GenomeNet

Database: RefSeq
Entry: NC_016480
LinkDB: NC_016480
Original site: NC_016480 
LOCUS       NC_016480            1549475 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Naumovozyma dairenensis CBS 421 chromosome 2, complete genome.
ACCESSION   NC_016480
VERSION     NC_016480.1
DBLINK      BioProject: PRJNA79341
            BioSample: SAMEA2272418
            Assembly: GCF_000227115.2
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Naumovozyma dairenensis CBS 421
  ORGANISM  Naumovozyma dairenensis CBS 421
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1549475)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1549475)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE580268.
            Accession numbers for all the chromosomes in this genome project:
            HE580267-HE580278.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1549475
                     /organism="Naumovozyma dairenensis CBS 421"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 421"
                     /db_xref="taxon:1071378"
                     /chromosome="2"
     gene            <474..>1028
                     /gene="NDAI0B00100"
                     /locus_tag="NDAI_0B00100"
                     /db_xref="GeneID:11497639"
     mRNA            <474..>1028
                     /gene="NDAI0B00100"
                     /locus_tag="NDAI_0B00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668239.1"
                     /db_xref="GeneID:11497639"
     CDS             474..1028
                     /gene="NDAI0B00100"
                     /locus_tag="NDAI_0B00100"
                     /inference="similar to DNA sequence:INSDC:YJL151C"
                     /note="similar to Saccharomyces cerevisiae SNA3 (YJL151C);
                     ancestral locus Anc_1.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668287.1"
                     /db_xref="GeneID:11497639"
                     /db_xref="GOA:G0W5I3"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G0W5I3"
                     /translation="MTNTNNSNNDSNREERPRFSINQDDLLLVIISVFVPPIGVLIRK
                     GFFSKEFLLNFILFLILFFPATIHAFYVIYETSQERISATADESRNTPTDATASIPLV
                     TSNANGVVVNSNRDKKGNGNFDVDLEVNLNEGGHDNYDDNDDVRSTDGLLLPSYDDIV
                     ESSGQNGKSNDGLQDNKIQFNQLP"
     gene            complement(<1233..>2192)
                     /gene="NDAI0B00110"
                     /locus_tag="NDAI_0B00110"
                     /db_xref="GeneID:11496228"
     mRNA            complement(<1233..>2192)
                     /gene="NDAI0B00110"
                     /locus_tag="NDAI_0B00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668240.1"
                     /db_xref="GeneID:11496228"
     CDS             complement(1233..2192)
                     /gene="NDAI0B00110"
                     /locus_tag="NDAI_0B00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668288.1"
                     /db_xref="GeneID:11496228"
                     /db_xref="UniProtKB/TrEMBL:G0W5I4"
                     /translation="MQLLMLYILTLVNIFQIGTANVLPSLDSLSTNKTFQKEYSFQSI
                     ERLSNRLEISKGITPKTAFIFQLTTIIFHSNHSLSNKKTVPIVNLIKEKFEELLVLES
                     LHGISGEIPLKKDMISITDDITKLASQYEQLVRNKISWKERILINKGFKVAIAKYLNH
                     NLKKLINLKCQTILLYGKEGPHNNNSNHDLIDSGYRILRHSSFALKAAINTIELIQKN
                     SSSAELTKLIHDHFNYLPAIEDKMVLIDGIVDKLRNDKFKIMVDPPELKFLIKGLKTL
                     AEGMVFLALCVVLSNVFCSVVFILTISVAVVIWMIIFWRMLNT"
     gene            <3784..>5487
                     /gene="NDAI0B00120"
                     /locus_tag="NDAI_0B00120"
                     /db_xref="GeneID:11498089"
     mRNA            <3784..>5487
                     /gene="NDAI0B00120"
                     /locus_tag="NDAI_0B00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668241.1"
                     /db_xref="GeneID:11498089"
     CDS             3784..5487
                     /gene="NDAI0B00120"
                     /locus_tag="NDAI_0B00120"
                     /inference="similar to DNA sequence:INSDC:YJL153C"
                     /note="similar to Saccharomyces cerevisiae INO1 (YJL153C);
                     ancestral locus Anc_1.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668289.1"
                     /db_xref="GeneID:11498089"
                     /db_xref="GOA:G0W5I5"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W5I5"
                     /translation="MTTSSNTNNNTSSTVEYSTNTNSSGDFNWSLNSDKCKYSQSENA
                     LLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIPKIGVMLVGMGGNNGTTF
                     LASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQQTNEDVYVPFNSIL
                     PMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKSIYYPDFIA
                     MNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVIILWTAT
                     TEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNTFVPG
                     LIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNLSS
                     SLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAM
                     DEYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQGDGNY
                     QQFYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERL
                     M"
     gene            <5979..>8933
                     /gene="NDAI0B00130"
                     /locus_tag="NDAI_0B00130"
                     /db_xref="GeneID:11498090"
     mRNA            <5979..>8933
                     /gene="NDAI0B00130"
                     /locus_tag="NDAI_0B00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668242.1"
                     /db_xref="GeneID:11498090"
     CDS             5979..8933
                     /gene="NDAI0B00130"
                     /locus_tag="NDAI_0B00130"
                     /inference="similar to DNA sequence:INSDC:YJL154C"
                     /note="similar to Saccharomyces cerevisiae VPS35
                     (YJL154C); ancestral locus Anc_1.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668290.1"
                     /db_xref="GeneID:11498090"
                     /db_xref="GOA:G0W5I6"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:G0W5I6"
                     /translation="MPAASTSTTSSSNALSYSSSVEKAIVTIDQHATLMNQYLEDDHL
                     LLALKHATIMLTELRNPNLSPKDYYQLYLQCFDPLTNSLSKYLRTQSQNDKIDLYEIY
                     EFVQYTGNILPRLYLMIIVGINYLQFVEDLNTKNEILKDLMEMMLGEQHSIRGLFLRY
                     FFIQFFFSFSKTPQDNVFELIAFHPNPNDPPLSSSSSSTSLDHENDDEELKFIITEIL
                     MKNFIEINKLWIKIQFHGPSSQKHQRHIERNELKTLVGFQIVKISELLPPPPSSPPSS
                     SKDGVSTSSTSSIKILKNDFLPLYLQNIIQCNDSLSQEYLIDIYIQIFPIEFILKNLD
                     QLLLTIINLSPHVSIDIIIINLIEKFRTTSNIESEDDKTIAILVEDNLLFEKFYNFLI
                     KYIQQKTMQTQISADSDEGNNNKIGTRPRILLLSLLPLFDHIIQLTLFWYPNNFENLN
                     KIFEVMKDNLNLIEFNNKQNIIQIRQLLTFHNLTLNANGKEAMGFIIDSNFLLKLITN
                     SESYKSLIIDSLSNYRSLQYDILIELVSAFIENDIELQLESIDQLQKIYTYLPTTTKY
                     TVSSSYTTKSFQIYSFNYEFYIITSTKKNQELKYITIDSQIDILINLKNWLLKSTKKT
                     MLDNNELQHHHNQHYSSGQNKNNIWGIYPSIITSFWRIINKCHILKSKQINDKFKLRY
                     NQLIINLFKHLSKFINDILVNPSFSSSSSSSSSSSSNNLQEIFKLILRTSTFAQNIQQ
                     FDIANDFITQSFIILEDQLNSDSSIQYESLLLLIRTLNQLKTNNANNGNEVMNDLRIR
                     CVSRCSKLLKKKHQCRSIYLCSYLWSNDNDVKDKDESNQGARKYIMECIQRSIRIADS
                     IMDGLISCQLLIEILNQCIYFNTKALSDGVFVIFNEKFMSSLIELIKKSIESLQNDQD
                     NYDQDMIKPLRFIFTLNDQVIGYEMGKISFVSKLVAPDFQSKYVNEMIQSVDEYFNRT
                     CKYIENIEHIEV"
     gene            <9402..>10814
                     /gene="NDAI0B00140"
                     /locus_tag="NDAI_0B00140"
                     /db_xref="GeneID:11498091"
     mRNA            <9402..>10814
                     /gene="NDAI0B00140"
                     /locus_tag="NDAI_0B00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668243.1"
                     /db_xref="GeneID:11498091"
     CDS             9402..10814
                     /gene="NDAI0B00140"
                     /locus_tag="NDAI_0B00140"
                     /inference="similar to DNA sequence:INSDC:YJL155C"
                     /note="similar to Saccharomyces cerevisiae FBP26
                     (YJL155C); ancestral locus Anc_1.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668291.1"
                     /db_xref="GeneID:11498091"
                     /db_xref="GOA:G0W5I7"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0W5I7"
                     /translation="MGFHTISNDKDLKICVFMVGLPATGKSFISQKIVRYLSWLSIPV
                     KCFNVGQSRRELGVVSPDAEFFNSQNEENYKLRQKALSNTMEQLFQWFEKEDGTVGIV
                     DATCSTRERRQWIIKQCEMYDIKPMFLESWCNDDELIMKNIKDINSTSPDYTDVDPMM
                     AELDFKKKIQYYKNVYESLNSQTDSEVTFVKLINISEEVIINKIQTYLQSRIVFYVMN
                     IRIKPRCIWLSRHGESIYNVEKKIGGDSLLSERGLQYAKKLKEMIEENAPGEDLTVWT
                     STLKRTQQTAQYLNFKKLQWKALDELDAGVCDGMTYEEIEEVYPEDFKARDEDKYFYR
                     YRGGESYRDVVIRLEPIIMELERRENILIITHQAVLRCIYAYFMNVPQEESPWMAIPL
                     HTLIKLEPRAYGTKVTKMKANIPAVSTYKEKGTSHVGEADVSNKKNDKFHNLLINAPE
                     IISPVASSTNLGKFGDLSKQ"
     gene            <12567..>14822
                     /gene="NDAI0B00150"
                     /locus_tag="NDAI_0B00150"
                     /db_xref="GeneID:11498239"
     mRNA            <12567..>14822
                     /gene="NDAI0B00150"
                     /locus_tag="NDAI_0B00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668244.1"
                     /db_xref="GeneID:11498239"
     CDS             12567..14822
                     /gene="NDAI0B00150"
                     /locus_tag="NDAI_0B00150"
                     /inference="similar to DNA sequence:INSDC:YJL156C"
                     /note="similar to Saccharomyces cerevisiae SSY5 (YJL156C);
                     ancestral locus Anc_1.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668292.1"
                     /db_xref="GeneID:11498239"
                     /db_xref="GOA:G0W5I8"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="UniProtKB/TrEMBL:G0W5I8"
                     /translation="MVRRLFNFNRKNNYNDNDHNKENNSSSPQNVPLDARPQISSFDE
                     DDNITEAEEQETKPSSSIFSKGRSTYHTSNSSDFSSAFHSQKNTHTKLQTSSSTHFGD
                     VGKPLKVLQTHRLDSLNIVPEEEPEIILPDVTRSSTTGHTEPTQFVEPSFDSQAKAIA
                     IPQQSQPQTLNHATSTKDYQSVTDRSNIDAVKKELHILETNLSDLMDDIHQNVTNISK
                     AVIESIEFFKDFTLNFDELKLPKTYKFNFQNNYSLRVITKIVLHFIDNLLISDGLSNS
                     RSILLRRYMYFLKKLDISILSNDETTNDTDYFTTINNLNSSNMSSHPLPHMTNFCITE
                     ESNFPSTIKIGEIMNKLTRTNSSTISEQEGSFIAPILRGLSKNSAILTIMFGIPNLKQ
                     DHLEMVKVLYSLFPDVHFYCCKDYIKPCADILNLQQEQNISSSSTTTNHLFDNIPPSS
                     VSQSRYQFSPPYRVAPNPLQPPISMSISRDENTKITGTLGGYIFPQIDESNAKLSKFA
                     GSTFAITCAHVVLSESQEFPNVSIPSTILQTAYKTTLINEANKYPKNSKEQVAFIEEA
                     SHVERNIEWQKNNKFGQVVWGERSIIDQKLSDFAIIKVDGKYHCENTIGIDPKSIPDP
                     TLRFQNTLVKKKILKVKSGLKVFKIGSSSNFTTGQINGAKIVYWADGKLQSSEFIVSS
                     PSPMFATAGDSGAWILTKLEDHVGLGVVGMLHSYDGEQKQFGLFTPISNIMERLNTVT
                     GIQWDIDRPVK"
     gene            <15572..>17869
                     /gene="NDAI0B00160"
                     /locus_tag="NDAI_0B00160"
                     /db_xref="GeneID:11498240"
     mRNA            <15572..>17869
                     /gene="NDAI0B00160"
                     /locus_tag="NDAI_0B00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668245.1"
                     /db_xref="GeneID:11498240"
     CDS             15572..17869
                     /gene="NDAI0B00160"
                     /locus_tag="NDAI_0B00160"
                     /inference="similar to DNA sequence:INSDC:YJL157C"
                     /note="similar to Saccharomyces cerevisiae FAR1 (YJL157C);
                     ancestral locus Anc_1.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668293.1"
                     /db_xref="GeneID:11498240"
                     /db_xref="GOA:G0W5I9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0W5I9"
                     /translation="MQLTTPTRFAFDKRVHSPPSIERENSKSSPSKFLRSLSGKAFRN
                     KTPNLKLKQNDTFQIPNTVTPSSTLRMSKRQNVPKPLDLSKPLSPPPSLQKSTSISSL
                     SSSNQKKNSRASLDFSLDSLNSPVNIFPSRYPKNLTSSLLRETISANSTLNTNDNIVI
                     CTDTNEDPYLEEDSPTYLSSLRRNVKTTNSGPKKYIGEKCSMCEEMINYTFQGEKVLE
                     LTCNHISHYECYLTILDSIYFNEKFPDCKICHKMVKPKDDELLQEMGSKILTGLDSNQ
                     HKMDNDITMNIETGIGPTQEQWLNLNSARGGSGSFGIPQFTPRDQVIHTADISSNGFR
                     TPLLSSTNDAVFSRHPVQNTELFNHTLEDEQRQDIDNGLDYELNIFLAPDDIKMDCTN
                     KGHQEFNPEDEVELRNRINQYFESKECGSIIMIRRVKYSTDGEQWTDSIIYFYENYIL
                     LFDCNFAHNDLIEKKLLGKIPMDQLYKVTEFNSNELLLDLKSTVLPEVYLQFPSVFSE
                     TLSSKWKYYLEKINNCDVKPIEEGCFPTLNQLTVTAWDIIPISFIEKINQLYSADQIS
                     KPWEIINRNVPLEVIICLNLSCAIEDEQDKYQLFLREALATIRSNLNKEDKFGLVLVG
                     KDGSGNIGEYGTFIGTIENEWDGWDDIIDNMTIIKKEVFIDSSKELLKMLEAGCKIAC
                     TSDNNIPEDGGEQKVVKQMIILRSSNEEPIFENEKETKKLKRFEDQIRKDYQFNILTI
                     SVDDIANDYTAKFESIINELHRSLA"
     gene            <19375..>20046
                     /gene="NDAI0B00170"
                     /locus_tag="NDAI_0B00170"
                     /db_xref="GeneID:11498241"
     mRNA            <19375..>20046
                     /gene="NDAI0B00170"
                     /locus_tag="NDAI_0B00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668246.1"
                     /db_xref="GeneID:11498241"
     CDS             19375..20046
                     /gene="NDAI0B00170"
                     /locus_tag="NDAI_0B00170"
                     /inference="similar to DNA sequence:INSDC:YJL158C"
                     /note="similar to Saccharomyces cerevisiae CIS3 (YJL158C);
                     ancestral locus Anc_1.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668294.1"
                     /db_xref="GeneID:11498241"
                     /db_xref="GOA:G0W5J0"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G0W5J0"
                     /translation="MQFNKIALAATVAATTVSAEGYTPGNPWSTLTPTATYSCGVAQF
                     TSSFGIAVKEIASTSAAKAKRDVVSQIGDGQIQAVATTTLKPTTTTTTSKTSTTSTSS
                     ASKTSSSASSCAASATVTPKDSSCKNSGTLQLTLEDGVLTDAKGRIGAIVSNRQFQFD
                     GPPPQAGSIYAAGWTITEEGNLALGDSDVFYQCLSGNFYNLYDQNIAEQCTPINLEVV
                     SLVDC"
     gene            complement(<21003..>22037)
                     /gene="NDAI0B00180"
                     /locus_tag="NDAI_0B00180"
                     /db_xref="GeneID:11498242"
     mRNA            complement(<21003..>22037)
                     /gene="NDAI0B00180"
                     /locus_tag="NDAI_0B00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668247.1"
                     /db_xref="GeneID:11498242"
     CDS             complement(21003..22037)
                     /gene="NDAI0B00180"
                     /locus_tag="NDAI_0B00180"
                     /inference="similar to DNA sequence:INSDC:YJL159W,YKL163W"
                     /note="similar to Saccharomyces cerevisiae HSP150
                     (YJL159W) and PIR3 (YKL163W); ancestral locus Anc_1.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668295.1"
                     /db_xref="GeneID:11498242"
                     /db_xref="GOA:G0W5J1"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G0W5J1"
                     /translation="MQYKKTFVTAALTATAFAAYVPSEPWSTLTPSATYKGGLTDYAS
                     TFGIAVEPIATSSASASASIAKRDVVSQINDGQIQATTKTTAKASTKTTAAVVSQITD
                     GQIQATTKTASKTSTKTTAAAVVSQITDGQIQATTSTISKSKTTAAAVSQIGDGQIQA
                     TTSTKTTAAAVSQIGDGQIQATTSTKTTAAAVSQVSDGQIQATTSTKTTQGASQVTDG
                     QVQAEATSSASSSEDSTTSSDDPVEAVSCKASGTLQMNLKGGILTDGSGRIGSIVANR
                     QFQFDGPPPQAGAIYAAGWSITPEGNLAIGDNDVFYQCLSGNFYNLYDESIGAQCSEV
                     HLQAIDLVDC"
     gene            <23975..>25222
                     /gene="NDAI0B00190"
                     /locus_tag="NDAI_0B00190"
                     /db_xref="GeneID:11498092"
     mRNA            <23975..>25222
                     /gene="NDAI0B00190"
                     /locus_tag="NDAI_0B00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668248.1"
                     /db_xref="GeneID:11498092"
     CDS             23975..25222
                     /gene="NDAI0B00190"
                     /locus_tag="NDAI_0B00190"
                     /inference="similar to DNA sequence:INSDC:YJL160C,YKL164C"
                     /note="similar to Saccharomyces cerevisiae YJL160C and
                     PIR1 (YKL164C); ancestral locus Anc_1.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668296.1"
                     /db_xref="GeneID:11498092"
                     /db_xref="GOA:G0W5J2"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G0W5J2"
                     /translation="MQYKKTLTTAALTATTFAAYLPHEPWSTLTPSATYKGGLTDYAS
                     TFGIAVQPIATASVAKRDAVSQIGDGQIQATTKTTSKATTKTKAAAVSQINDGQIQAT
                     TKTQAAAVSQINDGQIQATTKTQAAAVSQIGDGQIQATTKTQAAAVSQIGDGQIQATT
                     KTQAAAVSQIGDGQIQATTKTLAPAVSQIGDGQIQATTKTTAPAVSQIGDGQIQATTK
                     TTAPAVSQIHDGQIQATTKTLAPAVSQIGDGQIQATTKTTAPAVSQIGDGQIQATTKT
                     TAPAVSQIHDGQVQATTTTSAAKPTSTSTSSNSKDPVSAESCKNDGTLQMNLKGGILT
                     DGSGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLAIGDNDVFYQCLSGNFYN
                     LYDESIGSQCNKVYLQAIDLIDC"
     gene            <25694..>27478
                     /gene="NDAI0B00200"
                     /locus_tag="NDAI_0B00200"
                     /db_xref="GeneID:11498093"
     mRNA            <25694..>27478
                     /gene="NDAI0B00200"
                     /locus_tag="NDAI_0B00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668249.1"
                     /db_xref="GeneID:11498093"
     CDS             25694..27478
                     /gene="NDAI0B00200"
