312214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666976.1"
                     /db_xref="GeneID:11507339"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="JGIDB:Spoth2_2312214"
                     /translation="MAPSPSKPVALGGTAARARTIRTIVTQLTSMYLRNRTRISRAIY
                     ITLFVALVNRIRNSIADQKRASAREAEERSRRAGTTSMTGDDEEGRKKKVGLNREFLR
                     SLLRLLRIVVPGWRSKETQYLISHSFFLVLRTLISLKVAAMDGAIVKALIKGNGREFL
                     MRILWWMLIAVPATFTNSMLAYHQSELSLRYRTRLTEYIHDKYLSQLTFYGISALDDR
                     IKNADQLIAVDVTKFSNNLAELYSNLAKPILDMTIYTISLSRAVGGEGVVFMSLLVQL
                     SATVMRALTPPFGKYVADEARLEGEFRFQHSRLIDHAEEVALYAGHEAEKDTLDKGYF
                     TLIKHINYLLRKRFYHGFMEDYVVKYIWGALGLILCSFPVFFKLPGQVVSSMGDRTES
                     FVTNRRMLLGASDAFGRLMFSYKEIMELAGYTSRVSSLLDVMQDVQAGKFSKKLVSSS
                     DTEANAAVLRGRGKTFVSNDIRFVDVPIISPNGDVLVPALSFSLKQGDHLLVVGPNGC
                     GKSSLFRILGGLWPVYGGTVYKPPFHEIFYIPQRPYLSSGTLRQQIIYPDNLTTMRNK
                     GVTDADLEAIIRTLSLDHLLDVYPDRWDAQAEWKDVLSGGVQQRIAMARLFYHRPRYA
                     ILDECTSSVTLETEKVMYDTAKDLGITLMTVSHRRSLWKYHTHILQFDGQGHYVFSKL
                     DAERRLKLEDEREDLEVLLRGVPEIERRVKELAGED"
     gene            complement(2082527..2084546)
                     /locus_tag="MYCTH_2312218"
                     /db_xref="GeneID:11507340"
     mRNA            complement(join(2082527..2084210,2084474..2084546))
                     /locus_tag="MYCTH_2312218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666929.1"
                     /db_xref="GeneID:11507340"
     CDS             complement(2082536..2084149)
                     /locus_tag="MYCTH_2312218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666977.1"
                     /db_xref="GeneID:11507340"
                     /db_xref="JGIDB:Spoth2_2312218"
                     /translation="MKAAYLTLGLFAALTPAASAYSKRHPRYMRLRQRFNNGTAGIIV
                     SPEDDPAAISDSTSATASVPLSTGVSSDTASLVTSAPPFPTNGTGSGITTLTVSTTSI
                     HTVTSCLPEVVDCPARTEDLTNLPTEALTTAIVTDTIVLTTTVCPVTAVPSITSSVLS
                     EHSKGIITGSTLSPAKTSTAAPASATTGVSSDAASLVTSAAPSLTTGTGSGVTTLTVS
                     TTSVHTVTSCLPEVIDCPARTEDLTNLPTEALTTAIVTDTIVLTTTVCPVTAVPSITS
                     SVLSEHSKGVITGSTLSPVETSTTAAETDTTTTATITTTGTRTVTVKRPTATAATTVG
                     VSPGSGSGSGNGNGNGNGNGSGSGTVCNCDAAAATVTVTEAAVTVTAPASTVFVTVAG
                     ADCQATASPSSASAQDGNGNGNGNGSGSGSKTTSVASSASATSTASPTGTGETGSGDD
                     EEDACPTDEVDDAVTASATTASATASVTASTTESAAPSQTSGTSTGEDAGNSDDDDNC
                     PDDEVVTVTASEEAPSATTSSGSAATSGL"
     gene            <2087249..>2089397
                     /locus_tag="MYCTH_57572"
                     /db_xref="GeneID:11509295"
     mRNA            join(<2087249..2087407,2087466..2087729,2087786..2087846,
                     2087904..2088002,2088064..2088112,2088166..2088221,
                     2088279..2088816,2088929..>2089397)
                     /locus_tag="MYCTH_57572"
                     /product="gamma-glutamyltranspeptidase-like protein"
                     /transcript_id="XM_003666930.1"
                     /db_xref="GeneID:11509295"
     CDS             join(<2087249..2087407,2087466..2087729,2087786..2087846,
                     2087904..2088002,2088064..2088112,2088166..2088221,
                     2088279..2088816,2088929..2089397)
                     /locus_tag="MYCTH_57572"
                     /codon_start=1
                     /product="gamma-glutamyltranspeptidase-like protein"
                     /protein_id="XP_003666978.1"
                     /db_xref="GeneID:11509295"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="JGIDB:Spoth2_57572"
                     /translation="LLLLFSQPGPCSASPLAQQRFISDLASTQASRGAVASESSICSK
                     IGIDTVAMGGSAADAMVATTLCVGVIGMYHSGIGGGGFMLVRDKHGRYETIDYREAAP
                     AAASRDMYEHNPDASIRGGLAVAVPGELKGLDYLHRKYGVLPWKTLVMPAVRVAREGF
                     QVTEDHVRYMKSTIKDNSTFLVDDPIWAEDFAPNGTLVQLGDIITRKRYADSLEKIAN
                     QGIDVFYRGEIAESMIGWIQNMNGTMTMQDLDEYHVDVKPSLNITYGDYRLFTTKVPS
                     SGSVMFSILQTMQQYDPADLTDTNLTAHRLVEAMKFAYGARLQLGDPEFVDNAAELET
                     QLLSNDRAHHIRQRILDDKTQPVEAYDPLLLYAPESHGTSHIVAADASGLTVTSTTTI
                     NLLFGAQIMTPDTGIILNNEMDDFSQPNRRNAFGFAPSPSNYIAARKRPLSSITPIIA
                     EHASNSSVFFATGAAGGSRIISATTQVAWHVLAQGMGMRDAIAAPRLHHQLTPDVLLV
                     EDGFDPGTVEELVGKGHEVEWMRPGLSAVQGIMKLWDGRFEAVGEPRQVSSGGYSI"
     gene            complement(2092365..2094565)
                     /locus_tag="MYCTH_2316610"
                     /db_xref="GeneID:11509296"
     mRNA            complement(join(2092365..2092808,2092878..2093711,
                     2093765..2093851,2093905..2093951,2094000..2094224,
                     2094295..2094317,2094434..2094565))
                     /locus_tag="MYCTH_2316610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666931.1"
                     /db_xref="GeneID:11509296"
     CDS             complement(join(2092743..2092808,2092878..2093711,
                     2093765..2093851,2093905..2093951,2094000..2094224,
                     2094295..2094317,2094434..2094468))
                     /locus_tag="MYCTH_2316610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666979.1"
                     /db_xref="GeneID:11509296"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="JGIDB:Spoth2_2316610"
                     /translation="MANQTPAVVMDNGTGFSKLGFAGNDSPSFVFPTAIATKGSAGGG
                     GSGSGRPAVANKPSFLTGGAGPTGHLSAKRGTEDLDFFIGDEAIAAASGPGYGLHYPI
                     RHGQIENWDHMERFWSNSIFKYLRVEPEDHYFLLTEPPLNPPENRENTAEIFFESFNC
                     AGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSSIKSIP
                     IAGRDITYFVQSLLRDRGEPDSSLKTAQEIKEEYCYVCPDIVNEFAKYDRDRSRFLKH
                     VVTQPGGRQVTVDVGYERFLAPEIFFNPEIYSSDFLTPLPVVVDGVIQSSPIDVRRGL
                     YKNIVLSGGSTLYKDFGRRLQRDIKHLVDARIRQSELRSGGAKSGGLEVQVITHKRQR
                     HGPWFGGSLLGQTPEFRSYCHTKAEYQEYGPGIVRRFALLGGPGGS"
     gene            2095220..2097741
                     /locus_tag="MYCTH_2312235"
                     /db_xref="GeneID:11509297"
     mRNA            join(2095220..2095876,2095930..2096129,2096198..2097741)
                     /locus_tag="MYCTH_2312235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666932.1"
                     /db_xref="GeneID:11509297"
     CDS             join(2095946..2096129,2096198..2097477)
                     /locus_tag="MYCTH_2312235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666980.1"
                     /db_xref="GeneID:11509297"
                     /db_xref="InterPro:IPR000246"
                     /db_xref="JGIDB:Spoth2_2312235"
                     /translation="MSFLKAGATATQAVEAAIRCLEDKEITNAGFGSNLNIDGVVECD
                     ATIVDHLGRSGACGAVAGVKNPISLAKKILDTSSQPLSLRRVPPNILVGPGAKEFAEE
                     HALKIVRNEFLVSRNAKDRYLRWNEDLKRAEARKRPRTAYSGVNWSGQRTSSPGAYDK
                     AANPANTVQLRDHASAILTGTWNEGQPDSPDSGRSPIGESASRTAADSSASPASQPPG
                     NRSASLESTERVGLGAESPYLASMPLSSRPVNDGPASCDDTEVHTGDGKIEYHDTDGL
                     GISCGKVKRHHATTQSPVDVEQVADMVTDTVGAIAVDLRGNIAAGSSSGGIGMKHKGR
                     TGPAALVGVGTAVVPEDPDDDFATSVAAVTSGTGEHMATCMASSKCAERLFQGTRRGP
                     GGRDIPEEDEHTIMESFILDDFMNHPGVRDQPSVGAIGVMAVKKDLTGIYFYFAHNTD
                     SFALASMSSTEREPLCVMSRLGKTGRVAQGGRRIRLG"
     gene            complement(2097742..2099658)
                     /locus_tag="MYCTH_2312237"
                     /db_xref="GeneID:11509298"
     mRNA            complement(2097742..2099658)
                     /locus_tag="MYCTH_2312237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666933.1"
                     /db_xref="GeneID:11509298"
     CDS             complement(2098006..2099307)
                     /locus_tag="MYCTH_2312237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666981.1"
                     /db_xref="GeneID:11509298"
                     /db_xref="InterPro:IPR004600"
                     /db_xref="JGIDB:Spoth2_2312237"
                     /translation="MNVQDAVDASEHYEVYNTDDIPSLCTIIIDTNPRAWAALNEVLP
                     VSKAIANILVFVNTHLAFSNSNQVALIAAHSNRAVWLYPTPPKQAAPRDVDMQDASSN
                     ASKASSANKYPQFAQIEKSLLTSLRALIDDTTDADLSTTTPQISGALTLALAHINKTA
                     LSFSASATAAAAHAAATTGTAVTAGATVGPAPVASTSTSSGGLAGLHARILIISVSDS
                     APAQYIPTMNAVFAAAHARVAIDTLALRGSATFLEQASFITRGTFVRAAEPRGLLQYL
                     MFGFGSGSAPSHPSGGADPGKGPAAPKTTAASVPGGGPGGRRKTGRLGLGASVADLLL
                     TPSADAVDFRAACFCHRNVIDTGYVCSVCLSIFCEVPPGGECLTCGTVLALGDYGKCP
                     VVSAGGRLGGGANAASTSGAAGGSMAEGRKEKRKVGPNGEI"
     gene            2099870..2102676
                     /locus_tag="MYCTH_2312238"
                     /db_xref="GeneID:11509299"
     mRNA            join(2099870..2101047,2101137..2102676)
                     /locus_tag="MYCTH_2312238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666934.1"
                     /db_xref="GeneID:11509299"
     CDS             join(2100298..2101047,2101137..2102510)
                     /locus_tag="MYCTH_2312238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666982.1"
                     /db_xref="GeneID:11509299"
                     /db_xref="JGIDB:Spoth2_2312238"
                     /translation="MATPASGSSKATQPTSRQDKTLLLFARLMEGGKEDEETAADLAE
                     LTKLLNEDRKLSKEDDKSIISVIDIDCVDTIFGFLDMRQPDVVRAQATLCTTAYLNAA
                     GEEGRRKVTEFFHTRMKRATYDDYIIAFCAATALFPIAYDLMADLIHTEGFLPSLAPL
                     MRRKWKSKKVETACLEMLQAACLQTKCHAAIYKYCIDWMEEIIFEDPEDRVETMWQTE
                     TDLKIEEEGAGPLRRHCEEARSLAAVVWMKIMAAPVQLAENQGTEPQTDSVTGKIEIL
                     SRRFAKMLSASSELVQCAVEGLAFATTRPVIREQVARDKETLQRLVKTLESAPAKSAL
                     EYGVLSIFAHLTRYQPTETEEQKRLRELKAYANAAGKPQPDPLADDAHVAERCKLVFE
                     AGVASALSRRGSTASAASLFQIVSILSSLSVTQSRRGQLAQQGAVRVLVNAWNTLPCN
                     EEAPRRVAAQALARILISVNPQLVFKHIPEQAAISPLVSLLTQDPTAETRDLLPTFEA
                     LMALTNLASGSSGGDGSATRKAIVSTAWDAIEEQLFSSNDRVCTAAVELVCNLVQDPE
                     QTLRIFGDGSAKASTRIKIILAMADAEDEQTRSAAGGALASVSAFDGIARELVMQPRG
                     AEIILGLCRDDSEGLRHRGAVVVDNLISHGGEVGKLAKEKLFASDGVRALTECAKKSR
                     TPEVVQAVVHALEVLLEGRNMSEAM"
     gene            complement(<2102666..>2104822)
                     /locus_tag="MYCTH_56445"
                     /db_xref="GeneID:11509300"
     mRNA            complement(<2102666..>2104822)
                     /locus_tag="MYCTH_56445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666935.1"
                     /db_xref="GeneID:11509300"
     CDS             complement(2102666..2104822)
                     /locus_tag="MYCTH_56445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666983.1"
                     /db_xref="GeneID:11509300"
                     /db_xref="JGIDB:Spoth2_56445"
                     /translation="MPVKVISLLSSSEAGSPPLQRARQPSPPGPKAQENRRVGSDNIL
                     ASALPRNQSVNSGRPIPNRRPEVQISSDDVWLVSDDDVGPSEKAHEDESVIIEEPAQK
                     RRKLHPNGANVGSPNGVSARSTAAVPLRACGLNRSNATALSRLELAEPRRQWIEDEDP
                     LVSSSSRVTEKPPRRAHDQVATLPSHDLDDDPFASSPAQLQRHEHLKTGSRLAVLDDI
                     DPFASSSPGQVQRPADSAQLTAAWDPISSSAPLPASTDDGFGRPSRSLRRSQSEVVLL
                     EDSDDDCGVQTVSDDDFPDIAGLAASKRKFDAFIKTSAESAAVKQLRTLTSAETKADQ
                     AGCKRTSLEKAKEKEEKAAAREAEKERKRLQREREKEEKAREKARAAALAEVNKIRTG
                     KKVSTPEMIVDLPITLEETLKEQVKTLLRDLDVEFASWTSPVENVIKWRRKVCSRYND
                     EEGHWEPVPERIEQENYAMVLVSAAQFVGLVLGKDEDASLEYHVMRMKDHFPNDTIIY
                     LIEGLELWLRKNRGVRNREFVTAVRGGLEPLEGDQQPPSSTQQQRKRKAAATPTYVDE
                     EIVETSLLQLQILHGVLIHHTAIPLETARWIAVFTQHISTVPYRRQRDAANDAGFCME
                     SGQVRTGDGPRDTYVRMLQEIGRVTVPIAYGIAAEFETVPKLVRGLEDGGPLSLEKVR
                     KSVNKDGEASDRTVGQAVSRRIFKIFLGRDEASTDI"
     gene            2116861..2120440
                     /locus_tag="MYCTH_2097501"
                     /db_xref="GeneID:11509301"
     mRNA            join(2116861..2117101,2117205..2117228,2117328..2117354,
                     2117476..2118638,2118707..2118967,2119062..2119466,
                     2119540..2120440)
                     /locus_tag="MYCTH_2097501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666936.1"
                     /db_xref="GeneID:11509301"
     CDS             join(2117041..2117101,2117205..2117228,2117328..2117354,
                     2117476..2118638,2118707..2118967,2119062..2119466,
                     2119540..2119602)
                     /locus_tag="MYCTH_2097501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666984.1"
                     /db_xref="GeneID:11509301"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Spoth2_2097501"
                     /translation="MAQDAAKAPVVAEAHEVDTYHPPKKMLEKHPSKPHLSGLEEYQR
                     LYKESITEPDKFWGRLARELLTWHKDFQTVRSGSLVNGDVAWFLEGEINASYNCIDRH
                     AFKDPNRVAIIYEADEPTDGRTVTYGELLREVSRVAYVLKSLGVRKGDTVAIYLPMIP
                     EAVIAILACARIGAVHSVVFAGFSADSLRDRVLDARSRVVITADEGKRGGKLIGTKKI
                     VDDALRQCPDVTGVLVFKRTGADIPMTKGRDVWWHEEVEKWPAYMAPERMSAEDPLFL
                     LYTSGSTGKPKGMMHTTGGYLVGAAATGKYVFDIHDGDRFFCGGDVGWITGHTYVVYA
                     PLLLGVSTVVFEGTPAYPNFSRYWDIIEKHKVTQFYVAPTALRLLKRAGDQHVRNEMK
                     HLRVLGSVGEPIAAEVWKWYFEVVGKEESQIVDTYWQTETGSHVIAPLAGVTPTKPGS
                     ASLPFFGIEPAIIDPVSGEEIHGNDVEGVLAFKQPWPSMARTVWGAHKRYMETYLNVY
                     KGYYFTGDGAGRDHEGFYWIRGRVDDVVNVSGHRLSTAEIEAALIEHAAVAEAAVVGV
                     ADELTGQAVNAFVSIKDGNEPSDALRKEFILQVRRSIGPFAAPKAVYIVPDLPKTRSG
                     KIMRRILRKILAGEEDQLGDITTLSDPSVVEKIINAVHEAKKK"
     gene            2121712..2124486
                     /locus_tag="MYCTH_2312247"
                     /db_xref="GeneID:11509302"
     mRNA            join(2121712..2121976,2122063..2124486)
                     /locus_tag="MYCTH_2312247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666937.1"
                     /db_xref="GeneID:11509302"
     CDS             join(2121910..2121976,2122063..2124470)
                     /locus_tag="MYCTH_2312247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666985.1"
                     /db_xref="GeneID:11509302"
                     /db_xref="InterPro:IPR001590"
                     /db_xref="InterPro:IPR001762"
                     /db_xref="InterPro:IPR006586"
                     /db_xref="JGIDB:Spoth2_2312247"
                     /translation="MILSKAFAAVVTAAGLLVQDAIAHSVKRNPLSSVSRIDHAVIHT
                     PSHRVHAHSSFDVSFTLSTTQQRVRLALEPNHDLFGEDATIQYLGADGTLRRSKPIDR
                     RDHRVFKGDSFVQREGRADWKHVGWCRIHVHRDGVKPIFDGVFTIDGNHHHVQTKTNY
                     HLSTVSGDPVIEDGDDEYMVVWRDTDVQATAGDELRRDLAGAATCGSDTLRHNSRENN
                     NVYRSLEEATQDTSVWQMSPRALFGRQVDTTPGGNGAGVNLQNSIGSTAGCPTTRKVA
                     LVGIATDCTYTSLFKTDDAVTKNIVQVVNAASQLYESTFNISLAIQNLTISDPGCPST
                     PPQAAPWNRPCSDSATVDTRLSLFSQWRGQWKDTNAYWTLMSTCSTGPTVGLAWLGAV
                     CQEGSSTKDNETSASANVVVHTSTEWLVFAHETGHTFGAVHDCDSRTCSDGSVEKQEC
                     CPLSTDTCDADAQFVMNPSTGNGITKFSPCSIGNICSFLGRAPNRFNCLSSNRGVTSF
                     TGAQCGNGIVEHGEECDCGGEEGCVGNPCCDPKTCKYTEGSVCDPNNEECCTPQCGFM
                     SNGTVCRASTGACDPEEVCSGTSAGCPADVSAPDGQSCGDGLQCASGRCTSRDQQCAT
                     FMGSDAVTSCSRSGCVLSCHSPQLGPNQCYLLNQYFLDGTSCQGGGKCRNGDCVDTSL
                     SQTILEWIQDNKQIAIPVISIGGGLILLALLSCVWSFCARCSRRRRSRSNKLAAMSPP
                     RGPWGGGNPYRGARGVLRGSGAGGVRGGQSPPMRPGPAYAPVPSPPPMDGLGSAPPPP
                     YPHQHQQQPQQDMRWEPMRSRSFRYA"
     gene            complement(2125316..2126609)
                     /locus_tag="MYCTH_2312248"
                     /db_xref="GeneID:11509303"
     mRNA            complement(2125316..2126609)
                     /locus_tag="MYCTH_2312248"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666938.1"
                     /db_xref="GeneID:11509303"
     CDS             complement(2125321..2126388)
                     /locus_tag="MYCTH_2312248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666986.1"
                     /db_xref="GeneID:11509303"
                     /db_xref="JGIDB:Spoth2_2312248"
                     /translation="MCLPSLGSMLISIQGPDVELRHTRTSLSYTWRGMRIMHSMNPTI
                     VHIGDGVNDVFHVGDEPENGHAVGNGAWIQPTYNLTVERRDVGGIAGLLRAVRNVFRA
                     AMQRVRQLGAAAVERCLDLRRNLAALSPGGWCILLFLNIFLVPLALTGVTILFWLAIV
                     WLVLYGVYEVTDRVAYLTARLLDGPVETAIAIIWNMARSGQAYLIREVASAEPQPAPS
                     SPAQQPPDRRPQDQQPHQQLSGQQSPGMQPEQQGSGQHILGQHIPSQQQAPGQQPLDQ
                     QALDQHAPDQQASGQQTPGQRLLDRQAADQQAPNQQAPNQQALNQQAPVQQSVRQQAV
                     EEGPTEQQAPVQQPDGQRAQG"
     gene            complement(2126611..2127038)
                     /locus_tag="MYCTH_2312249"
                     /db_xref="GeneID:11509304"
     mRNA            complement(2126611..2127038)
                     /locus_tag="MYCTH_2312249"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666939.1"
                     /db_xref="GeneID:11509304"
     CDS             complement(2126842..2127015)
                     /locus_tag="MYCTH_2312249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666987.1"
                     /db_xref="GeneID:11509304"
                     /db_xref="JGIDB:Spoth2_2312249"
                     /translation="MNPSTASSFMDDDFTPEMRDRQARGKDPYQSGDGSDGGSLSDRE
                     SGSGTRLRLGSGR"
     gene            complement(2127483..2128645)
                     /locus_tag="MYCTH_2312251"
                     /db_xref="GeneID:11509305"
     mRNA            complement(join(2127483..2127788,2127980..2128645))
                     /locus_tag="MYCTH_2312251"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666940.1"
                     /db_xref="GeneID:11509305"
     CDS             complement(join(2127532..2127788,2127980..2128250))
                     /locus_tag="MYCTH_2312251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666988.1"
                     /db_xref="GeneID:11509305"
                     /db_xref="JGIDB:Spoth2_2312251"
                     /translation="MSDQDYMAFLDKANEDPSKGVTSAAAAGGAATNRGAKTEFRATQ
                     EGVEVPAPIARVCGKGDVSFYASDADEPFEAVALRWDEGGKGLPDEEEFATLIEHWDP
                     KNAEVQIMDPVDWDRNGQYGEIVDAVREAGEGNDVRVYRVARDGVRAEYWVVTTQGKG
                     EEAKLVGAKALAVES"
     gene            complement(2128910..2130660)
                     /locus_tag="MYCTH_2312253"
                     /db_xref="GeneID:11509306"
     mRNA            complement(join(2128910..2129179,2129238..2129887,
                     2129947..2129970,2130029..2130185,2130280..2130358,
                     2130522..2130660))
                     /locus_tag="MYCTH_2312253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666941.1"
                     /db_xref="GeneID:11509306"
     CDS             complement(join(2128927..2129179,2129238..2129887,
                     2129947..2129970,2130029..2130185,2130280..2130358,
                     2130522..2130534))
                     /locus_tag="MYCTH_2312253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666989.1"
                     /db_xref="GeneID:11509306"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="JGIDB:Spoth2_2312253"
                     /translation="MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDPKKPVHLT
                     AAMGYKAGMTTIVRDLDRPGAKAHKKEVVEAVTIIDTPPMVVVGLVGYIETPRGLRSL
                     TTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKHSENNGAAITRELERIKKYCTVVR
                     VLAHTQIRKTPLKQKKAHLMEIQINGGTVAEKVDFGHGLFEKPVSIDTIFEKDEIIDV
                     IAVTKGHGFTGVTARWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHR
                     TSVNHKIYRIGKGDADDNAATDVDVTKKKITPMGGFVRYGEVNNDYVMVKGSVPGVKK
                     RVMTLRKSLFVHTSRKALEKVELKWIDTSSEFGHGAFQTPAEKKQYQGTLKKDLVAA"
     gene            complement(<2131372..>2134404)
                     /locus_tag="MYCTH_2071423"
                     /db_xref="GeneID:11509307"
     mRNA            complement(join(<2131372..2132895,2132951..2133195,
                     2133263..2133419,2133474..2133566,2133629..2133808,
                     2133873..2133955,2134006..2134209,2134284..>2134404))
                     /locus_tag="MYCTH_2071423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666942.1"
                     /db_xref="GeneID:11509307"
     CDS             complement(join(2131372..2132895,2132951..2133195,
                     2133263..2133419,2133474..2133566,2133629..2133808,
                     2133873..2133955,2134006..2134209,2134284..2134404))
                     /locus_tag="MYCTH_2071423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666990.1"
                     /db_xref="GeneID:11509307"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Spoth2_2071423"
                     /translation="MQMQMHHGPPGPARAPVPQQSFSSSRQTLLQQTEAVWIQLGNLA
                     EQMGNLDDAMASYERALRTNPNSIPAMSAMSSVLRTREDFPKAAEYLNAILKLDERNG
                     EAWGCLGHCYLMMDDLQQAYNAYQTALVHLPNPKEPRLWYGIGILYDRYGSLDHAEDA
                     FAQVMKMQPDFDKAHEIYFRLGIIYKQQQKYNESLECFKYIVNSPPPPLTEEDIWFQI
                     GHVHEQQKDFENAKIAYHKVLERDPNHAKVLQQLGWLHHTQSQHYDSQERAIEYLEKS
                     VAADNSDAQSWYLLGRCYMQMQKYPKAYEAYQQAVYRDGRNPTFWCSIGVLYYQINQY
                     RDALDAYSRAIRLNPYISEVWYDLGTLYESCNNQIADALDAYQRAADLDPTNPHIKTR
                     LQLLRSGQTGGAAPGPTDVHPQAYQAPGAVGPPGPQWAGSGSGAPQAPPPQPQQPMLN
                     GSAQGPAGPNSWSGRISDINPPPQPRNPYASERELFRGQAGPGQRPPSPQPEQQMRPY
                     QDANRMPEQLRRGPSPPPPGHYAAPPPPPPPQQTQQPPQGSQPPRVRNPNYGGHTPVA
                     VLQPSSGPSPSGAASNPLMPYRAGSPRNDGRQPMHENRMPSPKSAYPQHPPYQAHPDQ
                     AGPHGPEPGAPVPPQPGMASDGPHHREHDHRPPSVGPKRMREWEDEREAKKPSTEESR
                     ARMEDIRHRRPSTSPRVEPYRRNSSEARRFDERRMEDARRAEEQRRVDEMRRADEQRH
                     NNEAYHPSEAAHHPPTHSTAGHLPPMQQGPSAMQGLMHEGPGAQAGPAKKEYQSGPEE
                     RRLEHPPAASSIVGEPERAARAMEVDENYDDSGEEDKKTGIVPGPSSSSGATATAEVK
                     NGPSATANMNGN"
     gene            complement(<2138973..>2139260)
                     /locus_tag="MYCTH_2130919"
                     /db_xref="GeneID:11509308"
     mRNA            complement(join(<2138973..2139069,2139142..>2139260))
                     /locus_tag="MYCTH_2130919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666943.1"
                     /db_xref="GeneID:11509308"
     CDS             complement(join(2138973..2139069,2139142..2139260))
                     /locus_tag="MYCTH_2130919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666991.1"
                     /db_xref="GeneID:11509308"
                     /db_xref="JGIDB:Spoth2_2130919"
                     /translation="MALDSDPGSVSLSLPPPPPPPRCAFLLAQPARPGRVRGHALKSL
                     QATLGGRLHNEATVAEQEAEWDTGYVG"
     gene            complement(2140606..2142109)
                     /locus_tag="MYCTH_2312260"
                     /db_xref="GeneID:11509309"
     mRNA            complement(join(2140606..2141528,2141604..2142109))
                     /locus_tag="MYCTH_2312260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666944.1"
                     /db_xref="GeneID:11509309"
     CDS             complement(join(2140763..2141528,2141604..2141980))
                     /locus_tag="MYCTH_2312260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666992.1"
                     /db_xref="GeneID:11509309"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="JGIDB:Spoth2_2312260"
                     /translation="MPPRINIPPVTRITLIVLGVQSVLSAAIRYRQWTATSEIVIPYL
                     NLIPQLSLAYPWTFLTTTFVESNVFTLSIACTTLYNGGRYLERAWSSREFAKFLLITS
                     VVPNALCFGTLILFYALTRNERWTLMTIAGTIPLQISFLVAFSQLVPAHTVTLFRGLL
                     SLRVPRFPLLYISLVTLLCLTPMLTAASFFLAVYGFLVSWTYLRFFKVAFPDLDTSQP
                     SSLRGDASETFAIAAFFPGPVRPLVASISTQVFNVLVAMRLCVPFSAADISAARGDHH
                     HHHSFSHRGAPGSARAEAERRRALALRALDQRLHAATAHAAARAQSAPVPPAVAPPVP
                     SATGPTVKSQPQAPPPNAMTAQAAPGSGMLGETNYNPDADADRNGP"
     gene            2144491..2147820
                     /locus_tag="MYCTH_84911"
                     /db_xref="GeneID:11509310"
     mRNA            join(2144491..2144662,2144767..2144783,2144889..2145052,
                     2145239..2146369,2146438..2146866,2146919..2147820)
                     /locus_tag="MYCTH_84911"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666945.1"
                     /db_xref="GeneID:11509310"
     CDS             join(2144616..2144662,2144767..2144783,2144889..2145052,
                     2145239..2146369,2146438..2146866,2146919..2146954)
                     /locus_tag="MYCTH_84911"
                     /note="Contains conserved domain: WD40 domain, found in a
                     number of eukaryotic proteins that cover a wide variety of
                     functions including adaptor/regulatory modules in signal
                     transduction, pre-mRNA processing and cytoskeleton
                     assembly. 7 copies of the repeat are present"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666993.1"
                     /db_xref="GeneID:11509310"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="JGIDB:Spoth2_84911"
                     /translation="MKELLDTDRVNFLVWRYLLESNYRETAAKLQKEWRVHQPHRQFD
                     FAAHVNTYALVSLLNKGLIYEDYQRKFAAAQEAARDVPAAAQEPPRGVFGPLKFQPEV
                     VDENGEDDEESEPEPEAEEIENPRKRAVERQHHRELSHGSPAKRQRLSNGYENGADSA
                     TTPMEIDQPAENNHAYPSPLEGEQAESPLLRTEGPSRGTQVEKVRDLTQDTVFLRLSP
                     GECPDGSENPIVLLCEWNPRDPTLLATAGTDALARIWTLPCGSAPDADPGHVDPAGRP
                     FLSIVEDDLPKNAAVSAMAWSSNGELIALGTELGSKSRVSVCSADGTSLQRFDGLDTP
                     ITNLCWSPNSNFLLAISPDVSKGVDNAGTLIHISSPSMVNSLSHVLDHDLRSDSLDAT
                     WISETEFLLCGGNLLVSFRCTEQGIVQGREFQTGKDERFSLVEFDWRSNLVATASDKG
                     YIDIWDESGKRRSIPAHDGGVTSLKWQPLQGEPAEDERLLVSGGEDGAILIWNVRSAE
                     NKPKYSITMPPPLAVNNLSMSPDGALIAVATHDRILVWKIGDHMLPKASWVPQSGWQS
                     PSSGSDTEDAIPCLGWDCEGKRLVYGLENRLAVISVREHER"
     gene            complement(2148332..2150541)
                     /locus_tag="MYCTH_2312265"
                     /db_xref="GeneID:11509311"
     mRNA            complement(join(2148332..2149966,2150060..2150541))
                     /locus_tag="MYCTH_2312265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666946.1"
                     /db_xref="GeneID:11509311"
     CDS             complement(join(2148472..2149966,2150060..2150445))
                     /locus_tag="MYCTH_2312265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666994.1"
                     /db_xref="GeneID:11509311"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2312265"
                     /translation="MTLGDIDRAIEAAELDASGRRSEEIERVVSASSVSSSSSSGASR
                     PGMSRVETQRDLERDPTELSRIQTARSQHSGTVGRAKSKEWKKPLPNFGAGKPYPPLL
                     PNQEDYVVEFDGPDDPLHAQNWPLKKKLATAAMLGFTTMTAAFGSSIFSTATRAVGVE
                     FGVSPEVSLLGVSLYVLGFATGPTFWAPLSELKGRRLPLVISMFGFSIFNTANAVAKD
                     LQTVLITRFFAGFFGASPLAVVAAVFSDMFDNRTRGIAITVFSMTVFTGPLLAPFIGG
                     FITESHLGWRWTSWIVSFMGWLAFVLDLVFLRETYPPVILIDKAAELRRRTLNWGIHA
                     KQEEIEVDLRELITKNFSRPMRLLFTEPIVTLLSVYMAFIYGLLYLFLTAYPFVFQGV
                     HGMKPGVAGLTFFGMILGQIVAGITIVLQQPWYQRKLAANRGVPVPEWRLPSVIAGGV
                     AFAAGLFWFGWSGYRRDIHWIVPTLSGLLSGFGLASIFLQALNYLVDAYLMFAASAIA
                     GNTFLRSLAGAGFPLFSTYMFDGMGIQWASTLLGCVAAALVPIPIIFYLYGPKIRAKS
                     AFAPTFPATMPPEEAAAATPAAPGTPSEEERANTPDEKEILEGSANANLPKLDKDARS
                     AV"
     gene            complement(2151835..2153373)
                     /locus_tag="MYCTH_2312267"
                     /db_xref="GeneID:11509312"
     mRNA            complement(2151835..2153373)
                     /locus_tag="MYCTH_2312267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666947.1"
                     /db_xref="GeneID:11509312"
     CDS             complement(2152177..2152779)
                     /locus_tag="MYCTH_2312267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666995.1"
                     /db_xref="GeneID:11509312"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Spoth2_2312267"
                     /translation="MYFSATIFTMLGFPIPTLTSLVVAVTNFIFTLAALFLIDRIGRR
                     RILLWSVPVMAAGLLLAAWGFSFIDIAATDAADDAPSQPPPARGAAVTILISFMMYVA
                     GYAMGLGNVPWMQSELFALNVRSLGSGIATATNWGANFVIGLTFLLLMEALTPSWTFV
                     LYAAICAVGTGLIWKFYPETAGLSLEEAASLLEDDNWGVR"
     gene            2154370..2156058
                     /locus_tag="MYCTH_2312270"
                     /db_xref="GeneID:11509313"
     mRNA            join(2154370..2154467,2154611..2155084,2155198..2156058)
                     /locus_tag="MYCTH_2312270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666948.1"
                     /db_xref="GeneID:11509313"
     CDS             join(2154617..2155084,2155198..2155827)
                     /locus_tag="MYCTH_2312270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666996.1"
                     /db_xref="GeneID:11509313"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Spoth2_2312270"
                     /translation="MPPTAPPPQRDSWFAPLTIDLIVKVLKTSFFHPFVAWIIPLCFR
                     AQNMFWDAPPMLVSIAWASFITLCWIAGVINNRIAFGLPREVDLSEEVIVITGGASGL
                     GLLLAEVYGMRGATVAVLDVAEMENGEARGVTYYKCDVTDKDQVARVAAEIERDLGTP
                     TILINNAAVVVGKPLLEMSFAEIEKSLSTNLLSHFYTLKTFLPAMACNEAGGTVVTLS
                     SVIGTVGAAQLTDYAAAKAGVSALHRSLAAELRRSHPRIRTVLVTPGQLSTPLFHGVR
                     TPNRFLAPVVEPVDVAKEVIAAIDSGRSAAIAIPLYARWIDWYSVLPAGLQAIARRLA
                     GVDTAMQTFVGRAGSGGERKEGKGDVLIQAF"
     gene            2156816..2158819
                     /locus_tag="MYCTH_2312273"
                     /db_xref="GeneID:11509314"
     mRNA            2156816..2158819
                     /locus_tag="MYCTH_2312273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666949.1"
                     /db_xref="GeneID:11509314"
     CDS             2157126..2158808
                     /locus_tag="MYCTH_2312273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666997.1"
                     /db_xref="GeneID:11509314"
                     /db_xref="JGIDB:Spoth2_2312273"
                     /translation="MWWDDETIERIVTKQFVANKLGSKAAGRLDQPLGFGENLTDCTY
                     WDWIEAKSKKTFLILSELGLPNHIFELVDDSLDDQDLPFAIDQVARLRLSPSKNDKLE
                     RKFYHRQFHYLLRYVDHGVHIDYADDEVVPLDAVDKKHAAGQGHHVDKVTSSNRPGMV
                     FCRCQISLGPGHVSMEELMSEINGIKAVQNEHLLSYWASYTHRGYGYILFTPASEYSL
                     KSLLTTMPSCLKRLDKKARRRAVMNWIYCLADTVCFFHNQGLSHGNIRPSTVNFSKDN
                     LAFFTGFTPFHIHVLGGVEDNKVFDREAYDYGAPEKVRYLPSSSSSDSIHRATDGRDH
                     QPAGFDPQAADVYSLGCIILELLSFLFKRQGRPFAAHRAAKHRAVGRGSPFPDSSFHE
                     NVEQVESWMTQLATDAVEKDDPVFEGVEPILCLVVKMLAFYPSERPKACEVKEEIGQI
                     LMGSCGMPEPHCLCRSGHWSFGNGSLRHSSSSMQSTASAGTGPVSTQRRSGSQEEGSS
                     KRASAGSGSSVSLRSIKTFLREPGDGEAALRPRNWSQGSQASVQEKRSRASR"
     gene            2160467..2161565
                     /locus_tag="MYCTH_2312275"
                     /db_xref="GeneID:11509315"
     mRNA            join(2160467..2160701,2160804..2160910,2160998..2161565)
                     /locus_tag="MYCTH_2312275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666950.1"
                     /db_xref="GeneID:11509315"
     CDS             join(2160596..2160701,2160804..2160910,2160998..2161333)
                     /locus_tag="MYCTH_2312275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666998.1"
                     /db_xref="GeneID:11509315"
                     /db_xref="JGIDB:Spoth2_2312275"
                     /translation="MKVSWLVPSLLAGGGAAIGTVSDKVLNSEGRVLANGIPDQRHDR
                     DLEGAALQSPSANTVAVNLDALDIALPNRTKAQLAVQARDASELGQHPDEGEPPVITF
                     RTSNGALSGAEGDPAVRPPSSASSASSASLDSDHDLEFDEDSASASNGAGKAGNPASA
                     NRAIAGMSVGLVSVMLIFTIFL"
     gene            complement(2162348..2164456)
                     /locus_tag="MYCTH_2312280"
                     /db_xref="GeneID:11509316"
     mRNA            complement(join(2162348..2162656,2162736..2162867,
                     2162923..2163050,2163108..2163197,2163251..2163615,
                     2163678..2163781,2163842..2163917,2163970..2163996,
                     2164053..2164165,2164289..2164456))
                     /locus_tag="MYCTH_2312280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666951.1"
                     /db_xref="GeneID:11509316"
     CDS             complement(join(2162357..2162656,2162736..2162867,
                     2162923..2163050,2163108..2163197,2163251..2163615,
                     2163678..2163781,2163842..2163917,2163970..2163996,
                     2164053..2164165,2164289..2164294))
                     /locus_tag="MYCTH_2312280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003666999.1"
                     /db_xref="GeneID:11509316"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="JGIDB:Spoth2_2312280"
                     /translation="MKIKALSRSITAQQAPGSDVQRAPRNLAPEIHPFERAREYQRAL
                     NAVKLERLFAKPFLGQLGNGHVQGVYSMCKDKNSLNSVASGSGDGVIKVWDLTTRDEE
                     VWRTAAHSNIVKGLTFTNDKKLLSCATDGIKLWDPYNTPSNTTPFATWQEGGPYTSLS
                     VHRTGNVFAASSGAGCIRVWDLDQSTAAQTIQWPNFTDTITDVCFNQVETAVVASVAT
                     DRSLILFDLRTNLPVIKTILQFAANRVVFNPMEAMNLAVASEDHNVYIFDARNFDRAQ
                     NILKGHVAAVMDVEFSPTGEELVSGSYDRTIRVWRRDHGHSRDIYHTKRMQRVFRTMW
                     TMDSKYLLSGSDDGNVRLWRANASERSGVKSTKQRQALEYNSALLERYSHMPEIRRIR
                     RHRHLPKVVKKASEIKREELAAIKRREENERKHSNKKFEKRKSEREKAIIAKQQ"
     gene            2164633..2166363
                     /locus_tag="MYCTH_2312284"
                     /db_xref="GeneID:11509317"
     mRNA            join(2164633..2165072,2165142..2165224,2165349..2166363)
                     /locus_tag="MYCTH_2312284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666952.1"
                     /db_xref="GeneID:11509317"
     CDS             join(2164891..2165072,2165142..2165224,2165349..2166355)
                     /locus_tag="MYCTH_2312284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667000.1"
                     /db_xref="GeneID:11509317"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Spoth2_2312284"
                     /translation="MAQGDSERVREAQKLAKSDPAQAEAIYKDIISKPPSVTSEAAIK
                     EYEVALVSLGELYRDQKNTDELAALVTKSRTVLSSFAKAKTAKLIRQLLDFFEAIPNS
                     LDIQIAVTKSCIEWATSERRSFLRQNLETRLVTLYMAKQSYYDALTLINGLLRELKRM
                     DDKLVLVEVQLLESRVYHALGNIAKARAALTSARTSAASVYTPPLLQANLDMQSGMLH
                     AEDKDFQTAYSYFIEALDGYHSQDEPARAQAALQYMLLCKIMLNLVDDVNQLMTSKQA
                     LKYAGKSLEAMKAIARAHANRSLEEYERALAAYKYELGSDAFIRNHLRRLYDAMLEQN
                     LIKVIEPFSRVEIDHIAKMVGLDTQQVERKLSQMILDKVIIGVLDQGAGCLIIYDETQ
                     RDEAYDAALATIEKLSNVVDVLYTNQASMLE"
     gene            complement(<2167009..>2172537)
                     /locus_tag="MYCTH_2130929"
                     /db_xref="GeneID:11509318"
     mRNA            complement(join(<2167009..2169944,2169997..2172385,
                     2172499..>2172537))
                     /locus_tag="MYCTH_2130929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666953.1"
                     /db_xref="GeneID:11509318"
     CDS             complement(join(2167009..2169944,2169997..2172385,
                     2172499..2172537))
                     /locus_tag="MYCTH_2130929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667001.1"
                     /db_xref="GeneID:11509318"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_2130929"
                     /translation="MVWIAASHREFALLTGTAAVSWPIRVVNVDPRLFGDSDIDIDID
                     SDGDSDSDGDDDSDNPSASRGLAAMEEERTITLDLGSSPDPLIDPVLSPPMMPPSAIK
                     KKTQAAERLVTAFAPPSPRKQTFELDVGDERTPQRLLVTVEAESGGPRSTTRRLFQSP
                     TPKQRRLTPRREPKTMVTTTTVPLRGLSDDEGVTPRRRGRPRKSGTPTTTRRKRPGTP
                     AKVLRKSTGRASASPEKVVSTLDTGIETTPRPGAQRATKRKATSPAKEDNGGAPGSQP
                     RKRGRPRKQTSTADDLARLGQDIFREPGDNSDAPTAPAQSQPASDMQNDDGYGDDDDI
                     WLATLSDQPTPLPLPLPPARQQEPARDRSSEIPVGDRSAEPEPQLSRREPEPEPEPEP
                     EPQQEPQRYQYDWPDLGGGGADSYSEAGSFASDQDDDREGFEDTVMAEEFTMISIRSL
                     PSMQPNSSVVAPANEELGEATSLIINGALESLRQSRNRSAEEQQPRAEPTNPAPAPAP
                     ALAPALIQAQRSGGAETAESPVQQYQPRRDAQQQQQQQQQQQPPSSPQPVRRSPRRTT
                     AQPLARQLTLKSREQAARQSPAPAPAPAPAPDQHPTTAPRAPAPRRSPVDNEPRDAGA
                     YEDSFSEIPEAVLAAATPRRPYRQQQQPAPAPAPADEQAQDIQPSIERPSRVNHSNPQ
                     SETNRLLTPDETPSPIPSDAETREPQQHEQQQQQQQQQQQQRQQQPPNPTGASSADAD
                     LPSSPPIESPVLSHAVEQLIRRNSTETPADQLSSFASSNAPARDPNPLHLPAPEQPQR
                     RPTLSPIVRAGPSWGSPFRGSVSKSSQSPAPVVAPVAVAAAAAAAAPAAEQGSESASR
                     PRDDAAAASPSASPSRRWLAPVQHVRDLIVRSARSLSPARVSVSGTDHMDDPFGPDPG
                     ELAGSGSQRTTLFSGPGKQANGRKAAAAAAAGGSSSPSASPAPDEDRMSWLAEGSPAG
                     GGGGGSPRPASRDLSSTVAASASSSGPAGEQGDWPRFATSEVSPRPRPVSDRQPSLFE
                     REQQDPEKQKEQEVEEGEGEGEEEEDIWAIEAQRPTPYAPRYGLARQESQPDPPLRGK
                     MPSPWGQNSRRPLVNNRESERNPVSQRASGWAPPTNEEEEEPSLVAQNRRERVPRFRA
                     QRNATSGEGDEEEFSLLSQNRQKQTPAPTAKQAQAKKPDLLDFFSSPAVLPDLGQGSP
                     GVGSSMAPGPARDQQANPVAQPPTIPPQRPRPSGNSLFAQYIQQQSQTQTRLPSVAQK
                     KQQLEIGTRHRSVDLFSPARESVERSSPQQAPASTARSSSPRSLEGSAPARVPEPASY
                     ASGSLPAESARRSDASVPRTASPESPAETGFGHIPQKMNFTPRRRGESNNSLFQPKPV
                     APASSLFGNSQVAAFFSRSSSRPQPQRPPARSWEEEREDDNNRDDSNDEDENENENED
                     SEGEPRSALPASKLQPHRAASPTKSCIRSPLKPKTPGRVVEFTSSTLSPLAQAQARAE
                     RRASTSPDKENNPPPKVPRGIAGAAPEGNNNTTQSSPPSPSPSPSLSPSPSSSPSPSP
                     SPSPSPSPSPRRSYSTTNFSSATTASHQKEAPPISTRQSSTSAAATIATTTTTTTTTT
                     TTTTTMTPPLEPLSRTTTWSRAHWLRLDELLQARKRGPLELQRQLARHHHRDRRHRPP
                     RSSFSFSFSSTNRGGDDGDSTWRQRLLGKQVTAQGERMEIEGWHLDVVEGFLAEVRSG
                     GGRGDGAAGDAAGDAAGDAAGAAAAGGDGWDEAQIVKRVFALLVGEERRRLGLVPPRR
                     GEK"
     gene            2173192..2174606
                     /locus_tag="MYCTH_2312287"
                     /db_xref="GeneID:11509319"
     mRNA            join(2173192..2173734,2173861..2174112,2174229..2174606)
                     /locus_tag="MYCTH_2312287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666954.1"
                     /db_xref="GeneID:11509319"
     CDS             join(2173386..2173734,2173861..2174112,2174229..2174488)