                     /locus_tag="NDAI_0B00200"
                     /inference="similar to DNA sequence:INSDC:YJL162C"
                     /note="similar to Saccharomyces cerevisiae JJJ2 (YJL162C);
                     ancestral locus Anc_1.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668297.1"
                     /db_xref="GeneID:11498093"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0W5J3"
                     /translation="MNLPENMEDIDIKLDETTYYSILGLHPQATDNEIRKSYMKFARK
                     LHPDKSKSDTCAELFKLVVHAHSILTDKELKLEYDRELIRKGLNNYSPKSNIGELLIN
                     NKTGNTNDHKDHYDHQVPKFTRKSKPYEQQPYGFEGKYNNTKSTTNGGKKTARKKSEE
                     KSFKKFNVKSYQQSKYTDTNKDRPYEDKHHRTLNTDTDQRHFPYHYKYHHAHTQDNDY
                     RNTQLDENDEIKHRASSIPSYLQADDSLSPDELSFQRNNYTGNKNSSGNSDDDSNVRP
                     TSEQSNDTAARISEDLEDHTIPTNLTSNEGYNTKRDDLDDDQDRPGRQQKMHKTNSTS
                     NVPKSPFFPTKESRHYARTRFMNANDRRRSISPFKNPSTKTSLFDLNDHWDTLKRVID
                     MFNEENKREDEAYNIKTLSIDDEDTGYNTSSMNDSTSVNFNTSNDTGVHDKFNYSTNP
                     SKRRKTESNTYNNASDDTSFDMAFFEHNLNSILIQDDNENHEDIMTNLHSIKIPQLRI
                     SDNSNSILSRREIEKYIDNGNRMKQFFLRVLVARQSTVPNASCLLDRRAFQEYMEQQN
                     IQLNVINKLAELEYSLCLGLQRYHDSLQ"
     gene            <27983..>29185
                     /gene="NDAI0B00210"
                     /locus_tag="NDAI_0B00210"
                     /db_xref="GeneID:11498094"
     mRNA            <27983..>29185
                     /gene="NDAI0B00210"
                     /locus_tag="NDAI_0B00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668250.1"
                     /db_xref="GeneID:11498094"
     CDS             27983..29185
                     /gene="NDAI0B00210"
                     /locus_tag="NDAI_0B00210"
                     /inference="similar to DNA sequence:INSDC:YJL164C,YKL166C"
                     /note="similar to Saccharomyces cerevisiae TPK1 (YJL164C)
                     and TPK3 (YKL166C); ancestral locus Anc_1.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668298.1"
                     /db_xref="GeneID:11498094"
                     /db_xref="GOA:G0W5J4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W5J4"
                     /translation="MSQTDDFISMKEIGQAINDSQRQEQLPQQQQHQQEHDQGQQELQ
                     QQQPPAPPIQPEHHQHPHPNTQGPTKVRKNLEGRKTSGKYTLNDFQILRTLGTGSFGR
                     VHLIRSIHNGRFYALKVLKKHTIVKLKQVEHTNDERLMLSVVNHPFLVRMWGTFQDCE
                     QIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALDYLHSLDIIYRDLKPENI
                     LLDKNGHIKITDFGFAKYVPDITYTLCGTLDYIAPEVVSTKPYNKSVDWWSFGILIYE
                     MLAGYTPFYDSNTMKTYENILNSKLKFPEFFHEDVRDLLSKLITKDLSERLGNLQNGT
                     DDVKSHPWFSEVVWDKLLSRNIETPYEPPIQQGQGDTSQFDRYPEEEINYGIRGVEDP
                     YHDLFKAF"
     gene            <29825..>32470
                     /gene="NDAI0B00220"
                     /locus_tag="NDAI_0B00220"
                     /db_xref="GeneID:11497833"
     mRNA            <29825..>32470
                     /gene="NDAI0B00220"
                     /locus_tag="NDAI_0B00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668251.1"
                     /db_xref="GeneID:11497833"
     CDS             29825..32470
                     /gene="NDAI0B00220"
                     /locus_tag="NDAI_0B00220"
                     /inference="similar to DNA sequence:INSDC:YJL165C,YKL168C"
                     /note="similar to Saccharomyces cerevisiae HAL5 (YJL165C)
                     and KKQ8 (YKL168C); ancestral locus Anc_1.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668299.1"
                     /db_xref="GeneID:11497833"
                     /db_xref="GOA:G0W5J5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W5J5"
                     /translation="MTTSHNSSDKVSRHSSVHRARSLSESIKGLFKSSSSSSSSSVNN
                     HHTHKNNTAATRANPVSPKVVIQQQPTVAELPAFAEIPEGSKSHTNGSQKVPLHINTS
                     SIYEAISPVHSPVMSNARQKPKGSQQYLPNIAKLSLSPPSMKRDDKFSHESSDISDED
                     PLHVDKKYLNKKEFSSSGKDAMYAPIPVPGPSTADRSDNNLIDETNLSSIDAMLEVSN
                     KNTVPNATSKSATVPPPVLHKHRNSTGHSFNTNVKNSSLRQENLNVNSRSRSLRRGNS
                     LSSSTSSVSNSASIGSLSTTNKSPYSNGRKHAESVSASNLMKYMEHESKCILNVENFK
                     VFENGYHQHNLRKMAIVSNEEKKKSKLSPAVSNTVNFSSSLNVDDRIDSNALVNDDDT
                     DTISLQKQKSGFSLSGLFKPHAKDNANAMIEENQKFENALSLIPTHRLSLYKRLNKMN
                     EQGDADSYSDPDYDYDDIDNNEQSNSKNSMMTGRTEQESLVDSRTTYVDSEGKQEKIS
                     NNKKKQFNKSMPKVVNTNAAVSSEELSLINTLSEKIHNGLKGKVTRSEENDQLPSFAE
                     QYGKSIGTIGHGAYGIVKVCGRPINPNFDKSPFQTFCNGQKLFFAVKELKPKQNDPIE
                     KFSTRITSEFIIGHSLSRCHKKGDRVSPNILKVIDLLENNDTFFEVMEFCPAGDLYSI
                     LTRKSKSGTALHPLEADCFMKQLLHGVKYMHDHGVAHCDLKPENILFHPDGLLKICDF
                     GTSCVFQTAWEKHVHFQSGAMGSEPYVAPEEFIRDKEYDPRLVDVWSCGVVYCTMVLG
                     HYLWKIAIKEKDGLYESYIQEMTKEKEFYIFEELRHVNSDLTRLRKLILYKLFQWNPE
                     RRITIDQLLASSWMKKTRCCVVYKK"
     gene            complement(<32811..>35645)
                     /gene="NDAI0B00230"
                     /locus_tag="NDAI_0B00230"
                     /db_xref="GeneID:11497834"
     mRNA            complement(<32811..>35645)
                     /gene="NDAI0B00230"
                     /locus_tag="NDAI_0B00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668252.1"
                     /db_xref="GeneID:11497834"
     CDS             complement(32811..35645)
                     /gene="NDAI0B00230"
                     /locus_tag="NDAI_0B00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668300.1"
                     /db_xref="GeneID:11497834"
                     /db_xref="GOA:G0W5J6"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:G0W5J6"
                     /translation="MEFFNILKSLTIILFLFCGLSSGKSSNVDPRYADQNVSSIAISL
                     LKTSARVSAIGKDAFPDSKFVNSTTSMPERSFSTVINSDESIRSIEPSSSLGHSYSFS
                     NLIVTAYSESDSTLDLIQYPTRTSPNSGTIPESSALRDISSRKSLEASIYLASSQHKN
                     SILSNSSPISTSQDPAISALPTSFIHSNEQSSNTETQAPHHLPSSFNSAYFNMSSLTR
                     DTDTGSASKSNGKVESSISSNSGSFSWSHPANSEPRSNASPLSPLETNVSSSTTSIIS
                     STNNIRGSSSLSVSSIAYVSASASYVSTSATSSSGLSRSGVSSSGAPSIPASTSYANS
                     SAASNPATSSSATSSSGISSSGVSTSAVSSIPASATYANSSAASSSGVSSSGVSSSGV
                     STSAVSSIPASASYANSSAASSSVPSSSGVSTSGASSIPASASYAESSATSSSGISSS
                     GLSTSGVVTSGASSVSPSVSGAYNPSSIPVSSASGTSTPGVSTTGASSVPASVSGANN
                     SSSIPVPSVSRSSTSGVSTSGVSTSGASSVSAFVSARQYRPHSSTPPASNFASVIASG
                     SESALFSTSATVANGSSSVESSVPTTSAPSNPSTMTTSSVTFQIHTSSGTTTQAPIAT
                     TSTSGSTTSTTSLNYSAESNFASIMLQAQNDKRALHEDTPPLTWSEDLATYAQDYADQ
                     YVCGSDIVHSGGPYGENIAAGTSPVGSVDAWYAEGAYYNYSNPGFSSATSHFTQLIWK
                     STTEVGCGIKDCSSIGWGDYVICSYNPSGNINAPVFFEENVEPLIGQSSSSSVFSSTE
                     TLEASISTSSPSTHSASEDLTSSLSMESHPSSHALSMSYSESFPSIKMENSVSTDNVG
                     SNISGSFNPTTTFPTSTYISSIMNPSQTSISLTRPTSVTSTYNTTRGRRTITLTEYDK
                     TVHISKYEYYTWTGYSIITSYTVSTITPYL"
     gene            complement(<40157..>40444)
                     /gene="NDAI0B00240"
                     /locus_tag="NDAI_0B00240"
                     /db_xref="GeneID:11497835"
     mRNA            complement(<40157..>40444)
                     /gene="NDAI0B00240"
                     /locus_tag="NDAI_0B00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668253.1"
                     /db_xref="GeneID:11497835"
     CDS             complement(40157..40444)
                     /gene="NDAI0B00240"
                     /locus_tag="NDAI_0B00240"
                     /inference="similar to DNA sequence:INSDC:YJL166W"
                     /note="similar to Saccharomyces cerevisiae QCR8 (YJL166W);
                     ancestral locus Anc_1.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668301.1"
                     /db_xref="GeneID:11497835"
                     /db_xref="GOA:G0W5J7"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:G0W5J7"
                     /translation="MGGPTGGKAYMGWWGHMGSPPQKGITSYSVSPYAQKPLAGIFHN
                     AYYNTFRRFKSQALYVLIPAGIYWYWWTNGREYNEFLYTKAGREELERVNV"
     gene            complement(<44784..>46190)
                     /gene="NDAI0B00250"
                     /locus_tag="NDAI_0B00250"
                     /db_xref="GeneID:11497836"
     mRNA            complement(<44784..>46190)
                     /gene="NDAI0B00250"
                     /locus_tag="NDAI_0B00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668254.1"
                     /db_xref="GeneID:11497836"
     CDS             complement(44784..46190)
                     /gene="NDAI0B00250"
                     /locus_tag="NDAI_0B00250"
                     /inference="similar to DNA sequence:INSDC:YKL172W"
                     /note="similar to Saccharomyces cerevisiae EBP2 (YKL172W);
                     ancestral locus Anc_1.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668302.1"
                     /db_xref="GeneID:11497836"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:G0W5J8"
                     /translation="MDWTILLREREREKNPILLLREKNRSSKDYRENHPIYIYIMVKG
                     TKLKALLANQKQEEKIQKEEQLKKDKKAQQLAKEEPTVIDNDVLKAKEEEKLAKAKAK
                     ADAELLKNKVDTEGEEYQSQALSKKDKRKLKKQLKSLGVSTEKNKTEENANEEEESED
                     EDEDEQPQQLDLDKLARSDSESDEDEEDEEQEQDQEQEQEQEQEQEQEQEDVPLSDVE
                     FDSDADIVPHHKLTINNTKSMKHALERIQLPWSKHSFQEHQSITSTTNTDESIKDIYD
                     DTEREVAFYKQSLEAVQEARTKLQKLKVPFKRPLDYFAEMVKNDEHMDKIKGKLIKEA
                     SEKKAREDARKQRQLKKFGKQVQHATLQKRQLEKKETLDKIKSLKKKRKHDEIDQSDF
                     NVGIEEEVSEKSSSSRDRSRPNGKRAAKNAKYGQGGMKRFKRKNDSESSADVSGFSQR
                     KMKGKQSRPGKSRRSKRY"
     gene            <47006..>49393
                     /gene="NDAI0B00260"
                     /locus_tag="NDAI_0B00260"
                     /db_xref="GeneID:11498468"
     mRNA            <47006..>49393
                     /gene="NDAI0B00260"
                     /locus_tag="NDAI_0B00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668255.1"
                     /db_xref="GeneID:11498468"
     CDS             47006..49393
                     /gene="NDAI0B00260"
                     /locus_tag="NDAI_0B00260"
                     /inference="similar to DNA sequence:INSDC:YJL168C"
                     /note="similar to Saccharomyces cerevisiae SET2 (YJL168C);
                     ancestral locus Anc_1.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668303.1"
                     /db_xref="GeneID:11498468"
                     /db_xref="GOA:G0W5J9"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /db_xref="UniProtKB/TrEMBL:G0W5J9"
                     /translation="MSTDISIPPNKLFLNEEDKTEEALNSFIPIESCIYSSKKLGNSK
                     NNDFIECDCYEDKDPQIHINHACDEDSDCINRLTLIECVNNLCYSCGNDCQNQRFQKK
                     QYSNVSIFKTKLKGYGVRANENIENGQFIYEYIGEVIDEIQFRERMIDYDLKKFKHFY
                     FMMLQNGQFIDATIKGSLARFCNHSCSPNAYVNKWEVAGKLRMGIFAKRKILKGEEIT
                     FDYNVDRYGATAQKCYCDEPNCIGFLGGKTQTEAASLLPQSYAEALGIRPSIEKQWIK
                     EMKRNGQKIEKAKNNDNNINVDFVDSLDILPCETPDDVRKVMSILLQVDSTYMATKLF
                     HRLFNITNENEILLHQVIKLHGYICFSKLLDLFQDDSNTIEEILEFLMRLPKSTKNGI
                     VSSQIDKKISNLSEEIPHLKDQCDLLIEKWNQYETYNRIAKRDITNDLNGNGNGSSSN
                     LSRLMDMRRVRLPLGWEIIFENGRRLFFNAEREIKLTEPPTEEQLRLDDHAKDKDVND
                     NQNGRHRHQNRNRDNHHRPSRYNNNEDNLESHWNHDKNKIDSNMMLSSKKRRRMERQL
                     ELSKARAYANKKRREELEKKIKGQTSSSTLNSPMENNSDNNNSSGKDDLNLNKSNSLN
                     HSHNNAQTPSPTPADHPSGVETNKTEILKIIEHANKIKELEREKELKLKRENEMKRKK
                     KSISESNEHKWDNFFASFVPNLVRKNTGDVELSRDHIKECSRDIVKTLTSKELKRDDP
                     KPPPEEATKEKKYKVNKFVKIYMEKFITKYKEKHSRAQSRSRSDLHHHTGKKTSS"
     gene            <50017..>50745
                     /gene="NDAI0B00270"
                     /locus_tag="NDAI_0B00270"
                     /db_xref="GeneID:11498469"
     mRNA            <50017..>50745
                     /gene="NDAI0B00270"
                     /locus_tag="NDAI_0B00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668256.1"
                     /db_xref="GeneID:11498469"
     CDS             50017..50745
                     /gene="NDAI0B00270"
                     /locus_tag="NDAI_0B00270"
                     /inference="similar to DNA sequence:INSDC:YJL170C"
                     /note="similar to Saccharomyces cerevisiae ASG7 (YJL170C);
                     ancestral locus Anc_1.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668304.1"
                     /db_xref="GeneID:11498469"
                     /db_xref="UniProtKB/TrEMBL:G0W5K0"
                     /translation="MSSSATLTPETSSINISDYSQDDFVHHTNNNNSKVRYLIASFDE
                     EKIEYKCECKSCIESRKYSRLLIRSFWIGIVIPFIWIISLGVSLYLQYWLNHEVHHDN
                     LSEEEFPTVFENERYSKRSQLKLSKNTVREMTDLKAEEKSRTNNFDISIGNNKVENNN
                     NNNNDDDEYKKMKYEYLKKVVEGIVDDHDILRQSYRTWNLRTIGAILVYVIVIVIVVV
                     LCIHHSSNEMKFKRQFIKDIINYC"
     gene            complement(<50884..>52650)
                     /gene="NDAI0B00280"
                     /locus_tag="NDAI_0B00280"
                     /db_xref="GeneID:11498470"
     mRNA            complement(<50884..>52650)
                     /gene="NDAI0B00280"
                     /locus_tag="NDAI_0B00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668257.1"
                     /db_xref="GeneID:11498470"
     CDS             complement(50884..52650)
                     /gene="NDAI0B00280"
                     /locus_tag="NDAI_0B00280"
                     /inference="similar to DNA sequence:INSDC:YJL172W"
                     /note="similar to Saccharomyces cerevisiae CPS1 (YJL172W);
                     ancestral locus Anc_1.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668305.1"
                     /db_xref="GeneID:11498470"
                     /db_xref="GOA:G0W5K1"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:G0W5K1"
                     /translation="MIGLPTDEGGSRFARSRSFIVRNKKALLYTLAVILTLGTILLVW
                     GVTAHHNPHDKEPRCRATEPIQPSFNRSIYTILNDPTFKNASIHRLSGAVKIPTVVQD
                     INPSPEDDPSYYHHFNQFHRYLKLTFPLVHAQLKLEKINKFGLLYTWQGRNETKKPLL
                     LMSHQDVVPVNEQSLDDWEYPPFSGHYDPETDFIWGRGSNDCKNLLIAELEAVEQLLL
                     DGFVPDRTVLLSMGFDEEANGLHGAKSLAQFLHKRYGNDSIYSIIDEGEGVVEVDDGL
                     YIASPVATEKGYVDVEFTVVGKGGHSSIPPDHTTIGIASKLISLIEDSPYPFEFKNDN
                     PVYGSLVCAAEHSKSMSKKDRKVILQATKNKKKGKLLSKFLESMKPLRDLIRSTSAVD
                     IIHGGVKANALPEDTTFLVNHRIDLHSSVNKTVEKDLKLAREIAEEYDYGLYLDDECI
                     VPETDLGYIELKPLRPLEPAPMSPTDGPVWDLLAGTIQNVFENGVFATKTHKLNHDDN
                     DDDDDHEDKKLFITTGLFSGNTDTKYYWTLSENIYRFVASIIDDDLAKTLHSVNEHVD
                     MPGHLSAISFIYQYITNVNEYA"
     gene            <54413..>54766
                     /gene="NDAI0B00290"
                     /locus_tag="NDAI_0B00290"
                     /db_xref="GeneID:11497485"
     mRNA            <54413..>54766
                     /gene="NDAI0B00290"
                     /locus_tag="NDAI_0B00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668258.1"
                     /db_xref="GeneID:11497485"
     CDS             54413..54766
                     /gene="NDAI0B00290"
                     /locus_tag="NDAI_0B00290"
                     /inference="similar to DNA sequence:INSDC:YJL173C"
                     /note="similar to Saccharomyces cerevisiae RFA3 (YJL173C);
                     ancestral locus Anc_1.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668306.1"
                     /db_xref="GeneID:11497485"
                     /db_xref="GOA:G0W5K2"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="UniProtKB/TrEMBL:G0W5K2"
                     /translation="MASETPRLDPTEIANSNASVFRIIAQVKSQPTESTLILSSPSKG
                     NEMITLSNVRLSMTRTPFQIDSWYEFVCRANDTGDVGFLILDSVPCILKENESISIDG
                     IVALQQLTKKFPEIY"
     gene            complement(<54946..>55803)
                     /gene="NDAI0B00300"
                     /locus_tag="NDAI_0B00300"
                     /db_xref="GeneID:11497486"
     mRNA            complement(<54946..>55803)
                     /gene="NDAI0B00300"
                     /locus_tag="NDAI_0B00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668259.1"
                     /db_xref="GeneID:11497486"
     CDS             complement(54946..55803)
                     /gene="NDAI0B00300"
                     /locus_tag="NDAI_0B00300"
                     /inference="similar to DNA sequence:INSDC:YJL174W"
                     /note="similar to Saccharomyces cerevisiae KRE9 (YJL174W);
                     ancestral locus Anc_1.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668307.1"
                     /db_xref="GeneID:11497486"
                     /db_xref="GOA:G0W5K3"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:G0W5K3"
                     /translation="MGNIQILNHYCLLPLLLLFSYIHIALADVNIVSPTEGAAFTSSG
                     GSVSLKIEWMDNTAYPTLDKISFYTFSLCTGPNNNIQSIATLATQVSSDAITVDDNVY
                     SYSFDLADTLTGNGQYFIQIYAWVNDQGSTIHYTPRFFLKSMEGATSYTFSDTVQPVP
                     QTSIQTTTTQANDNQQGTTIDSRSFTVPYTKQTGISRFAPMQTQPKTKISSQKSWTRK
                     FQTSAVTFYSTMRKSLQQMTTITPGWSYTITSDVNYASPALFPSDNGAGYNPSKRLTL
                     SVRKINARK"
     gene            <56840..>59860
                     /gene="NDAI0B00310"
                     /locus_tag="NDAI_0B00310"
                     /db_xref="GeneID:11497487"
     mRNA            <56840..>59860
                     /gene="NDAI0B00310"
                     /locus_tag="NDAI_0B00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668260.1"
                     /db_xref="GeneID:11497487"
     CDS             56840..59860
                     /gene="NDAI0B00310"
                     /locus_tag="NDAI_0B00310"
                     /inference="similar to DNA sequence:INSDC:YJL176C"