                     /locus_tag="MYCTH_2312287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667002.1"
                     /db_xref="GeneID:11509319"
                     /db_xref="JGIDB:Spoth2_2312287"
                     /translation="MAISYEPPRGDVVAALNFYSPPEDGSAPYNLAGDHPPGLPLRNF
                     GSVAHDVLIRDIRGKESSFNLDNDAFQIIQNLPPSAEPSFTDDESIQKNYYPEVERLL
                     LDTVPGAFKVVIFDHTIRRPNGKRQPVPRVHIDQTARSVAQRVRRHASSPEEAEHLLS
                     SSRYRIINVWRPLNKGPVESNPLAFASSSTLRDEDVVPVEHRYPAEVGYVGQTAAIRY
                     HPDQKWYYLSGMTGDERILLECFDSEGLKEGSAVKGGRVAHTAFDDPRTREGAEGRES
                     IEVRALVFGS"
     gene            complement(<2174898..2176909)
                     /locus_tag="MYCTH_84896"
                     /db_xref="GeneID:11509320"
     mRNA            complement(join(<2174898..2176160,2176235..2176909))
                     /locus_tag="MYCTH_84896"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666955.1"
                     /db_xref="GeneID:11509320"
     CDS             complement(join(2174898..2176160,2176235..2176636))
                     /locus_tag="MYCTH_84896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667003.1"
                     /db_xref="GeneID:11509320"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="JGIDB:Spoth2_84896"
                     /translation="MATTEATMSDATTRRVNGSPPPAQSKRDKRRQMLADRLASLSDR
                     FNKDRDQAFREQLHKIQIDTALVMRVDPYVDRPLDSFEQDQQRLAQLNGDGDNQSGPQ
                     TLLDRAGPRFSKWMEKVQDLIEQRDYALTKYKFDYEKKTSEYLTTHAFKIETANREYK
                     ALSQTLRDRLINVIMSKKSRLNKEKEALEISDASALLLHPNQFSINNPASPGGAHGKR
                     ATRQRREMEDMTFDKKRKRMNNDDDGSPAPQRRLLDTSSTTPLWQTDRLASRKATGTV
                     YSIDKLFTDKELGMTSTAATLAARKYILTHKPKIDEQGRPIKSGDGSDSGAGDNDDDG
                     SDSVPSAPMMERNVSHATRSGRGGANNPNFVDDKLMGMEMLANFDFQGNFDRMLAADP
                     KLPPTFPSTYIKGNKMEYNVPSTLNPEDAQSDIMVMQALRQYEELHGVGSNFSVENGS
                     RKLLEAASMPAQDARFVAYLQGERPSENQVRKQLGLPILSDVVEPVMSERAGTPKPGH
                     GGTPGASPAKGSALGGGVPMSRQSSANGVPMSRSSSRKGGRGGRGG"
     gene            <2177637..>2178266
                     /locus_tag="MYCTH_57908"
                     /db_xref="GeneID:11509321"
     mRNA            join(<2177637..2177730,2177814..2177882,2177950..>2178266)
                     /locus_tag="MYCTH_57908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666956.1"
                     /db_xref="GeneID:11509321"
     CDS             join(2177637..2177730,2177814..2177882,2177950..2178266)
                     /locus_tag="MYCTH_57908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667004.1"
                     /db_xref="GeneID:11509321"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Spoth2_57908"
                     /translation="MPPVLGRPPPPLQQLPAQMFTTAAQLLDLTDKKLMVALRDGRKL
                     LGILRSWDQFANLVLQSTKERIFVAPGTVPNQPRGLYADIDRGLFLVRGENVLLLGEI
                     DLDKEDDPPAGYDLADAELVQNLAKQRKQQDKAKEKKKVKMLAREGFEGENLGEILL"
     gene            complement(2178604..2181296)
                     /locus_tag="MYCTH_2312293"
                     /db_xref="GeneID:11509322"
     mRNA            complement(join(2178604..2178779,2178871..2180680,
                     2180734..2181296))
                     /locus_tag="MYCTH_2312293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666957.1"
                     /db_xref="GeneID:11509322"
     CDS             complement(join(2178725..2178779,2178871..2180680,
                     2180734..2180995))
                     /locus_tag="MYCTH_2312293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667005.1"
                     /db_xref="GeneID:11509322"
                     /db_xref="JGIDB:Spoth2_2312293"
                     /translation="MRAVSLLLVLSSFAEAVSVGQRRKVVQSCNVHRDKSSDTTPLQV
                     GNGNFAFGADVTGLQTFKPYAIMSTWGWHNFSLPTTPGQTSVDDFTGVQLWTHGRLVT
                     YEIPNPAQNDISNWLRENPHRLNLARVGFDFGCDNVTEDQLQHRFQELDIWTGKLSSY
                     FAYNGHPVRVETWADPDSDTVAVSINSNLLRKGLGLFFDFPYPDNEKFNAPFVGHFNL
                     TSRHSTVLERLSRRSARIRHTLQNTTYYTHVSWSGHGTVTGPAEGSHRYLFTSPQTNI
                     QLTITFAPSATNPHPTSYRRVTSASRSWCGTFWTTGAFIDLTSVRDDPRARALQQRIF
                     LSQYLTAVNSASAYPPQESGLVNNGWYGKFHLEMTLWHALPFARWNRFPLLWRSIPDT
                     YTRLLPSVRARARMQGYAGARWGKMMAPLSAAPGGPSAPGDINALLIWQQPHPLYFAE
                     TEWRAFPNRTTLERWDEVITATADFMASYAWWNATTGVYDLGPPMYPVSENTDANGTR
                     NPTFELAYWRFGLDVAARWKERQGKPAPREWVRVRDGLAPLPMVDGTYAVYEGIEGMW
                     TSNATTNDHPAMAGIYGLLPPPASGEPLDMDALKKTAGKIKELWALDYSYGWDFSMLA
                     MNSLRLGDPDQAVEYLLHPIFQFDDAGYPVGGSRVPTPYFPNSASLLIATAMMAGGWD
                     GSEGITGHWPKSWENHVRVEGFTPAL"
     gene            2182426..2183948
                     /locus_tag="MYCTH_2312297"
                     /db_xref="GeneID:11509323"
     mRNA            join(2182426..2182822,2183023..2183189,2183252..2183345,
                     2183395..2183528,2183591..2183948)
                     /locus_tag="MYCTH_2312297"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666958.1"
                     /db_xref="GeneID:11509323"
     CDS             join(2182800..2182822,2183023..2183189,2183252..2183345,
                     2183395..2183528,2183591..2183832)
                     /locus_tag="MYCTH_2312297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667006.1"
                     /db_xref="GeneID:11509323"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="JGIDB:Spoth2_2312297"
                     /translation="MSSFLTTVNNRTRNQVRPRAPGKGGATSYQLRQYAEATLGGGSL
                     RKVVKLPEGEDENEWLAVNMVDFYNQINLLYGAITEFCSPQTCPEMKATDEFEYLWQD
                     SENYKRPTKMPAPAYIEQLMSWVQSNIDNEAVLPSRIGVPFPKSFPSLMRQIFKRMYR
                     VYAHIYCHHYPVIRELGLEPHLNTSFKQYVLFIDEHNLASGKDYWGPLGDLVDSMLRS
                     D"
     gene            <2184362..>2185350
                     /locus_tag="MYCTH_57224"
                     /db_xref="GeneID:11509324"
     mRNA            join(<2184362..2184520,2184708..2185001,2185090..2185182,
                     2185237..>2185350)
                     /locus_tag="MYCTH_57224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666959.1"
                     /db_xref="GeneID:11509324"
     CDS             join(2184362..2184520,2184708..2185001,2185090..2185182,
                     2185237..2185350)
                     /locus_tag="MYCTH_57224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667007.1"
                     /db_xref="GeneID:11509324"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="JGIDB:Spoth2_57224"
                     /translation="MFSRQALLRSARTAAPQRALLGQTRTFAAPASSEKVKPPVALFG
                     LDGTYATALTSSLEPTAKGVAALGNLIQKDSKLVTILEAPTLSAADKSAIVAELQKSA
                     GVSGETIKNFLETLAENNRLGLLPGVCNKFNELMSAARGEVEMIVTSAQPLDNKTLTR
                     LENAVSKSSYVGAGKKLKVKNNVNPDIVGGLIVEVGDRTIDLSVSSKLAKMNKLLTEA
                     L"
     gene            complement(2186017..2186087)
                     /locus_tag="MYCTH_t191"
                     /db_xref="GeneID:11509325"
     tRNA            complement(2186017..2186087)
                     /locus_tag="MYCTH_t191"
                     /product="tRNA-Gly"
                     /note="Anticodon: GCC"
                     /anticodon=(pos:complement(2186053..2186055),aa:Gly,
                     seq:gcc)
                     /db_xref="GeneID:11509325"
     gene            complement(2186371..2190260)
                     /locus_tag="MYCTH_2312307"
                     /db_xref="GeneID:11510131"
     mRNA            complement(join(2186371..2186942,2187016..2188260,
                     2188322..2188781,2188834..2189461,2189576..2189672,
                     2189734..2189851,2189912..2189950,2190013..2190260))
                     /locus_tag="MYCTH_2312307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666960.1"
                     /db_xref="GeneID:11510131"
     CDS             complement(join(2186495..2186942,2187016..2188260,
                     2188322..2188781,2188834..2189461,2189576..2189672,
                     2189734..2189851,2189912..2189950,2190013..2190136))
                     /locus_tag="MYCTH_2312307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667008.1"
                     /db_xref="GeneID:11510131"
                     /db_xref="JGIDB:Spoth2_2312307"
                     /translation="MPVFDGHEYLTEEERRLKEDRERKKYWKKWGSYLSERQWATVRE
                     DYSADGDAWSHFPHDHARSRAYRWGEDGIAGVCDTHGLQNIAFAFWNEKDPFLKERLF
                     GLSNPQGNHGESIKEAHFHLDNTPHSYMKYLYKYPQKEFPYEDLLKENARRGKQDREY
                     QILDTGVFDEDRYWDIFIETAKEDDDPDELLFRVTAWNRGPERAPLHIIPHVWFRNTW
                     SWGREPAENRPSMGVYDENLIKSKHHRLGERYVLFSPSPGVGPSGEDVQPDLLFTENE
                     TNFELLYGGKNESKYVKDAFHRYIVNREKDAVNPAQVGTKAAAWFAFNEAGGVNPGEC
                     AVVRFRFSRKAETYLDEEEFDDIIERKREEADDFYYHISPLPMSDDLRNIQRQAFAGM
                     MWCKQHYLFIWDEWAHGDPSQPPPPPGRKGIRNAAWKHLHCDDILSMPDSWEYPFFAA
                     WDTSFHCITLAMMDPDFAKKQLDLFTREWYCHPNGQLPAYEWNFGDVNPPVHAWATFR
                     VFKIERKLYGRQDLDFLERVFQKLLLNFTWWVNRKDVEGKNVFEGGFLGLDNIGLFNR
                     SEPLPTGGTLEQADSTGWMAFYCLNMLNIALELAKHRRIYEDIATKFFEHFVLISDAM
                     TFRMGQKDEKSLWNEEDGFYYDAISWGGPWIQQMPVRSLVGLIPLYATLTLEPELINK
                     LPTFKKRVEWFMANRCDVAERTMHSIRTRGKGNRILLSLVNKERLIKILERMLDEDEF
                     LSPHGIRSLSKYHKDHPYSMQVNGQVFKVGYVPGDSDSGLFGGNSNWRGPIWLCVNFL
                     LVESLQRFYLFFGQDLKVECPVGSGDYMHLGHVSEEIQHRLQHLFARDNDGRRSINGG
                     NDILDFDPHWRDYLWFYEFFDGDTGRGLGATHQCGWTGLIARMIHDTGVNCRLPQTPR
                     TPRAGLSHYFDDILHRGAYLNGPQTPMLSPTAPRLRRSSTSRSLAARSDYSVSDINLN
                     VGYDGHSDEDENGEGGGGTNSLRRGSVNPALLNDPERVKARAEADAHLHSYITQQLEK
                     VKMERLEDGYETLEGDEFETKA"
     gene            complement(2190775..2193124)
                     /locus_tag="MYCTH_2312310"
                     /db_xref="GeneID:11509326"
     mRNA            complement(join(2190775..2192191,2192292..2193124))
                     /locus_tag="MYCTH_2312310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666961.1"
                     /db_xref="GeneID:11509326"
     CDS             complement(join(2191063..2192191,2192292..2193037))
                     /locus_tag="MYCTH_2312310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667009.1"
                     /db_xref="GeneID:11509326"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Spoth2_2312310"
                     /translation="MRRAAVHAFRTSIQCSAWGLRFSTRRGLSPLLLPTATRRSAAAA
                     ASTRRFLSTSPPARSSSSTSTSNRLRAAEHAPVPGEPLRSSMSLRRASVALVSALVGY
                     GAYYSYNGNATDSLVKRAYSSSSSSSSTSTATGAAAAQTRSVLVIGADELHTGTFVGD
                     GPISKTTSDDGRRVIEMLTPEQATQMLRRNEESYYVNRGQGVVRYDVVQLPSNDPIED
                     DHAEKIVEIPDKSEAHGSSDWMFWGVFDGHSGWTTSAKLRQALVTFVARELNDTYRAA
                     NLMPSQEAVDAAIKRGFLKLDDDIVNQSVQKVLQANNKIAAAELLAPALSGSCALLSF
                     YDSRSKLLRVACTGDSRAVLGRRSASGKWVATPLSVDQTGSNPDEAARLQKQHPNEPH
                     VVRNGRVLGGLEPTRAFGDASYKWTREVSEKLRQHFFARSVSSFLKTPPYVTAEPVIS
                     TTKIEPENGDFVVMATDGLWEMLTNEEVVGLVGKWLESQQITKSDSASQFDSVWTRIF
                     GSRGTRGGLPVEAPRETDAGGGQKTPFRGARQWGGSSDKFVVQDPNAATHLVRNALGG
                     KNQEQVSALLTLPAPFSRRYRDDLTVQVIFFGNGERTGEVVVNLDATAPAKEPVEAKL
                     "
     gene            2194443..2195736
                     /locus_tag="MYCTH_2312312"
                     /db_xref="GeneID:11509327"
     mRNA            join(2194443..2194654,2194767..2195285,2195409..2195736)
                     /locus_tag="MYCTH_2312312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666962.1"
                     /db_xref="GeneID:11509327"
     CDS             join(2194541..2194654,2194767..2195285,2195409..2195546)
                     /locus_tag="MYCTH_2312312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667010.1"
                     /db_xref="GeneID:11509327"
                     /db_xref="JGIDB:Spoth2_2312312"
                     /translation="MEANTSQGSGVIPAQPGDSEAAFKRFDTYPWVRDRSFLQGLMAT
                     LGPSLLGATDGFSRQKALSTTLQARIWWYKSRFNTDVDRAAYEAYSASHPSSCPDSAI
                     LARLEEIRQRMAGEGTGAGGAPGSATSSSSSSSSSSSSSAAGANQNIPAWQLNAPKVD
                     LSKKADDGVNHSNTGDGAPYPENFQDLIEAVTTGKPIPGIKEIPDTVVRPPGVTPFGR
                     MKAPRKPWEKDVPSDTVGVGSVFGDVVDKEFPPLPSDE"
     gene            complement(2196235..2198993)
                     /locus_tag="MYCTH_2312316"
                     /db_xref="GeneID:11509328"
     mRNA            complement(join(2196235..2196389,2196502..2198406,
                     2198501..2198515,2198574..2198625,2198681..2198704,
                     2198772..2198993))
                     /locus_tag="MYCTH_2312316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666963.1"
                     /db_xref="GeneID:11509328"
     CDS             complement(join(2196272..2196389,2196502..2198406,
                     2198501..2198515,2198574..2198625,2198681..2198704,
                     2198772..2198889))
                     /locus_tag="MYCTH_2312316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667011.1"
                     /db_xref="GeneID:11509328"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR015405"
                     /db_xref="JGIDB:Spoth2_2312316"
                     /translation="MLRQTLARSAWRTGKHPARAASRTFSATTQRPAEVELTIDGKKV
                     SIEAGSALIQACEKAGVTIPRYCYHEKLMIAGNCRMCLVEVERSPKPVASCAWPVQPG
                     MVVKTNSPLTHKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMRYGADRGRFHEIG
                     GKRAVEDKNIGPLIKTSMNRCIHCTRCIRFANDIAGAPEMGSTGRGNDIQIGTYLEKN
                     LDTELSGNVIDLCPVGALTSKPYAFRARPWELKRTESIDVLDGLGSNIRVDSRGLEVM
                     RILPRLNDDVNEEWINDKTRFACDGLKTQRLTIPLVRRDGKFEPATWEQALTEIAHAY
                     QTLAPKENEFKAIAGELIEVESLVAMKDLANRLGSDNLALDMRNGSKPVAHGIDVRSN
                     YLFNSKIWGIESADCILLVGTNPRHEAAVLNARIRKQWLRSDLEIGVVGQTWDSTFEF
                     EHLGTDLNALKEALAGPFGKKLQAAKRPMIIVGSGVTEHPDAKSFYEAVGQFVDKNAA
                     NFLTDEWNGYNVLQRAASRAGAFEVGFVTPSAAVAETKPKFVWLLGADEFDEADVPKD
                     AFIVYQGHHGDRGAQIADVVLPGAAYTEKAGTYINTEGRVQMTRAATGLPGAARTDWK
                     IIRAVSEFLGVPLPYDDVAQLRDRMAEISPALAAYDVVEPVALKQLSKVQLVDQNKGA
                     KPTGEPLRKVIENFYFTDVISRSSPTMARCSAAKETGDPRTNFMAPGMEEDRPMGQVA
                     YGA"
     gene            complement(2199340..2200452)
                     /locus_tag="MYCTH_2312317"
                     /db_xref="GeneID:11509329"
     mRNA            complement(2199340..2200452)
                     /locus_tag="MYCTH_2312317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666964.1"
                     /db_xref="GeneID:11509329"
     CDS             complement(2199469..2200029)
                     /locus_tag="MYCTH_2312317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667012.1"
                     /db_xref="GeneID:11509329"
                     /db_xref="JGIDB:Spoth2_2312317"
                     /translation="MEPNASERIPQLKNIAPAIFVPLQDDIFLAEPPRDRAERLKRIL
                     ETIDYQREGVKENLLYMFEREKKRVVQQAAELEQAQGPSAIKPSLAPAEVDEIIANME
                     APGSGRIEDYMIRDVPRLDSSKPVAPNTSLRDKTVTELLAMIEAAVADLEGFERHMAG
                     IKNWYLACLEQEMARLDQAGKRPEER"
     gene            complement(2200454..2201352)
                     /locus_tag="MYCTH_2312319"
                     /db_xref="GeneID:11509330"
     mRNA            complement(join(2200454..2200686,2200768..2200878,
                     2200979..2201352))
                     /locus_tag="MYCTH_2312319"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666965.1"
                     /db_xref="GeneID:11509330"
     CDS             complement(join(2200531..2200686,2200768..2200878,
                     2200979..2201044))
                     /locus_tag="MYCTH_2312319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667013.1"
                     /db_xref="GeneID:11509330"
                     /db_xref="InterPro:IPR013097"
                     /db_xref="JGIDB:Spoth2_2312319"
                     /translation="MTVTHIVLFQFKADAKPEAVKAVVDNFLSLKDNCIHPTSKTPYI
                     LSLKCGKDNSPEGLQNGMTHGFVVEFASAEDGDYYVTTDPVHQNLVKSLGDVLEKPIV
                     LDFSDGVY"
     gene            2201752..2203654
                     /locus_tag="MYCTH_2312320"
                     /db_xref="GeneID:11509331"
     mRNA            2201752..2203654
                     /locus_tag="MYCTH_2312320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666966.1"
                     /db_xref="GeneID:11509331"
     CDS             2201871..2203112
                     /locus_tag="MYCTH_2312320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667014.1"
                     /db_xref="GeneID:11509331"
                     /db_xref="JGIDB:Spoth2_2312320"
                     /translation="MSGPLDDPVLRHKEEEDKVEMLRHRHMQEEDEQLQDGNAQNNNN
                     DVLQRTIALWESADRRQQREHDMIFMKQLQALASLFTSKRTFVALSTLTSEEDLEVWD
                     GQLRSSLAPYKLFRYLDSDVPEPDKDDIVAHAIWEADRADIYRVITASLESNILWRMI
                     RIGWNPEVVDPRATYKKVFEALQPRTINTTRLLIQEYREIEPSKFDTMDRYIDRLCVL
                     RQRLRNLGIINPPEMDIYPVLTAIKESYPELYKRNMRKMEDKSLTWNDLIKDMTKTCV
                     DRDMEKNFVNVTVGNSGNDNKKMDDRSKPPSDRKRSTYGNIKCRDCDRHFNHEVKHCS
                     GCGWHHNPKQVCWACNPEKAPDSWPKKARFLAKKNAPSSTAALHPNSGVANSTTSAAR
                     SIFHCTNFASIRPSFHSGPRI"
     gene            complement(2205103..2206495)
                     /locus_tag="MYCTH_2312321"
                     /db_xref="GeneID:11509332"
     mRNA            complement(join(2205103..2206277,2206366..2206495))
                     /locus_tag="MYCTH_2312321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666967.1"
                     /db_xref="GeneID:11509332"
     CDS             complement(join(2205373..2206277,2206366..2206381))
                     /locus_tag="MYCTH_2312321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667015.1"
                     /db_xref="GeneID:11509332"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="JGIDB:Spoth2_2312321"
                     /translation="MSDSIDRVFVHALNTVKKIPKTGAARPPPSDRMRLYGLYKQAME
                     GDVDGVMERPTATSSGNSEDLVREQDKWDAWNSQKGLSRTEAKRRYVEALIETMHKYA
                     NTPNALELVAELEFVWNQVKSNSPSAAGSSSERSGGGGTGAQRGGVGGAGGIIPSPVV
                     RRFQAPLSGSEGPMKVLSPMSEEDESERRMAELADQADDDPGEYARRQDQRSKRMERA
                     IVRLSAEIAALREQIATGREWRARRERGVFAWLGWIFWAVAKHITVDIALLLLLLIWM
                     RKRRDRRLEDNVRAIFRIAREYVSGILPPR"
     gene            complement(2207636..2208779)
                     /locus_tag="MYCTH_2312322"
                     /db_xref="GeneID:11509333"
     mRNA            complement(2207636..2208779)
                     /locus_tag="MYCTH_2312322"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666968.1"
                     /db_xref="GeneID:11509333"
     CDS             complement(2207682..2208674)
                     /locus_tag="MYCTH_2312322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667016.1"
                     /db_xref="GeneID:11509333"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="JGIDB:Spoth2_2312322"
                     /translation="MPKRTHSESASSSPSEQSTKSTEGEPAPKRTRSSPATTSISSPQ
                     IPPWTIFTRWTSATITRSYPPLPEVLDPALETAALTHSGMRKSLSDPSYERLEWIGDV
                     YLELVASELIAQTFPTLDPGRCSHYREMLVRNATLGQFSVHYGLDKRANFPAEFGLGG
                     RPNGTKASEKQRAKALGDIFEAYVGAIVRSDPENGLRRVAEWMKVLWGPVLERQIREE
                     ETGARVSDRELNPKTRLEQLIGGPGVKIEYRDLPSGGKRDRDTNQELFFVGCFLTGWG
                     ETGLQLGYGAALGKKEAGQKAAVKAMENKKLMKKFVEKKKAYMAARAAQAEKAT"
     gene            2209090..2209499
                     /locus_tag="MYCTH_2312323"
                     /db_xref="GeneID:11509334"
     mRNA            join(2209090..2209204,2209254..2209499)
                     /locus_tag="MYCTH_2312323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666969.1"
                     /db_xref="GeneID:11509334"
     CDS             join(2209166..2209204,2209254..2209487)
                     /locus_tag="MYCTH_2312323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667017.1"
                     /db_xref="GeneID:11509334"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="JGIDB:Spoth2_2312323"
                     /translation="MSVPRARLLDLMRARCELFSTTFNPDGIRTGNKILRQRLKGPAL
                     ASYYPRKIVTFRQFQDAFKPLELEVDNEEEIDRLEHIAAYATPRSA"
     gene            2212231..2214128
                     /locus_tag="MYCTH_2312328"
                     /db_xref="GeneID:11509335"
     mRNA            join(2212231..2213453,2213518..2214128)
                     /locus_tag="MYCTH_2312328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666970.1"
                     /db_xref="GeneID:11509335"
     CDS             join(2212263..2213453,2213518..2214042)
                     /locus_tag="MYCTH_2312328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667018.1"
                     /db_xref="GeneID:11509335"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="JGIDB:Spoth2_2312328"
                     /translation="MADQLPAANPNRSRGIWNNNNNNNNNNFRPAFGNPYSPGQMMVE
                     DAQPIAWPNSRVANYEPTFAASAMDVYRQNRMGPEQDAMRPMGRRGNRYDNRHGSSNH
                     YGGGYSGYGMGPAPYEMTQGYSTGPPAMMGSGMGMGLYSPYQQQPVGTALSPHATEFT
                     ASSWKGEVSRPIWKALSDELLLTLPSQTLTADGQTYVSPTTEPLNYRRLLDRNVTCDW
                     KYIVDKIVCNNDQQASIFLQQKLKVGTPEQKYDIVEAIVAQAYPLMVNRFGNFLVQRC
                     FEHGTPEQVIKIAQSIRGNTLNLSMDPFGCHVVQKAFDCVPEDYKAIMVHELLRRIPE
                     TVIHRYACHVWQKLFELRWTESPPQIMKYVNEALRGMWHEVALGETGSLVVQNIFENC
                     LEEDKRPCIEEVLANIDIVAHGQFGNWCIQHICEHGAPADRSRAIDHVIRYAAEYSMD
                     QFASKVVEKCLKIGGSEFLGRYLDRVCEGRMDRPRIPLIDIASDQYGNYLVQYILTHA
                     APQHREIVAAHIRKHMVSLRGSKFGSRVGMLCTNHAVATRPGPAMGPMPGRMAGSSRY
                     GTGYR"
     gene            complement(2214557..2217046)
                     /locus_tag="MYCTH_2312329"
                     /db_xref="GeneID:11509336"
     mRNA            complement(2214557..2217046)
                     /locus_tag="MYCTH_2312329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666971.1"
                     /db_xref="GeneID:11509336"
     CDS             complement(2214878..2216956)
                     /locus_tag="MYCTH_2312329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667019.1"
                     /db_xref="GeneID:11509336"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="JGIDB:Spoth2_2312329"
                     /translation="MRFQPAARCLAVAQQFRGPCWSRSFFFSATFTNPAAAFATMAAP
                     NGSSSPPRGGSRDEGVTLAALPKSWHFTSSLPADPQFPTPADSHKASREDLGPRQVRG
                     ALFTWVRPETQEEPELLAVSPAAMRDLGLAQSEAETDEFRQVVAGNKILGWDPETLSG
                     PGYPWAQCYGGFQFGAWAGQLGDGRAISLFEATNPRTGRRYEVQLKGAGITPYSRFAD
                     GKAVLRSSIREFIVSEALHALGIPTTRALAISLLPHSRVRRERVEPGAVVVRFAESWL
                     RFGTFDLLRARGDRALLRRLATYVAEDVLGSWENLPARLDDPDDPAKTPAPARNVPRD
                     AVQGPPGAEENRFARLYREIARRSALAVAKWQVYGFMNGVLNTDNTSVLGLSMDYGPF
                     AFMDAFDPAYTPNHDDYMLRYSYRNQPTVIWWNLVRLGEALGELLGAGPDVDADDFVA
                     TGPTEAAAPALVARAERLINAAGEEYKAVFLAEYKRLFAARIGLRGGPRPADFDALFS
                     PLLDTLEALSLDFNLFFRRLSDLRLRDISTPEDRLAQAGRFFYQDQDQNQSGRQRVAD
                     WLAVWRERVVQDWGTLEDWGSSFSSADGSGAVSDKADAERMAAMKRVNPNFVPRGWIL
                     DEVIRRVEKDGERDVLKRALHMALHPFEDEWAGRVFDGVVYEGDREEEVRWTGDVPKT
                     GRAMQCSCSS"
     gene            2217751..>2218961
                     /locus_tag="MYCTH_2141012"
                     /db_xref="GeneID:11509337"
     mRNA            join(2217751..2217964,2218057..2218180,2218246..>2218961)
                     /locus_tag="MYCTH_2141012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666972.1"
                     /db_xref="GeneID:11509337"
     CDS             join(2217857..2217964,2218057..2218180,2218246..2218961)
                     /locus_tag="MYCTH_2141012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667020.1"
                     /db_xref="GeneID:11509337"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Spoth2_2141012"
                     /translation="MSSATAEFQVHASGTAPKQVDYIPHLKLNDGNEIPMLGYGLGTA
                     RFKRGNSDKLDENIINAALTAIKNGYYHLDGAEGYGNEAELGEAIARSGVDRSKLFVT
                     TKSSCRPGESIETAFSRSLAKLGLDYVDLYLIHSPFWAKSPAELQERWAEMEALKDSG
                     RARSIGVSNYLPEHLEATLQTARYPPAVNQIEYHPYLQHEDGDLLGYLRDKGIAIVAY
                     SPLTAITRAPGGPVDAVYDRLARKYGVTPGEIGLRWCLDQGIVTLTTSAKEERLKDWK
                     QRLPLFKLTPKEVEEIADRGKEGHYRAFWTKHFKEGDRR"
     gene            complement(2219068..2220631)
                     /locus_tag="MYCTH_2312334"
                     /db_xref="GeneID:11509338"
     mRNA            complement(join(2219068..2219998,2220090..2220274,
                     2220394..2220631))
                     /locus_tag="MYCTH_2312334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666973.1"
                     /db_xref="GeneID:11509338"
     CDS             complement(join(2219198..2219998,2220090..2220274,
                     2220394..2220535))
                     /locus_tag="MYCTH_2312334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667021.1"
                     /db_xref="GeneID:11509338"
                     /db_xref="JGIDB:Spoth2_2312334"
                     /translation="MVTSHIIRIPRTDEEGSFILGEVTPSGSKPLNVKFVATEGEEPY
                     VVKLRHDRIGELRASSSPCSPGEWESILKALLLGSEPIEGIEAGAEAKVGKSITITIR
                     RRVAGINQRLGALTLNHKPDEAIQLFDWCGAAALQREQLQEAAVAEKARVSELESRIA
                     ELRTQLDELTESKKAREAEMLEKFCVLLNEKKVKIREQQRLLSTAQVDYSKLDAARAS
                     QAARLDTSEGHKPAPSRRTKRKALEDASGGGSSDSDDAFEKVTPGSDKMDIDQVEPRR
                     ENKELSESEDRETTDGDETETGSEPEEEEEEAPAPRRSPSSPKLRQAQGPEPKSRPAA
                     PRRAGKGKDFVIHPPKNPVRKAKAATPPPAEGSETESDDEL"
     gene            2222494..2225796
                     /locus_tag="MYCTH_2312336"
                     /db_xref="GeneID:11509339"
     mRNA            join(2222494..2225148,2225203..2225796)
                     /locus_tag="MYCTH_2312336"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666974.1"
                     /db_xref="GeneID:11509339"
     CDS             join(2222661..2225148,2225203..2225762)
                     /locus_tag="MYCTH_2312336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667022.1"
                     /db_xref="GeneID:11509339"
                     /db_xref="JGIDB:Spoth2_2312336"
                     /translation="MDSSTLRLKARPHVEEEIENWDDDDDFVFDGDDIAFPSLSNLAN
                     ISSNRRDSQSSFRSDFESVHGEEEKQVHLPDNDEKSTLDAIAAAAKAGIPLPKNVPPS
                     ALMGGTIKRLGGRKIKKIIQEDWVDDLEFPDAGQVLQIKDRDGAQFPEVLRQVSNSAQ
                     PSPSKPPKDLPTMFQDEQKEEKPTTSSSLVDLEKFRDGDDDDFFGDGGATIKVSKRRV
                     MPKSLSLITSPTPQRHIGDTQTGDDDFEKDLELPEDGHLKLSAKRDIPPKTPTFANIL
                     DDLDWTEGSLGTRFGGTRREAQSTRSSSVSAFSPSISSSVMESEDEIFDGLIIPNGPL
                     DFGERLKRRRKSRSPERIPEEPSVTEELGQQDTIKQKSFKGPLMEPLREEKGEEKEDF
                     LDGLEIGDGEIFDSRKLTLNRNIQVKTTRPASPSRPKASVALKFTNKPVTASRLPRPM
                     GSMASHERSHTQSSLEPVSESGGPIQRAHSRRSLSRMGGHSAHSSVTSLASSTTSTRP
                     SSTQTVAPSTPRRRESGQGTSQGSLGNESATTNAQLLRMKRSLPAMRGTQSPARPQPT
                     RGYERPPSRAEQTNRAPPTLRPKTPVERTRPSESAAALARKAPVPFVPAGASATQSHN
                     VNAKPRTFRRHDSETSIEYRPSSRAVSRSAIRSPSPRLYRSAEKATPESHWGKMSVPK
                     RARNFGDGHELDAFDDLPTSTQAEAKFLKQPSSAKSQTRTRGYQNIPDRNVTPSPRAP
                     PSSRVDNVPSFARDTAASRIARETNLAQRNPSGVIAPLTAQRVAQLSAKGNSNAQSHF
                     TPPTAKAKKVRRSPQSKPHLIANLNPPRDAKMVKGMWYNPEMFRWEGNDNALNAFEVP
                     ATSSSTGSGHQHMVRERETATPRPALITNIGVTKGVQVVGGMVFDPQNMCWLKLAPQN
                     RSGKGGALDGLDAFDDEEDVFKDIPDLEERTMASSDGGNPRVSDVNHEWPVGEEFDVG
                     PEFVRRQREEEERWRKKCHLWINNQADRGDAWKWAIRDIVNEG"
     gene            complement(<2226685..>2227755)
                     /locus_tag="MYCTH_104106"
                     /db_xref="GeneID:11509340"
     mRNA            complement(<2226685..>2227755)
                     /locus_tag="MYCTH_104106"
                     /product="glycoside hydrolase family 3 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666975.1"
                     /db_xref="GeneID:11509340"
     CDS             complement(2226685..2227755)
                     /locus_tag="MYCTH_104106"
                     /note="CAZy_ID 267965"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003667023.1"
                     /db_xref="GeneID:11509340"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="JGIDB:Spoth2_104106"
                     /translation="MKWTRLSLATASLFGLAVAGSKNKIQIGQQVIYSYPGETPPEHL
                     FDLIRAGQVGGLILFGENVNDELPATIEQFLSAYRESPAYADLKTPFLIMTDQEGGQV
                     RRLPGAPVESAKEVGESADPVAAAGRAGAGAAETLLRYNMNANLAPVLDVYREEGDFT
                     DNYERSFSNDATVVAGCAAQFVRDQQRAKVLATAKHFPGLGAAKKDENTDARPVTIDL
                     TLEEIRAVDEVPYHDAIGAGIAMIMPSWAIYPAFDAERPAGLSSRWIRDELRGRLGFD
                     GVIVTDAIEAGSLKAFGDDADRALLAKKAGVDLILASGRNVTQGESIVSALAAALENG
                     DLSQQELDASDKRVQAARAKLA"
     gene            complement(2228866..2231360)
                     /locus_tag="MYCTH_2316635"
                     /db_xref="GeneID:11509341"
     mRNA            complement(join(2228866..2230161,2230243..2230291,
                     2230360..2230433,2230506..2230697,2230919..2230924,
                     2230993..2231079,2231230..2231360))
                     /locus_tag="MYCTH_2316635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666976.1"
                     /db_xref="GeneID:11509341"
     CDS             complement(join(2230018..2230161,2230243..2230291,
                     2230360..2230433,2230506..2230697,2230919..2230924,
                     2230993..2230995))
                     /locus_tag="MYCTH_2316635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667024.1"
                     /db_xref="GeneID:11509341"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="JGIDB:Spoth2_2316635"
                     /translation="MSQSRATVNEECIATYNELKLNKKYKYIIFKLSDDNTQIVVEST
                     SEDGPEYDDFRNKLISAQSKSKTGALGKGPRYAVYDVQYDLKSGEGTRNKITFIAWSP
                     DEAGVLAKMVYASSKEALKRALPGIAFEVQANDEDDIEWQTLVTAVSKGTAAI"
     gene            complement(<2231996..2233965)
                     /locus_tag="MYCTH_2097570"
                     /db_xref="GeneID:11509342"
     mRNA            complement(join(<2231996..2233509,2233568..2233709,
                     2233806..2233965))
                     /locus_tag="MYCTH_2097570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666977.1"
                     /db_xref="GeneID:11509342"
     CDS             complement(join(2231996..2233509,2233568..2233709,
                     2233806..2233895))
                     /locus_tag="MYCTH_2097570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667025.1"
                     /db_xref="GeneID:11509342"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="JGIDB:Spoth2_2097570"
                     /translation="MQRALTRASVSSPLAAARVRSTQQLRFAHKELKFGVEGRAALLN
                     GVETLAKAVATTLGPKGRNVLIESTFGSPKITKADGVTVAKAISLKDKFENLGAKLLA
                     DVASKTNEIAGDGTTTATVLARAIFSETVKNVAAGCNPMDLRRGIQAAVEAVVEYLQK
                     HKRDITTSAEIAQVATISANGDEHIGALIANAMEKVGKEGVITVKEGKTLQDELEVTE
                     GMRFDRGFVSPYFITDAKAQKVEFEKPLILLSEQKISAAADIIPALEISNKLRRPLVI
                     IAEDFEGEALAVCILNKLRGQLEVAAVKAPGFGDNRKSILGDIAVLTNGTVFTNELDV
                     KLEKITPDMLGSTGSITITKEDTIILNGEGSKDAIAQRCEQIRGVMADPSTSDYEKEK
                     LQERLAKLSGGVAVIKVGGASEVEVGEKKDRFVDALNATRAAVEEGILPGGGTALIKA
                     SVNALNDLKPANFDQQLGVSIVKNAITRPARTIVENAGLEGSVVIGKLSDEYASDFNT
                     GFNSAKGEYVDMIQAGILDPLKVVRTGLVDASGVASLLGTTEVAIVEAPEEKPAGGMG
                     GMGGMGGMGGMGGMM"
     gene            complement(<2235801..>2236182)
                     /locus_tag="MYCTH_17263"
                     /db_xref="GeneID:11509343"
     mRNA            complement(join(<2235801..2236032,2236124..>2236182))
                     /locus_tag="MYCTH_17263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666978.1"
                     /db_xref="GeneID:11509343"
     CDS             complement(join(<2235801..2236032,2236124..>2236182))
                     /locus_tag="MYCTH_17263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667026.1"
                     /db_xref="GeneID:11509343"
                     /db_xref="JGIDB:Spoth2_17263"
                     /translation="FQVNFENVAQELDIVSKAAAAKRYERLLKAHNINPTTPRKGAAS
                     GNADAAEDGEEPKTPASKKRKRAAASKKEEDEDETPVKKENTVKKELSVKKEE"
     gene            <2238756..>2239860
                     /locus_tag="MYCTH_96681"
                     /db_xref="GeneID:11509344"
     mRNA            join(<2238756..2238957,2239271..>2239860)
                     /locus_tag="MYCTH_96681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666979.1"
                     /db_xref="GeneID:11509344"
     CDS             join(2238756..2238957,2239271..2239860)
                     /locus_tag="MYCTH_96681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667027.1"
                     /db_xref="GeneID:11509344"
                     /db_xref="JGIDB:Spoth2_96681"
                     /translation="MARQSKTAAAADPASEGQAGAVSGSTINGIVPTHLETKFAFALV
                     SQFKSKPDIDWDQVATIMGMSKKSAIERWRVMRIKFGITFNDEAGDGAAETPGSARKG
                     RKSTVATTPKAAKDDGKEESKEDQDAAPFTPAKRGRKPAGAGKKTPTPGSAAGRKRRA
                     GPADATTTSGAAAAGSLGNDGGKGAGGDDTVEREGPIATASPSKKIKAGKKAAAAPAT
                     PAATLPAATSTATPVGGTQEGHASSPLSSVPGMTADEGSGDEMEV"
     gene            complement(<2241847..>2242420)
                     /locus_tag="MYCTH_104102"
                     /db_xref="GeneID:11509345"
     mRNA            complement(join(<2241847..2242102,2242272..>2242420))
                     /locus_tag="MYCTH_104102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666980.1"
                     /db_xref="GeneID:11509345"
     CDS             complement(join(2241847..2242102,2242272..2242420))
                     /locus_tag="MYCTH_104102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667028.1"
                     /db_xref="GeneID:11509345"
                     /db_xref="JGIDB:Spoth2_104102"
                     /translation="MAERMTWDHRADHDLLTAIMQELQPSQEQLRGVMARMHSFGYTC
                     TVKAITQHLQKLRRKEEKAAGGGSANGEGSSTPRTPGGRKKNAAAGVKKEPGSGSKRK
                     PVAVSDEEEDVKPARVKKLKEEPGVKSEESDG"
     gene            complement(<2243163..>2243775)
                     /locus_tag="MYCTH_27775"
                     /db_xref="GeneID:11509346"
     mRNA            complement(join(<2243163..2243351,2243632..>2243775))
                     /locus_tag="MYCTH_27775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666981.1"
                     /db_xref="GeneID:11509346"
     CDS             complement(join(<2243163..2243351,2243632..2243775))
                     /locus_tag="MYCTH_27775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667029.1"
                     /db_xref="GeneID:11509346"
                     /db_xref="JGIDB:Spoth2_27775"
                     /translation="MPKWEDIREDLFEAIMQVHPPINKEQQAEVVRIMREKGHDMGWN
                     AIRYATDIKATDITVTMARTLQNWDAETHEAVLLALIEHMKPNGSDWSAVVASLRPKG
                     YTFSEGALV"
     gene            complement(2245147..2246612)
                     /locus_tag="MYCTH_2312344"
                     /db_xref="GeneID:11509347"
     mRNA            complement(join(2245147..2245276,2245343..2246020,
                     2246285..2246612))
                     /locus_tag="MYCTH_2312344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666982.1"
                     /db_xref="GeneID:11509347"
     CDS             complement(join(2245255..2245276,2245343..2246020,
                     2246285..2246439))
                     /locus_tag="MYCTH_2312344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667030.1"
                     /db_xref="GeneID:11509347"
                     /db_xref="JGIDB:Spoth2_2312344"
                     /translation="MMNKNWNDRADKDLFFTILSVKNIGVISGTEWVTIGNHMRSLGY
                     GFTNEGCRQHFQGLRRAQAKAENGVAGDNPRKIDPTLNPITRRPGPGRGRPRKQPAAD
                     AAASVPPAAPASGVHPGGTAAGGAPPGAPGTPSGAPALVPGTTPIQNMSHGLPVHAQF
                     TGLPGVSPAPPTPASTVPGPSGTPAMANAPDSQGLPQGQGQAQPPPPQTNPGVAPQAQ
                     MAAHEELAVDPSLGGEPEEEHAAKRQRLDDSQEPTLEDEAVLNALASHNNPTTPGEYT
                     TEYSYGDA"
     gene            2248402..2250433
                     /locus_tag="MYCTH_2312347"
                     /db_xref="GeneID:11509348"
     mRNA            2248402..2250433
                     /locus_tag="MYCTH_2312347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666983.1"
                     /db_xref="GeneID:11509348"
     CDS             2248627..2249901
                     /locus_tag="MYCTH_2312347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667031.1"
                     /db_xref="GeneID:11509348"
                     /db_xref="JGIDB:Spoth2_2312347"
                     /translation="MRYSRFRAAMLGLEPQRRNRTANSGNNNKNRVSKKKKDDGPKPK
                     KEDDENVKSSGSGIGNIKTEKTTTGAAVKSERRGSSQELPGPSQPSAPMATPVMMKAE
                     PGFVNPFNQHQNRLHHDSLLSSGSPRVKPEKFMTTASANNKTNSVPEPTPFGILATVI
                     PTTSPSVSSTPYIDGSHHRMQGRLPTPCSDSDGTIAGMHDFVSHSPPPAELLHHSQHH
                     SHPLHHHHHHHVVGAGSSSPLSTSGPHSYDFSQHQCCDISPGSFPGSSSSPWHSQHQH
                     HSQHGHGPSQAQTQAQTMFSPAAPGFDLGLGLSLGLTTGSYTPETGFNNNSNINENNN
                     NPICGSYHDNIHLHHHHSLCHDEDGHHVMDDPLGLHGVGGAAPNMFRERAMELELAGG
                     MISDTAAAAGVDAGGTARQVKREWEGEGKFTI"
     gene            2251050..2251607
                     /locus_tag="MYCTH_2312348"
                     /db_xref="GeneID:11509349"
     mRNA            2251050..2251607
                     /locus_tag="MYCTH_2312348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666984.1"
                     /db_xref="GeneID:11509349"
     CDS             2251367..2251549
                     /locus_tag="MYCTH_2312348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667032.1"
                     /db_xref="GeneID:11509349"
                     /db_xref="JGIDB:Spoth2_2312348"
                     /translation="MPPKAVAKAATGVSDGKQPTAQEAYLFYTIIKNMKGKPEIDWAA
                     VAADAGYKTAETAKVS"
     gene            2251880..2253076
                     /locus_tag="MYCTH_2312349"
                     /db_xref="GeneID:11509350"
     mRNA            2251880..2253076
                     /locus_tag="MYCTH_2312349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666985.1"
                     /db_xref="GeneID:11509350"
     CDS             2251922..2252845