                     /note="similar to Saccharomyces cerevisiae SWI3 (YJL176C);
                     ancestral locus Anc_1.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668308.1"
                     /db_xref="GeneID:11497487"
                     /db_xref="GOA:G0W5K4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G0W5K4"
                     /translation="MDSETNEIRDQTTTPVENTDIDTKTIEDESCASHENNLKSTLDD
                     TTALQNEQAQQIVQTPETNDSTKGLLKTDTEGEGNVVSPPNENSLLTTEEIDNDCSNI
                     EGTESNGSKGPTTDTVTEANVEQIEKNPQNTDTAIDGDQNISNLPEENIKEDGIVHET
                     TENVNNNITSDVNAPTPGSHDEPGSNQSVINDNGNTSQEDTTTRINGTNNMTINEENT
                     SIDNPNLLEHVEDDHTKSFDNNIKLENKEQTQEQEQQKEVNQESNPILDQLGNQKLNK
                     ETTIPVATGEDSFEQNITTSAPSQPQDAMAPAEPSQLQATTPSGLPQGQTSNVISSNG
                     IINNTNTSEVLNMNEDDNMDVDDEQSLDIQVDAQKGFFGNAEEEEEEEEDDVDGDKKV
                     GENTEQRNAQQTDSQRSGPEVVLTKEIDPNSTKLDFPQFHEIVIPSYSKWFDLNKIHK
                     IEKQSLPEFFTNRIASKTPQIYVRYRNFMVNAYRLNPTEYFSVTAARRNLSGDAAVIF
                     RLHRFLMKWGIINYQVDPKHLPKSIEPPFTAEYSTKHDAPRGLFPFESFKPSLQLPEL
                     AKLKNMMDLNDQNSALYKYLLSKANRERRNSILADEPLMQDATILKENKANTNNTNHN
                     TNINETTKNNKRTTDDAKLDTNDDKEEEKREENMKLELGTSNQRESPHPVKKLKIVDA
                     GKDNSWTERDIQNLLKAINEFGSNWYKIAKSIGNKSPEECILKFLQLPIEDKFLYQSN
                     MNGKENDIGPLKYAPHLPFSKSDNPVLSTIAFLVGLVDPKTVQKMTNRALKESLEENN
                     IDDVDSKEAKLIESRNENDSSNPPVSSNGIENKESVPSMIKEGSEVAMAALGIRSNIF
                     ATNEERKLVTLSNQLVQVQMQKLESKFNLLKKFEKSLELEKKIIEKQQEDLLIQRLSF
                     IRNSNILLNKLKQSVDHDAETKIDNKEALKEVIMDVERFLANPTKLSVGSSVDSNTLK
                     TGGANDYGSSSSKTEKDIKPISIDAPQFYRYWSA"
     gene            complement(<61138..>62164)
                     /gene="NDAI0B00320"
                     /locus_tag="NDAI_0B00320"
                     /db_xref="GeneID:11497488"
     mRNA            complement(join(<61138..61383,61856..>62164))
                     /gene="NDAI0B00320"
                     /locus_tag="NDAI_0B00320"
                     /product="ribosomal protein L17"
                     /transcript_id="XM_003668261.1"
                     /db_xref="GeneID:11497488"
     CDS             complement(join(61138..61383,61856..62164))
                     /gene="NDAI0B00320"
                     /locus_tag="NDAI_0B00320"
                     /inference="similar to DNA sequence:INSDC:YJL177W,YKL180W"
                     /note="similar to Saccharomyces cerevisiae RPL17B
                     (YJL177W) and RPL17A (YKL180W); ancestral locus Anc_1.161"
                     /codon_start=1
                     /product="ribosomal protein L17"
                     /protein_id="XP_003668309.1"
                     /db_xref="GeneID:11497488"
                     /db_xref="GOA:G0W352"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:G0W352"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAVSGWELTKA
                     QKYLDQVLEHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANA
                     EAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVTEREEAVEKA
                     AEKKVVRLSSRQRGRIAAQKRISA"
     gene            <62738..>63604
                     /gene="NDAI0B00330"
                     /locus_tag="NDAI_0B00330"
                     /db_xref="GeneID:11497960"
     mRNA            <62738..>63604
                     /gene="NDAI0B00330"
                     /locus_tag="NDAI_0B00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668262.1"
                     /db_xref="GeneID:11497960"
     CDS             62738..63604
                     /gene="NDAI0B00330"
                     /locus_tag="NDAI_0B00330"
                     /inference="similar to DNA sequence:INSDC:YJL178C"
                     /note="similar to Saccharomyces cerevisiae ATG27
                     (YJL178C); ancestral locus Anc_1.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668310.1"
                     /db_xref="GeneID:11497960"
                     /db_xref="InterPro:IPR018939"
                     /db_xref="UniProtKB/TrEMBL:G0W5K6"
                     /translation="MKSITLNNLLILSLVFSPSLVSSIQCSKDAVLKRYQINEFASLG
                     EIESDTPPSKTTEKWWINPCEENNEANVNIPSDCYHDDVSCGLVEVLLPGKEALTTQV
                     INFSKNLKYVAEEFDDKLLITLKGTKWGSNTFDAEFEFSCDPKLKSDTLVETSWQRGL
                     IKLYVNGPSGCLRDKRDNDNDDNNNNKDKDDDNNRKDSDKKNGNSEKNKRNGGISWFS
                     WLLIYSLMFTLIYLMVVSYMNTRGGSFDDFRTEFVTRSTQLLTSLPEFTKEVINKVLG
                     RNDSQRGGYSAV"
     gene            complement(<63831..>64187)
                     /gene="NDAI0B00340"
                     /locus_tag="NDAI_0B00340"
                     /db_xref="GeneID:11497961"
     mRNA            complement(<63831..>64187)
                     /gene="NDAI0B00340"
                     /locus_tag="NDAI_0B00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668263.1"
                     /db_xref="GeneID:11497961"
     CDS             complement(63831..64187)
                     /gene="NDAI0B00340"
                     /locus_tag="NDAI_0B00340"
                     /inference="similar to DNA sequence:INSDC:YJL179W"
                     /note="similar to Saccharomyces cerevisiae PFD1 (YJL179W);
                     ancestral locus Anc_1.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668311.1"
                     /db_xref="GeneID:11497961"
                     /db_xref="GOA:G0W5K7"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G0W5K7"
                     /translation="MSSSSLIQEMTTTLRTSKGQLDVVNQQLSHLERQEKIAQVTTKE
                     LDSYPNDDVWRSCGKAFVLQKKNEYIKDLNHDENLLKDQKKALEIKQNYLKTTVEKTV
                     DGLKAVLNQQQQQQKK"
     gene            <64512..>65516
                     /gene="NDAI0B00350"
                     /locus_tag="NDAI_0B00350"
                     /db_xref="GeneID:11497962"
     mRNA            <64512..>65516
                     /gene="NDAI0B00350"
                     /locus_tag="NDAI_0B00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668264.1"
                     /db_xref="GeneID:11497962"
     CDS             64512..65516
                     /gene="NDAI0B00350"
                     /locus_tag="NDAI_0B00350"
                     /inference="similar to DNA sequence:INSDC:YJL180C"
                     /note="similar to Saccharomyces cerevisiae ATP12
                     (YJL180C); ancestral locus Anc_1.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668312.1"
                     /db_xref="GeneID:11497962"
                     /db_xref="GOA:G0W5K8"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:G0W5K8"
                     /translation="MLRVLPVSKTVIVGTVGRITSRQRGFFSSIAPIKYNKSNKKPNS
                     INVEDKLKKGVRFWETVTLDDKCIENKILIKLDSKPIKTPSGFDLSVDKNRPLLAYLL
                     RQEWATLPTVSMKNTDHLPLTSLVFRCIDLETAVAKGDKDLITKINADRSLINEQLLR
                     YLDTDTLLVFSPRNEFEGALRSKQDELYLPIIAKIERFLNGFKSSAKSCDIKLRTLDG
                     ETDGIRGNKQNQDTKNAAINYMKSLSMWDLAIFERVVLITKSFICGILLLQNKSPLIT
                     APSSLRDDLQISTEDIAHLATLEIFHQTERWGEVEDTHDVNKRDIRRNINAAAIVAYK
                     "
     gene            complement(<65637..>66911)
                     /gene="NDAI0B00360"
                     /locus_tag="NDAI_0B00360"
                     /db_xref="GeneID:11498113"
     mRNA            complement(<65637..>66911)
                     /gene="NDAI0B00360"
                     /locus_tag="NDAI_0B00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668265.1"
                     /db_xref="GeneID:11498113"
     CDS             complement(65637..66911)
                     /gene="NDAI0B00360"
                     /locus_tag="NDAI_0B00360"
                     /inference="similar to DNA sequence:INSDC:YJL183W"
                     /note="similar to Saccharomyces cerevisiae MNN11
                     (YJL183W); ancestral locus Anc_1.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668313.1"
                     /db_xref="GeneID:11498113"
                     /db_xref="GOA:G0W5K9"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:G0W5K9"
                     /translation="MVFKPKSNVKNQTFNNDSSASSWFLGLSNSVPRNNKIWLNIKRK
                     FNVKILSLITTFILTLYIFSKLFYPSSISSRSSHTPEHGLYIHELPASSRLIFPHVEH
                     APVLKEVGINSLYIQRHEMDGTKKFVLKPDDKPLTDDEKKKTNDQVLLVKKSFLDHGK
                     LVYRKNSAEPEIVIVTLIDFENYELESIVKIVQNRVDYAQKHKYGVYIRWAQEFLPLV
                     ENQNVLESYDKFKPIVMRAAMHAFPRAKYIFYVDKDSLIMNLDLSLQRNLLEPSVLDL
                     GLLKNVPVIPQSNIRTYNHFNPEDASIIIPQSSDGVLDSSSFIIANDQFGKVFLEYLN
                     NPLIVNFDWANLHAAMGHVLQWHPTLLKKTGLVIPKLLASQYDSTRSIDKASSDSYHY
                     TTGDLIASLKGCKERNSCARDIDTLYSKIKKR"
     gene            complement(<67578..>67988)
                     /gene="NDAI0B00370"
                     /locus_tag="NDAI_0B00370"
                     /db_xref="GeneID:11498114"
     mRNA            complement(<67578..>67988)
                     /gene="NDAI0B00370"
                     /locus_tag="NDAI_0B00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668266.1"
                     /db_xref="GeneID:11498114"
     CDS             complement(67578..67988)
                     /gene="NDAI0B00370"
                     /locus_tag="NDAI_0B00370"
                     /inference="similar to DNA sequence:INSDC:YJL184W"
                     /note="similar to Saccharomyces cerevisiae GON7 (YJL184W);
                     ancestral locus Anc_1.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668314.1"
                     /db_xref="GeneID:11498114"
                     /db_xref="InterPro:IPR014849"
                     /db_xref="UniProtKB/TrEMBL:G0W5L0"
                     /translation="MGDLITAKYSSPDIPELHFTIDVNDKRYQTTNGMTTGPSEHVLN
                     AGQIDRDRPSDPKLLSGSSSDVEPHYTELSKLRMHLTGLQDDINIFLTEQMELAKKKK
                     IKLHSEEEEKRIDEEINELLDGGDGDEEDEDEGK"
     gene            <69299..>70015
                     /gene="NDAI0B00380"
                     /locus_tag="NDAI_0B00380"
                     /db_xref="GeneID:11498115"
     mRNA            <69299..>70015
                     /gene="NDAI0B00380"
                     /locus_tag="NDAI_0B00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668267.1"
                     /db_xref="GeneID:11498115"
     CDS             69299..70015
                     /gene="NDAI0B00380"
                     /locus_tag="NDAI_0B00380"
                     /inference="similar to DNA sequence:INSDC:YJL185C"
                     /note="similar to Saccharomyces cerevisiae YJL185C;
                     ancestral locus Anc_1.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668315.1"
                     /db_xref="GeneID:11498115"
                     /db_xref="UniProtKB/TrEMBL:G0W5L1"
                     /translation="MSFFNQPSRQGIKGTPFQQVSENGSGTDTIIREESFILPLEEEQ
                     EFIINNPSRNTSHFLIIDNNSPKIDTLSTDSEESITGIISARTSEEFSILSSSAQSPE
                     LKYNKELDTIENVLKENEEKTSLEAVPLHGYHFLDTEENNKNLRSILTQEQLTLLNKF
                     RTELYSLLKRSRRKNDHQSPNRKYPDIPSLFSNRHLILKCSILLFHDQQRQFISCNKR
                     EPFINNYLYSSSLSTVSLGE"
     gene            complement(<70401..>73115)
                     /gene="NDAI0B00390"
                     /locus_tag="NDAI_0B00390"
                     /db_xref="GeneID:11498544"
     mRNA            complement(<70401..>73115)
                     /gene="NDAI0B00390"
                     /locus_tag="NDAI_0B00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668268.1"
                     /db_xref="GeneID:11498544"
     CDS             complement(70401..73115)
                     /gene="NDAI0B00390"
                     /locus_tag="NDAI_0B00390"
                     /inference="similar to DNA sequence:INSDC:YCR030C"
                     /note="similar to Saccharomyces cerevisiae SYP1 (YCR030C);
                     ancestral locus Anc_1.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668316.1"
                     /db_xref="GeneID:11498544"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G0W5L2"
                     /translation="MSTDYNNSGNTTNTRNIPVQRTKYADSILISKQPYEATETIRIR
                     LSQAKLINKIFYLFFNEIANLKKNYAQQLRKIIVENQDLSVLLNQQLLENSVLTEKEL
                     ENFDFDLLGELKPLWTTVIAELKNDLNSTLEFKNVLSKQVVKNLKDSTENNSSWNESK
                     KLHSKLTQIAASIDHYSKSSNDSQNNLQQANQQWDQEVPYLFELFENIDYNRLQLLKD
                     CLLTYQTGFSDYLLNTTNQCETVMTKFLEFDPEKEIDRFAQEATNYDFKPLLDHNKNV
                     PEQQQRQNPLQQQEQMAKNESNQTDHKSKRKSTFGNLGHRFTSSSTVVHHDLLNNEFS
                     DSSNNQSLKPKKSNHKLRSKMGSIFGLKNRKSQFIANSTPLPPSTTSNIPESKRESTP
                     NSTNSGTISRRSSTLVNNNNTNSSSRRATFTSTTSTTTNPDTSRNNTFTSPNRNNQFN
                     YNVIKEESMSQQKMQQPAPATATVQQQPLSPPLTRAQHSMSPSVGRQKQQLHMGQTPP
                     ISESPITPVSNNSNNLSMSQPPLQPQMKNKPLPTEPQSQVQQQQQQQQQQQQQQQQQQ
                     QHYVDNKPMHIHAPAVPPSRKLSQSRNSQIYANQQQQQQQQQQQQQQQPASSTIQSKL
                     PVQMTGELNILNPQATGSSSTLQLTGQSVFQHATLEETSSQSTFGLNASIAEVINASF
                     KEGIIQDCQLIGEIALTYIPNSIMNTPLPIGINLKINNSDNFDAMILNQAFMEKIQES
                     NEECKETFKINPEFINSRTLGALKYSIKQNEKVIPPITIQPVWKFENHQASVVLTIKI
                     SPMVPDEIDSLILEDLVVFVSIEGANGASDDNVDLEATSALSKPQGSFNKEKRRITWR
                     FKEPLVLKRNSTGERLIARFLTNGLARESPRGVITKFTIRSNQKILIL"
     gene            <74403..>76643
                     /gene="NDAI0B00400"
                     /locus_tag="NDAI_0B00400"
                     /db_xref="GeneID:11498545"
     mRNA            <74403..>76643
                     /gene="NDAI0B00400"
                     /locus_tag="NDAI_0B00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668269.1"
                     /db_xref="GeneID:11498545"
     CDS             74403..76643
                     /gene="NDAI0B00400"
                     /locus_tag="NDAI_0B00400"
                     /inference="similar to DNA sequence:INSDC:YJL187C"
                     /note="similar to Saccharomyces cerevisiae SWE1 (YJL187C);
                     ancestral locus Anc_1.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668317.1"
                     /db_xref="GeneID:11498545"
                     /db_xref="GOA:G0W5L3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W5L3"
                     /translation="MTNVKIRTNLSSPWKGNKHSNDKQINQSLQSNKENPNHYNHKDN
                     IPYYNIAKPDPAAFNSNGLVSKISRLSSSSSHSSSRHNKITIPNTPVKKSPRIHANSD
                     FSTLDSSIMEFRDGNTTTYDSYINNNDNNHTNTTNVSSSLLLQSPSLKKVPKIQISDN
                     FTSPSRNKQNISYSKNERSSSSLLDYPHLQYHSYNNTDSDNHNHSTKKYKKMKKSRNS
                     IILNNTGLSNSLQQFTDDLYGTSLPTTTNFFLSNNNNNNNSTLQIGTDNHSHKKNNNL
                     MKSPLSNNTSNEKHRHLIISPIKEIDFDKDNTGNDDDDNDGYQYIEEADLTTPTRRKS
                     VSGSKPTPFTTNISKLPPSPLNRTSKRHINATITTVDSSTKPPATTPMAELNPDSHLF
                     EKFSNVHKIGSGEFSSVYQVTFTMTNKKYAVKSLNSNKHNTTISKILQEIKILDEIRS
                     SELDHEGKEYVIDFISSWKFQNSFYIMFDYYENGNLDTFLQEHIICKLIKLEEWRIWK
                     IIVELSLALRFIHQSCQIVHLDIKPANIMITFEGNLKLGDFGMATHLPIVDDSFENEG
                     DREYIAPEIISDCIYDFRADIFSLGLMVVEIAANVMLPDNGIAWHKLRSGDLSDAGKL
                     SSTNLHSDSLFSNPAKVDTNLTDYSYTINSNIESEENGSHTKSSNNIESISKSKIPAW
                     VPKFLIDGESLEKMVKWMINPDYKKRPTADQILNTEECIYVEMTRKAGAIIQEDDYGP
                     KPNFLT"
     gene            complement(<78060..>78576)
                     /gene="NDAI0B00410"
                     /locus_tag="NDAI_0B00410"
                     /db_xref="GeneID:11498546"
     mRNA            complement(join(<78060..78209,78571..>78576))
                     /gene="NDAI0B00410"
                     /locus_tag="NDAI_0B00410"
                     /product="ribosomal protein L39"
                     /transcript_id="XM_003668270.1"
                     /db_xref="GeneID:11498546"
     CDS             complement(join(78060..78209,78571..78576))
                     /gene="NDAI0B00410"
                     /locus_tag="NDAI_0B00410"
                     /inference="similar to DNA sequence:INSDC:YJL189W"
                     /note="similar to Saccharomyces cerevisiae RPL39
                     (YJL189W); ancestral locus Anc_1.148"
                     /codon_start=1
                     /product="ribosomal protein L39"
                     /protein_id="XP_003668318.1"
                     /db_xref="GeneID:11498546"
                     /db_xref="GOA:G0W5L4"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR020083"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="UniProtKB/TrEMBL:G0W5L4"
                     /translation="MAAKKAFKIKQKLAKAKKQNRPLPQWIRLRTDNTIRYNAKRRNW
                     RRTKLHI"
     gene            <79101..>79493
                     /gene="NDAI0B00420"
                     /locus_tag="NDAI_0B00420"
                     /db_xref="GeneID:11498547"
     mRNA            <79101..>79493
                     /gene="NDAI0B00420"
                     /locus_tag="NDAI_0B00420"
                     /product="ribosomal protein S22"
                     /transcript_id="XM_003668271.1"
                     /db_xref="GeneID:11498547"
     CDS             79101..79493
                     /gene="NDAI0B00420"
                     /locus_tag="NDAI_0B00420"
                     /inference="similar to DNA sequence:INSDC:YJL190C"
                     /note="similar to Saccharomyces cerevisiae RPS22A
                     (YJL190C); ancestral locus Anc_1.147"
                     /codon_start=1
                     /product="ribosomal protein S22"
                     /protein_id="XP_003668319.1"
                     /db_xref="GeneID:11498547"
                     /db_xref="GOA:G0W5L5"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:G0W5L5"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKH
                     GYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIADIEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<80040..>80826)
                     /gene="NDAI0B00430"
                     /locus_tag="NDAI_0B00430"