                     /locus_tag="MYCTH_2312349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667033.1"
                     /db_xref="GeneID:11509350"
                     /db_xref="JGIDB:Spoth2_2312349"
                     /translation="MEDDANQNTDDDDDNADADDNDDDGDEHMLMNQVPETPTKNKTG
                     RVVGKRTKAGPGRKDNGTTAGPSVMDEFVDFPAVLPESVIEREAILVNNNGVWTVSPV
                     PIDVHAQWLARLPASLQTRFYLQAHSVTTAAPTAGIAYSNHGDNVTGEGNTGNAGFIL
                     PHAIAPAVARENEEEEEEEEEEEEKKKKNEEVHDANNTAAEHQERLSSLPGMVPMDLG
                     GYVAPNQHNGSGTNDEDSAAAAAAAAAAVVGGCGGVDPDNVDLHSIPWHPGFFAEQMA
                     RRDEERDRAVLFGGGDGHDQDEDGEEGHDGY"
     gene            complement(2254336..2257138)
                     /locus_tag="MYCTH_2312350"
                     /db_xref="GeneID:11509351"
     mRNA            complement(2254336..2257138)
                     /locus_tag="MYCTH_2312350"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666986.1"
                     /db_xref="GeneID:11509351"
     CDS             complement(2254515..2257004)
                     /locus_tag="MYCTH_2312350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667034.1"
                     /db_xref="GeneID:11509351"
                     /db_xref="JGIDB:Spoth2_2312350"
                     /translation="MDGAEENAHDVAQQILPESPHHLSLSFDRRFPRPDAWTFSGPSS
                     SLQYMTYISAAQRGILTTRAAFEISDETPPPPPSMPVKALAKGEPKKKLSLMDYQNRK
                     KSASPVENGLPTRTESRTNGAITARSLPSKDDVTAGERTHAPPRPANAAPEKPRAEVN
                     GERYSAQTAAPWGASRIANSPGRSKVSQTKPQPDPESRKRTAEVSAEPSPRKRTKSDV
                     GMAKAEQSSRPAKPGTPRGREGAEKPAREIRAETSHPTVNGLPPLSAADRDREHTASP
                     KSTIQVNGSRPRSDSGTSTPRKPESIKAALPQLLSPLHPSLFEGESEREDMPKHKTAG
                     KASKPEKEKAKRFKIPELLSPTLPPVIEEILALRDRKPTASKGVSSQSSGHSSDSPSG
                     ARKTIVAALPGRTAEEEERPSRPSRIVTFKLKKANAKRAKELLSLPSKSTKDALKKER
                     SESAEAPPPPAKKRPRPAEDAPQESAAASKRPKISADVITARPAGSRTPLKPAAPAMS
                     RVASSQSQGQGNTPAATTGLTPSTSDNRPPTRSEPLDPKVLAQVDYFKDRHTEYSRLG
                     SKLKHARDDMMRDRGTNPAAADERRISALHFEMVLAYMVAFDSLNQSRILERKVCEIS
                     AWESLLPHLAELRGRVQANRALKALAMQMHALCLEQISNAFATLDPAGAAATFGRWTK
                     HHRNRTLMWGDANATYERVEEPKMRVVMGPWTAVDDAVAAVLDIMRRWAEKDGVRWQP
                     EVNVKGGKDREREREKVPDKDRENKNRDKERARDRYRDREKDRERERDRDRDRERDRD
                     RERERDRDRDRDRDRDKERERPRHPANGSKY"
     gene            complement(2258753..2261434)
                     /locus_tag="MYCTH_2312351"
                     /db_xref="GeneID:11509352"
     mRNA            complement(join(2258753..2260802,2260912..2261199,
                     2261295..2261434))
                     /locus_tag="MYCTH_2312351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666987.1"
                     /db_xref="GeneID:11509352"
     CDS             complement(join(2258980..2260802,2260912..2261182))
                     /locus_tag="MYCTH_2312351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667035.1"
                     /db_xref="GeneID:11509352"
                     /db_xref="JGIDB:Spoth2_2312351"
                     /translation="MSHRSSDVYSRRPFGDDRRVPESRDHRRESLQRVGSDSSRADRY
                     RKDSDTSARDSLRNQSDISSLGTPSLSPTVKPHLVRSSRSENGIKISASASQSSAESP
                     SPGSTLSTRLISLLKQHDAAVIEVARLRAERDPLEKVWKKRQEEYEKSKIKHAEFPSV
                     PEVQNLHRVKYGERLRYLDAEIRKAQDIVDETGRSIALAVSGCSEPTVPLQPQEPSKS
                     RLAEISELRSELRKIKAGRLQERSGFEAELERRFAELKEQLTKQFTKQLSEQREKIVT
                     GLSEMKEIKAMRSMKEETVEEVEQQLRAAREELDKRLSDGLEAVTSAKASTLAQKEMS
                     ALRTDYSGLLKRVDDLTQQLSRNAQDTIYLRGELTEQLAQSNRRIASLSKDLSACVQR
                     VEVEARKVEEHEEKLSGLDAEALEGVAEKMSIEFPDLQRKMAGIQAKMDGTISRQEVE
                     SKQNSLLARVQRYVTESGESLAQMVDAVQKATAEQSVQIEELKKASISTARVGADSEP
                     NQATKAEFETISSDIASIKSEFDATRMTVDKLSKDVSIIIDEDLKNQLEMVRLSIKVL
                     DSQFSNLSTKSLAEHIIGQLGQIYPNAQQINADIEALKTMISNLAYRMVQLERQTEDL
                     RRAQIMSCSCRAKTCAPETNSFDMLKVSNMQDSNLRNLNDNAQPVLKRRRTDSVLNAD
                     EHLLAVPNGTNQTGG"
     gene            2262601..2265059
                     /locus_tag="MYCTH_84848"
                     /db_xref="GeneID:11509353"
     mRNA            join(2262601..2262646,2262713..2262939,2263019..2265059)
                     /locus_tag="MYCTH_84848"
                     /product="AAA family ATPase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003666988.1"
                     /db_xref="GeneID:11509353"
     CDS             join(2262638..2262646,2262713..2262939,2263019..2264234)
                     /locus_tag="MYCTH_84848"
                     /codon_start=1
                     /product="AAA family ATPase-like protein"
                     /protein_id="XP_003667036.1"
                     /db_xref="GeneID:11509353"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="JGIDB:Spoth2_84848"
                     /translation="MAAPVVTISESKELRGLNLIAAHSHIRGLGVDADTLEPRAVSQG
                     LVGQEKARKAAAVVLEMIKQGKIAGRAVLIAGPPSTGKTAIAMGMAQSLGPDVPFTTL
                     AASEIFSLEMSKTEALTQAFRKSIGVRIKEESEIMEGEVVEIQIDRSVTGGAKQGKLT
                     IKTTDMEAIYDMGSKMIDAMTKERVMAGDIISIDKSSGKITKLGRSYARSRDYDAMGV
                     DTKFLQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEIRDQINT
                     KVGEWKEEGKAEIVPGVLFIDEVHMLDIECFSYINRALESDLAPIVIMASNRGQSRIR
                     GTDYKSPHGLPLDFLDRVTIINTHAYTADELRQILSIRAQEEEVDLTPDALALLTKIG
                     QEAGLRYASNLITTSQLICAKRRAKQVSVEDVQRSFKLFYDPARSVRFVTESEKRLIG
                     HDGTVDFAVKTNVAENNAADNINGPPAETMDTS"
     gene            <2266676..>2267728
                     /locus_tag="MYCTH_2121561"
                     /db_xref="GeneID:11509354"
     mRNA            join(<2266676..2266876,2266934..>2267728)
                     /locus_tag="MYCTH_2121561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666989.1"
                     /db_xref="GeneID:11509354"
     CDS             join(2266676..2266876,2266934..2267728)
                     /locus_tag="MYCTH_2121561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667037.1"
                     /db_xref="GeneID:11509354"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="JGIDB:Spoth2_2121561"
                     /translation="MAPGAERPELNYGSKIFLPPSALDKVSRLHVQWPIMLELINGAT
                     GKHTHAGVLEFVAEEGRAYIPQWMMQTLQLDVGDMIQVKTTSLELAKLVKLQPQSVNF
                     LEITDPRAVLEKAFRNFAALTKGDVFNFEYNDEIYDVAVLDVKPESEKMGVSMIETDV
                     SVEFAPPVGYVEPEKAPRGSGTSTPRSTRGAGAGVPPGGLLYNQGTMAQAINYDAIAP
                     GSTAASSGNFRGEGQRLSSKKNKGSTPKPATPASGTSGTGSESAVPKRRTNGPAPLRL
                     PPNKLFLGYPIKPVKTAEDKEKEAANAKQPHFAGQGQTLRGAAKKKNDAGDKGGK"
     gene            2268407..2271180
                     /locus_tag="MYCTH_2312359"
                     /db_xref="GeneID:11509355"
     mRNA            2268407..2271180
                     /locus_tag="MYCTH_2312359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666990.1"
                     /db_xref="GeneID:11509355"
     CDS             2268650..2270998
                     /locus_tag="MYCTH_2312359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667038.1"
                     /db_xref="GeneID:11509355"
                     /db_xref="JGIDB:Spoth2_2312359"
                     /translation="MTNAAGSVPAQLAATTRNLRPRQASGAPGSSVGGAARKAGGRVT
                     RSSATLLRTSSTNENSAAPQPQVLENPAKSHKRSQSSVGNARQQAKRTRLTPHEPGFY
                     GESSDSGGDYDSLHEPPGPDVEQKAGGHQRRKPPKNSTPKKSSKPARATIRSPRKLAS
                     EKFPASEGDESAGENGIIPDWGSLPYHILVQIFRYAAAPLNQVQQAKWLTATSGVCRA
                     FAEPALTALYRAPPLLTRPMAHGLVSLLCKDPSTTLFNYRQKVEELWIDVEHIASKTF
                     KGQPLDLPALVGNLPRLKSIQFFHQKDGPPYRSLDGSLRWHYPPALFKALNGTRHSAE
                     EGGTINHAKLLGWQWNRRLMGPDLDLAAIKVLHETPPFLSLEKVSFVNYQVPSLHAGA
                     SVDDKELAASDEAFIQGMADAITALPALKHLAIESSTVANSQLLLRLPDRLETLELVN
                     CWEVDGDDFADYLLSRGHHLKQLTLRHNQSLSLSFVTVLGTACPNLEVLSMDFKTFKH
                     HEFYHDSDPSYDDLLTASQVPDWPQSLETLQLLNMKKWTAEAAETLFQSLVDSAPRLL
                     KLRWLELKAMLSIPIQERSRMRNKWGCKLRQVFLREKEEPKPLFSLREKPRPPDAEKI
                     TKRTPKKSRKLGGVLPAESPSRRSSRIAGQSSNSSSRAGSIGRGLRHSLSRPSYAEPD
                     TDEDEEEEEEDDDEKYAELGGAQTTDGLGTGNQPEPVTSPADAEALFRHGMCEKVEIQ
                     LDNQKSAETTLTMDDFLDSGNDDLSDDDWVGQDDESDNGYAW"
     gene            2273000..>2276137
                     /locus_tag="MYCTH_84837"
                     /db_xref="GeneID:11509356"
     mRNA            join(2273000..2273303,2273359..2275293,2275399..2275947,
                     2276042..>2276137)
                     /locus_tag="MYCTH_84837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666991.1"
                     /db_xref="GeneID:11509356"
     CDS             join(2273761..2275293,2275399..2275947,2276042..2276137)
                     /locus_tag="MYCTH_84837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667039.1"
                     /db_xref="GeneID:11509356"
                     /db_xref="JGIDB:Spoth2_84837"
                     /translation="MSTINRRNRGLPFLHRNWLKATNHWSKMGNRSSFHSRDAGDKAA
                     EHGDEAERAAKRRRIDNDYDGFPLFEQYGTAQRALRIEVLKISHKDSPRVKNGILNGI
                     IAPNVRDVVRVKARCKLTISGHKGGEPVVLHVDSQVCDLRVFKNPAGSSPMARFSSLR
                     PFHIPEEKIFLERDDDAVFGLANSYSVLVELESAGDANWPPADLVPVSDEDTFYNRCL
                     PSRQWVLTASIADLFSSRNRKDVRLRVKKQPLADAATNFLLDMDVRWLTPISSRQRPR
                     THAKDILASISVFGSSEAEVPLVNGNTKPSTLPNGTNTHRHESQTNDEGEPTLDGQAN
                     GTVTDAAEELAEGELTPSRSRRTRQDINYNVKQMWNNAVGKETKKRRKLGDEHGQLDE
                     HTITYLLPPEQVQTDKFACLLCGAENDRLSQLRAHYLSHPQYDFCFEFKPKTGYCVTV
                     KPNASNHGSPLRPRVYQLGLPVKPLDLDKYVDGDDSWVTSRLGPDNGRELFRDTAPQG
                     GRTVLVPKTKQPLFDPLSKVQLQPGTPVPQHEIDDSWLLLKHRDNLQDFIDLNAAEKE
                     YLQTWDAFILRQHISSPQYLPRYFLRFVREKASWLVAKRARADEFSKHVATLLARRVL
                     PDAAIFEATQLLNDARSRRAAVGEQNQKEAEDEGEGADGLQPSKNRVSGGCCTACGEP
                     VPVVAMLVCANKGCEKRLYHDTCVEDPEAAAAKGRNWRCKACS"
     gene            complement(2277086..2279613)
                     /locus_tag="MYCTH_2312360"
                     /db_xref="GeneID:11509357"
     mRNA            complement(join(2277086..2279276,2279345..2279613))
                     /locus_tag="MYCTH_2312360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666992.1"
                     /db_xref="GeneID:11509357"
     CDS             complement(join(2277447..2279276,2279345..2279425))
                     /locus_tag="MYCTH_2312360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667040.1"
                     /db_xref="GeneID:11509357"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="JGIDB:Spoth2_2312360"
                     /translation="MAAPKMTKNQMRRAKKKEQKKAKAEAQQNGSKEPEVNKEEEIKE
                     ETPVNGESKPDDLEVKKDPDASDEIDADGPIDAPAIPEDDPAFAEYKSIFEKFGVSLD
                     GEEGSKEANKRDKGEVFFDQDDEIPSEGEEAQPKLSKKKRKKLNKLSIAELKALVRNP
                     EVVEWHDVSSSDPRLLVQIKSQRNIVPVPGHWSLKREYLSSKRGIEKPPFKLPKFIAE
                     TGITEMRDAVLEKQAEQTLKQKQRERVQPKMGKLDIDYQKLYDAFFRHQTKPDLTRFG
                     DVYYEGKEWEADYKVFKPGELSDALKEALGMQPGFPPPWLLQQQRVGPPPSYPTLKIP
                     GLNAPLPPGASWGFQPGQWGKPPLDEYNRPLYGGDIFGIMAPGQPGAAAPYQPQPQQP
                     QAAAYASLGEPVERTLWGELQPPAEESEEEEEEEEEEEEDEGASQAGDLPPGGSTDAA
                     SGLETPGGFASTVHADAHEPAGVETSMAGEFDLRKTRRGFETEESSYGGSGPRQAYTI
                     IPERQGRAEGFFGSDKTYDLSKKPPQPPPPAGMRVLGRDDDGGDDASRKRKKPGDVDV
                     AIDPDTLAASGGGLDKDELRRRFEAGRREEGVGAQWSRSAYEEDLSDMIAQKSRKRQR
                     REEERRGEKGRR"
     gene            2280095..2282325
                     /locus_tag="MYCTH_2312361"
                     /db_xref="GeneID:11509358"
     mRNA            join(2280095..2280633,2280721..2282325)
                     /locus_tag="MYCTH_2312361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666993.1"
                     /db_xref="GeneID:11509358"
     CDS             join(2280205..2280633,2280721..2282103)
                     /locus_tag="MYCTH_2312361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667041.1"
                     /db_xref="GeneID:11509358"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="JGIDB:Spoth2_2312361"
                     /translation="MPHSTSHSISTGSHMRAASQTRASTSKSYGDSNNGGSAHGETEK
                     FPDFDPGQTFLNAQPSGQQRWQQNGFPSGNGDASYLGRWHPRRDSRVKWGPREPISTS
                     STHAKTNSISSAVHRIRSASMSQNAHEIAEALRAPISWKLIGLCVMWYWSSALTNTSS
                     KTILTAFDKPATLTLVQFAFVSTYCVLFSWLAATFPRLREAVPALRYPIRAPSRDVIK
                     TTLPLAAFQIGGHLLSSNATSRIPVSLVHTIKGLSPLFTVLAYRFIFDIRYPRSTYFS
                     LVPLTIGVMLACSGNHTFGGQFLGILYALLAAIIFVTQNIFSKRLFNEAARAEREGPL
                     HQSRKLDKLNLLCYSSGLAFVLTGPIWLWSEGVGIIGDLLWDGSLDLNKSPNSLDHGP
                     LVLEYIFNGTFHFGQNILAFVLLSMVSPVTYSVASLIKRVFVIIIAIIWFRNPTTPVQ
                     AAGIALTFLGLYLYDRSNDKNKADQRARALADTRREASLLPLSSKHALSGAASAAAAH
                     NGQGGGPSSALLYDSPVGIGGEPPAAAARAYTPGSAAAAAFASNSVVSDPKKSDDVPG
                     GHGGGRSRGMSNAGWRPPGTRQEDTWRTGDSQEVTAR"
     gene            complement(2282486..2284628)
                     /locus_tag="MYCTH_2312362"
                     /db_xref="GeneID:11509359"
     mRNA            complement(join(2282486..2283794,2283885..2284274,
                     2284390..2284628))
                     /locus_tag="MYCTH_2312362"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666994.1"
                     /db_xref="GeneID:11509359"
     CDS             complement(join(2282547..2283794,2283885..2284274,
                     2284390..2284497))
                     /locus_tag="MYCTH_2312362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667042.1"
                     /db_xref="GeneID:11509359"
                     /db_xref="JGIDB:Spoth2_2312362"
                     /translation="MARSLFELPDELVLTALNHKFPCREPQIRALSTLFYPGAAPCRN
                     LVIYGTEATGKSAITAALLAELSNQSPDDGFILRHAIVNSTECITARHLYETVVAKVM
                     DALEWDAAPPRCETVSQLAVELSKLLKYTPRPDGFRFVLVFDAIDRQRDAPHTLLPAL
                     ARLSEIIPSLTTAFIVTSPPPNFLLTSSVPHVHFPAYTKPDFIAILSLSAPPALPNTT
                     AQETADLWARFTAAVHDALARAASRTLPSFRHACTALWPRFTAPIHAGTHSAREFSKL
                     LVAARVHFQDERLLDPGVLAVTSTTTTTTTSMAPKPATQATATGSTLSKQIPPPTPPP
                     PPPPPPPPPPPQSKTTATIIPTALAKPRSETSAGLALATLLPTTARLLLLAAYLASHN
                     PTRHDQTLFSTHYHGSRRGRRRRHRQRGPGLSSSFSLPASASASAADGAHGRGRGRGR
                     AKHRKIARKLLGAHAFVLERMLAIYEAVRAEWEVGGRGVAKEEGREEEAAAAAAAAAP
                     LGDADLGAAIATLASLRLLVRVGGGAAGGAAGAAGAVGDVMDRGGKWRVNVGWEVIRG
                     LGRGIGVEVEEWLIE"
     gene            <2285487..>2286902
                     /locus_tag="MYCTH_2070790"
                     /db_xref="GeneID:11509360"
     mRNA            <2285487..>2286902
                     /locus_tag="MYCTH_2070790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666995.1"
                     /db_xref="GeneID:11509360"
     CDS             2285487..2286902
                     /locus_tag="MYCTH_2070790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667043.1"
                     /db_xref="GeneID:11509360"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Spoth2_2070790"
                     /translation="METTATTETTATPVTNAAGKPYHAKRPHRKSRTGCRNCKARKVK
                     CDEGRPACRMCTLRRETCVYMAAPKRAPRSTSSSSPTPSRDGDAAALEQRCCTSAVVP
                     QPQFRPGGHDETDMRLLWFYTTATYSSFSTGQLKERNVDVILKVNVVQHAFANRFLMD
                     TILGLSAMHINHLGIRNLGISRSLELQYRARAFENFRKAVEAADPSTYPALLITSLFL
                     CGLSTHVFRGEEARPFAVLDWMNLWKGIGTIIELIRSQHEQLFRTRLGSLVFRPAVDL
                     DASARCIPNQLLLMIASIKEGDPDFPLSQVYYRALQLLGSLYLELRNGFTPLLFLRIV
                     TFFTFFPNSLIRPAREMRPRALVIIAHYLVFTRFKANHSWWIEDIAQYEIPNICSFLG
                     PGWEDLLRLPIASLYTEDNTALARLLLGDPSWHPPSKIEQVPAPSLYEERELAIRTVK
                     AEETAEEAREYLENYAADEFC"
     gene            complement(<2287063..>2288403)
                     /locus_tag="MYCTH_2130973"
                     /db_xref="GeneID:11509361"
     mRNA            complement(join(<2287063..2287357,2287551..2287609,
                     2287686..2287918,2288095..2288150,2288282..>2288403))
                     /locus_tag="MYCTH_2130973"
                     /product="carbohydrate esterase family 1 protein"
                     /transcript_id="XM_003666996.1"
                     /db_xref="GeneID:11509361"
     CDS             complement(join(2287063..2287357,2287551..2287609,
                     2287686..2287918,2288095..2288150,2288282..2288403))
                     /locus_tag="MYCTH_2130973"
                     /note="CAZy_ID 268089"
                     /codon_start=1
                     /product="carbohydrate esterase family 1 protein"
                     /protein_id="XP_003667044.1"
                     /db_xref="GeneID:11509361"
                     /db_xref="JGIDB:Spoth2_2130973"
                     /translation="MVTVSSLVAAAGVVLLAGQEVFAVQLTRVDYPNNATSRAEMYIY
                     VPDNVVESPPLVVVVLLGPGVLPKRGDPVAAGVGQQGVHHAVAVVSERGGGGDSQAIA
                     DMILHAVAEYGADAARVYLTGGSSGAMMGNVHGRDVAAWNNTCSGGRSRASPEQWGNV
                     VRDMYPGYEGPRPKMQIWHGSADSTLAPANYEETIKQWTNVFGVSQEPTNSVENYPAP
                     NYRTDDYGENVQGIFANGVGHSVPANLTASEAWFGL"
     gene            complement(2288965..2291446)
                     /locus_tag="MYCTH_2316642"
                     /db_xref="GeneID:11509362"
     mRNA            complement(join(2288965..2289796,2289873..2290366,
                     2290446..2290467,2290528..2290566,2290632..2290674,
                     2290738..2290823,2290899..2290913,2291012..2291166,
                     2291259..2291446))
                     /locus_tag="MYCTH_2316642"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666997.1"
                     /db_xref="GeneID:11509362"
     CDS             complement(join(2289102..2289796,2289873..2290366,
                     2290446..2290467,2290528..2290566,2290632..2290674,
                     2290738..2290823,2290899..2290913,2291012..2291166,
                     2291259..2291269))
                     /locus_tag="MYCTH_2316642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667045.1"
                     /db_xref="GeneID:11509362"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="JGIDB:Spoth2_2316642"
                     /translation="MFKSGISAFARTARPSFAAATRRAVRPASLNLRAPAFSRFASTA
                     GVGDGKIHQVIGAVVDVKFDTDKLPPILNALETDNNGQKLVLEVAQHLGENVVRCIAM
                     DGTEGLVRGAKATDTGAPITIPVGPATLGRIMNVTGDPIDERGPIKSDKRAPIHADAP
                     EFVDQSTSAEILVTGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGG
                     YSVFTGVGERTREGNDLYHEMQQTSVIQLDGESKVALVFGQMNEPPGARARVALTGLT
                     IAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLAVDMGGMQERI
                     TTTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSK
                     SRMLDPRIVGQEHYEVATRVQQILQEYKSLQDIIAILGMDELSEADKLTVERARKIQR
                     FLSQPFTVAQVFTGIEGKLVDLKDTIASFKAILNGEGDDLPEGAFYMVGDFASAREKG
                     EKILAELEKSA"
     gene            complement(2291830..2294909)
                     /locus_tag="MYCTH_2312374"
                     /db_xref="GeneID:11509363"
     mRNA            complement(join(2291830..2291998,2292055..2292685,
                     2292742..2293077,2293159..2293966,2294022..2294121,
                     2294190..2294314,2294392..2294909))
                     /locus_tag="MYCTH_2312374"
                     /product="glycoside hydrolase family 13 protein"
                     /transcript_id="XM_003666998.1"
                     /db_xref="GeneID:11509363"
     CDS             complement(join(2291972..2291998,2292055..2292685,
                     2292742..2293077,2293159..2293966,2294022..2294121,
                     2294190..2294314,2294392..2294476))
                     /locus_tag="MYCTH_2312374"
                     /note="CAZy_ID 267917"
                     /codon_start=1
                     /product="glycoside hydrolase family 13 protein"
                     /protein_id="XP_003667046.1"
                     /db_xref="GeneID:11509363"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="JGIDB:Spoth2_2312374"
                     /translation="MDPIAVNSSNTLADSGKLAEDDIPRDGTGVLKLDPWLSPFQDSL
                     KRRYAKAQEWIKRIDETEGGLDKFSKGTDLFGLRVKEDGSIVYREWAPNAVRASLIGD
                     FNKWDNKAHPMKKNEFGVFEITIPPTADGKPAIPHKSKVKITLELPTAEWVDRLPAWI
                     KYVTQDLSVSPAYDARFWNPPPEERYVFKHARPKKPASLRIYEAHVGISSPELRVTTY
                     KEFTKNMLQRIKGLGYNAIQLMAIMEHAYYASFGYQVNNFFAASSRYGEPEDLKELVD
                     VAHSLGLVVLLDVVHSHASKNVLDGLNHFDGTDHQYFHEGGRGRHELWDSRLFNYGHH
                     EVMRFLLSNLRFWMDEYQFDGFRFDGVTSMLYLHHGIGTGFSGGYHEYFGAAVDEEAV
                     AYLMVANEMLHQLYPEVITVAEDVSGMPALCLPLSLGGIGFDYRLAMAIPDMWIKILK
                     ELKDEDWNIGNICWTLTNRRHGEKTIAYAESHDQALVGDKTLMMHLCDAELYTNMSVL
                     TPLTPVIDRGMALHKMIRLLTHGLGGEGWLNFEGNEFGHPEWLDFPREGNQNSFWYAR
                     RQLNLTEDHLLRYQFLNNFDRSMNLCEAKYGWLHSPQAYISLKHEGDKVIVFERAGLV
                     FVFNFHPTRSYTDYRIGIEVPGTYRIVLDSDTKEHGGFCRLDPDTRFFTEPLEWNGRK
                     NCTHVYIPCRTAFILALESTL"
     gene            2295149..2297328
                     /locus_tag="MYCTH_2312381"
                     /db_xref="GeneID:11509364"
     mRNA            join(2295149..2295826,2295914..2296097,2296158..2297328)
                     /locus_tag="MYCTH_2312381"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003666999.1"
                     /db_xref="GeneID:11509364"
     CDS             join(2295376..2295826,2295914..2296097,2296158..2297268)
                     /locus_tag="MYCTH_2312381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667047.1"
                     /db_xref="GeneID:11509364"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="JGIDB:Spoth2_2312381"
                     /translation="MSVLSRARAPTSAATTLWFSRLRRPAYSTSNILLWAPRRSNYSA
                     SGYTSSYDPNQDTGRGPIFNKHTFGVPQFYPRDLKARVDDYVVGQERAKKTICFVIFN
                     HYQGLRRRQHHELQDQRLREKLQRQKYAQEQEDFERAGYNSTRTHPVEDEYPGHHEAV
                     RGTHQMPDSPYEPSADDFYIPEDLSPPDRVKIDKSNLLLIGPTGVGKTYILETLSKKL
                     NVPFTISDCNSFTQAGYIGQDVESCIERLLIEANYDVKAAEHGIVVLDEFDKIARRET
                     VNGRDVGGEGVQQALLKLVEGTKVTINIKEQRSSRATNHPPGGYGPPNPPSTPPTGKA
                     EQYTVDTTNVLFVFCGAFVGLDKTVLRRVAKPSIGFGSDIRGRGTSLSGSKDILPPEM
                     YQHLPHQPPSRGSGGREAGGFTPLDLTTPADLQAYGFIPELIGRLHNICALSPLSLDE
                     LYRILTEPRNSLVAQYTALFETYPSKLAFTRRALYAIAERAAKNETGARGLKMEMERV
                     LAEPMFDAPAPYVLITEGCVKGYEKAGYWGKDGRLEMERRMREEDEGLDAAGTASPGH
                     HAGFEQFRQAGLSGG"
     gene            2297953..2300100
                     /locus_tag="MYCTH_2312382"
                     /db_xref="GeneID:11509365"
     mRNA            2297953..2300100
                     /locus_tag="MYCTH_2312382"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667000.1"
                     /db_xref="GeneID:11509365"
     CDS             2298141..2299715
                     /locus_tag="MYCTH_2312382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667048.1"
                     /db_xref="GeneID:11509365"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Spoth2_2312382"
                     /translation="MSSSTPPQPAPAAATAAMETRDPAATTSSTTTTTTTTTTTTTTT
                     ITPTTTTTIPAATATPGTTTTTKTARNRADITPLPPFQPDLYQRAWCSVPHPTLPLLA
                     TAHAKSVTVFSLATLSKHSALTGGHARSVRAVAWQPPRGRAAPKRLGLVTGSFDATAG
                     LWSYDAERGSGGLEREIKLRGEDDDNNDDDEEEEEGDGGDKEEWEFNLVLEGHENEIK
                     SIAFSPGGQYLATSSRDKSVWIWEDVSGGEDEEEDEWETVAVLNEHDGDVKAVAWAPS
                     HLPNARAGVRRRHYSADVLASASYDNTVRIWREDADGEWVCVAVLEGHDGTVWGLQWE
                     GKERADGRFPRLMTFSADGLIKVWTLRADDEEEEEAGEQQGGNPFKSGFGGVPNTMRR
                     SLREEWDCTAVLPKVHTRDVYSVSWSAETGLVASTGSDGVIAVYAEAEEEETTPSEDV
                     GKGGGGGARNNGTPAPKSNWKVLGTVSKAHGPYEINHITWCKRFDPGAECKGKEEMLV
                     TTGDDGVVRPWQVRIS"
     gene            complement(2300026..2303862)
                     /locus_tag="MYCTH_2312383"
                     /db_xref="GeneID:11509366"
     mRNA            complement(join(2300026..2300794,2300904..2303862))
                     /locus_tag="MYCTH_2312383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667001.1"
                     /db_xref="GeneID:11509366"
     CDS             complement(join(2300253..2300794,2300904..2303487))
                     /locus_tag="MYCTH_2312383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667049.1"
                     /db_xref="GeneID:11509366"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="JGIDB:Spoth2_2312383"
                     /translation="MLRTSIRALQSAASSSSRCFSTATVSARANLRPTASRRPLALAA
                     QKRFESALHNAPEPNDNFLQGNTANYIDEMYLQWKQDPESVHVSWQVYFKNMESGDMP
                     ISQAFTPPPSLVPSTQAVVGLAAGAGVGIGEGADITNHLKVQLLVRAYQARGHHKSKI
                     DPLGIRNASKGFGNIRPKELELDYYQFTEKDLDTEYTLGPGILPRFRREGREKMTLRE
                     IVAACEKIYCGSYGVEFIHIPDREKCDWLRERIEVPQPFKYSIDEKRRILDRLIWSSS
                     FEAFLSTKYPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNV
                     VRKPNESIFSEFAGTSGAEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAE
                     DPVVLGKVRAIQHYNNDETTHRSAMAVLLHGDAAFAAQGVVYECLGFHSLPAFSTGGT
                     IHLVVNNQIGFTTDPRFARSTAYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRA
                     EFKQDVIIDLVCYRKHGHNETDQPSFTQPLMYKRIQEKVPQLDIYVNQLLKEGTFTKE
                     DIEEHKQWVWGMLEESFAKSKDYQPTSKEWTTSAWNGFKSPKELATEILPHTPTGVDR
                     KTLEHIGEVIGTAPEGFNLHRNLKRILANRTKSVLEGKNIDWSTAEALAFGTMVTEGR
                     HVRVSGQDVERGTFSQRHAVFHDQETEDTYTPLQHVSKDQGKFVISNSSLSEYGALGF
                     EYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQFIASGEQKWMQRTGLVMSLPHGYDGQ
                     GPEHSSGRLERFLQLCNEDPRVFPSAEKLQRQHQDCNIQVAYPSTPANLFHILRRQMN
                     RQFRKPLILFFSKSLLRHPLARSNIEEFTGDSQFQWVIADPAHETGAIKPHDQIDRVI
                     ICTGQVYAALHKYRAEKQIDDVAFTRIEQLHPFPWELLRENLDMYPNAKTIVWAQEEP
                     LNAGAWSYTQPRIETLLNQTKHHHRKHVMYAGRNPSASVATGLKASHTKEEQDLLEMA
                     FSVKQDKLKGE"
     gene            2304942..2307178
                     /locus_tag="MYCTH_2312385"
                     /db_xref="GeneID:11509367"
     mRNA            2304942..2307178
                     /locus_tag="MYCTH_2312385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667002.1"
                     /db_xref="GeneID:11509367"
     CDS             2305068..2307032
                     /locus_tag="MYCTH_2312385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667050.1"
                     /db_xref="GeneID:11509367"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="JGIDB:Spoth2_2312385"
                     /translation="MALPRGRTTYKKKEGILTLTDDRSALIWTPMPATGPPTVSLALD
                     NIMNLQQTPDGAPKVILKVVEKPRPGAGEGAAPSQFLFHFTSPTDARAEANSIRDLLS
                     QLLAAARENDPNVPKPAGAAQNGANGEDGGGASAAMSFASTVNAKPAPPKWFDDDALQ
                     ADTELQQSLLKKNEVLAQTYRDALALKPESISEAAFNARFWSSRVGLLRAHAIELNQK
                     KGAYNVLSTIKPRTEDGQFKLSITSEQISMILQQHPLVRRIYNENVPKLTETEFWSRF
                     FLSKLSKKLRGERITDNDNADAIFDRYLNADNTFGFASKITAAQKVPHMIDLEANEEN
                     QGGFKGGNRKDVEMRPRGNIPIIKTLNSLSEKIMANVAPSDLDPSAPDGLLDDTRAFE
                     QLTLRDLRGDTEAARIILNVKEQNKFFSNQEAQSEEAKVYEKQVPSEVLFEVHADLET
                     LDDDGSGGIDLRKAIGIDDDSDSDPDTEKPAHVGSRAARRQAQNQILDGMRKKRSEML
                     GGFGAGGGAAAADEDASPMGIPPEIAQRCVLTNATTTEFLRQFWSAFLSGDPARTREL
                     AYYAESLRRSTDRIDALAAEAEQIRQVVVERRKREIKEHYERTRKKLRWQPPKGGKDS
                     VLALFEATLTAINSALELYVSALGEAKGAK"
     gene            complement(2307566..2311150)
                     /locus_tag="MYCTH_2312386"
                     /db_xref="GeneID:11509368"
     mRNA            complement(2307566..2311150)
                     /locus_tag="MYCTH_2312386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667003.1"
                     /db_xref="GeneID:11509368"
     CDS             complement(2307620..2310928)
                     /locus_tag="MYCTH_2312386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667051.1"
                     /db_xref="GeneID:11509368"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="JGIDB:Spoth2_2312386"
                     /translation="MPTAAGARALLSAQTPSRARRLPRVAAITPAAARTALSTLPHHR
                     CAPCRPSEPAVPGRGFHTSSSLHAARPDEPPPNPEGPPPPPPSPPPSSADSNKDNGAP
                     LPGNGQPAEASGKSEADPAAADADANANANANAKREKLKSAGYGSARARANRNNRVEE
                     PPALELPRWFEVNQISLYERRPIGVAGTLLPRLGEGDREQMLTLMETLLDKAALSDEE
                     VETLKDRLRRFANRQDRDDLILTSLKTRARRIHQGAFWQALLLLYHPLADPAHVERLR
                     QHHAATIDRRQLWWPLPDSLMSDELKRWLSNLRSDAGPGRGFHLSPLAKRPDPEYPIC
                     MELLAAVDSQLAMPPTPSRQDARRPPIVLSMLKGKGPTLAESVVNDIATDLQADVIHL
                     NAHHIARIVGRHVGQNPYSARGALSMLGYAAAEMNGRLAARPNPDADQLGLVAVELPS
                     RLRSFLSPRETTAQGLFDGRWEDMKVNAALEAIVAAVDRERERARLSAAAAAAPALDK
                     GGSADADADPNANANAKLPSARKLIIHLHDYVELSSLYPSIIHKLRAIADRMWRAGRG
                     VVLVGSSSGDMDRSLQWRDQVIELGRDGAHVIPFHADSVKDYSLFEDWDNVLENLFNI
                     KEMLRAVVGDQVPITFITEFMDASGTILSEESHKTIFKLLASHVHDAQWVQRVVSLMG
                     GGRTGSREGYGVLTLNYALKFMLDRNKQWEQINPSVRPPYYSPLHTPRSGSSSSSSSS
                     SFPYSSSSADDPAAFSNLSGAAASKEYNNDEKKLLSGLINAKDIHTTFDQIIVPQETK
                     ESLMGLTTLSLVRPEAFSYGVLKTEHISGCLLYGPPGTGKTLLAKAVAKESGANMLEV
                     SAADINDKWVGQSEKNVQALFSLARKLAPCVIFLDEADALLAARRSGPARAAYRETIT
                     QFLREWDGLTGSRAFIMVATNRPFDLDEAVLRRLPRKILVDLPLAAEREAILRVVLRD
                     EVLAPDVDLARLAAETELYSGSDLKNLCVSAAMEAVREEVRAKEAWSGEGEYRFPDRR
                     VLTRAHFDKGLREISASISGDMQTLKAIRKFDEQYGDAGRKRRVRKGLGFDVVPDDGK
                     GLTGEARVRQVEAA"
     gene            complement(2311209..2318510)
                     /locus_tag="MYCTH_2312387"
                     /db_xref="GeneID:11509369"
     mRNA            complement(join(2311209..2313069,2313156..2313323,
                     2313386..2313570,2313621..2318510))
                     /locus_tag="MYCTH_2312387"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667004.1"
                     /db_xref="GeneID:11509369"
     CDS             complement(join(2311438..2313069,2313156..2313323,
                     2313386..2313570,2313621..2318337))
                     /locus_tag="MYCTH_2312387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667052.1"
                     /db_xref="GeneID:11509369"
                     /db_xref="JGIDB:Spoth2_2312387"
                     /translation="MKSWRELGEVPDSDDDSFDDTDLLDENLNFDWQPQSEDGYNVEG
                     TRVEENHAGPVKDADVWSVPSSPPEQALPYHSTNSAQASQTLTQFPWPAEPSPNPAGQ
                     TSPSTPAESSLDKPSSIPRIPAASNLPSDVFREDEISKSYVRVTSPAPSSSSISSLLS
                     RTPTPPQSPSLPQTHLSPPPARLSAPTNASPPADIVDSEQLSRQTAVRLERSLRPRKP
                     IQQHPYLLESVQYTAFMKSHGIKPVRVIQESRPLRSGAEDEDSQDTDFQAEESQETSA
                     DGLGGLDASGPVLFDDDEDELALTPSLPKTSPHGQQLRTSSQPTNPDQTDATSLSDEE
                     FPPLERLHPVSAKERQRLLKRQRSQLLSSTRRKRPRFVPDSSSQESPRRPRFIPPPPI
                     DIWDLSSSPRVPQVPEEQPQEPGASPKQPAERRPSPPSAPILSPRSTAAVSEDEAADP
                     PVLITEDSQSDPDDVDLPGSTASSCSDSEVVRQNSRRIRGVLPASWLRLDQPQSKPAA
                     RNVKRRTPEPSPDRTVRRGLALPRQGSPKPPGGASLMVFDESEESENELPRRPTESAD
                     DPARAALAAVVIDEDDGASVIEEDTIDWMLPGRKRSYSHTISGRAKRQKRSGTQSVFH
                     GRPNVPSRQPKITQVLPRAKHGVNSTSANRKLTHRQHQKGGTSVASRNISKRAASPPL
                     LSILDVVEPDAPRFVRLAARAVRRKSNLGKASPSNKVISLASRNDNVDALSVLRDWKS
                     GKTKPKIPAPLRKPVSKPKRRPALREISSNATSRPRGPRPHKLIRQSNLDSFVIADEG
                     PQEGQPPERPLASAISPRKPLQGRRLSFHPAQLEEDEAEERPRQLSARKRTLDALYRR
                     RRRTFGASTDDGLDQILDVNFTLQESAAEGQGDEGDIEPGARQSTTPTEGRTRAGRRR
                     FRKTCPPQRVDLDAPQYTRANDPLPPDFSDFEPRECLPQDRNQAQDKLRGLGPYGTHY
                     THHFEVFPLDMGVFFHESTVIGRGLVRDAVDLGLSDRIRHQRPPMSFSLDGRDLRWSR
                     WDDNTSSELGILVDWIAEQLAPNAAANAGFSRKTIEAAEFVLGYVLRSLSVSDEHEEK
                     AFVSRWLEVLSSFIGRFESSDWSTGSEETKTTQLEVVVRFCLATSAVRSISQASNADP
                     VQSTKLDGLLKQSASATIKRLLECGTKELRVLYGDLQRPSLRERGIRSHHLFANCWVV
                     MMRVLESAAIPRSSFWDVTQSVMLSGGVISSSDCQLFERLWQDMFTLLPLTEVDDSGL
                     VVPGMRRTAPMEGWTLPQQLLKRVFQLYQTNPRQPPGFNDYCRALVARCHLLVQQWGW
                     RKGTGIIGTIFDFFGSQNLEHLRNEEVYKSPRFLEELDGSPSLDIEPEDRCFHIFIKL
                     LALTIQRLKELNRPNDIRNLVTRTLPNHNRQYLKENMIHHRDLAALRNHHDLLCTLFW
                     VSPPELRREVHEIEDLIVPGSAHKEACLISVRAWNQLARFVIAKDEGGDAFRPLAMWR
                     NNIFNQVLDQYLSAASDIEQQFRALSSEMAGISKDVRDDMVAKNKPTALDVLHHSVKA
                     SLDVLQRAPTLGAALYGLNTGQLQKVFTSLDYQSPGFDWGILRVALDTIEHLLGRIDQ
                     ASEEQFSSEFDDNLDAPFLEDAVLLVNEHLTKDFFWMARTTLALPQESSARRHNQQVA
                     CAEKTVTLAARIAARFVKNRVTHLLSFFSTGKYGLFPDLPHNMTTPDRRYLPLFLAVL
                     VKNHVFDFKDLGINMLGMWMLAIVKPLRYLRYENYLAEVLQHRDLPFLERATVAVGIP
                     PDYNSNADFFACAIHHMRKSLRECGSVRAKQLREEFRKTLQLVMQKMKEDLALLRSHG
                     GEHGPYIEFVRQVVSLIKSHGVNICAVDPFFMQPSPDYSPSLQDPQLHTAGIVAYGVK
                     LSEGDTTATQPLFHYLFNNFKVSLGNDKLEQECKILSRAMRNGHVTSFMLQCMIPAII
                     QASTQAPDCWALLEVYAVAFQNMLESSWSVPKELGHEDMEHVLGIVTSILAWFQNLGC
                     TASPSLQQLHVMALLATLANTLQPSVASYLFNEVEGGTLVTQLQEAVDRLAALFSELG
                     SYLEDVLSRAGGNDVPQPEIISLSAVLGALPPAPPPPPQQQPTSGGARNPRVEMFANT
                     IISDVRQNWVVTADRVMVRMASPGRTGTTPGGPPLLSQAAVSSSAAASLRGACYGPWE
                     TRAVLERLRAAVGGWMLGSSRDGGRGGGKLKRGKEMVDLDLLF"
     gene            2319867..2321074
                     /locus_tag="MYCTH_2312390"
                     /db_xref="GeneID:11509370"
     mRNA            join(2319867..2320283,2320545..2320738,2320807..2321074)
                     /locus_tag="MYCTH_2312390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667005.1"
                     /db_xref="GeneID:11509370"
     CDS             join(2320055..2320283,2320545..2320738,2320807..2320893)
                     /locus_tag="MYCTH_2312390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667053.1"
                     /db_xref="GeneID:11509370"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="JGIDB:Spoth2_2312390"
                     /translation="MSSILRNSLVRASRHSATTALGYRAASTHAISNPTLANIEKRWE
                     GMPLQEQAELWMALRDRMKGNWADLTLQEKKAAYFVAFGPHGPRALDPPGENKKVAIY
                     TAVGVGFSLLLFAIVRAFANPPPRTMTKEWQEATNEYLKSQKADPLTGLTSEGYSGKG
                     HVQSPPAKA"
     gene            <2322886..>2325084
                     /locus_tag="MYCTH_104076"
                     /db_xref="GeneID:11509371"
     mRNA            join(<2322886..2324806,2324936..>2325084)
                     /locus_tag="MYCTH_104076"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /note="Has EST support"
                     /transcript_id="XM_003667006.1"
                     /db_xref="GeneID:11509371"
     CDS             join(2322886..2324806,2324936..2325084)
                     /locus_tag="MYCTH_104076"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_003667054.1"
                     /db_xref="GeneID:11509371"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Spoth2_104076"
                     /translation="MSRFAKARRLIPPLAVAGAAGGVLYYTYRPRNIPGYEGPVVPPP
                     IYGADGTFKLPRFPRVKSRLEQIADLKKSSSGVGGGGEGKGEGEGEEYDILVIGAGAT
                     GSGVALDAATRGLKVAVVERGDFSCGTSSKSTKLVHGGVRYLEKAVWNLDYAQYELVK
                     EALKERTYFLQTAPHLSSWLPIMLPLDRWWKVPYYWAGTKFYDFLAGSEGIESSYFLT
                     KSKAIDAFPMLKQTDLVGALVYYDGAHNDSRMNVSLAMTAALYGATVVNHMEVTGLLK
                     DDKGKLCGATVKDKIPERDGKPAEEFGIRAKCVINCTGPFTDSIRKMDDPNCKEIVAP
                     ASGVHVILPGYYSPGKMGLIDPATSDGRVIFFLPWQGNTIAGTTDEPAVVSTNPLPDE
                     KSIQWILNEIRHYLSPDINVRRGDVLAAWSGLRPLVKDPKAKNTESLVRSHLVDISES
                     GLLTCAGGKWTTYRQMAEECVDAAIKAFNLQPKPVVNAPRVSGTENVDDGANLDGTCQ
                     THRVRLIGAHGWSRTLFIHLIQHFGVETEVAKHLTESYGDRAWTVAALCRPTDKRFPA
                     RGERISQLYPFVDGEVRYAVRHEYAQTAADVLARRTRLAFLNAQAALEALPKIIDIMS
                     QELGWDKKRQDFEWNETVKFLESMGLPQPMLSVTRKQIEQGKIDWKSSLEYRMYSRHD
                     KPVDEEE"
     gene            complement(2327109..2327955)
                     /locus_tag="MYCTH_2312396"
                     /db_xref="GeneID:11509372"
     mRNA            complement(2327109..2327955)
                     /locus_tag="MYCTH_2312396"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667007.1"
                     /db_xref="GeneID:11509372"
     CDS             complement(2327144..2327425)
                     /locus_tag="MYCTH_2312396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667055.1"
                     /db_xref="GeneID:11509372"
                     /db_xref="JGIDB:Spoth2_2312396"
                     /translation="MLLENTTTTEKRLLHVPPCNEGDREEVDPDPYGWEAELEKRVTH
                     QCAAGTVGLGMSDCCRVPVIQYRRASGAKRTLLRRVLSFGPSAGTNAEG"
     gene            complement(2327956..2329592)
                     /locus_tag="MYCTH_2312397"
                     /db_xref="GeneID:11509451"
     mRNA            complement(2327956..2329592)
                     /locus_tag="MYCTH_2312397"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667008.1"
                     /db_xref="GeneID:11509451"
     CDS             complement(2328086..2329162)
                     /locus_tag="MYCTH_2312397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667056.1"
                     /db_xref="GeneID:11509451"
                     /db_xref="JGIDB:Spoth2_2312397"
                     /translation="MPGAQRRGHATAPMPPRPISRESTQPASVLEGAEGDSIMSASRP
                     PSLALMPPSSACSDPASPPSLRDILTNNAPPPYTLGAFTAFLSQNHCMETLEFTMDAD
                     RYSAAYSNLVGREQASGSRESNEYVSSLWKKIMSAYIVPYGHREVNLPAHVRDRLLSL
                     SYTPVPPDPSELDEAVRIVYELMNDSVLGPFLASVTPQHDWTEDNDPRHARSRLRIPR
                     DMSSSSDEASRSPKVGFLPMFSMPWATEPKSSTTSSSEPAERGLTDSNLNTPSPASTE
                     PMTPPTTPPVSDWELASSPGAVHHRAASSQSSGWKRVGAKLGFGRISRSKRGHSSSAT
                     SAPPGLEEMSRREPDHPRRKTNPL"
     gene            complement(2338740..2342769)
                     /locus_tag="MYCTH_2312400"
                     /db_xref="GeneID:11509452"
     mRNA            complement(join(2338740..2342327,2342461..2342769))
                     /locus_tag="MYCTH_2312400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667009.1"
                     /db_xref="GeneID:11509452"
     CDS             complement(join(2338826..2342327,2342461..2342624))