                     /db_xref="GeneID:11498304"
     mRNA            complement(join(<80040..80446,80817..>80826))
                     /gene="NDAI0B00430"
                     /locus_tag="NDAI_0B00430"
                     /product="ribosomal protein S14"
                     /transcript_id="XM_003668272.1"
                     /db_xref="GeneID:11498304"
     CDS             complement(join(80040..80446,80817..80826))
                     /gene="NDAI0B00430"
                     /locus_tag="NDAI_0B00430"
                     /inference="similar to DNA sequence:INSDC:YCR031C,YJL191W"
                     /note="similar to Saccharomyces cerevisiae RPS14A
                     (YCR031C) and RPS14B (YJL191W); ancestral locus Anc_1.146"
                     /codon_start=1
                     /product="ribosomal protein S14"
                     /protein_id="XP_003668320.1"
                     /db_xref="GeneID:11498304"
                     /db_xref="GOA:G0W5L6"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:G0W5L6"
                     /translation="MANDLVQARDASQVFGVARIFASFNDTFVHVTDLSGKETIARVT
                     GGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAA
                     LRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            <81978..>82667
                     /gene="NDAI0B00440"
                     /locus_tag="NDAI_0B00440"
                     /db_xref="GeneID:11498305"
     mRNA            <81978..>82667
                     /gene="NDAI0B00440"
                     /locus_tag="NDAI_0B00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668273.1"
                     /db_xref="GeneID:11498305"
     CDS             81978..82667
                     /gene="NDAI0B00440"
                     /locus_tag="NDAI_0B00440"
                     /inference="similar to DNA sequence:INSDC:YJL192C"
                     /note="similar to Saccharomyces cerevisiae SOP4 (YJL192C);
                     ancestral locus Anc_1.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668321.1"
                     /db_xref="GeneID:11498305"
                     /db_xref="UniProtKB/TrEMBL:G0W5L7"
                     /translation="MLFVLYLIVGFLLSFAKCTTIKGKLDLPFVNISNFSISRTYFSL
                     YQIGNYSTNEPYYKKTGLQDSDGNFEFSNLPINSGINETTHFVLYSTSLDFNLKPNRI
                     LIEFKELENGTITSKAFKNFFGREYFPSNDIIHPEHLEAIEMEPYITISEVNMAPYRS
                     YFQVRNVGILQSGPLASILNSRWKSAAVLSVILLAIFPFLVEKFDPETTKAMKQEALA
                     KKRKNISILHR"
     gene            complement(<82841..>84043)
                     /gene="NDAI0B00450"
                     /locus_tag="NDAI_0B00450"
                     /db_xref="GeneID:11498306"
     mRNA            complement(<82841..>84043)
                     /gene="NDAI0B00450"
                     /locus_tag="NDAI_0B00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668274.1"
                     /db_xref="GeneID:11498306"
     CDS             complement(82841..84043)
                     /gene="NDAI0B00450"
                     /locus_tag="NDAI_0B00450"
                     /inference="similar to DNA sequence:INSDC:YJL193W"
                     /note="similar to Saccharomyces cerevisiae YJL193W;
                     ancestral locus Anc_1.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668322.1"
                     /db_xref="GeneID:11498306"
                     /db_xref="GOA:G0W5L8"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G0W5L8"
                     /translation="MLLHLRPHLHIIILCICWYAISSLASQVTKQVLTLCPLPLFLGE
                     FQFLYTALLAALSCTMAYYYPSFNNIFPKGTFPEYNRDYNNSDYITRNSSQQKNIITR
                     PTKFIFKTVLPLSVFQFVGKYFGHKGTSLVPISTVASIKTLSPLFILLFQKMLRIKTL
                     PLTKILYFSLFSLVVGVWIIVREDSKFSTKNKNNSIGSSSYGVICAIISMFIFVGQNI
                     YGKKVFTYKSENQINPTLDRVEDYRENSPLPYYEGKMKMPEIQPHKPKSYDKLTLMIY
                     ISLVGFALSFCWFMALEFPIIWGHLFHGTSNDLIQEMPWRLYFLNGTFHFLQAMITFH
                     LLGEISTLTYSIANLMKRIAIISVSWVFVGRSVTLWQIVGLLLNVFGLFLYERCSNKR
                     KQIKSRPE"
     gene            complement(<84526..>86235)
                     /gene="NDAI0B00460"
                     /locus_tag="NDAI_0B00460"
                     /db_xref="GeneID:11498310"
     mRNA            complement(<84526..>86235)
                     /gene="NDAI0B00460"
                     /locus_tag="NDAI_0B00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668275.1"
                     /db_xref="GeneID:11498310"
     CDS             complement(84526..86235)
                     /gene="NDAI0B00460"
                     /locus_tag="NDAI_0B00460"
                     /inference="similar to DNA sequence:INSDC:YJL194W"
                     /note="similar to Saccharomyces cerevisiae CDC6 (YJL194W);
                     ancestral locus Anc_1.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668323.1"
                     /db_xref="GeneID:11498310"
                     /db_xref="GOA:G0W5L9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016314"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5L9"
                     /translation="MTMGRITRSKTKKIASRATLDLCLETPINISANSEDEPIMEPTT
                     PMKGEKDRENAANLLATPPGSIEKKQRVQQVTIIDTTPVKNSIALDGSLPSPCPSPLP
                     QDNRDSLSPKKLIFGKNSLYSRTKAVLQRSTETVTNKEDGSLPTRKLQYLQILEFLNR
                     NMEAHKSSSLYITGPPGTGKTAQVDSILKSSFLPIIPKHSQNQSIPKLSSHDLNNVSL
                     YQLPSGKIQQVAVTSINCIALTNPSSIFTRIYEAFHKQTFNTNIPSTPVKTMHALQQF
                     MEQYAQTTTFIVVLDELDKLVHPSITNVHSTKILFELFLLSRIPTVNFLLIGIANSLD
                     MKDRFLSRLNLRQDLLPETLIFQPYSSDEMFQIIMDRINLVDPNESVFNPMAIKFAAK
                     KCSGNTGDLRKLFDVLRRSIEIVELQILSDMKKNLNSNNTVLTKVGLPHIAKVFAQFM
                     NSSSTKSRIGKLNMQQRIVLCCLVHRQKIDIFQSHCSLDDAYDYYYQLLKRKDSLIPL
                     KRNEFLEICNALETNGVVTIFRGKTQGRTKHSIKMIKTTVDDKEFDEEINKMDLLKSL
                     LIH"
     gene            <87624..>89636
                     /gene="NDAI0B00470"
                     /locus_tag="NDAI_0B00470"
                     /db_xref="GeneID:11498311"
     mRNA            <87624..>89636
                     /gene="NDAI0B00470"
                     /locus_tag="NDAI_0B00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668276.1"
                     /db_xref="GeneID:11498311"
     CDS             87624..89636
                     /gene="NDAI0B00470"
                     /locus_tag="NDAI_0B00470"
                     /inference="similar to DNA sequence:INSDC:YCR033W"
                     /note="similar to Saccharomyces cerevisiae SNT1 (YCR033W);
                     ancestral locus Anc_1.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668324.1"
                     /db_xref="GeneID:11498311"
                     /db_xref="GOA:G0W5M0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:G0W5M0"
                     /translation="MFNKKRYHYSRKKYDGFNNRKPNATNLASPRQNNDRRHSYFPKP
                     DHNIRTGASTINITRGIGNPPHNIGTNSRYNPNSIPFKRYSNGKLSTEKRISNSRYNP
                     NASIYVSAIERPKSVPITINNTRTISRYSGTNTPTLLNTEQLGGFHGSRYRKPVRHSI
                     GKPNKVYTGSVIPHEKRYNASSVDKTTSYKREANIKHGGLLTSLGSSLINSVKHQTKR
                     LDELELGNDKGIKPDLSKKFFNDKMEVENELEKQKLVINTVGKDISIGKTTAINRTLQ
                     HEEGEKEEHSICEQISKNNSTEYEYISDPALLITDLTNLKKHLESKKEKLSKSWQVPI
                     NKHVSSCIYPLTKVSTQLAGLRERLINSKTNLAGRSNVCEKTTINSLKEYDIFNANIL
                     EYSSNVREKLYQRLSAIEKYKRIHEWTMENRSRNLKSQWDIDVSRMISANEPVTDFGN
                     ETQITETDEQYSQPSSTSDITEDTEIGLTYSIEPRPQARFSRRLNRADFVDDSELEEA
                     FLQIDPDYRHHQLAVTVPDIIKDPIKKLSTKYNDVTNLVTDKNDWASRIYTDGQIDFS
                     KREHDLFVKAYLIYPKKFGKISKYMGGLRSCEECVLHYYRTKHQVNYKKLIKLRNKRR
                     IQSTLIRRSKRKLSNDTAEEEDDANTSNTYEDVSISDNSDVEDDNE"
     gene            complement(<89965..>93726)
                     /gene="NDAI0B00480"
                     /locus_tag="NDAI_0B00480"
                     /db_xref="GeneID:11498312"
     mRNA            complement(<89965..>93726)
                     /gene="NDAI0B00480"
                     /locus_tag="NDAI_0B00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668277.1"
                     /db_xref="GeneID:11498312"
     CDS             complement(89965..93726)
                     /gene="NDAI0B00480"
                     /locus_tag="NDAI_0B00480"
                     /inference="similar to DNA sequence:INSDC:YJL197W"
                     /note="similar to Saccharomyces cerevisiae UBP12
                     (YJL197W); ancestral locus Anc_1.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668325.1"
                     /db_xref="GeneID:11498312"
                     /db_xref="GOA:G0W5M1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0W5M1"
                     /translation="MAFNDDENTESEELDVQLFDDLNDDKREQSQNQLEKDKSQQYEN
                     DASVAVEAESNDNEEEGDNTSQLIPDLPSQRNIISDLLEENKNMEAEGDKIYIIPKYW
                     FDKLKDPVTADPNELGPIDPSLICKDYDNLILADYNKHPYIPLPESVFLKLYEWYGLA
                     QGSQPVVTFLIYDDESNSLIPDYNWYFFRIHHLTQDGASRNYYPKNTKTCFTMTSLAT
                     LKDVLIKAMDYFAAIETNIDATQMNFQIWYVDDPSASHTASILSTLYELNPIQFLSFN
                     AITKITTQLMDKQMKEFTPTSFDFVIETKPKQKSSHWPSNFLIYNNLQSSPGTIGLTN
                     LGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSLFG
                     DNITSTTAYSPSYFKSTLGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIDKKPYVE
                     KPSLPLTANLNDFDVVKRLADDTWKAHLLRNDSVITDLFVAMYKSTLKCPECQNTSVT
                     FDPYNDLTLPLPVASIWHTKVKIFPLNSPPCTLEVELAKTSTYLDLKSYISECTGIKI
                     QNLFGCEIFSHQFYTNYETVESNSQFLPLQELISDQDDVIFYEINISNDEIIVPVLNT
                     KVEENFSRPSLFGVPFFITLSASELDNPCLIRYKLEKCYSNLSGGFIPFPSTEQEEFP
                     TLDDFPLLSAKYPKEALEKYTDVLHYSVPICIDNDKQVRNEEYFKIKILNFKQSIKTI
                     NNANDGKQSPAFWVPQTHMNFSKAQDITELLNPITRSLYQYHLSSDDEITSEGLVDTA
                     KNERKLMKVQDSDLESPLSEENISVDKDLDTITPEQEQLGIDNEIDLEEIQETDGNSE
                     EKCEEQPAEVSQTTVLNNNLDHTYNRSTLICPGNVIICEWPATNIQKAFTEDKVINWE
                     HPAPLPNPQLEKLKEQRDKQEERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQAT
                     KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYD
                     LIAVDNHYGGLGGGHYTAYAKNANDNKWYYFDDSRVSVTAPEKSIAGSAYLLFYVRRN
                     SHENVVETSLQETIKEAREAHQRKILALEERQKIIYEDNKSDMEDYTDGTDSESSQHA
                     IDVTSNKEVFEDNDIVERPRAAMKTESSMSPTTFGKNTEERRSSDYSNESVEVGEQEL
                     DDSNPDGINAARKKLRLLKKVYNRSSPSLPLTCSETNDEQTIETPKNDS"
     gene            complement(<94490..>97255)
                     /gene="NDAI0B00490"
                     /locus_tag="NDAI_0B00490"
                     /db_xref="GeneID:11498313"
     mRNA            complement(<94490..>97255)
                     /gene="NDAI0B00490"
                     /locus_tag="NDAI_0B00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668278.1"
                     /db_xref="GeneID:11498313"
     CDS             complement(94490..97255)
                     /gene="NDAI0B00490"
                     /locus_tag="NDAI_0B00490"
                     /inference="similar to DNA sequence:INSDC:YCR037C,YJL198W"
                     /note="similar to Saccharomyces cerevisiae PHO87 (YCR037C)
                     and PHO90 (YJL198W); ancestral locus Anc_1.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668326.1"
                     /db_xref="GeneID:11498313"
                     /db_xref="GOA:G0W5M2"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G0W5M2"
                     /translation="MRFSHFLKYNAVPEWQSHYVDYNALKDLIYTLQTDELKLNHNND
                     DDDDDATGGSSSRFGKKLKNKLFHNNKSTITGKSTNNNVNSDGKLAVGDMIHEETFEL
                     SDIPHHQNDSSLSQQQNNKNNNNTHTTTPSKFSALKRVHGKLFDSRRSSSSSDDDKTI
                     INTYDTFLNNLTVEKLKVDDFYKRTEAKFYERFEALIKDLEMEGISADTLSLNFFPEE
                     ANEIPSNSETNDLQDPISGSKTFNVLKTFGEQTQINNENELELDGTGNNNNENEDEDD
                     EDDIDDYDYGEFDEAQDHTALLNYSQVNIKSQKNSLLKQSIINLYIDLCQLKSFIELN
                     RLGFTKITKKGDKVLHLNIKDELIQTEEFYKDSYIFQRETMINLSVRITKLVEFYAIM
                     TNQQSNIANCKKELKLLLHDHIVWERSNTWKDMLGLLSHKDITTDLNGVDPNAALTER
                     LNLEYYYLPLPFTVKLKWVGSFSSIPIPKLFLTWKAFKIGFIITVTGILLGIKTFNDP
                     VEHRCMALVECVAFLWASEAIPLHITAFLVPLLTVLFRVLKNDDGSVMKATTASSTIF
                     SSMWSSTIMILLAGFTLAEALSQYNIAKVLASWLLAAAGTKPRNVLLMAMGVVFFLSM
                     WISNVAAPVLTYSLLKPILDTMDASKPFAQSLILGVALAANIGGMSSPISSPQNIISM
                     EYLKPYGIGWGQFFAVALPTGIISMLLAWGLICLTFKINTSKLTKFKPIKTRFTIKQY
                     YVIIVTIGTILLWCVEAQIEGAFGSSGQIAILPIVLFFATGLLTTKDLNAFPWSIVIL
                     AMGGIALGKAVQSSGLLATIARALQRKIENDGTMAILCIFGILMLVVGTFVSHTVSAI
                     IIIPLVQEVGDKLSNKKAAPVLVFGCTLLASAGMGLASAGFPNITAVSMLDNKGNRYL
                     NSNTFLT"
     gene            complement(<98919..>100079)
                     /gene="NDAI0B00500"
                     /locus_tag="NDAI_0B00500"
                     /db_xref="GeneID:11496242"
     mRNA            complement(<98919..>100079)
                     /gene="NDAI0B00500"
                     /locus_tag="NDAI_0B00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668279.1"
                     /db_xref="GeneID:11496242"
     CDS             complement(98919..100079)
                     /gene="NDAI0B00500"
                     /locus_tag="NDAI_0B00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668327.1"
                     /db_xref="GeneID:11496242"
                     /db_xref="UniProtKB/TrEMBL:G0W5M3"
                     /translation="MSQQIIHPIFYYDKDALKSMDEDMSRHMSYRSKELPSKASYAAF
                     TYRIIEIIDGSIKKISGEQFFECLGTGGDSTRIFLVPSFYHALYKAHLDPNESVGTLF
                     YKDQYLHFAKAFFLKVGCDVVVSLESGIFDSIIPGELLDEFGRGITYRAGIEWYFQRS
                     ICRLTLLFQKGIEDWEGGYRLPTNKTTDEFREEINSLTRIDELLDRVPKTLLCNFNIA
                     DGIDEDGREEIKRRILGAIIVPKKTIFDSKGVLYNEIHPQLPSLLFAALVVLIQTGMK
                     LVDPVLTSILEMENLSKMKKVFMFLIGVCLSNAWFLLIPSAFQRDAVDIIHYKVRYLY
                     EVLKGYVSSIYHFFLPFFRWLNFFLIDNVTSCYLLIIFSFFCYYFHYMSNVI"
     gene            complement(<101687..>102412)
                     /gene="NDAI0B00510"
                     /locus_tag="NDAI_0B00510"
                     /db_xref="GeneID:11496243"
     mRNA            complement(<101687..>102412)
                     /gene="NDAI0B00510"
                     /locus_tag="NDAI_0B00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668280.1"
                     /db_xref="GeneID:11496243"
     CDS             complement(101687..102412)
                     /gene="NDAI0B00510"
                     /locus_tag="NDAI_0B00510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668328.1"
                     /db_xref="GeneID:11496243"
                     /db_xref="UniProtKB/TrEMBL:G0W5M4"
                     /translation="MKYFLTDTGRSFPGPVVEAPFHKLMLKGGNPTLLVLGPNLYKEQ
                     AFYSCDIEETGKELLNIKYEIGNLELNGFLRYIHYRANVQYEGYCYKGSYKIHEHPMK
                     PNKILYLPPSQYSSIPLQAIFYGFSPEDAIIYRDLLIVYRIRAIRRGYKPTMDKVLSV
                     FFDPPYEIYVIPSPHGNDSKQEYMEVDHCEDVTKEERQTYQAYFMLKMRYMLGDKLEY
                     STFSELLENTNHAYCESVHLEEV"
     gene            <106240..>109149
                     /gene="NDAI0B00520"
                     /locus_tag="NDAI_0B00520"
                     /db_xref="GeneID:11496244"
     mRNA            <106240..>109149
                     /gene="NDAI0B00520"
                     /locus_tag="NDAI_0B00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668281.2"
                     /db_xref="GeneID:11496244"
     CDS             106240..>109149
                     /gene="NDAI0B00520"
                     /locus_tag="NDAI_0B00520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668329.2"
                     /db_xref="GeneID:11496244"
                     /db_xref="GOA:G0W5M5"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5M5"
                     /translation="MPCKELFDYCTTVEKNCYVSEDGHQIVNARTPKRFHQLAQKYLV
                     IPLYCKHKRTKYFYYKEESSTLIGALDFAVDRDIVHSKDSSFFEQEMNVSEITFTESD
                     LSILRQFHQVKPQFIESTHELFLQIYSTVRQRYHRRPYLGSFANQGLGEVFPKDLQIP
                     TIQKYSSLAAPFVYLIEVFPQLSFAQDIDSAELTDPPKSVDSMANWFTKKLLPGSSPS
                     IWFLLLRVCCYNWTDVSLSYPALHKLNGYRQFVDSIRALVYLFCLYRYLNHGAIAGDS
                     KADEIFLTSVSEPWNWTKNMYHKLATAYQDYTKFNVKVCKPDAVLISGKKFSRSYIQE
                     FYANVVARYDGCIEELRKYFADVWSVEAIAESVLNKGPNSKSLRVELFLRVHCFLLFD
                     HATLLAQVPHPKSGVTIEPDVVAKIVTEMGVCLMWMIYFSSTGPYRFPDMVILKYAGN
                     NRNLFIDAESRCFDIITSYSKTRTANYLCKSLDKKTSDYLFYYIFVARAVLKHALGKD
                     YCNMSRDLFQETDTVAEQYLLRNYLARSVGGGDSEDDFDPVKYSSNVLNSFVFVDGLS
                     HTLMHYHKFQSLLKVYPMSVDRSSRSSFRELRHGMIKLVREYVKVEGEDMDVMNVKER
                     LAGHSAATGQGIYGNDVEIGVGADASLGGEYASLINSAWQNWLGLGYSKEREEGESAV
                     ARDACVKKYFSSNGSIKDLFVAGKKLYGKEFQFREGQFDVAVEIYLSGTQIIPIQALP
                     GFGKTALFQIPLVALSYGEQKTVSFVFVPYVCLLSNMKLRLSSSGINCGILKDLFVNG
                     PAVEEKNLFCDVYVGTFNDLGSVEFVRLVNNWYNIYQDCILGMIVIDEFHNLETEQSY
                     RGQSFRLIPEINFNLAWKVVVMTGTAGEKGMVKPMKFIGYDKEMCTSMVSNKNRILYF
                     DLVNQIPLKNIVKKFQVFERSTVAETEVEKLVDRFMEYDTKSKVIIVCKEKVTVEK"
     gap             109150..109169
                     /estimated_length=20
     gene            complement(<109214..>111802)
                     /gene="NDAI0B00550"
                     /locus_tag="NDAI_0B00550"
                     /db_xref="GeneID:11496245"
     mRNA            complement(<109214..>111802)
                     /gene="NDAI0B00550"
                     /locus_tag="NDAI_0B00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668282.1"
                     /db_xref="GeneID:11496245"
     CDS             complement(109214..111802)
                     /gene="NDAI0B00550"
                     /locus_tag="NDAI_0B00550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668330.1"
                     /db_xref="GeneID:11496245"
                     /db_xref="GOA:G0W5M6"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5M6"