                     /locus_tag="MYCTH_2312400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667057.1"
                     /db_xref="GeneID:11509452"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="JGIDB:Spoth2_2312400"
                     /translation="MPSQAPTPRATRNSRGLRGSPSPKQVSSAADSRLGDSARVARRR
                     RSSRTPVDTDLSSALGTAVDTPTPRARFAHSPSRIRATALKAISEDQQQPATPTPTIR
                     PTSSRPPIFPPPVSLPPATPYVPTPLPRSSSPLEHPRVTAIRSRPTRSPRRTAPPKTP
                     ARYTRYVTRFIDLTPPISPAATPQSPGSETALFKQRREQEGEDKFARELWIAIRNEHY
                     MKGCWCGPPNIYNSKEEAEAATGHLRFYLAGSENKKLRVLQKKDDHRWHCVCGNNEYH
                     AVYKDLLNSNGKRPAEDTEVDLLTQNQEPRGVEGSQSVERVVAAPTDPVTGAVQSRTL
                     GAAQAKSPAPAQSMWAQTYGILSRAVAIMGSPIVALLDTLRGQFLGDAYETLDTRRTN
                     PANDAIVVKRLKRQAPLSGTEQASSDIDGDGFDDLVWADDPTQRIGLDKLEIICAAFD
                     TQYKIIKDDKVVRGSSIDEIRNQASDPRIYETSFSIFQYQEYLYGPLHPEASDAERAE
                     RWDVAVEGYEQGLLLFGRLVAQIYGPSLLADLRQKHSRLPRRLPVGNNEFRKDCMKLG
                     RFLGFMRSLDCIHNTAFDQALSQMIVDANAIHKQEMPPSYVKAKQDPTETMPGCFPKE
                     SAIVEIPADEVDIEPLYDYRFPDPEPSDGEPEVPGPGVYKMVQHPKGILKPSKARDPS
                     PPSPQYVATPKRNRKLSFISPVSKFIPPSHIPTKVMTPLEEEQFLNAKLKAEVVRDEH
                     STRAFEALKTVSRQPDGPLRLEDKWSLEALERDDQEMGLTYHAQHYGSFLDGLREELE
                     KRVERDSERRAKTLARPPPRRHMVHIPLPPLPSTPERRRRAAHLLEHDSSSPAVSTPG
                     TNPLSRLGPAEQPPKPSEKNRGPRSLEEFFAEEEDDLAISTLKLEQLQIDRQIGEELE
                     TSVQREIEEKRKRKEEEERRERERLLEEERRRKEEERRREQAARQRREADEFAALTGL
                     RRPARPLITALSDDWDARVANAARANPTAELVKTLEGQPLTRRDFEEKLLPPTAWLND
                     NVIIGSILHIADYVNRAKGATDQEPKCAAFTSYFWPRVLSHGPGGCGRLLRRAGVRKA
                     NLLDIDTVLIPICAQSHWTLAVIRPGKRTVAHIDSMRGGGGDERVKAKLLELVRFILE
                     EKFVESEWRAVDYEAPLQTNGWDCGVFTITNALCMAIGLNPKVSYTERELTLQRRRLA
                     AVLLNEGFKGEFSLDGL"
     gene            <2344669..>2345244
                     /locus_tag="MYCTH_2130987"
                     /db_xref="GeneID:11509453"
     mRNA            join(<2344669..2344969,2345045..>2345244)
                     /locus_tag="MYCTH_2130987"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667010.1"
                     /db_xref="GeneID:11509453"
     CDS             join(2344669..2344969,2345045..2345244)
                     /locus_tag="MYCTH_2130987"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667058.1"
                     /db_xref="GeneID:11509453"
                     /db_xref="JGIDB:Spoth2_2130987"
                     /translation="MESQTLKKAEKPKLFDGKTSYSVSRQKKPITNFQRCSNRSPCPL
                     PRRRSQAALFKQVTKTATAADTSGLRDGKEGMSEFLVEPPSPNFGSSFCDSYEEAQAL
                     RRYWAKSNNRETSCAVECQAGGDENMKDEDSDEYVWDDAAEDDEQIKERLEEARLNTI
                     KNNLEK"
     gene            <2345920..>2349814
                     /locus_tag="MYCTH_2136117"
                     /db_xref="GeneID:11509454"
     mRNA            join(<2345920..2346024,2346291..2346613,2346742..2347112,
                     2347173..2348194,2348273..2348947,2349001..2349291,
                     2349362..>2349814)
                     /locus_tag="MYCTH_2136117"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667011.1"
                     /db_xref="GeneID:11509454"
     CDS             join(2345920..2346024,2346291..2346613,2346742..2347112,
                     2347173..2348194,2348273..2348947,2349001..2349291,
                     2349362..2349814)
                     /locus_tag="MYCTH_2136117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667059.1"
                     /db_xref="GeneID:11509454"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR011498"
                     /db_xref="JGIDB:Spoth2_2136117"
                     /translation="MARKRKGTQQDDGAAAGAGQVKSAQAKAQDDQVMATNSSSIVSK
                     RSVEKLYHADEPPFFRYFVPKFQRRAPLINRGYWLRLRAVDVLVRNFLRTLRRPRQQQ
                     HQQHGRPEEGGEDEEDEEEEEEREKRKRGRKGVVVNLGCGSDVLPWQCLTRYPEDCAG
                     VKFVDVDFPDLIERKRRTVLGTPELLRAFTGVKEASASIAPIAFESEQYVQIGCDLRD
                     LGTLQKGLEAAVGDLSECDFIFVAEVSITYMEREGADEVIWWASTVGNAEFVLLEQIL
                     PDGSQHPFASTMLTHFDKLNTQLKSVSSYPTVADQYERFSSRGWDSVNVRTLWQVWAD
                     ETFLSRSERLQLDEIEEFDEWEEFALFASHYCLVHAKVGSDAAAIPAPSLPVSAEIPA
                     EPTEMRFNECPGVKGQRRFAAAMWLSPGGSDEQTQLSVLNVLGLGSKSRLQSCDVFRQ
                     GGLDGKEPLTFGGGGPTARMCHSLTDLGGNEVLLAGGRGRPCDPLKDCWLFDKETKTW
                     KQTHDLPTPLYRHSVTALGRSGLALLVGGRGEMAFGGCLVYHPEAGWVDCDIVGEKPA
                     AVYGAVLSCSGESSGGVFNGVYAGGLEDSLISDQIMYWEADKPTIKFRPMSITGILGT
                     DAERRLLTRFGATGLQHGDVLVLLGGVARDHLLTRRDEVLLCSVSKGELTVTCQLTVE
                     SSGAQGSAPRPLFVGHSAVLLPDGSVVVVGGGATCFSMGTFWNKGVYTIRIPGLGTAE
                     ARVSPSLPQWVYEKSIDIAPTQRSLPVPTKNQQSGEPAQITAIPRLKLKSAGDFLEIV
                     REGRPAVLEGLDLGRCVSTWTLEYLVDRVGSDRKVVIHEAATQAMDFTTKNFRYVTTE
                     LGDFVRKVKQGERVYLRALSHEKPSERPAMLADDFPALAADFLLPPELSLVEESLFSS
                     VLRLSGPVNMWLHYDVMANVYCQIGGSKRLLLFPPSDVERLSFAPGASSSSVDVFSSL
                     GSPELAHTHPQEAVLSPGEVLFLPPLWLHTATPTSKESIAVNVFFKDLDSVHYAAGRD
                     VYGNRDLAAYEKGRQDIARIANSFKKLPAEAREFYLLRLADELREKARG"
     gene            2350727..2352484
                     /locus_tag="MYCTH_2316652"
                     /db_xref="GeneID:11509455"
     mRNA            join(2350727..2350974,2351088..2351507,2351579..2351911,
                     2352016..2352484)
                     /locus_tag="MYCTH_2316652"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667012.1"
                     /db_xref="GeneID:11509455"
     CDS             join(2350853..2350974,2351088..2351507,2351579..2351911,
                     2352016..2352067)
                     /locus_tag="MYCTH_2316652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667060.1"
                     /db_xref="GeneID:11509455"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Spoth2_2316652"
                     /translation="MAAKVDTPAAPLSGVQLYSRFALAGAICCSVTHGALTPVDVVKT
                     RIQLDPATYNNGMIGGFKKVVQNEGAAALLTGAGPTFAGYFLQGAFKFGGYEFFKQQW
                     INYLGYDTASKYRTGVYLASSAAAEFFADIALCPLEATRIRLVSEPTYASGLVSGFGK
                     MLRQEGVGAFYAGFGPILFKQIPYTMAKFVVYEKVAEAVFRVFPKKDMSNSMQTVANL
                     GSGLIAGFAAAIVSQPADTMLSKINKTKGAPGESTTSRLIKIAKELGLRGSYAGIGAR
                     LFMVGTLTAGQFAIYGDVKRVLGAVGGIEISK"
     gene            2353059..2355280
                     /locus_tag="MYCTH_2312411"
                     /db_xref="GeneID:11509456"
     mRNA            join(2353059..2353166,2353236..2355280)
                     /locus_tag="MYCTH_2312411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667013.1"
                     /db_xref="GeneID:11509456"
     CDS             2353254..2355155
                     /locus_tag="MYCTH_2312411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667061.1"
                     /db_xref="GeneID:11509456"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2312411"
                     /translation="MASLPPRPATRGDDEASPLLCSPSSSMLSAVSSPASTTTTASSS
                     SSLRSASSRRRRQARLRRSLSLVSALLSALCAGSVTIFSLYGSVLQQRLRYSQFEVNG
                     LASAASVAMYAPVSLLGYLCDRAGPAPLSLLAALAFGGGYAGAAAAYVRAERVVAGHG
                     GGVGGGGDGNDNNDDNDGSAAHHWYALMVLAFVAIGVGTCAMYLSAVATCAKNFGRGK
                     HRGLAVALPIAAFGLSGMWLSQVGSRLFANRQLPSGGAESEVDVPRFFVFLAVLLVAV
                     GVAGAFGLQIVDEEDLIEEAVEELERSGILDGSAMLTPGRAAAEIRGNGYGAVAERAD
                     PFDELEDVKDPEEEEARLRKQWVLNAETRRFLTDHTMWCFALGFFFMIGPGEAFINNM
                     GTVIKTLYPPNPAPRYGGGGAPTSAATHVSIVGVTSTAMRLLTGTLTDLLAPSPGAGH
                     VQITSSSSGGGDRRRLSVSRVTFLLFFAALLSLGLAGLAAGLVQNHGGRFWIVSGLVG
                     AGYGAVFSLTPIIITVIWGVENFATNWGIVAMFPALGATLWGVVYSAVYQAGAQRQAS
                     PGRAGGVGAGGDARSGEGDDDDNNLCYGRECYAPAFWAMAASVWVACALVLWAWKGRK
                     GWAQRGIVV"
     gene            2356987..2359394
                     /locus_tag="MYCTH_2312413"
                     /db_xref="GeneID:11509457"
     mRNA            join(2356987..2357549,2357658..2357672,2357774..2359394)
                     /locus_tag="MYCTH_2312413"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667014.1"
                     /db_xref="GeneID:11509457"
     CDS             join(2357301..2357549,2357658..2357672,2357774..2358997)
                     /locus_tag="MYCTH_2312413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667062.1"
                     /db_xref="GeneID:11509457"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Spoth2_2312413"
                     /translation="MATAVSEDVAIHEGTAPSDDRDAHNDSEKVVPLEDAVDEESGTR
                     SPQSGQQLQRWNDPAVNIFRYFSILYSFILMGMTDGALGALLPYIESYYSISYTVVSL
                     VFLSPFAGYLLAALLNNQIHHRLGQVGVAFMGPVSRLIGIVPLVFHPPYPALPVILLF
                     TGFGNGIEDSAWNAWVGNMHRANELLGVLHGGYGLGGTIGPLIATAMVTKGGLPWYTF
                     YYVMIGLDGLVLFLMVPAFWRATAEVHRAAVRAGYAGEDSGDGRGGEGEEGKRTTTRT
                     VLRSPVVWLVALFLLGYVGAEVSLGGWITTFMLRVRHAEPFLAGLTSTFFWLGLTVGR
                     VVLGFVTGKIGEKVAIAAYLLLSVGLQLLYWLVPNIAASVTFVTFLGFFLGPLFPAAV
                     VAATKLLPTSYHVSAIGFAAAFGGGGAALFPFAVGAIAQSKGVEVLQPIVLAILLFIL
                     LIWLMLPGGLKTGGLENARDNNESVGDGFRKAFAWLKERLQPKRV"
     gene            complement(2363416..2365783)
                     /locus_tag="MYCTH_2312415"
                     /db_xref="GeneID:11509458"
     mRNA            complement(2363416..2365783)
                     /locus_tag="MYCTH_2312415"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667015.1"
                     /db_xref="GeneID:11509458"
     CDS             complement(2363489..2365624)
                     /locus_tag="MYCTH_2312415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667063.1"
                     /db_xref="GeneID:11509458"
                     /db_xref="InterPro:IPR006530"
                     /db_xref="JGIDB:Spoth2_2312415"
                     /translation="MSTLGNSIYTQAFNFGSFNKNGVDPRTGQYTFSIPIFETPSAAR
                     NCPPLRLSIKYNPLYLREFGLGRGWALNLSTYQRVEQGGRARAALVLSTGEHYRVTET
                     PSSCSVDDQKLRSFSFTKTSSTVQHNEIVEDGMAGRYYKIAHKSGLVEILSDDNGRYN
                     TAVPVKIYASTGRSLKLVWDRHGEEPRLVKIRDGDDDLLSLHYTSSLVQVKRSPGTAE
                     SNVISLTLDDDGLLAHVSFPISQAGGQDLERYARPAWAFKYKTFSNDITCLTTVVSPA
                     GLVEEVQHREDGHRLPGFSRFSYEYIPYVVSHIVKPGCGRPPTETTYSFSTRNFLGYG
                     GSSVWIDDEDNLYRMQGGYLYTCTSFVKGGPETRYTYDKFHLLTEVAQRKGDKHVVQR
                     MSYHDLLAQGLDSFAAQPPQFQLPSTIRTTYQDASTGQSRVETVHHDFDEWGNPTREV
                     DADGTVTYSSFYPASGHTDQESGEVWCPADPHGFKRYLWDEKTIPSRGAEPSSEPPVH
                     CVSYRYQGIPTAGTTSSSGEHFVVARQCRVLRGGKAISITDFSCVNQPGSRDHGRPSR
                     KVTHLPSEGQHQEVVDWSYNYDAEEGTVTEQVRVTTGGGGNRPVTGEAETGAREEKSA
                     FSLSSGLVVSHVDATGITNHFRYDSLGRLASLTISRGTPYEATRRYEYAPGVQQDDGS
                     GGGKRCYSYRRRWGDNADVHRRTGQGVSG"
     gene            complement(2366430..>2368348)
                     /locus_tag="MYCTH_2141041"
                     /db_xref="GeneID:11509459"
     mRNA            complement(join(2366430..2367062,2367150..2367682,
                     2367861..2368075,2368274..>2368348))
                     /locus_tag="MYCTH_2141041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667016.1"
                     /db_xref="GeneID:11509459"
     CDS             complement(join(2366683..2367062,2367150..2367682,
                     2367861..2368075,2368274..2368348))
                     /locus_tag="MYCTH_2141041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667064.1"
                     /db_xref="GeneID:11509459"
                     /db_xref="JGIDB:Spoth2_2141041"
                     /translation="MAPSPLPFMITLLMSTALARSDNEQLHVESSTDRCASASAIAFM
                     QGLYPPIPHAACDSDVPNHHWLSNGSILNNPLNGYQYPNIRTLAPDRDPDSIWVFSEA
                     FPLSQTNFYNAHELYDCAAYRWNHESSSASAMTSDDLEALRQLAWQEQSLKYGHSDNV
                     QRDSSFAIAGRTLASRVAAIFAENIESRGERNKLSLAFTTHEPFLGFFALANLTVGPS
                     NHLFSQLPNPGATLTFELFSVDEPVGSHNADSSKADASYPVDHYNKTSGSHRVRARLP
                     TSRNSSTISPSFPDTDHLYVRCLYQNPDRYNYSIKNGNSTRELTPCPLFDNTHTAIPF
                     KHFNAIVSAIGIADAASWCNACGSGDTVFFCKGAEPRTERQQHHLLAALAGSAGTLLA
                     VSLIGFLE"
     gene            2370324..2372191
                     /locus_tag="MYCTH_112498"
                     /db_xref="GeneID:11509460"
     mRNA            join(2370324..2370808,2370881..2371109,2371164..2372191)
                     /locus_tag="MYCTH_112498"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003667017.1"
                     /db_xref="GeneID:11509460"
     CDS             join(2370531..2370808,2370881..2371109,2371164..2371787)
                     /locus_tag="MYCTH_112498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667065.1"
                     /db_xref="GeneID:11509460"
                     /db_xref="JGIDB:Spoth2_112498"
                     /translation="MTVIGPLTTTFRAPSSCTTTSPQVYQIWSASHSRYVEGPLFTSG
                     SFDCFPSGYDPAPTNYYSPGWCPYGYTTACSSLASAHRTTETAVICCPTNFRYTCRAS
                     ALSNGHSIGCTTAWTNAMAVLGVTVVKNGEVRTTTVVSETSNAITAYGIQVRFKSNDP
                     TPTSSDDDPAFFAASRTPSPAASSSTHLLVPTQPPSSSSSFSSSTTSFSSSSSSSGGV
                     STSAAIGIGLGSAVAALLLAGAIGLFFFLRWRRKKRLKKAPSDIPPPVPPKDKFPPSS
                     RSPFPYRTVPPPYELSEEAASPRRRSMSISKQRLSFSPATGTAPTTPGGLRDSGVLAG
                     QEAAELEVPGTMTVRDRATPESERSGWTDRHARVGNMTMPWI"
     gene            2372668..2373741
                     /locus_tag="MYCTH_2316657"
                     /db_xref="GeneID:11509461"
     mRNA            join(2372668..2373059,2373145..2373741)
                     /locus_tag="MYCTH_2316657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667018.1"
                     /db_xref="GeneID:11509461"
     CDS             join(2372952..2373059,2373145..2373312)
                     /locus_tag="MYCTH_2316657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667066.1"
                     /db_xref="GeneID:11509461"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Spoth2_2316657"
                     /translation="MSFVPVNPRPFLQDLVNKDVIVRLKWGETEYKGRLVSIDSYMNI
                     QLSNTEEFIDRKFTGALGQVLIRCNNVLYVKAADNAGEGDKDTKMEG"
     gene            complement(<2373694..>2376242)
                     /locus_tag="MYCTH_2071301"
                     /db_xref="GeneID:11509462"
     mRNA            complement(join(<2373694..2373873,2373936..2375381,
                     2375436..2376047,2376108..>2376242))
                     /locus_tag="MYCTH_2071301"
                     /product="methyltransferase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003667019.1"
                     /db_xref="GeneID:11509462"
     CDS             complement(join(2373694..2373873,2373936..2375381,
                     2375436..2376047,2376108..2376242))
                     /locus_tag="MYCTH_2071301"
                     /codon_start=1
                     /product="methyltransferase-like protein"
                     /protein_id="XP_003667067.1"
                     /db_xref="GeneID:11509462"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="JGIDB:Spoth2_2071301"
                     /translation="MASGSSLNPESDSFESRPAFYIGQHDSSRKEALTDDQYAQVLDS
                     GFRFVTAPITNDHFFKRVVNLYRDYLKEREQWAQQGELAVGHQANPSLPGPVVPTLTD
                     EDTSVYPSNYIGSLALYSSPWIDLCSSDPHIASISRQVLNLEAAYANFCGARTIVVPG
                     PRRDDSSRGIAQYARAIREVLHVAGRANIIIHLPMYREPGLEEKAETLSSIFGIEDGA
                     GPNAKKEVDLFGTWDSWNTIRSVCCYSMRLFFTAIRIPRRVPERTLQERWFAEPLHYL
                     TISKEVFQPNRAGHPSLSRHHQDLINRYMRLRNAPWLLLCDVGPSTEQLAALLDETAS
                     EFPSLAEANQALKENRRPHMPAMNAYVGYMKYLERQQPPFSPMETPALTSFQDWLQPP
                     LQPLADNLESATYEVFEGDPVKYDQYEKAITEAMIEWRELKKPTSTSTPENPSNPELV
                     VTVAGAGRGPLVTRALRAAEKTGTPIQIWALEKNQDAYVYLLRKNKMDWDNKVTVVKT
                     DMRGWEGPGLRGREDAIGKVDILVTELLGSFGDNELSPECLDGIQNHLARPHGISIPH
                     SYTAHLSPISTPRLYADISSRIVGDPNAFETPWVVRLFALDYVAQKVPGHPRFQQAWE
                     FVHPVQVLRADEFAAVHGKAARYSTGGVGSMAGSSGTNEHNARYCHLTFVCPTRGVVH
                     GLAGFFESVLYAPQTGKGKQPVEISILPDQIDRKSKDMISWFPIFFPLKKPLYFPQDT
                     ELEVSMWRQTDDTKVWYEWLVEAYAWVGPNTRIKVGESELHSSRKVACLM"
     gene            2376801..2379651
                     /locus_tag="MYCTH_2312423"
                     /db_xref="GeneID:11509463"
     mRNA            join(2376801..2379143,2379222..2379651)
                     /locus_tag="MYCTH_2312423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667020.1"
                     /db_xref="GeneID:11509463"
     CDS             join(2376969..2379143,2379222..2379338)
                     /locus_tag="MYCTH_2312423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667068.1"
                     /db_xref="GeneID:11509463"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="JGIDB:Spoth2_2312423"
                     /translation="MAEPSKSLKRSSTEREGTQDSKRVKTNGDGDAKMDEKPNPYLAH
                     LNEGFKSPLDDFERHKTTALQAAKAEDSDINPWTGRPHSQQYFKILKTRRDLPVHKQR
                     QEFLDMYHSTQILVFVGETGSGKTTQIPQYVLYDELPHLTGKLIACTQPRRVAAMSVA
                     QRVADELDVNLGEEVGYSIRFENKTSPKTLLKYMTDGQLLREAMHDHDMSRYGCIILD
                     EAHERTLATDILMALLKQISERRKDLKIIVMSATLDAQKFQTYFFNAPLLAVPGRTHP
                     VEIFYTPEPERDYVEAAVRTVLQIHASEPEGDILLFLTGEEEIEDACRRISLEVDEMI
                     RESDAGPMSVYPLYGTLPPHQQQRIFDKAPEPFRKGGRPGRKCIVATNIAETSLTIDG
                     IVYVVDPGFSKQKIYNPRTRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEAAF
                     KKELIEQTYPEILRSNLANTVLELKKLGVEDLVHFDLMDPPAPETMMRALEELNYLAC
                     LDDDGELTALGSLASEFPLDPALAVMLISSPEFYCSNEILSITSLLSVPQIWVRPNNA
                     RKRADEMKQQFAHPDGDHLTLLNAYHAYKGAEQAGEDVKKWCHEHFLSYRHLSSADNV
                     RAQLKRIMETHNIELVSTPFQNKEYYVNIRRALLAGFFMQVAMRESSGSKVYKTVKDD
                     QLVMIHPSTTVTTPYDWVVYNEFVLTTKQYVRTVTNIRPEWLFEIAPAYYDIDTFEKG
                     EIKNALIRVSEKIRRRQALKGGR"
     gene            2382684..2383966
                     /locus_tag="MYCTH_2085008"
                     /db_xref="GeneID:11509464"
     mRNA            join(2382684..2382972,2383036..2383966)
                     /locus_tag="MYCTH_2085008"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667021.1"
                     /db_xref="GeneID:11509464"
     CDS             join(2382868..2382972,2383036..2383350)
                     /locus_tag="MYCTH_2085008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667069.1"
                     /db_xref="GeneID:11509464"
                     /db_xref="JGIDB:Spoth2_2085008"
                     /translation="MSGSGGFYKYRCKYFYTYNCPNWVYCNGHACAMCLAEGRDSTES
                     EATAPATWQQQVQQHLRRPNVGSAYTEICVPQAIHGTLRYTVMEIIPTDEPGPGAYWV
                     LRQKAMAAQALPYSTFTTSDTPRPVMTSIGVTGQVAC"
     gene            complement(2387070..2390094)
                     /locus_tag="MYCTH_2312426"
                     /db_xref="GeneID:11509465"
     mRNA            complement(join(2387070..2389424,2389484..2390094))
                     /locus_tag="MYCTH_2312426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667022.1"
                     /db_xref="GeneID:11509465"
     CDS             complement(join(2387191..2389424,2389484..2389793))