                     /translation="MNVSEITFTESDLSILRQFHQVKPQFIESTHELFLQIYSTVRQR
                     YHRRPYLGSFANQGLGEVFPKDLQIPTIQKYSSLAAPFVYLIEVFPQLSFAQDIDSAD
                     LTDPPKSVDSMANWFTKKLLPGSSPSIWFLLLRVCCYNWTDVSLSYPALHKLNGYRQF
                     VDSIRALATYSVLYRYLNHGAIAGDSKADEIFLTSVSEPWNWTKNMYHKLATAYQDYT
                     KFNVKVCKPDAVLISGKKFSRSYIQEFYANVVARYDGRIEELRKYFADVWSVEAIAES
                     VLNKGPNSKFVESRVVPKSSLFFIFDHATLLAQVPHPKSGVTIEPDVVAKIVTEMGVC
                     LMWMIYFSSTGPYRFPDMVILKYAGNNRNLFIDAESRCFDIITSYSKTRTANYLCKSL
                     DKKTSDYLFYYIFVARAVLKHALGKDYCNMSRDLFQETDTVAEQYLLRSYLARSVGGG
                     DSEDDFDPVKYSSNVLNSFVFVDGLSHTLMHYHKFQSLLKVYPMSVDRSSRSSFRELR
                     HGMIKLVREYVKVEGEDMDVMNVKERLAGHSAATGQGIYGNDVEIGVGADASLEEKYA
                     SLINSAWQNWLGLGYSKEREEGESAVARDACVKKYFSSNGSIKDLFVAGKKLYGKEFQ
                     FREGQFDVAVEIYLSGTQIIPIQALPGFGKTALFQIPLVALSYGELKDCFICVCPLCC
                     LLSNMKLRLSSSGIDCGILKDLFVNGPAVEEKNLFCDVYVGTFNDLGSENFVRLVNNW
                     YNIYQDCILGMIVIDEFHNLETEQSYRGQSFRLIPEINFNLAWKVVVMTGTAGEKGMV
                     KPMKFIGYDKEMCTSMVSNKNRILYFDLVNQIPLKNIVKKFQVFERSTVAETEVGKLV
                     DSIYGV"
     gene            <115756..>116718
                     /gene="NDAI0B00560"
                     /locus_tag="NDAI_0B00560"
                     /db_xref="GeneID:11496225"
     mRNA            <115756..>116718
                     /gene="NDAI0B00560"
                     /locus_tag="NDAI_0B00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668283.1"
                     /db_xref="GeneID:11496225"
     CDS             115756..116718
                     /gene="NDAI0B00560"
                     /locus_tag="NDAI_0B00560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668331.1"
                     /db_xref="GeneID:11496225"
                     /db_xref="UniProtKB/TrEMBL:G0W5M7"
                     /translation="MDLVTVNGLKLRKPFSESRRKSNIWWFLPNYFSNNSTSTANTFS
                     VKQESWILDEPTTFALDNEPSSHWIFKECIMKYFLTDTGRSFPGTVVEAPFHKLMLKG
                     GNPALLVLEPYLFEEEGFYSCNIEEPGKELLKTKFDFEYPELDSLLCRIHIYTDVQYE
                     GYSYEASYKASENSIKPDKILFLPPSRYSNIPLQAVFYGFSPEDAIIYRDLLIVYRIR
                     AIRRGYKPTMDKVLSVFFDPPYEIYVIPSPHGNDSKQENMEVDHCEDVTEEKRRTHQA
                     YFMLKMKYMLGDKLKYSTFSELLENTNHAYFESIFLEESNDFES"
     gene            <119272..>119562
                     /gene="NDAI0B00570"
                     /locus_tag="NDAI_0B00570"
                     /db_xref="GeneID:11496226"
     mRNA            <119272..>119562
                     /gene="NDAI0B00570"
                     /locus_tag="NDAI_0B00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668284.1"
                     /db_xref="GeneID:11496226"
     CDS             119272..119562
                     /gene="NDAI0B00570"
                     /locus_tag="NDAI_0B00570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668332.1"
                     /db_xref="GeneID:11496226"
                     /db_xref="UniProtKB/TrEMBL:G0W5M8"
                     /translation="MKTHNHTKRYNNLDAKRVSYGCDNGNCGLAKIAMEDRALEEEDY
                     DNKDGPQCPDDACDIYIFILRGSNIIAFRYPNRKQIIYFLYFIIKTHLVRLF"
     gene            <121735..>122754
                     /gene="NDAI0B00575"
                     /locus_tag="NDAI_0B00575"
                     /db_xref="GeneID:11496227"
     mRNA            <121735..>122754
                     /gene="NDAI0B00575"
                     /locus_tag="NDAI_0B00575"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668285.1"
                     /db_xref="GeneID:11496227"
     CDS             121735..122754
                     /gene="NDAI0B00575"
                     /locus_tag="NDAI_0B00575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668333.1"
                     /db_xref="GeneID:11496227"
                     /db_xref="UniProtKB/TrEMBL:G0W5M9"
                     /translation="MEFASINGLKLRKPFPESRIKNKILGFLSNCFSNNSTSATNTYS
                     VKEESWILDEPTTFALDYRKSTNWIFKDCIMKYFLTDKGRSFPDTMLETPFHKQMLRG
                     DYYTLLVLGPNLFKEQAFYSCDIEEAGKELIKTKYNFSASDFWRLLHGIHDFTYVQYE
                     GYCYKECCKLSKTLSKPDKMLFLPPSRYSSIPLQAMFYGFSPEDAIVYRDLLIVYRIR
                     SIRRGHKPTIDNVLNVFFDPPYEIYVIPSPHGDNSREEYIEVHHCEDVTDEERQAYQA
                     YFMLKMKYMMGDKLKYSTFSELLEDTNHAYSESVYLEESNHSQSHCSPLCDEPAKIEL
                     LHHAF"
     gene            <125381..>126397
                     /gene="NDAI0B00580"
                     /locus_tag="NDAI_0B00580"
                     /db_xref="GeneID:11497666"
     mRNA            <125381..>126397
                     /gene="NDAI0B00580"
                     /locus_tag="NDAI_0B00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668286.1"
                     /db_xref="GeneID:11497666"
     CDS             125381..126397
                     /gene="NDAI0B00580"
                     /locus_tag="NDAI_0B00580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668334.1"
                     /db_xref="GeneID:11497666"
                     /db_xref="UniProtKB/TrEMBL:G0W5N0"
                     /translation="MWAHVSHRSNELASKDFDTAFRYEIIEISDGNITKMRGKEFFEK
                     LKIEHKSIRVFLVPSFYHDLYKGSLGPDEMVGYFFFKEQYFRISKTYFIKVGTNIVIS
                     LQDGVFDTEVAHELVDEFSAVNIFPDTTEWYLGCSIQRLTFLMEKTLKTWEDIYHLSA
                     EETGHDPTEEIAKLDKIERLLNSAPAMLSVNLTIAGGLTEEESVERIKYLHRLIVSAK
                     QRIYDDKLILFRRIHPRQPPTLFAGLVALMQTIMRLFTPVLTTLFQLRSISNITKFVI
                     LLMAIIVSNVWFTLFPQKFLTDAVTIIHEEIWHLWQLLRAWNLWQLIRTWHLWQLLRT
                     RLGW"
     gene            complement(<127958..>128911)
                     /gene="NDAI0B00590"
                     /locus_tag="NDAI_0B00590"
                     /db_xref="GeneID:11497667"
     mRNA            complement(<127958..>128911)
                     /gene="NDAI0B00590"
                     /locus_tag="NDAI_0B00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668287.1"
                     /db_xref="GeneID:11497667"
     CDS             complement(127958..128911)
                     /gene="NDAI0B00590"
                     /locus_tag="NDAI_0B00590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668335.1"
                     /db_xref="GeneID:11497667"
                     /db_xref="UniProtKB/TrEMBL:G0W5N1"
                     /translation="MSKIYKTVQKLPDQTDLAQLIKTQTEGAGMLEGVEDINTPAVGD
                     KPSVHKGLSAVSVAAFLNNSQISQADKDIFIAMLQTRGSPMKSTNGVPKQKTIADIRY
                     SLKSFDYFDGEGGNKVTMDTWARRLRFKIGKVQLQGADAVDLLGDLLTGSAANWFFDN
                     IEKIPNYETKDFHFFVDLIVDKYKWKDYAIDKTERIKNHRIQTPEDVFKFEQLVSALG
                     DGYFTDDAVKCLFISSLPEDLKLYAKLNVPISADAAYNWAIPLLQDRRIEKRSRSDNT
                     YQQRKKIKVNKVNKKRSHFGKLGHDDSTCWTLHSKNDSKQV"
     gap             129789..129808
                     /estimated_length=20
     gene            <131225..>132361
                     /gene="NDAI0B00595"
                     /locus_tag="NDAI_0B00595"
                     /db_xref="GeneID:11497668"
     mRNA            <131225..>132361
                     /gene="NDAI0B00595"
                     /locus_tag="NDAI_0B00595"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668288.1"
                     /db_xref="GeneID:11497668"
     CDS             131225..132361
                     /gene="NDAI0B00595"
                     /locus_tag="NDAI_0B00595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668336.1"
                     /db_xref="GeneID:11497668"
                     /db_xref="GOA:G0W5N2"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W5N2"
                     /translation="MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEV
                     KDFLQSIDENPVYAKESYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRF
                     FMDGGYFGVHAIADLLTRNYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEAL
                     GERVHTKGAILSIDATLASPPLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKE
                     QAYELIEDRIHLGTNIGNLESYLLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNK
                     VVNKIYHSSSQDDDFIQKQLSGLYCPVFAITLHSIDQCKELPLHLKYFQHATSLGAAE
                     SLIEWRAVSDVDIDQCLIGVSIGCENADDLIKDLENALQILQNK"
     gene            complement(<133131..>134048)
                     /gene="NDAI0B00600"
                     /locus_tag="NDAI_0B00600"
                     /db_xref="GeneID:11497669"
     mRNA            complement(<133131..>134048)
                     /gene="NDAI0B00600"
                     /locus_tag="NDAI_0B00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668289.1"
                     /db_xref="GeneID:11497669"
     CDS             complement(133131..134048)
                     /gene="NDAI0B00600"
                     /locus_tag="NDAI_0B00600"
                     /inference="similar to DNA sequence:INSDC:YGR277C"
                     /note="similar to Saccharomyces cerevisiae YGR277C;
                     ancestral locus Anc_5.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668337.1"
                     /db_xref="GeneID:11497669"
                     /db_xref="GOA:G0W5N3"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0W5N3"
                     /translation="MRVGVIFDWFGKPDYNEFENILRNCLKNVRFGEQTQITTNADAL
                     DIVLVHDKESLISSIYLDKILGKLYSIARDILLEHEYFLLPINVLFDGSDYDNIQWDI
                     MFMNTHEFSLIEKDKFHYRESQTFEQRNMGSRNGTGSSMDDQTINDKNEYKVTALGGT
                     FDHIHDGHKILLTMAAFLTSDRLIVGVTDEELLVNKKYKEQLENFDKRCLNVMTFVHL
                     VKPSLRVEIVPIKDVCGPTGTVPEIEALVVSRETIAGGQVVNDTRQQRKMHPLAIHVV
                     NVLGGNEEDGWREKLSSTEVRKLISEHRE"
     gene            <134365..>136254
                     /gene="NDAI0B00610"
                     /locus_tag="NDAI_0B00610"
                     /db_xref="GeneID:11498307"
     mRNA            <134365..>136254
                     /gene="NDAI0B00610"
                     /locus_tag="NDAI_0B00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668290.1"
                     /db_xref="GeneID:11498307"
     CDS             134365..136254
                     /gene="NDAI0B00610"
                     /locus_tag="NDAI_0B00610"
                     /inference="similar to DNA sequence:INSDC:YGR278W"
                     /note="similar to Saccharomyces cerevisiae CWC22
                     (YGR278W); ancestral locus Anc_5.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668338.1"
                     /db_xref="GeneID:11498307"
                     /db_xref="GOA:G0W5N4"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W5N4"
                     /translation="MSHESTKLDNEKFQKETWEMIRNHLNAVLSHIDVSKTKNEEYII
                     QTMEDILQANILLGKDIFISLLIEYQRQYNAPEFFTILIKIINSELPNVGLDCSKELT
                     SRFIEKYNKEPQSRRSLFTMTTFLCALFNYEVIHEIVLLQLLHLLLQDINDFSIQIII
                     EILEKSGKKLLEVSKTAHNMIFEKLREILQSNEFGSSPDMINEKLVSLFDKRRLNYES
                     VARLFYPVVLSKLSPQSPHSFMLNDLSTMKSSTLDQFQLHSDYLQLQKDYDILHSRLL
                     QQISSSSEEEQSSKVAEPLKDMTAKSEIEFKKKIYLIIKSSLSADEAAHKLLKLRIPD
                     DKKFEIVDIIINSSLQDPTYSKFYGLLSERLISAHSRSWIPAFHSIFVENWKNTENWE
                     PNQLRILGRYWGHLLAVESIGFGDTLGIIHLNDEETNASNRVFFKFLLQELVAEMSID
                     KMKTTMDELKDQLEGLFPTEDIEHMRYSINYFTAIGLGILTEDMRERLDTIQEEEQKV
                     LLELEEQRRKEEAEAAVTAETEGKERIISEQESKQGSLPIEKSIMMTKEEAGKPRASR
                     YNPNQIVPPKRKRERSITPPRKKGWGSSRNRSRYQNTQNQAGINSRGTPKSTEREKNK
                     VLLKY"
     gene            complement(<136788..>137903)
                     /gene="NDAI0B00620"
                     /locus_tag="NDAI_0B00620"
                     /db_xref="GeneID:11498308"
     mRNA            complement(<136788..>137903)
                     /gene="NDAI0B00620"
                     /locus_tag="NDAI_0B00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668291.1"
                     /db_xref="GeneID:11498308"
     CDS             complement(136788..137903)
                     /gene="NDAI0B00620"
                     /locus_tag="NDAI_0B00620"
                     /inference="similar to DNA sequence:INSDC:YGR279C,YMR305C"
                     /note="similar to Saccharomyces cerevisiae SCW4 (YGR279C)
                     and SCW10 (YMR305C); ancestral locus Anc_5.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668339.1"
                     /db_xref="GeneID:11498308"
                     /db_xref="GOA:G0W5N5"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G0W5N5"
                     /translation="MRFSTIVTTTSLLGAAMAAPAVHQHKEKRAVVTTTIETHKTVTV
                     NAINNNVVAPTQVAALDATVVEAAQKDAVADVASPKAAAAVSTQAAVSAAASTASTAS
                     SSTKSDDSTEMAASDVKGVTYTPYNADGTCKSPDQVASDLSSLKDFPVIRLYGTDCNQ
                     VENVYKGKTSSQKLFLGVYYVDQIQASVDTIKAAVEKYGSWDDVVTVSIGNELVNSNQ
                     ATPSQVGQYVATGRSALTSAGYTGPVVSVDTFISVINNPELCKYSDYMAVNAHAYFDK
                     NTVAQDSGDWLLQQIQRVWTACDGAKDVVITESGWPSKGETYGVAVPSKANQADAVNS
                     IKKVCGSSTYLFTAFNDYWKADGPYGVEKYFGILSDE"
     gene            complement(<139423..>140310)
                     /gene="NDAI0B00630"
                     /locus_tag="NDAI_0B00630"
                     /db_xref="GeneID:11498309"
     mRNA            complement(<139423..>140310)
                     /gene="NDAI0B00630"
                     /locus_tag="NDAI_0B00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668292.1"
                     /db_xref="GeneID:11498309"
     CDS             complement(139423..140310)
                     /gene="NDAI0B00630"
                     /locus_tag="NDAI_0B00630"
                     /inference="similar to DNA sequence:INSDC:YGR280C"
                     /note="similar to Saccharomyces cerevisiae PXR1 (YGR280C);
                     ancestral locus Anc_5.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668340.1"
                     /db_xref="GeneID:11498309"
                     /db_xref="GOA:G0W5N6"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:G0W5N6"
                     /translation="MGLAATRTKQRFGLDPRNTAWSNDTSRFGHKLLEKFGWQPGTGL
                     GMLPGQSHKSHIKVHIKDDNLGLGAKIKRQERKDEFDNGECAGLDVFQRILGRLNGKE
                     EEIVDELEKQRKDKILSGKWGIHFLKGEVLASTWDPKTKKLKSYSNERKRKYSNDEDD
                     ADDDDDEEEDQKNSDSESDVVSDSDVSSDRKTKGKKKKDKKERKEKKHKKRKLDKKTK
                     KSDKNIEKEKKKQRKKEKKAKKVQKRQAAFLESSKTASKIPDSVSTRLSVRSKWIKQK
                     RAAIMDAKALNEIFMIKND"
     gene            <141258..>145733
                     /gene="NDAI0B00640"
                     /locus_tag="NDAI_0B00640"
                     /db_xref="GeneID:11498579"
     mRNA            <141258..>145733
                     /gene="NDAI0B00640"
                     /locus_tag="NDAI_0B00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668293.1"
                     /db_xref="GeneID:11498579"
     CDS             141258..145733
                     /gene="NDAI0B00640"
                     /locus_tag="NDAI_0B00640"
                     /inference="similar to DNA sequence:INSDC:YGR281W"
                     /note="similar to Saccharomyces cerevisiae YOR1 (YGR281W);
                     ancestral locus Anc_5.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668341.1"
                     /db_xref="GeneID:11498579"
                     /db_xref="GOA:G0W5N7"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5N7"
                     /translation="MSIAGQENGAAHTESAANHSSSSSSSSHSSSSASNQIQTSKKYI
                     PSIEVNSGMSESISKTQSNNSSNGADSNSLLPTGEYKVNRNKPETYLNSDDIEKVTDS
                     ELFVQKRIFSFLHTKKIPEVPSNDEERKAFPLFHTNILSNMFIWWVIPIIRVGYKRTI
                     QPNDLFKMDERMSIEKLYADFQDNMNYYFDKAKKKYLIDHPNATEEELVHHLTLPKMT
                     VIRALLFTFKRQYFVATLFAVLANCTSGLNPMITKRLIQFVEEKAFFPHMHVNKGIGY
                     AIGACIMMFLNGLFFNHFFHASQLTGVQAKAILTKAALDKMFRTSNYGKHKFPNGKVT
                     SFVTTDLSRIEFAISFQPFLMGFPVILAICVVLLIVNLGAIALVGIGVFFMAFFLCLF
                     IFKSILGLRVKANKYTDARVTLMREILNNMKMVKYYAWEDAYEKNIQDLRTKEIITVR
                     KMQFIRNFIIALAIALPSIASLVTFLAMYKVNNMGRTPGNIFASLSLFQVLSIQMFFL
                     PIAIATGIDMVIGLGRLQDLLVAPENDPNITKERAPSPDLDPSIALKLDNTSFEWENY
                     ELLESEEKKLEEASNDKLKKKKKKGNNNKSKKEEEQVVKTNESAPNNTEKLEDGKIQF
                     SGFHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNGDLLLCGYPWI
                     QNATVRDNILFGSPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGERGITLSGGQKAR
                     INLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILATHQLSLLERA
                     SRVIVLGTDGSFEIGPVDVLKRTNQTLINLLLFSNQESKEEDTENIMEEEEFEKAERT
                     FTEINELEKQMTQKSKDPSVIVNGNTMLKEERAVNSIGWNVYKAYLSAGVGKWGFILI
                     PFYLLLIIITTFCQLFSSVWLSYWTEDKFKNRSTSFYMGLYSFFVFAGYLFTSSQFTL
                     LCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIRLM
                     LFQTANIVGVCVMCIIYLPWFAIAIPFLFIGFTLITDHYQSTGREVKRLEAIQRSFVY
                     NNFNEILGGMDTIKSYGSEERFLAKSDYLINKMNEAGYLSVALQRWVAIFLDLVAVCF
                     ALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLLNGVLRALTQTENDMNSAERLVSYA
                     TELPLEAAYRRPEVSPPENWPSEGKIEFKHVDFSYRPGLPIVLKDLDLDIKSGEKIGI
                     CGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGT
                     IRKNLDPFNEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFKFHLDQLVE
                     EEGANFSLGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQARIVKEFGDCTIL
                     CIAHRLNTILNYDRILVLEKGEVAEFEKPKVLFDQEDSIFRSMCLRSGITEEDFA"
     gene            complement(<146699..>147640)
                     /gene="NDAI0B00650"
                     /locus_tag="NDAI_0B00650"
                     /db_xref="GeneID:11498580"
     mRNA            complement(<146699..>147640)
                     /gene="NDAI0B00650"
                     /locus_tag="NDAI_0B00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668294.1"
                     /db_xref="GeneID:11498580"