                     /locus_tag="MYCTH_2312426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667070.1"
                     /db_xref="GeneID:11509465"
                     /db_xref="JGIDB:Spoth2_2312426"
                     /translation="MERSDGVRTTLEFVFSVHPTSTVRLSEAAVPQKRGANITQDALN
                     LACNLLSTPASVPPEEWYAAVAPQLLALLDKGNDEPELVKAASYIIGFGILGKRATGA
                     PGTAGWKYFAEPMLFRIKPPPGLPGATGTEDSEIIDLSKDKVIVSCTDLSTALRRLHA
                     LVVAHPNPGLCKRLLSPLLLSLWTLATWDETVQQTVVERVCEPALALLKIFLKLTPSP
                     DLILLLVQNMGYVGGYNSSSPEWMYKAINDSEIAIVDTKQPIRSASASSPRLTLEDIE
                     RKVPKLLDLVTSTLSDADVSIAFLELFNSWLKSARRSKEPSIMIKQDQEQEDPISRLV
                     EMRTLQAMMEKFPEKLATQPKHILNLVSQILSNSGEKAEDEDEVISVALSLLNMIVTT
                     PGFQKSRVNPETLALIESSLDTLAKSPADFSQTASNLRLLLLYRDEVDPAESTSAAPT
                     DRQVEDRKTYSLAISYITAPDSPPPVRSEGVNLLSTLITSRSPVLDIPGILVLLGGLL
                     ADEDEYIYLRVIKAYTLLCDAHPRSVVRELTDRFVDARETQALDARLRAGEALLQVVQ
                     RLGETFTGDLARETATALVTVAGRRPRRPRTEARRQREKAARERREREARDAWGGEVP
                     DFSDPDDEDEDDDDVLGTGGGGGNSSLTREAKRRRKEVIERIVQGWEGKRGSEDVRVR
                     ASALSVLGAAVEANVAGLGRELVSGAVDLCVAVLQLEREEEKGILRRAAVMFVLSFVR
                     ALEDAREKGRDLGFGFGARAQEDVMRTLRYVAETDNDGLVVQHARDVVESLENWQVVR
                     LMPSRTAAAPAFGGGLTRLAGLEVNPERSAPAAGSGGPGPAKPRIEEVE"
     gene            complement(<2393255..>2393410)
                     /locus_tag="MYCTH_57398"
                     /db_xref="GeneID:11509466"
     mRNA            complement(<2393255..>2393410)
                     /locus_tag="MYCTH_57398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667023.1"
                     /db_xref="GeneID:11509466"
     CDS             complement(2393255..2393410)
                     /locus_tag="MYCTH_57398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667071.1"
                     /db_xref="GeneID:11509466"
                     /db_xref="JGIDB:Spoth2_57398"
                     /translation="MGKKFTYNTRNSLVVTDPTTTRALSSLTKAERTGCRAFYWVWSY
                     VLGRVGN"
     gene            2393452..2394269
                     /locus_tag="MYCTH_2312429"
                     /db_xref="GeneID:11509467"
     mRNA            2393452..2394269
                     /locus_tag="MYCTH_2312429"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667024.1"
                     /db_xref="GeneID:11509467"
     CDS             2393482..2393946
                     /locus_tag="MYCTH_2312429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667072.1"
                     /db_xref="GeneID:11509467"
                     /db_xref="JGIDB:Spoth2_2312429"
                     /translation="MRGSTRTMFRFEHGQILQGRRSSYTIAAALRNRPGGPWLATDVV
                     LPIVSAVNLFLTRSSGPNQETVTVKTAPAKRLDNESRVLRLFQGCDSIRQLVDEVEDP
                     RSLVLEYMDDNVVNLLKTKRLPRVEAKRALKAAVQGLIALHDKNIVHTAAFY"
     gene            2394271..2394787
                     /locus_tag="MYCTH_2312431"
                     /db_xref="GeneID:11509468"
     mRNA            2394271..2394787
                     /locus_tag="MYCTH_2312431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667025.1"
                     /db_xref="GeneID:11509468"
     CDS             2394307..2394609
                     /locus_tag="MYCTH_2312431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667073.1"
                     /db_xref="GeneID:11509468"
                     /db_xref="JGIDB:Spoth2_2312431"
                     /translation="MFLPRNAPPPGDPQLSLQVLQIQNYFYGPISRQALHGLADDSIL
                     PLLEQFEKNYQPFPLSSASPKITQEDLDFFGHIMKIDPRQRPTAKEISGHPWFNGV"
     gene            2395571..2398031
                     /locus_tag="MYCTH_2312433"
                     /db_xref="GeneID:11509469"
     mRNA            join(2395571..2396726,2396783..2398031)
                     /locus_tag="MYCTH_2312433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667026.1"
                     /db_xref="GeneID:11509469"
     CDS             join(2395629..2396726,2396783..2397718)
                     /locus_tag="MYCTH_2312433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667074.1"
                     /db_xref="GeneID:11509469"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Spoth2_2312433"
                     /translation="MAPRREILDSEDDGSDFGDCSEPAHAESHEIETAGEGPHEAVGV
                     GASNNPSTDSADPAFSQPISDGQRGVSDVKEAAPDAGPNDASVSAWTDMSSAPPPGKK
                     PQIEDSLLTSITDPAPKGRESRRTTTRNVGQAETIDLTNVTTPRKGAASETSDVWDVP
                     PSTNSQRATRTAGKRKAAQLSLEQEPMRRTPPPDTQDPYAFPDATPPRKRSRRGTPSS
                     SARQPPASSPVMLIPTEELPCSDRRTRSSGRKKVGSDGVGSTLPDTAPPSLYVTQSAL
                     TASQKREFQVVDLSSEPMPGVPRESEVHEEFSAAQSSGAGEMYRSSMATTIAYPTPSR
                     VALQRRLPDVPGEMGDDCASSRTSPGCDVGYQQSSPDVLADMTSTTALRSRRGSKAKD
                     ASLTGPELSEREPPSSARRAKKRKVVREIEDGHQEPDPLGTTRENTETPPQATETQRG
                     FVEDLSHIAAQSGKDVNDEDFVPEADPTDAEVMEKQGPTPKPAAKGKKGKKRKGSRTQ
                     AAAPEPDEPAQTSLVAPAETSPGAAETAEPPAKRKRGRPRKSDASKPQPEPESEEQVP
                     EQQPEKDAGPEPEAHTAPQPLAEVDRHNSQPDPRVAASDAGDTIGETESGEKENKVAV
                     EKDAAATDKVAEKEKQQAAKDIIKPALPKVQYRVGLSRRTRIAPLLKSLKRAA"
     gene            2399031..2403131
                     /locus_tag="MYCTH_2312435"
                     /db_xref="GeneID:11509470"
     mRNA            join(2399031..2400327,2400385..2402555,2402722..2403131)
                     /locus_tag="MYCTH_2312435"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667027.1"
                     /db_xref="GeneID:11509470"
     CDS             join(2399120..2400327,2400385..2402281)
                     /locus_tag="MYCTH_2312435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667075.1"
                     /db_xref="GeneID:11509470"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="JGIDB:Spoth2_2312435"
                     /translation="MTTTSHPRSHTLTPPCRLAPAPSPAPTPGLEDIPPLRAQFFYAS
                     HIPIDDPLSPATIAGSSSSSSSADKSKPSSSKLPLRPFSPGDNAALERAWLGLGSDRH
                     RRIHALSRRDRSPASGLSSENAEKLAAIVAALAAKHHEKHDREGQQASGAAGVAATAT
                     TAAAAADGGLATDSSAMMDAPLENDGVSLCCAELAMDASAELRREFCAVTRRRQPALD
                     HDRVLEGVMAQLARLRMEAEGTAARQPCDSGLSSTAPGAGPALHAVGSLGARSSTTPP
                     VDGAPPPLASSLPVGGLVPARPPVLDDGISGKPFVRVEPAPRSNRSSGIATPDDRPAK
                     NVLRSRARGDSRASARGRPAAERLEDSVEVPVGISRLHMVSLPVLQMKPIYWSPVNDI
                     ATVLRATWFYRDTMVPVEPMVANQLEAGYRELRPWTETWRDEIRSALDVGPLGEEKIS
                     HRLWPEVPDKRHKNKDGLLPEPPISSDPFCAARCFSGEAATEGSLEPVHAEENTALPP
                     PESRMYSNHHVIYKDGSTAFLLKPSQKPSAYYGRRPLSKIMKGITVGLPVVRGFDRAA
                     WERVHDKGASSRGKSAAALTPEAELRQIAEQGGCPGCQLDKDRGQVTDLVLVIHGIGQ
                     KLSERVESFHFTHAVNAFRRAINIELENPAVKSVLRPGQNGIMVLPVNWRHLLSFEDE
                     NPPRQEHRTAYCPEGFTLKDIEPPTIPAVRSMISDVMFDIPYYMSHLKPKMIAALVGE
                     ANRVYRLWCSNNPGFSEKGRVHLIAHSLGSAMAIEVLSKQPTRVPRPLDLSKSTPDTR
                     FFEFDTTNLFLLGSPAGFFLLLERSGLVPRRGRLKPGADAADTVAKDVVGDVGMFGCI
                     AVDNIYNILAKEDPIAYLLNGTIDPIYAASLKTAYVPSTNTSFFQSVGNAVRGLTGTS
                     RHPAAAAAAATASELGKRPPLTARLPSQLELEVHDFTREEIAERKAFLLNDNGQIDYF
                     LRSGGGPLEIQYLNMLSAHTSYWTNQDLVRLLCVEIGREPGKAHALASMRAVKTKGRI
                     LGQF"
     gene            complement(<2403173..>2406171)
                     /locus_tag="MYCTH_104059"
                     /db_xref="GeneID:11509471"
     mRNA            complement(join(<2403173..2404558,2404639..2404736,
                     2404791..2405121,2405183..2405299,2405363..2405616,
                     2405683..2405814,2405872..2405891,2406040..2406084,
                     2406155..>2406171))
                     /locus_tag="MYCTH_104059"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667028.1"
                     /db_xref="GeneID:11509471"
     CDS             complement(join(2403173..2404558,2404639..2404736,
                     2404791..2405121,2405183..2405299,2405363..2405616,
                     2405683..2405814,2405872..2405891,2406040..2406084,
                     2406155..2406171))
                     /locus_tag="MYCTH_104059"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667076.1"
                     /db_xref="GeneID:11509471"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="JGIDB:Spoth2_104059"
                     /translation="MEFNIDDLPVLFPYPRIYPGNYMVDLKKTLDAGGNCVLEMPSGT
                     GKTVTLLSLIVAYQQYYPSHRKLIYCSRTMSEIEKALVELKALMKFRAERLGYEEEFR
                     GLGLTSRKNLCLHPSVKREKSGNVVDARCRSLTAGFIKEKKEKGEDVEVCVYHDNLDL
                     LEPHNLIPNGVWTFDGILRYGEQHKQCPYFTARRMMQYCNVIIYSYHYLLDPKIAERV
                     SRELSKDCIVVFDEAHNIDNVCIEALSTDITDDSLRKATRGAQNLENKINEMRESDQQ
                     KLQDEYEKLVEGLKGADDGRQEDSFMANPTLPDDLLKEAVPGNIRRAEHFVAFLRRFI
                     EYLKTRMKVRQVISETPPSFLAHLKEHTFIEKKPLRFCAERLTSLVRTLELTNIEDYQ
                     PLQEVATFATLVATYEKGFLLILEPFESDTAEVPNPVLHFTCLDAAIAIKPVFDRFSS
                     VVITSGTLSPLEMYPKMLNFPTVVQESYSMTLARRSFLPMIVTRGSDQASISTSFQVR
                     NEPSVVRNYGNLLTEFAKITPDGMVVFFPSYLYMESIISMWQGMGILDEVWKYKLILV
                     ETPDAQETSLALETYRTACCNGRGAVLLCVARGKVSEGIDFDHQYGRTVLCIGVPFQY
                     TESRILKARLEFLRETYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGLMVLADRRFQ
                     RKRAQLPKWISQALLDADVNLSTDMAVSSARRFLRTMAQPFRAKDQEGISTWSIDDLR
                     RHQEKMDEERIKELQAQRERELNPALAAQAAVAEDGGVSDYDMDDDDEAELMALDNKQ
                     G"
     gene            2416681..2418532
                     /locus_tag="MYCTH_2312442"
                     /db_xref="GeneID:11509472"
     mRNA            join(2416681..2417994,2418176..2418532)
                     /locus_tag="MYCTH_2312442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667029.1"
                     /db_xref="GeneID:11509472"
     CDS             join(2416943..2417994,2418176..2418440)
                     /locus_tag="MYCTH_2312442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667077.1"
                     /db_xref="GeneID:11509472"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Spoth2_2312442"
                     /translation="MEQTPPPSLTRSPSSPANTYCSSERSSLGYPSPGLVEQQYKISS
                     MYGDQSCVTPPMDPELSLPPLDSMGHPDWNNPTVIHPMSSASGMPSILSADYETFSHY
                     PYNQEVYQAHPTSQPPSVHASTPPPTGSAPRSPAGPMRTPYTPATSVPVPAPAPMTPR
                     VNMESGSGTSDYNSQSTEASHYPSPRSIHTPYASDSGTYTSSTSTAGYLSDSGSTWHK
                     PEYHQQPMEPEHFYPGPPPPPPSAFLHDPRRQFRVARPKRAPRRLTTKEEANFQCQVK
                     GCGKLFSRSYNFKAHMETHDEKREYPFPCQVPECTKKFVRKTDLQRHHQSVHLRERTH
                     KCDYCSRMFARKDTLRRHMEDGCSKRFDIGTMDVRADTAYDSMHHGVRPPMGPLSHMM
                     PPQGGLPPIGIPPLCGPSLLSSMPPSMRPREPIAGGDHSQGHNWGR"
     gene            complement(2425306..2427159)
                     /locus_tag="MYCTH_2312445"
                     /db_xref="GeneID:11509473"
     mRNA            complement(2425306..2427159)
                     /locus_tag="MYCTH_2312445"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667030.1"
                     /db_xref="GeneID:11509473"
     CDS             complement(2425623..2427089)
                     /locus_tag="MYCTH_2312445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667078.1"
                     /db_xref="GeneID:11509473"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="JGIDB:Spoth2_2312445"
                     /translation="MDRNAQSGGLGPRHDASSRIQKPESAADRLAALKARVAAAVGSA
                     KAKGGLNTPLHPALADLNAPLKPGDSLRSALGQRPTTADTAKTAKGRPAGLSATTQDG
                     QRTNPYLDTGSAPAGKAREPRQLIFNQKGKYIQQANALRRQAALEEMKKRIAEQARKA
                     GLEEDRAAEKAFVVEAPPDLEWWDEGLVDGKDYSNIPESIKLSTSDSIITVYIQHPVA
                     IEPPQDKLAPEPKPMYLTPKEQQKLRRQRRMMELKEKQAKIRLGLEPAPPPKVKKSNL
                     MRVLGEEAVKDPTAVEARVNREIAERYNKHMQANEERKLTKEQRHEKIAANQAKDAAK
                     GIHVAVFKIGSLVNGQHRYKININATQNGLGGVCIMHPKFSLVIVEGGEHSVNNYKKL
                     MLRRIDWTESLPPRDRDAASAGGPAAGRDWLKSEDENGQLKDLSANKCVLVFEGETKA
                     PAFKKWGSKVCETDAEAREFLSQRKMENFWTQAKSIPM"
     gene            2427489..2433486
                     /locus_tag="MYCTH_2312447"
                     /db_xref="GeneID:11509474"
     mRNA            join(2427489..2427897,2428002..2432744,2432891..2432964,
                     2433064..2433486)
                     /locus_tag="MYCTH_2312447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667031.1"
                     /db_xref="GeneID:11509474"
     CDS             join(2427716..2427897,2428002..2432744,2432891..2432964,
                     2433064..2433230)
                     /locus_tag="MYCTH_2312447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667079.1"
                     /db_xref="GeneID:11509474"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="JGIDB:Spoth2_2312447"
                     /translation="MNIAQPVGSALESVEFTFLSPDEIRSISVKRIENDSTFDNLLNP
                     IPGGLYDPALGSWGDSLCRTCNLNQAQCPGHPGHIELPVPVYHPVFMDQAYRLLRAQC
                     VYCHKFRLPRHEIHKYTCMLRLLQVGLVHEANMIESFSASDLGEQLRKLRLSDVPTVE
                     ADEAEEEGNNLHDSTMRARETYVRQVLREHRLKVNVGDIRKGKHEGAAEMRRALVKEF
                     LAQIVKEKRCRSCDGISPVYRKDRWVKIFERDLSEKERAAMAQAGRTRVDALALSRKA
                     KKHHDLNPDEGIADVDSSSEGSSGERDSEGEGEGEELDENGDVVMTDAAVKTRRSKSK
                     AAKPAQRYLSTMEVHKRLELLFEKEQEILSLLYNSKPRPRNSKPLTADMFFITALLVP
                     PNRYRPEARMGDSQISEAQQNNLYKMILRSASNVAQISREISSQTKETAADEGRRTRD
                     MSSLYQAWTELQDAVNSLIDRDKNPIQGAAAKRNEEGIKQKLEKKEGLFRKNMMGKRV
                     NFAARSVISPDPNIETNEIGVPPVFAKKLTYPEPVTSHNFKDLQQAVINGVDKWPGAS
                     AIENENGQIINLRTKSLEDRIALANQLLAPTGNNFSGQRNKKVHRHLTNGDVVLMNRQ
                     PTLHKPSIMGHRVRVLPGEKTIRMHYANCNTYNADFDGDEMNMHFPQNELARVEALQL
                     ADTDHQYVSGTAGNPLRGLIQDHLSVSVELCSKDVFLDQGAYHQLIYSALRPESGHIT
                     GERIELVPPAVIKPVSRWTGKQVITTILKNIRPADCGNLWMNGSAKIKSRSWGEDSEE
                     GQVMFRDGEFISGILDKSQLGPSSGGFVHAVHEIYGPSVAGKLLSSMGRLLTRYLAMI
                     AFTCGMDDLRMTPQGEKDRRETIRAAADIGLRVAAKYVSLEEQKPTKDDPLLLERLEE
                     VLRDDKKQEGLELLTSHALADLSSEITRLCLPAGLEKQFPKNHMQSMTTSGAKGSPVN
                     ANLISCNLGQQVLEGRRVPVMVSGKTLPSFKPFDTDVRAGGYIVNRFLTGIRPQEYYF
                     HHMAGREGLIDTAVKTSRSGYLQRCLIKGMEGLRVSYDSSVRDSDGSVVQFLFGEDGI
                     DISKQKYLNDFEFVLRNLDSQLPQIRYHEPGTQALFEHKDEVMKRMKSAIRSSNTRNP
                     LDPVTAELDPSAFAFATSEKFYTKMMDYVKTNKDGLIKDKKGPEKQQGLIARKTAEKI
                     LAAKYIRSLVEPGEAVGIVAGQSVGEPSTQMTLNTFHLAGHSARNVTLGIPRLREILM
                     TASTKPSTPSMTLVLNEELSEQDGERFAKSISVLPLAHVTKEAVVREHVGRGIGYALA
                     KSFEIRLRFFKADEYIKMYAITIADVLNTVERKFIPLLSALTRKEIKKKQKQNSAATP
                     EIGVKSGVVEMAAPNPERERGPGGDDDDDDEEGEEDATSAKQRANRSEAVSYGPNDEE
                     DDAIQQQLQRETDDAEEGEEQLEFVDEAYGGSPEPEDGLGDGKTDEGRSRSREARIKN
                     KNEHVARFRCDEVGGEWVDFTLEFDASIPKILMLSLVQEAVKKSLIQQIDRIGTATFE
                     PKKVKDAVTGEERTELLVHTEGANLRAMQQYGDYINPNRISTNDIAQVLEVYGVEACR
                     SNIVQELSAVFSGHGIAVDPRHLNLIADYMTRAGGFTAFNRIGLTSNVSPFTKMSYET
                     TVGFLKDAVLEGDWDCLATPSSRLVAGKLGTLGTGSFDVLTKVPTEHKAAVAF"
     gene            2433918..2435866
                     /locus_tag="MYCTH_2312450"
                     /db_xref="GeneID:11509475"
     mRNA            join(2433918..2434313,2434427..2434495,2434584..2434614,
                     2434853..2435182,2435326..2435866)
                     /locus_tag="MYCTH_2312450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667032.1"
                     /db_xref="GeneID:11509475"
     CDS             join(2434239..2434313,2434427..2434495,2434584..2434614,
                     2434853..2435182,2435326..2435573)
                     /locus_tag="MYCTH_2312450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667080.1"
                     /db_xref="GeneID:11509475"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="JGIDB:Spoth2_2312450"
                     /translation="MARPKITLYVDTVSPFAYLAYHVLRHDAVFKGCDITYVPVFLGG
                     IMHKCGNVPPIKVKNKDTYINTERLRWARHFSVPMTSGLPPDFPAVTLPVMRALCYLE
                     AQDAQDAAAAGQQQQQQQEEPQKQPRLIKALDEFYLQYWGNAVATHKPEVLKQTLAGL
                     FGEAGADKILAESTTPAIKRALIANTDRAFESGAFGLPWMECTNAEGKTEGFFGVDHL
                     GQVAQFLGLPRPGEAKGHNGDEAGSSGWRALL"
     gene            complement(<2436150..>2436764)
                     /locus_tag="MYCTH_57779"
                     /db_xref="GeneID:11509476"
     mRNA            complement(join(<2436150..2436194,2436277..2436429,
                     2436552..>2436764))
                     /locus_tag="MYCTH_57779"
                     /product="histone H3-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003667033.1"
                     /db_xref="GeneID:11509476"
     CDS             complement(join(2436150..2436194,2436277..2436429,
                     2436552..2436764))
                     /locus_tag="MYCTH_57779"
                     /codon_start=1
                     /product="histone H3-like protein"
                     /protein_id="XP_003667081.1"
                     /db_xref="GeneID:11509476"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Spoth2_57779"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLV
                     SLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERN"
     gene            <2438681..>2439031
                     /locus_tag="MYCTH_2071169"
                     /db_xref="GeneID:11509477"
     mRNA            join(<2438681..2438795,2438868..>2439031)
                     /locus_tag="MYCTH_2071169"
                     /product="H4-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003667034.1"
                     /db_xref="GeneID:11509477"
     CDS             join(<2438681..2438795,2438868..2439031)
                     /locus_tag="MYCTH_2071169"
                     /codon_start=1
                     /product="H4-like protein"
                     /protein_id="XP_003667082.1"
                     /db_xref="GeneID:11509477"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="JGIDB:Spoth2_2071169"
                     /translation="GKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEET
                     RGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
     gene            <2442670..>2443123
                     /locus_tag="MYCTH_2044135"
                     /db_xref="GeneID:11509478"
     mRNA            join(<2442670..2442847,2442957..>2443123)
                     /locus_tag="MYCTH_2044135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003667035.1"
                     /db_xref="GeneID:11509478"
     CDS             join(<2442670..2442847,2442957..>2443123)
                     /locus_tag="MYCTH_2044135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003667083.1"
                     /db_xref="GeneID:11509478"
                     /db_xref="JGIDB:Spoth2_2044135"
                     /translation="QLGMSSPACHPPRSSTITAPTSPPTLPASCTYRPTATSYLTTGC
                     EFACPTTTSVWCISDAYVVLACGCDRAAVSPTTVTRCPTASVHCLQCSTGWGIATITD
                     PNCPSSTTETASA"
     gene            2445956..2447152
                     /locus_tag="MYCTH_112491"
                     /db_xref="GeneID:11509479"
     mRNA            join(2445956..2446187,2446246..2447152)
                     /locus_tag="MYCTH_112491"
                     /product="MFS sugar transporter-lik