     CDS             complement(146699..147640)
                     /gene="NDAI0B00650"
                     /locus_tag="NDAI_0B00650"
                     /inference="similar to DNA sequence:INSDC:YGR282C"
                     /note="similar to Saccharomyces cerevisiae BGL2 (YGR282C);
                     ancestral locus Anc_5.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668342.1"
                     /db_xref="GeneID:11498580"
                     /db_xref="GOA:G0W5N8"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G0W5N8"
                     /translation="MRFSTFATTATTLLFTATQVSAIGDLAFNMGVKNNDGSCKSTEQ
                     YESDLETLKGYTSTVKVYAASDCNTLQNLAPAAENKGFSIFVGVWPNDDAHFEAEVQA
                     LQTYLPTIKTDTVAGFLVGSEALYRNDMSPDQLAEKINSVRDTISKISDSQGNSYSGK
                     QVGTVDSWNVLVAGYNSAVITASDFVMANAFSYWQGQVMSNASYSFFDDIMQALGTIQ
                     TAKGSTDISFWVGETGWPTDGSNFESSYPSIDNAKQFWQEGICAMRAWGVNVIAFEAF
                     DEDWKPPTSGISDVENHWGVFTSDNKLKYSLSCDFSK"
     gene            complement(<148409..>149377)
                     /gene="NDAI0B00660"
                     /locus_tag="NDAI_0B00660"
                     /db_xref="GeneID:11498581"
     mRNA            complement(<148409..>149377)
                     /gene="NDAI0B00660"
                     /locus_tag="NDAI_0B00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668295.1"
                     /db_xref="GeneID:11498581"
     CDS             complement(148409..149377)
                     /gene="NDAI0B00660"
                     /locus_tag="NDAI_0B00660"
                     /inference="similar to DNA sequence:INSDC:YGR284C"
                     /note="similar to Saccharomyces cerevisiae ERV29
                     (YGR284C); ancestral locus Anc_5.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668343.1"
                     /db_xref="GeneID:11498581"
                     /db_xref="GOA:G0W5N9"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:G0W5N9"
                     /translation="MSYRGGQGTAFNGGAMNGNMNMHGQFANTQYQANVHRPMSNPNN
                     NNTGSSLLQKTQKTLDNWNDMLEELSHHPFINRIKPYIPAIARFCIVVTFYEDSMRIL
                     TQWTDQVSYLNQWKHYPYFFVVLFLFSVSVTMSVGSTFLILRKHTKYATSALCFVVIL
                     QGLVYGLFNSSSFILRNFSVIGGLLIAFSDSIVQNKITFGMLPELSDKKDQIRGYLLF
                     AGRIMMVLMFLGFTFGKSWIVIVFTIICTICLAVGFKTKLASVVLVLILTFYNVLLNN
                     YWFQDAFQRDLSKYEFFQNLSIIGGLLLVTNTGAGELSVDSKKKIY"
     gene            complement(<150183..>151478)
                     /gene="NDAI0B00670"
                     /locus_tag="NDAI_0B00670"
                     /db_xref="GeneID:11498582"
     mRNA            complement(<150183..>151478)
                     /gene="NDAI0B00670"
                     /locus_tag="NDAI_0B00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668296.1"
                     /db_xref="GeneID:11498582"
     CDS             complement(150183..151478)
                     /gene="NDAI0B00670"
                     /locus_tag="NDAI_0B00670"
                     /inference="similar to DNA sequence:INSDC:YGR285C"
                     /note="similar to Saccharomyces cerevisiae ZUO1 (YGR285C);
                     ancestral locus Anc_5.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668344.1"
                     /db_xref="GeneID:11498582"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0W5P0"
                     /translation="MFSLPTLTSDITVSVNDSAKLTEAIRRPIEPVGKHFMHHAQRTL
                     RNHTWSEFERIQAERNVQTVDESNVDPDELLFDQELADESLLSHDARDWKTADLYAAM
                     GLSKLRFKATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDAFFKIIQKAFETLTDSTK
                     RQQYDSCDFVADVEPPKKGSKYDFFEAWAPVFQSEARFSKKSPVPQLGDANSSKKDVE
                     QFYSFWHRFDSWRTFEFLDEDVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLV
                     ERAMSEDPRIKAFKEEEKKEKERKKWEREAGSRAEAEAKAKAEAEAKAKAELEAASQA
                     SAKADKKKQKEAAKAAKKKNKRAIRNSPKEAGYFGDADKAATIDEQVGLIVDSLDDDQ
                     LVDVAGKIKAGSVKETFQEIAGTLKDSGKLPASLLSYFI"
     gene            <152736..>155096
                     /gene="NDAI0B00680"
                     /locus_tag="NDAI_0B00680"
                     /db_xref="GeneID:11496216"
     mRNA            <152736..>155096
                     /gene="NDAI0B00680"
                     /locus_tag="NDAI_0B00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668297.1"
                     /db_xref="GeneID:11496216"
     CDS             152736..155096
                     /gene="NDAI0B00680"
                     /locus_tag="NDAI_0B00680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668345.1"
                     /db_xref="GeneID:11496216"
                     /db_xref="UniProtKB/TrEMBL:G0W5P1"
                     /translation="MLLFLLYFLSICSSPILAIEIKSNLTLNRDSSFSGGVTIDYGSQ
                     LIMDGYTHEFYGDLEVDGNLCVANTKAMTNFGFITKGNTITNNGNIVLQNYATFYSGV
                     LDWEMNNFYNYGYMQLGQFFSKSLKWTVTNDFVNTGKFLLVVTQELQLGNNVTTLQNS
                     GTINLYTNFLTSINSPVKGGGCIILTSTVLSINTSKDINDQTFYFTGYNVDLNVVGKN
                     PISTPTIYGFGNTEHKISFNGSGVATVDKMSYSTTTGILSATVNGVTYTFNMGKGYDA
                     SKFSSVSYTSTTNNYPYITYSGTTPSQTVPKLCDTNTGLTIDECVAIQTLPKPITTAA
                     AIREYTVSEIVSYYSTTYSDGFAGIVTTISTLSHPFYIPKPYTTTIASGSSTISEVIS
                     FYSTTVGGSAATGTKISTIPPPFSIPKPYTTKITTGGSTISEVVSFASTQVGGKPATV
                     TSISTIPPPFSIPKPYTTTITTGGSTISEVVSFASTQVGGKPATATRVSTIPPPFSXX
                     XXTTITTDGTTISEVVSFVSTQISGKPATVTSVSTIPPPFSLPAPYTTTITTDGTTIS
                     EVVSFVSTQISGKPATVTSVSTIPPPFSLPVPYTTTITTDGTTISEVVSFVSTEISGK
                     PATVTSVSTIPPPFSLPAPYTTTITTDGTTISEVISFASTEISGKKATVTSISTILPS
                     YIATSIEESLTTSDVVSSSSVTETDGKDITGTFKTTIASPGKSSSFHPASTSIEDIEI
                     TYVTITIYLHTTHITSEVLIPFVGTARETLSSEVRTFIVSGGADTQ"
     gap             154255..154265
                     /estimated_length=11
     gene            <157522..>159411
                     /gene="NDAI0B00690"
                     /locus_tag="NDAI_0B00690"
                     /db_xref="GeneID:11496217"
     mRNA            <157522..>159411
                     /gene="NDAI0B00690"
                     /locus_tag="NDAI_0B00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668298.1"
                     /db_xref="GeneID:11496217"
     CDS             157522..159411
                     /gene="NDAI0B00690"
                     /locus_tag="NDAI_0B00690"
                     /inference="similar to DNA sequence:INSDC:YGR276C"
                     /note="similar to Saccharomyces cerevisiae RNH70
                     (YGR276C); ancestral locus Anc_5.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668346.1"
                     /db_xref="GeneID:11496217"
                     /db_xref="GOA:G0W5P2"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G0W5P2"
                     /translation="MTDSINNELPLNETLVAVESTDVITANIIDETVTKKRKRTAADS
                     NKDMNDDNITQKNKKLKKNKKNKKLSKPITITIDESRFSNPTKKISLKDLRDLSLFVL
                     NNTNNIPDWIQINNRGAINKLVVLFTPGLQGEDYSFSEGTRFHKEFITLRKEKSDKIP
                     LHNFKYLENYPNFAIPNNSIQSFPVIGPGSKLTIYSPYNAYINVGLTKNEKLEKREML
                     AKRKITIHDLLMTLDELLESDYPIHPNTKGIINNSDNYKEIIALPSQDWIDTKPFDHD
                     GSHTFALDCEMCLSENDGLVLTRISVLDFDMKVIYDTYVKPDVPIVDYLTKFSGITKE
                     ILDPVTTTLKDVQNDLMKIISSDDILVGHSLQSDLKVMKLRHPRIIDTAIIFNHKAGP
                     PFKPALRYLASTYLNINIQEGNSNVLGHDSIEDARTCMQLLKLKLVNGLTFGISINTE
                     NIFDRLYEKNGVKSCILNDSVISTLSNKGDNQYKKRIRCNNDQEIFDSILENVETTDF
                     IVARLRDLEFIRGYSQRSKISEINFESELSNENEILSNMGEYIDKIYEKAPEGTMILL
                     ISGSGDTRPWAAMMKELNALTGEKKNELKRELEKEIEESVHIARDGVASIIIKQPVVA
                     KRNTD"
     gene            complement(<159547..>160491)
                     /gene="NDAI0B00700"
                     /locus_tag="NDAI_0B00700"
                     /db_xref="GeneID:11496218"
     mRNA            complement(<159547..>160491)
                     /gene="NDAI0B00700"
                     /locus_tag="NDAI_0B00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668299.1"
                     /db_xref="GeneID:11496218"
     CDS             complement(159547..160491)
                     /gene="NDAI0B00700"
                     /locus_tag="NDAI_0B00700"
                     /inference="similar to DNA sequence:INSDC:YGR275W"
                     /note="similar to Saccharomyces cerevisiae RTT102
                     (YGR275W); ancestral locus Anc_5.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668347.1"
                     /db_xref="GeneID:11496218"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:G0W5P3"
                     /translation="MELLINKANRANNYYGPNQDSNIHWEYNWFTPLKIETYANNTTN
                     RNPEGNLEKYPFKFKKWQLRIQNTNDENDTIMTTSQDNTHDISSVSLSSLLFDLNKFD
                     RTKQQSQLPKVANAMNANGTADGSLTVDDIRGAVGGSEAIPGLSSSTDVNANANANAN
                     ANANANANVNTNTEANTIVENITDALPLEDSKVDPVEINNESTMVASNDKTRTETEEI
                     VVNNGVQEREAELPVDDDNTNTATETTDQPLPPTSQDEEESSLIEPVNNTDTIPATVD
                     LNQQNDESSTAIPLSASEDPTHEPSSAVDAEGDIEMKE"
     gene            161294..161387
                     /gene="NDAI0Btrna11P"
                     /locus_tag="NDAI_0Btrna11P"
                     /db_xref="GeneID:11497609"
     tRNA            join(161294..161330,161351..161387)
                     /gene="NDAI0Btrna11P"
                     /locus_tag="NDAI_0Btrna11P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11497609"
     gene            <161717..>163834
                     /gene="NDAI0B00710"
                     /locus_tag="NDAI_0B00710"
                     /db_xref="GeneID:11497640"
     mRNA            <161717..>163834
                     /gene="NDAI0B00710"
                     /locus_tag="NDAI_0B00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668300.1"
                     /db_xref="GeneID:11497640"
     CDS             161717..163834
                     /gene="NDAI0B00710"
                     /locus_tag="NDAI_0B00710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668348.1"
                     /db_xref="GeneID:11497640"
                     /db_xref="GOA:G0W5P4"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="UniProtKB/TrEMBL:G0W5P4"
                     /translation="MDPHLEHQNDKTEKNNKAVHNEFHLHHNIVTDDDDDDDDDGFIK
                     KINEVSNFDEQQLILALRHIISSYCFPSESLFRRLAKDCLRNRNLFIDSQQNKWIHKF
                     IDYYRSFFSIKDRFNLQEFTHLPNSENLKTMELFYERLNNFFTRFKFKKKNIFKIDET
                     VYSLQYMNFLFPMDRKIFFDNKGIHILDDEDLIDKFITITECIIATGEVFPPYLVVPN
                     DIIATNTSSTNTKISFTASTNTFFRENPNTTRGWKVYNNNNNNINTDGSQKNIQSSLA
                     WLTDIFAKRESFNIKENKLLLIDEESRYLNIPFILKCKELNIKLFLIPNYATSWFQPL
                     EISTFGLIRGYVDSNLPSLTNIHDNNNNPKDHRLQIDPMISNLNICLTTYSKARSIGF
                     YPFDIKSGFKNCGILPLNKNIVQERIFSNEPSPNMNTITRNLPNIMAEHLSTIKPNPC
                     TSGILAMPQKRHHIHERIQDIYGLPNKKSRINPENSTNLTEIKSPSTTVKSTVKQTND
                     DNKSETGKDTSLPFNFRKLCQNKKSLLFDSSTTQGNIIIRKDSENENERRNHQMFKKK
                     QKLGNIVPATSVLRSLFVRDTSVDSIRSTDEEDSKVTDNNANMTGIEEMINKKTNINK
                     DVGKAKVKKVNNTNNTNNTNDSIKNEKKDDDSIIPFTHHLIHSNKEEGEKNQEAVKDL
                     GSIHTIELESSDYDDVEEVNNSS"
     gene            complement(<163941..>164411)
                     /gene="NDAI0B00720"
                     /locus_tag="NDAI_0B00720"
                     /db_xref="GeneID:11498157"
     mRNA            complement(<163941..>164411)
                     /gene="NDAI0B00720"
                     /locus_tag="NDAI_0B00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668301.1"
                     /db_xref="GeneID:11498157"
     CDS             complement(163941..164411)
                     /gene="NDAI0B00720"
                     /locus_tag="NDAI_0B00720"
                     /inference="similar to DNA sequence:INSDC:YMR298W"
                     /note="similar to Saccharomyces cerevisiae LIP1 (YMR298W);
                     ancestral locus Anc_5.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668349.1"
                     /db_xref="GeneID:11498157"
                     /db_xref="UniProtKB/TrEMBL:G0W5P5"
                     /translation="MMSQRSKQIRNLFLYILIALSLIAAVEYFKYSTRIHYEWFHCTA
                     IKEPIPYDYYNQEVIDILDAEPSSSVVKYYARGGPSCDKRGEFKTIIKRITRDFEPNL
                     EHYSFCIFENFELPQRHYPIDENKGAPGYVAYVGYDSDSKLVERLCNDSTIYHM"
     gene            <165305..>165823
                     /gene="NDAI0B00730"
                     /locus_tag="NDAI_0B00730"
                     /db_xref="GeneID:11498158"
     mRNA            <165305..>165823
                     /gene="NDAI0B00730"
                     /locus_tag="NDAI_0B00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668302.1"
                     /db_xref="GeneID:11498158"
     CDS             165305..165823
                     /gene="NDAI0B00730"
                     /locus_tag="NDAI_0B00730"
                     /inference="similar to DNA sequence:INSDC:YGR273C,YMR295C"
                     /note="similar to Saccharomyces cerevisiae YGR273C and
                     YMR295C; ancestral locus Anc_5.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668350.1"
                     /db_xref="GeneID:11498158"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:G0W5P6"
                     /translation="MSNIKKHLGNNNSKFPKPSIGTSKSHILNEILKMQNRKHNNKAT
                     ITRKGEGEIKEVSSADGKIVPVRNAIITDPILDAFQEAEPFQQALGNASNGGNNCRSF
                     LNDAKRYKYRDVFGRKIKVRDRSNPTRERDERPLDTIKGFQYSLTKDSNLKKNLETST
                     LGFNPRCSSNYY"
     gene            <166514..>168262
                     /gene="NDAI0B00740"
                     /locus_tag="NDAI_0B00740"
                     /db_xref="GeneID:11498237"
     mRNA            <166514..>168262
                     /gene="NDAI0B00740"
                     /locus_tag="NDAI_0B00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668303.1"
                     /db_xref="GeneID:11498237"
     CDS             166514..168262
                     /gene="NDAI0B00740"
                     /locus_tag="NDAI_0B00740"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668351.1"
                     /db_xref="GeneID:11498237"
                     /db_xref="GOA:G0W5P7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="UniProtKB/TrEMBL:G0W5P7"
                     /translation="MHAPYPYHYYGMPPPQGYYYPYPAMNHNMAPPSHMSAPPSPHVY
                     SQPMYNNHLPIPQTFSQPPLQPIVNHYRDVPHALNPQNPSPLYPISSTGEFSNWIRTL
                     MDHLKSAKYGDLIPNKHGVAARTPSHWEELGLQWLFSTYVKKDFYPKWVKQAQEASVP
                     LFTILQRAMTLAMQATDITIIMRKLRDLHFEGKEPAFIFNANVQSIISQIDTKELTQY
                     EPLIKDCILNALTGPYSTINKEFRTSQSPYSISDIYTRISAEYDYITTTQSARPKCSY
                     CHIVGHTRDQCFKAVAPSTANPIPKPKSNTRTTRSSPTHRKQSAKSSKITNNITVDRT
                     TEHDHYWLRPDSLPINEDQHFILDSGASVTVVKNGSILHDLHQTASPPVISSSQNIPM
                     RCTGQGTLRLKLYHSKTIDIPAYVIPELEHNLLSTNSLEHHGIFVDAKHGTLESRDGN
                     TLAQFVRFNSLPWLTFHHVVIPPHARINNLIQKFPLDVVHRLLGHVNVKSLQQSIKNK
                     TFDHFTIEDIDWTGISTFQCITGLQGKSRKHNHTVGSRLKYQKNYEPFQYIHTDVFGP
                     VSVDKPYPSWFVVLYR"
     gap             168386..168735
                     /estimated_length=350
     gap             168831..169334
                     /estimated_length=504
     gene            <169335..>170407
                     /gene="NDAI0B00750"
                     /locus_tag="NDAI_0B00750"
                     /db_xref="GeneID:11498238"
     mRNA            <169335..>170407
                     /gene="NDAI0B00750"
                     /locus_tag="NDAI_0B00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668304.2"
                     /db_xref="GeneID:11498238"
     CDS             <169335..170407
                     /gene="NDAI0B00750"
                     /locus_tag="NDAI_0B00750"
                     /note="Ty-like retrotransposon"
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="XP_003668352.2"
                     /db_xref="GeneID:11498238"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G0W5P8"
                     /translation="GANWYKLIKGFLTDKLNMTEVLGWPCVFMKRKDKQVLIICLFVD
                     DMILFTNSNKMATDAIELLKTRFATKVINDGKGNTINKYDILGMEIEYVKNHSMKFGM
                     EKSLEEKLPTLGIDLSKLRKVPGTPGLIIEKEDIKVTKQEYNQKVKWMQQIIGLASYV
                     GYKYRFDLLYYINVLARHTLYPSGTVIQLAKELIQYLWNTRGRKLIWLKSNNSNTHNK
                     LDIICDASFANQENFKSQYGHIIKLNDNIIAGTSSKSTITCSSSTEAELYSVSQAIPQ
                     FELLTALVKEIEDKTIELKLISDSQPGIASMKNNDEKIMKKKFYAIRLLRLKEEIKER
                     ISNSNILTLRKTSQTFLLNHYQ"
     gene            <171634..>172377
                     /gene="NDAI0B00760"
                     /locus_tag="NDAI_0B00760"
                     /db_xref="GeneID:11498291"
     mRNA            <171634..>172377
                     /gene="NDAI0B00760"
                     /locus_tag="NDAI_0B00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668305.1"
                     /db_xref="GeneID:11498291"
     CDS             171634..172377
                     /gene="NDAI0B00760"
                     /locus_tag="NDAI_0B00760"
                     /inference="similar to DNA sequence:INSDC:YGR272C"
                     /note="similar to Saccharomyces cerevisiae YGR272C;
                     ancestral locus Anc_5.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668353.1"
                     /db_xref="GeneID:11498291"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="UniProtKB/TrEMBL:G0W5P9"
                     /translation="MANPKSHRKNNALGASLEMTQFVDAGANKIKKRIRDLERLLKKK
                     KDILPDTVIIEKERTLEALKLELENATLRQKIKHNAKKYHMVRFFERKKALRRYKKAL
                     NELTSAKDKDEKKIKATELQERKIDLCYVVNFPKTEKYIALYPNTKNEDDSESDSDNK
                     KENDEKDQTSRRRKAFRSVVIKQMEEGTLPVPFDDILEGKKLNKEGTGILLEDESNTK
                     SGRKDERKAGENKKELNEEEEEEEDDFFE"
     gene            complement(<172508..>178384)
                     /gene="NDAI0B00770"
                     /locus_tag="NDAI_0B00770"
                     /db_xref="GeneID:11498292"
     mRNA            complement(<172508..>178384)
                     /gene="NDAI0B00770"
                     /locus_tag="NDAI_0B00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668306.1"
                     /db_xref="GeneID:11498292"
     CDS             complement(172508..178384)
                     /gene="NDAI0B00770"
                     /locus_tag="NDAI_0B00770"
                     /inference="similar to DNA sequence:INSDC:YGR271W"
                     /note="similar to Saccharomyces cerevisiae SLH1 (YGR271W);
                     ancestral locus Anc_5.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668354.1"
                     /db_xref="GeneID:11498292"
                     /db_xref="GOA:G0W5Q0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q0"
                     /translation="MSVSYSVTSAGSYMQAMQTMIEASHSFNIDREKVSIPTIDNEIK
                     KEHSSEHDNTTTLTVLAQDKNEWDDIYKEFDDISFEQLQSVVESYKKGNVTSIYHKIN
                     RLVRSCTSSMPPDSLLDSVIQLTFTYEKGELAKELLDFLGPENIELLSFLLEHRNQLI
                     NQPVEDVLQQIRNSENNGPRLLSQKDIRNQVLQNAESAKNQKLDPAQKVVKYPHVFRK
                     YEASGSSSLSFSGQKFSLPLGTTRTSFQTFEEIIIPAADPSTNKKFVFTKLLKVEDLD
                     YYCRSVFKYETLNQIQSLVYPVAYRTNENMLICAPTGAGKTDIALLAILNAIKQFSTA
                     NDDGEIDIQYDDFKVIYVAPLKALAAEIVAKFSEKLSVFDIKVRELTGDMQLTKSEII
                     ETQVIVTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLHEDRGSVIETLVARTLRQ
                     VESSQSMIRIVGLSATLPNFMDVADFLGVNRQVGMFYFDQSFRPKPLEQQLLGCRGKD
                     GSKQSKENIDKTSYEKLLEMIQRGYQVMVFVHARKETVKSSRTFIKMAQSNAEIDLFA
                     PDPSTKDRYSKQLAKNRDKDLKELFQFGFGVHHAGMSRSDRNLTEKMFKDGAIKVLCC
                     TATLAWGVNLPADCVIIKGTQVYDSKKGGFIDLGISDVIQIFGRAGRPGFGSAHGTGI
                     LCTSNDRLDHYVSLITQQHPIESKFGAKLVDNLNAEISLGTVTNVEEAIQWLGYTYMF
                     VRMKKNPFTYGIEWDEVASDPQLYERRKRMIVTAARRLHSLQMIVFDEISMHFISKDL
                     GRVSSDFYLLNESVEIFNQMCDPRATEADVLSMISMSSEFDGIKFREEEAKELTGLSD
                     SAVECQVGGALDTPQGKTNVLLQAYISQSRIMDSALSSDANYVAQNSVRICRALFLIG
                     VNRRWGNFSKVMLDICKSIEKRLWSFDHPLCQFDLPENIIHQIRTKRPSMEHLLELEP
                     EELGELLHNKKMGGKLYSLLSRFPKIQIETEIFPISSNVMRVHVTLKPDFIWDGRIHG
                     DAQFFWVMVEESDKSQILHFEKFILNRRYVKNPHEMDFMIPLSDPLPPQIVVKAVSDT
                     WIGCESTHAISFQHLIKPHNETLQTKLQRLRPLPTTALHNSLIESIYPFKYFNPMQTM
                     TFHTLYNTNENVFVGSPTGSGKTVVAELAIWHAFREFPGKKIVYIAPMKALVRERVDD
                     WSKRFTPVTGDKVVELTGDSLPDPRDVRDATIVITTPEKFDGISRNWQTRKFVKDISL
                     VIMDEIHLLASDRGPILEMIVSRMNYIASKTGQPIRLLGMSTAVSNAHDMAGWLGVKN
                     NGLYNFSSSVRPVPLKMYIDGFPDNLAFCPLMKTMNKPAFMAIKQHSPDKPALIFVAS
                     RRQTRLTALDLIHLCGMEDNPRRFLNIDDEEELRYYISQVTDDTLKLALQFGIGLHHA
                     GLVEKDRSISHRLFEQNKVRILIATSTLAWGVNLPAHLVIIKGTQFFDKKIQGYKDMD
                     LTDILQMMGRAGRPAYDTSGTAIVYTKESKKMFYKHFLNVGFPVESSLHKVLDDHMGA
                     EITSGTITNKQEALDFLNWTFFFRRAHHNPTYYNIEVDTGDAGVSKHLSELIDSTLEN
                     LKESRCISIHGTDIEPTPFLSVASYYYISHKTIRLLLKQIYNKATFRDVLKWLSLAVE
                     YDDLAVRGGETIMNVELSAQSRYSGESTFTGEWELPIFDPHVKAFLLLQAYLSRADLP
                     IADYIQDTVSVLEQSLRILQAYIDVASELGYFETVLTMIKVMQCIKQGCWYEDDQTST
                     LPGCTLTRHVDMEFTEQGYPLQPKQGLLSLNEIGTFSYKKLQSLIRKFNIDDEDTKQF
                     LYITQRLPVLKDIGFKKQIDNDKITLTASHSNNKSTKGFEVYCSKFPKIQKELWFLIG
                     YEGSELVLLKRCQPRQHGKEVVLSCDLLIPEELQNHKIYFLLVNDAMDIKYQLSHKIL
                     "
     gene            complement(<178836..>182882)
                     /gene="NDAI0B00780"
                     /locus_tag="NDAI_0B00780"
                     /db_xref="GeneID:11498293"
     mRNA            complement(<178836..>182882)
                     /gene="NDAI0B00780"
                     /locus_tag="NDAI_0B00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668307.1"
                     /db_xref="GeneID:11498293"
     CDS             complement(178836..182882)
                     /gene="NDAI0B00780"
                     /locus_tag="NDAI_0B00780"
                     /inference="similar to DNA sequence:INSDC:YGR270W"
                     /note="similar to Saccharomyces cerevisiae YTA7 (YGR270W);
                     ancestral locus Anc_5.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668355.1"
                     /db_xref="GeneID:11498293"
                     /db_xref="GOA:G0W5Q1"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q1"
                     /translation="MTRNLRNRQNKQAAENNMNNGEQPIVSSESNTVVTDANGIVHTS
                     HRSLRRINYAEIEKGFDFLEQDEDEMQDDIPHPNNKDTLIPIASNDDDDNRERNEIDN
                     SNGNSSNKKRKMNNNHHHDPEDDDESFNEEDAEIDEDEILDDDDDDDIYTEDVPLKDR
                     RRRADKQFIVQDNDDDDDDEQISYRANHRSSRVAKRRRTPETTPPRQLRSLRSRTRSS
                     YNVNDNNNNDNNNNAEEGSQEGNITLADEIRELQEDSPIQEKRSLRERRKPVNYRIPP
                     PLSAANPSNDYLDDALAFSNPSPSRRGRNNTMRWNSTQNMGPTRRLFPTGGPFGGNDV
                     TTIFGKNTNFYNQDLYPANIGANTNNKLLLDSDSSDDEILPLGATPKAKSKESIERKK
                     NRKKKPEIADLDPLGVDMNISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPR
                     GVLFHGPPGTGKTLMARALAASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEE
                     AKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRP
                     DAVDPALRRPGRFDREFYFPLPDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYG
                     GADLRALCTEAALFCIQRKFPQIYRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARS
                     TGSSPEPLPDSIKPLLERQFEELKLILDTILPKGNLHIKRDTSLIERYIEYEDLNSDL
                     AEDNNTLEFNKHKLMKQIEQARICKPRLIITGPSGNGQQYISAAILNYLDKYNVQKLD
                     LASLFSETTKSMEATVVQSFIEARKRQPSVILIPNIDIWLRTVPPSIISTLSSLLRSL
                     QGSEKILLLAIGEDISSDQIASEPLSQLSLSRNIFYLKEPSTKQRTEYFNTIASLLKT
                     KPTSFHQLQKRAKPLAKLPTVESQVSPENLDSNGNPLSKNDILRKKLRSFQHQDMKLK
                     NILKIKLSGLMDLFKNRYKRFRKPPIDDALLIHLFEPQPIDDPNWQPAYVKDNDMILE
                     VATGRRFFNMDLDIVEERLWNGYYSEPKQYLKDIELIYRDANTMGDRERIIKASEMFA
                     NAQMGIEDISTPDFIAECKATKLRDLERKELSQKDELLRLEKEKLAEQNLQDTNAAQA
                     TDEDIPHPADKAEIVELGVAAGTQLQLQIQEKKPHSNKIDELNPEEKDSVATQESGMV
                     PDAIKDASTMIDNIPSQRTLAKDEKETEVIPTAERLVKTSEDLSEDNVENSVASKIDL
                     DKDPLQRRTETSEEPLKETIVKHPDNVIVDERLLESIVDSLQKKTKHHAVSYLENIYS
                     EVIELVWEDRYLWDKTETVQKIIQFIEN"
     gene            <184290..>184961
                     /gene="NDAI0B00790"
                     /locus_tag="NDAI_0B00790"
                     /db_xref="GeneID:11498294"
     mRNA            <184290..>184961
                     /gene="NDAI0B00790"
                     /locus_tag="NDAI_0B00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668308.1"
                     /db_xref="GeneID:11498294"
     CDS             184290..184961
                     /gene="NDAI0B00790"
                     /locus_tag="NDAI_0B00790"
                     /inference="similar to DNA sequence:INSDC:YGR268C"
                     /note="similar to Saccharomyces cerevisiae HUA1 (YGR268C);
                     ancestral locus Anc_5.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668356.1"
                     /db_xref="GeneID:11498294"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q2"
                     /translation="MSKIPDDNDGLPSYEDVINEEERLQQQQQQQQQNSRPRPPPIPS
                     NNRPSTSIRPPPLQPARPSPRPPASHPTQQGDQRIKPSNYNPSIPWTYPAGFHCKKCN
                     NTGYKLKNGHSCKSCWRRFAPSNNTMTMPTTYNAYYQNGSNPFFPFAGAPPTPSFMPH
                     VSVGPTPPIGPNGVRPLMVQPGDPRLGGVICGECRGSGRIRFLLDDDLCPLCNGLGRI
                     IGRRP"
     gene            <185488..>186228
                     /gene="NDAI0B00800"
                     /locus_tag="NDAI_0B00800"
                     /db_xref="GeneID:11496235"
     mRNA            <185488..>186228
                     /gene="NDAI0B00800"
                     /locus_tag="NDAI_0B00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668309.1"
                     /db_xref="GeneID:11496235"
     CDS             185488..186228
                     /gene="NDAI0B00800"
                     /locus_tag="NDAI_0B00800"
                     /inference="similar to DNA sequence:INSDC:YGR267C"
                     /note="similar to Saccharomyces cerevisiae FOL2 (YGR267C);
                     ancestral locus Anc_5.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668357.1"
                     /db_xref="GeneID:11496235"
                     /db_xref="GOA:G0W5Q3"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q3"
                     /translation="MNNRNDLMGINRNETGTPLNMKASSPFTLNPPVDSDGFSWPSVG
                     TKQRSIESPEEEQQRIERIADAVKVILNEVGEDINREGLLATPERYAKAMLFFTKGYQ
                     TNIMDDVINNAVFEEDHDEMVIVRDIEIHSLCEHHLVPFFGKVHIAYIPNKKVIGLSK
                     LARLAEMYARRLQVQERLTKQIALALSEILKPLGVAVVIEASHMCMVSRGVQKTGSST
                     MTSCMLGCFRDQHKTREEFLTLLNKSNR"
     gene            complement(<186509..>188635)
                     /gene="NDAI0B00810"
                     /locus_tag="NDAI_0B00810"
                     /db_xref="GeneID:11496236"
     mRNA            complement(<186509..>188635)
                     /gene="NDAI0B00810"
                     /locus_tag="NDAI_0B00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668310.1"
                     /db_xref="GeneID:11496236"
     CDS             complement(186509..188635)
                     /gene="NDAI0B00810"
                     /locus_tag="NDAI_0B00810"
                     /inference="similar to DNA sequence:INSDC:YGR266W"
                     /note="similar to Saccharomyces cerevisiae YGR266W;
                     ancestral locus Anc_5.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668358.1"
                     /db_xref="GeneID:11496236"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q4"
                     /translation="MTYTENEWFDDWDTEALYQEKVRDCDQCIAHSPINNVESGVVCG
                     PNVRLIDVNYDTFMYNGSILIVTKNLTANEENVPIVTYTIGPATNSDNTFELKEGEFP
                     HRLFHTDKLDDNNAFQFYRYKIELPLQNYEQMVKYTINNESKPHYRFFIPSKTMNFNT
                     IAYSCNGFSLAVDTSVFKGSLWFDILNKHSKFRYHVMLGGGDQIYSDSINLYCPAVKK
                     WLKTHDPIKRYSTKMTPEFFEQLNQFYLKEYIEWYGFGHWKGSTPKSMTTQNCFPIAT
                     STIPSINIWDDHDIIDGFGSYSDAFMKTPVFSSIGKAAYKYYMLFQHHVSIDANDDDD
                     IAYLKTSNWILGKRPGQYIEEKSHSVFTRLGPTMGMLGLDCRTERKLKEIVSEGTYQL
                     VFERLHKEIQKGQLDHLLIMLGVPIAYPRLVWLEWLFSSRLLAPLKYLSKKGLFARGL
                     VNDFNGDVELLDDLNDHWCARHHKAERNLLITRLQDFGAKYGIRITILSGDVHLASLG
                     RFKSKIHKRHLANDKKMQQNEKTFNEPENDVRLMFNVISSAVVNTPPPDPMAKLLQAR
                     VSEHHFDFQTTEDSVPLFKFDTDGITSREQPGFLNKRNWSDIIPMENVFNNKYLNDNF
                     KVKLNDRIIPGILKPGEGIPSIPINKEQDQAYPVTKDGIMVSIHVETDRANPNSFSTC
                     YSLPIPELRKKEENLSHKGAKHLPLT"
     gene            <189011..>190144
                     /gene="NDAI0B00820"
                     /locus_tag="NDAI_0B00820"
                     /db_xref="GeneID:11496237"
     mRNA            <189011..>190144
                     /gene="NDAI0B00820"
                     /locus_tag="NDAI_0B00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668311.1"
                     /db_xref="GeneID:11496237"
     CDS             189011..190144
                     /gene="NDAI0B00820"
                     /locus_tag="NDAI_0B00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668359.1"
                     /db_xref="GeneID:11496237"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q5"
                     /translation="MHASNALFIVKLFTLLPIRLVYCYLVILIRHRRSLKGSIWIRAF
                     MREAFDMTDDHTCPDIINPLFNLCVNYLCDKVETIQYQITDEHRLSFSAIGLRDEMID
                     VRYRWYYKPDDFNASDDDILLYFHGGGFAVTLVPTSLIFLRNLSIWFPKMAIIMIDYS
                     VTVGENDKQYPYQILESIGLYTHLINNLQCKNVILMGESAGGNLELALLNYLSTTTMM
                     KTKIPLPKKTILISPWVNPSRLDRYDIMQEKEIERLDCLSFEGLEKFTKRYLQSMNPL
                     NGVNSLPFVDLSYDFDSDNWKTILEQSSIYITYGKDEILKPQIQTFIKNLEMIHPNNF
                     DTSRQVSAYEGGCHIEPLLKLDTDLNSWSMHASVNGILRFIEH"
     gene            <190567..>191688
                     /gene="NDAI0B00830"
                     /locus_tag="NDAI_0B00830"
                     /db_xref="GeneID:11498300"
     mRNA            <190567..>191688
                     /gene="NDAI0B00830"
                     /locus_tag="NDAI_0B00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668312.1"
                     /db_xref="GeneID:11498300"
     CDS             190567..191688
                     /gene="NDAI0B00830"
                     /locus_tag="NDAI_0B00830"
                     /inference="similar to DNA sequence:INSDC:YGR263C"
                     /note="similar to Saccharomyces cerevisiae YGR263C;
                     ancestral locus Anc_5.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668360.1"
                     /db_xref="GeneID:11498300"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q6"
                     /translation="MHLKSLLFIVNICTILPIRLLYCYLVILIKYKRSLRGTICTRTF
                     MRESFILTSDDAFAEVINPLLNWCVSYLCGKPETLQYCTTTEDRLIFDKELGLTEIDT
                     IIDVKYRWFKMPDGFDPRNDDILIYFHGGGYAVAMSPSTLTFLGNLSKKFPKLAIIML
                     DYSLTLGPDSKKFPAQLLEGLGIYDYVINTLHCENVILMGESSGGNLELALLNYLITN
                     TTIPLPKKAVLISPWANPSKMDRYNKRQEKELEMLDCVTFDGSIDFKDRLLGPELRNE
                     CLPLVDILYHFDPKVWYKILDVCSIYVTYGKDEILRPQIEHLIDKFADTHPDKFNEIT
                     DVSGYEGGCHIEPLLVSDKNMDSWSQHGAVSGILQFIEK"
     gene            <192007..>192804
                     /gene="NDAI0B00840"
                     /locus_tag="NDAI_0B00840"
                     /db_xref="GeneID:11498301"
     mRNA            <192007..>192804
                     /gene="NDAI0B00840"
                     /locus_tag="NDAI_0B00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668313.1"
                     /db_xref="GeneID:11498301"
     CDS             192007..192804
                     /gene="NDAI0B00840"
                     /locus_tag="NDAI_0B00840"
                     /inference="similar to DNA sequence:INSDC:YGR262C"
                     /note="similar to Saccharomyces cerevisiae BUD32
                     (YGR262C); ancestral locus Anc_5.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668361.1"
                     /db_xref="GeneID:11498301"
                     /db_xref="GOA:G0W5Q7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q7"
                     /translation="MSQEIVDEVAKYLTSNIPIVPISQGAEAVVFTTTIHPYIPSSNN
                     EKKEKFIIKYRPTKKYRHPLIDKSLTKHRTLSESRILSKLYQIDGIKVPKLIACDPYN
                     GCIWLEFLGEDLPNGFGFSNLKNFLWMNAKDPYNDCVKDTLYKVGQQIGLLHWNDYCH
                     GDLTSSNIVLVKDEDYGTNWIPHLIDFGLGSTSSLVEDKGVDLYVLERAIISTHSSFA
                     DKYNEWLIQGFSDVYKSKGKQGNKKLNEVLKRFAEVRLRGRKRSMIG"
     gene            <193331..>195865
                     /gene="NDAI0B00850"
                     /locus_tag="NDAI_0B00850"
                     /db_xref="GeneID:11498302"
     mRNA            <193331..>195865
                     /gene="NDAI0B00850"
                     /locus_tag="NDAI_0B00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668314.1"
                     /db_xref="GeneID:11498302"
     CDS             193331..195865
                     /gene="NDAI0B00850"
                     /locus_tag="NDAI_0B00850"
                     /inference="similar to DNA sequence:INSDC:YGR261C"
                     /note="similar to Saccharomyces cerevisiae APL6 (YGR261C);
                     ancestral locus Anc_5.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668362.1"
                     /db_xref="GeneID:11498302"
                     /db_xref="GOA:G0W5Q8"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q8"
                     /translation="MVDSVNPIASVLESARTITMDAAAVASSKLGESSYTQYSKKITP
                     KQLRTMLNSRNTRDLKDAMKRIISLMASDDTSTDLSSYFADVVKNITSNDIKIKRLIC
                     IYLLRFAEREPNLTLLSVNSLQKTISDTNPEVRCFAIRSLSDMKIASLNPMILYTLKT
                     SVTDPSALVRYEVAFALLKLFKNDEEEGEFREEISNLLKDLLADADPRVISGAVILLK
                     ECFPSNLELLHGHFRRYCRVLKEIDSWAQGPLIDLLAKYCKQYLPRPMIIDCSSEEDG
                     SAKQIPLPDNCSEIPFMAYNVSYDPDLSLFLDNLKTLIYSPNPIVILACCNAYFQLSV
                     PSHMINSKFPDALVRSYLCSSNAGLKDTILQSIIYLSALEPTLFQSHLTQFFLSPINN
                     NNIGISSLKLRILSNLVNATNVKGIVKELQHYIISFNSKKYSKIIIESSNALAKCGQL
                     STKLETYIMNWFIELMEDECTNLKPSVLDVIVNIIRQLVQNEPRRHLAVILKLSNVLN
                     TQKTALADNARAGIIWLFGEIAGICFDICPDLLRQLIPNFVDEGVESRGQILLFAAKL
                     LSYDIDKFKESHGLEVEYDFKNSRISQMFNAVLFFCKVDDEFDVRDRARCFESLFNSK
                     KFEIASLLLQAPKPLPLYYSQMNGTRPGQNNVNLPSSIVGLDQEIQNYCKYIPWTYTA
                     SEDNNTAAEEGREDIRSESPVKDYSRYKKSFSSSSFISKSSSSSRAFASSNIHGITNG
                     IDQLDLKKEGSDTITLNTVPFNKKYKLQSLDEFFQDIPEKPKPRLKKKIIIQEEEEEE
                     EEAEEDDEEDSDESGTSSDDGVDDDDTDDTESSSDEDSSIDEELHP"
     gene            complement(<196238..>197905)
                     /gene="NDAI0B00860"
                     /locus_tag="NDAI_0B00860"
                     /db_xref="GeneID:11498303"
     mRNA            complement(<196238..>197905)
                     /gene="NDAI0B00860"
                     /locus_tag="NDAI_0B00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668315.1"
                     /db_xref="GeneID:11498303"
     CDS             complement(196238..197905)
                     /gene="NDAI0B00860"
                     /locus_tag="NDAI_0B00860"
                     /inference="similar to DNA sequence:INSDC:YGR260W"
                     /note="similar to Saccharomyces cerevisiae TNA1 (YGR260W);
                     ancestral locus Anc_5.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668363.1"
                     /db_xref="GeneID:11498303"
                     /db_xref="GOA:G0W5Q9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W5Q9"
                     /translation="MSEEKYDTLSQVYVDEVLFGPTQSNTDNENNNNNMKNNMKNNIS
                     INEDKNKNNIVSFLTDESDINSIHHRIDKEKYQLAKEREIQATTTDDDGLPSLSHPLE
                     RKICKKMDMFLIPLMGMLYFLSNLDKSNIGNAEVAGLSKDIGLVGTQYNVCVTVFFGT
                     YVIFDPIGTNLLKIMGPPTMMSLCLLCFGVISLCTAWVKNYPQLIVVRLLLGAFEGMI
                     YPAINMYLSVCYRREQYALRFAFIFAAACLSSSFGGLIAYGCSTINGSLSSWQYIYIV
                     EGAISIGFVPFYVFGLSKHLEDSWFFTKEESQYIVDRYKTMNTFDPDEKFDWFQVKLA
                     IKDIKTWISAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVPIYFLTAFVFFG
                     CAVWSDHLRLRSPFIIGACITTATGISIVLGSQVHGVRYFGVYILCMGIYVNAACNCL
                     WLSGNNGNYFKRATALGINLFLGSGSGLVSGQIFVASDKPKYTKGLSLCLGFQILSII
                     MTVIQFLLYRRENKRKEAIIDHYQSMNEPIPYDEKLSDMNPEFRYMY"
     gene            200989..201061
                     /gene="NDAI0Btrna16V"
                     /locus_tag="NDAI_0Btrna16V"
                     /db_xref="GeneID:11498583"
     tRNA            200989..201061
                     /gene="NDAI0Btrna16V"
                     /locus_tag="NDAI_0Btrna16V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUA"
                     /db_xref="GeneID:11498583"
     gene            <201262..>204327
                     /gene="NDAI0B00870"
                     /locus_tag="NDAI_0B00870"
                     /db_xref="GeneID:11497653"
     mRNA            <201262..>204327
                     /gene="NDAI0B00870"
                     /locus_tag="NDAI_0B00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668316.1"
                     /db_xref="GeneID:11497653"
     CDS             201262..204327
                     /gene="NDAI0B00870"
                     /locus_tag="NDAI_0B00870"
                     /inference="similar to DNA sequence:INSDC:YGR258C"
                     /note="similar to Saccharomyces cerevisiae RAD2 (YGR258C);
                     ancestral locus Anc_5.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668364.1"
                     /db_xref="GeneID:11497653"
                     /db_xref="GOA:G0W5R0"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G0W5R0"
                     /translation="MGVHSFWDVVARTSKPVRLESLQDKKMAIDASIWIYQFLKAVRD
                     ENGNKVKNSHITGFFRRICKLLYFGIKPVFVFDGGVPVLKRETIRQRREIRQGKRDDA
                     SRTAKKILALQLLQKNNGTQDGQTSPGKKKNESTKTTKNTTLFKPDDDWDLPEIEGFK
                     YDLSDQRVNTAKKFENVISNMDDELDTIDLDSINPASKEFEELPKSTQYMVLSTLRLR
                     SRLRMGYTKEQLEDIFPNSLDFSKFQINMVKRRNFYTQKLMNVTGLHDSGASKLNDEV
                     INRISGQLHKEYKLQKTENGWALGLGEMDGSEVQKAIILDKPSNNTNTEVHTQVNDTH
                     TKSKSSVPQEVKTEDEDEEDEFDWEDVDLKANKEKEVEDFSLSAARLPKLDEVRQAVG
                     SQSFLDTRPNQVSPLKKSQRSIIRHVDINDESDHSDNDEDYLDQIEEIEMMEAYQKSL
                     LDARTMKAKKTNKIEDSEKENIAEQQTKQFLATLPDEILSKEKTVTSKSINNVSSTIT
                     NDVKVLPPVVPQINSNATHPNLTETEQNLNFIVGKIPNSSFLFQSPTREIINEVDESV
                     SEKEEEKKLPPPEVPAWFQTVSNVEATNPFTTSNFVQDKKIADLNSNEKNNNNADGDF
                     KLVSGFDAEDLLEVQQNSAPLIEDDTLIEEVQPTTNIETKEDSAENNDIGESTTEKPQ
                     KRKPLIFNYDFSDEEEENLTENIRKEQQEFEAFKDLTLLNGKASGSTSSLIDKAFMED
                     ELYEQQMKDKRDSDEVTPDMVQDVQDLLSRFGIPFIVAPMEAEAQCAELLHLNLVDGI
                     VTDDSDVFLFGGSKVYKNMFHEKNYVEFYDSASILRNIGLDRINMIEMAQLLGSDYTN
                     GVKGMGPVSSLEIIAEFGNLRKFKEWYEEGQFNEKKQENESKFEKDLRKRLVKNEIVF
                     DSNFPSELVKDAYLNPEVDHDKTKFIWNFPDLDLLREFLKRKIGWPQEKSDEVLIPLI
                     QDINKRKKQGKQRSISDFFPSEYLEGSNAMNMSKRLATAAGKMKKRRME"
     gene            <204719..>205837
                     /gene="NDAI0B00880"
                     /locus_tag="NDAI_0B00880"
                     /db_xref="GeneID:11498584"
     mRNA            <204719..>205837
                     /gene="NDAI0B00880"
                     /locus_tag="NDAI_0B00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668317.1"
                     /db_xref="GeneID:11498584"
     CDS             204719..205837
                     /gene="NDAI0B00880"
                     /locus_tag="NDAI_0B00880"
                     /inference="similar to DNA sequence:INSDC:YGR257C"
                     /note="similar to Saccharomyces cerevisiae MTM1 (YGR257C);
                     ancestral locus Anc_5.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668365.1"
                     /db_xref="GeneID:11498584"
                     /db_xref="GOA:G0W5R1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W5R1"
                     /translation="MSNNAKDELTLQQRMLSACSGSLLTSLTLTPMDVVRIRLQQQEL
                     LPDCSCGPIEKVITASVSKQKLKTDLSTVQAKLVAPIINKNKLFWESPCFQQLNCKNS
                     SVRFNSTWEAFTKISKLEGITTLWRGISINLLMAVPANIVYFTGYEYMRDNSPISKSF
                     PNFNPLLCGAFARIVAATVVAPLELTKTKLQSIPRSSKSTSSWMLIRELLKETRQEMK
                     VNGIYRALFKGLEITLWRDVPFSAIYWGSYEFCKNHFWIDTDPSLNVNWIQFINSFVS
                     GSVSGTLAAIFTHPFDVGKTRWQISFFNAPDKALVTSSKNNKAVVSKNMFKFLGNIWK
                     TEGAGALYVGLLPRIIKIAPSCAIMISSYEISKKIFNS"
     gene            complement(206292..206363)
                     /gene="NDAI0Btrna18T"
                     /locus_tag="NDAI_0Btrna18T"
                     /db_xref="GeneID:11498585"
     tRNA            complement(206292..206363)
                     /gene="NDAI0Btrna18T"
                     /locus_tag="NDAI_0Btrna18T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:11498585"
     gene            complement(<207975..>208580)
                     /gene="NDAI0B00890"
                     /locus_tag="NDAI_0B00890"
                     /db_xref="GeneID:11497659"
     mRNA            complement(<207975..>208580)
                     /gene="NDAI0B00890"
                     /locus_tag="NDAI_0B00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668318.1"
                     /db_xref="GeneID:11497659"
     CDS             complement(207975..208580)
                     /gene="NDAI0B00890"
                     /locus_tag="NDAI_0B00890"
                     /inference="similar to DNA sequence:INSDC:YGR251W"
                     /note="similar to Saccharomyces cerevisiae YGR251W;
                     ancestral locus Anc_5.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668366.1"
                     /db_xref="GeneID:11497659"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:G0W5R2"
                     /translation="MSRAQEIQEKLDLQAKLQLALSNKSSKVAAWLESSTDETKDRSK
                     EIEDAKELEDSKNAFFNLPVVQIGSGLHFAYNETSKDDIHTIGEFINSDKKISSLSKK
                     KKRNEPTDVRNDIYRIAKDDTKAMVALKRKMRHGQKMALRQDLAESVNKKTSVEPESR
                     NTSNAKNDAHSSSDDEADMRNQKSTKKTFGLLFNGNKKRRK"
     gene            complement(<209012..>210322)
                     /gene="NDAI0B00900"
                     /locus_tag="NDAI_0B00900"
                     /db_xref="GeneID:11498586"
     mRNA            complement(<209012..>210322)
                     /gene="NDAI0B00900"
                     /locus_tag="NDAI_0B00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668319.1"
                     /db_xref="GeneID:11498586"
     CDS             complement(209012..210322)
                     /gene="NDAI0B00900"
                     /locus_tag="NDAI_0B00900"
                     /inference="similar to DNA sequence:INSDC:YHR169W"
                     /note="similar to Saccharomyces cerevisiae DBP8 (YHR169W);
                     ancestral locus Anc_5.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668367.1"
                     /db_xref="GeneID:11498586"
                     /db_xref="GOA:G0W5R3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5R3"
                     /translation="MSTSKQETFKSLGLSKWLYESLSAMKITQPTAIQSACIPEILKG
                     RDCIGGAKTGSGKTIAFAGPMLTKWSEDPCGMFGVVLTPTRELAMQIAEQFTALGSSM
                     NIRVAIVVGGQSIVEQAIQLQNKPHFIIATPGRLAHHIMNSGEDTVGGLKRTKFLVLD
                     EADSLLTDSFAGDLATCIGALPPKHKRQTLLFTATITDQVRTLENAPAQDGKPSVFTY
                     QVESVDKVAIPSTLKTEYILVPEHVKEAYLYQLLTCETYKDSSAIIFVNRAMTAEVLR
                     RTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDVAARGLDIPIVELVINY
                     DIPSDPDTFIHRAGRTARAGRSGDAISFVTQRDVSRIEAIEERINKKMDESDKVHDTA
                     VIRKALTKVTKAKRESLMAMEKENFGERQRIQRQKNMASKRHRE"
     gene            <210693..>211511
                     /gene="NDAI0B00910"
                     /locus_tag="NDAI_0B00910"
                     /db_xref="GeneID:11496238"
     mRNA            <210693..>211511
                     /gene="NDAI0B00910"
                     /locus_tag="NDAI_0B00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668320.1"
                     /db_xref="GeneID:11496238"
     CDS             210693..211511
                     /gene="NDAI0B00910"
                     /locus_tag="NDAI_0B00910"
                     /note="ancestral locus Anc_5.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668368.1"
                     /db_xref="GeneID:11496238"
                     /db_xref="UniProtKB/TrEMBL:G0W5R4"
                     /translation="MARADIVAILRPKVHDTIYKLIRLGYSFQDIVQESHINADFLKK
                     TFKELGLNIQITTRITQRQSPIQRLIPSKQSQIPQTPSHVQSQPPPQLNKETTTVQPQ
                     MPQEQVITNVPSKKRAKTLPTCPHEMVHSHTNNAEKPINIPNRPISTTESPRRTTSLS
                     NGNGLPKVPRNNVDANDLVPEKKDKNARADQYDDVIEVKFNEFVTNTREQMRKFGREL
                     GTLGVQEEVISELRRTMAQGLYNLVQDVQSLKRNSEEDRNDDSNDYKRRRLTSG"
     gene            <212588..>213868
                     /gene="NDAI0B00920"
                     /locus_tag="NDAI_0B00920"
                     /db_xref="GeneID:11496239"
     mRNA            <212588..>213868
                     /gene="NDAI0B00920"
                     /locus_tag="NDAI_0B00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668321.1"
                     /db_xref="GeneID:11496239"
     CDS             212588..213868
                     /gene="NDAI0B00920"
                     /locus_tag="NDAI_0B00920"
                     /inference="similar to DNA sequence:INSDC:YHR179W"
                     /note="similar to Saccharomyces cerevisiae OYE2 (YHR179W);
                     ancestral locus Anc_5.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668369.1"
                     /db_xref="GeneID:11496239"
                     /db_xref="GOA:G0W5R5"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W5R5"
                     /translation="MPFVTNFQPVALKDTNLFKPTKIGNTELKHRAVMPPLTRMRAEH
                     PGNIPNRKWAYEYYKQRSQRPGTMLITEGTFISPQAGGYDNAPGIWSQEQMDQWKHIF
                     KGVHDNKSFIWVQLWSLGWQAFPDTLARDGLRYDSATDGSANIYMDEESELKAKKANN
                     PQHGLTKNEIKQYIEEYVQAAKNSIACGADGIEIHSANGYLLNQFLDPMSNQRTDEYG
                     NSIENRARFVLEVTDAVVKAVGPERVGIRFSPYGKFGNMSGGSDPDLLAEYCYILGEL
                     EKRAKNGKRLAYVHLVEPRVTNPFLKEGEGEYTDGTNDFAYSIWKGPIIRSGNLALHP
                     EIAKDLLQDDRTLLGYGRFFIANPDLVDRLEYGEPLNKYDRSTFYAMTDKGYLDYPTY
                     DETFEHRSGSVEPLTDKAYENHQNFDRTFEKRTI"
     gene            <215394..>218216
                     /gene="NDAI0B00930"
                     /locus_tag="NDAI_0B00930"
                     /db_xref="GeneID:11496240"
     mRNA            <215394..>218216
                     /gene="NDAI0B00930"
                     /locus_tag="NDAI_0B00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668322.1"
                     /db_xref="GeneID:11496240"
     CDS             215394..218216
                     /gene="NDAI0B00930"
                     /locus_tag="NDAI_0B00930"
                     /inference="similar to DNA sequence:INSDC:YGR250C"
                     /note="similar to Saccharomyces cerevisiae YGR250C;
                     ancestral locus Anc_5.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668370.1"
                     /db_xref="GeneID:11496240"
                     /db_xref="GOA:G0W5R6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W5R6"
                     /translation="MASKIKTKSDHKRSNNNNKDGPTTGHSTTSTQFSNVLPLEQLAN
                     TNTLTIRLKWEDNNVRYDIDQQLKDLLLKNHGYIIPLNEIESYQYLNDTKRLETLQEF
                     KDIYKFENGNEEIQKFTRIGKDKIEQEEKHEEDEQFFYNLVLQAQLHNETNLTKACEA
                     VQSLLSKDDHDSVKELIQWSISWNKRALTHPNNLFIGGVNKNMTLENMTDYLCKYGHI
                     SSLKLLQNENNSKNNKSNNDSEILSNTGYGFVSFQLGSQASNCINELNGKLFKGSKLF
                     LNYHVERKERERIQWNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEF
                     NYRITPEIIIEKIKSELLPLIPDFEILSYYFPRIQNNHDVTYIKNQSTVNAKVFESDN
                     VNDLTKSGTENALPLKGYGFINVLNHEQALQIIAKFNNYEWNGSRLIVNKAVQNSIHE
                     GTSHNSHSFTIHGNSSHNATSKKQEGDDAYNITRSSISSSSRHASLSGLSNNNSKPFI
                     PRNRSYNNSQYYKNNNSNPYAFQPNYPISPPTTNLLPMAPPFSPNANGYTYAYPLPIG
                     GPRNDSFDNGGLSPLLDNLTVGGVVPPPPPPPPLALSPIPQPNMMGPGISVPSLISKA
                     SPTVYVPTSSSSALSKRNKDKKGEIDEEDDDLDERSQNDYPINPMFYFNNFGYGYMPN
                     YTYNYGYNNTYNPNTAGSSNLGYSRDYNIVPGFDGINEKINNNGKLPIPLYFQQESNL
                     YVKYLPLDWDDDDLYDFFVQYGNIISAKVITVGGSKNKTQQKDRGDDKELKEREEDED
                     NDSSTIKSEDELGQHEEDKDEDINGADEAKEKIGISKGYGFVCFENPLDASQAILGTD
                     GVAVTPTNILGVTFAQKRHHHARDNSSASNNNNMKWNDHGNEIRYNRKFMNAVIEQQQ
                     QQQQNGSTARPNNHWSYRISTTHPLN"
     gene            complement(<218385..>219965)
                     /gene="NDAI0B00940"
                     /locus_tag="NDAI_0B00940"
                     /db_xref="GeneID:11496241"
     mRNA            complement(<218385..>219965)
                     /gene="NDAI0B00940"
                     /locus_tag="NDAI_0B00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668323.1"
                     /db_xref="GeneID:11496241"
     CDS             complement(218385..219965)
                     /gene="NDAI0B00940"
                     /locus_tag="NDAI_0B00940"
                     /inference="similar to DNA sequence:INSDC:YGR249W"
                     /note="similar to Saccharomyces cerevisiae MGA1 (YGR249W);
                     ancestral locus Anc_5.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668371.1"
                     /db_xref="GeneID:11496241"
                     /db_xref="GOA:G0W5R7"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G0W5R7"
                     /translation="MQQRNFVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSE
                     KVLKKYFKHGNISSFVRQLHMYGFHKISSNDLPNSILNSNPNPNNRINTIWYFAHPSG
                     FFTQTSTNEILKKIQRKSTGVDKDGEKRKNILSTLSVSYLNPNHHTPLNTSDVHAASV
                     ETNNIIPSENNNTTNSFTLKRKSENGQSKISSTHYPVNQLQRLPLPPISSLEGLKSSD
                     ASAFPNNKNDNHLLNYFPGYNESNKLFKSESHPQLFRINPAPGTPSNTTTSTPSNRLF
                     NTPFPKCGSQPEIHGNFSSYLSDQNQSLDQQKALLSLASSLSSSLASSSTSLFSKKGT
                     TIPTDSLASSRSSLSIANIPFKPKKKNFEIFANSNSNQDNNTKSSHLNIMNTINSNEV
                     KIRKISSLLAEAENKRKIDNNTSFPLSHDNDIILNPLIKKDEGHSHNNIAHDNNNNNN
                     NNNDNDTNVKETMKINMDIINESILLISTILEDLSTNSNPENQRNDEPLFVKIEERLN
                     KLNLMQEQLDKLIKEEDK"
     gene            complement(<222816..>223529)
                     /gene="NDAI0B00950"
                     /locus_tag="NDAI_0B00950"
                     /db_xref="GeneID:11498100"
     mRNA            complement(<222816..>223529)
                     /gene="NDAI0B00950"
                     /locus_tag="NDAI_0B00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668324.1"
                     /db_xref="GeneID:11498100"
     CDS             complement(222816..223529)
                     /gene="NDAI0B00950"
                     /locus_tag="NDAI_0B00950"
                     /inference="similar to DNA sequence:INSDC:YGR248W,YHR163W"
                     /note="similar to Saccharomyces cerevisiae SOL4 (YGR248W)
                     and SOL3 (YHR163W); ancestral locus Anc_5.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668372.1"
                     /db_xref="GeneID:11498100"
                     /db_xref="GOA:G0W5R8"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:G0W5R8"
                     /translation="MQSDLVKKIIEIQNEVLKKSDRFKVGVLPSKGLIDKLSEILIDK
                     IDVELFKQIKWPQWDIFLCEENLVEFSDPLSQYGQLERNFIERITHKGDSLNFGPVVI
                     TINESMIDMMHENKEIKIAKEFDTFLPQSLDLILTGFHDEDEKGSKEKETINERVPIS
                     GQLELIKDSKASACNQLIITSKYFLNSSRIVLLSYKNLDIEDNDEVELLKEIFKEEKR
                     LSIKYIQTVAKGSVEHLQV"
     gene            complement(<223876..>224529)
                     /gene="NDAI0B00960"
                     /locus_tag="NDAI_0B00960"
                     /db_xref="GeneID:11498101"
     mRNA            complement(<223876..>224529)
                     /gene="NDAI0B00960"
                     /locus_tag="NDAI_0B00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668325.1"
                     /db_xref="GeneID:11498101"
     CDS             complement(223876..224529)
                     /gene="NDAI0B00960"
                     /locus_tag="NDAI_0B00960"
                     /inference="similar to DNA sequence:INSDC:YGR247W"
                     /note="similar to Saccharomyces cerevisiae CPD1 (YGR247W);
                     ancestral locus Anc_5.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668373.1"
                     /db_xref="GeneID:11498101"
                     /db_xref="GOA:G0W5R9"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR012386"
                     /db_xref="UniProtKB/TrEMBL:G0W5R9"
                     /translation="MTVVLWYCPPPGSTAYETLNTLIQSIQTLFPNSPVFEPHITLNT
                     HLTVSTKDDVNKVLTYCVAAMNSIKKSIEKENKSLVRMNGFVTGKSYFQKVKLSCELD
                     KYLLSIAQIIRELFVESEQNTELKKLNAQNWVHNDFKPHVSLLYSDIYPISPAFTKII
                     QQRIEDTLGVKVISNEADEWKFDQIPKNVSWGIPATFKVVNCEGPIEEWEVLGRTDI"
     gene            <224933..>226843
                     /gene="NDAI0B00970"
                     /locus_tag="NDAI_0B00970"
                     /db_xref="GeneID:11498102"
     mRNA            <224933..>226843
                     /gene="NDAI0B00970"
                     /locus_tag="NDAI_0B00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668326.1"
                     /db_xref="GeneID:11498102"
     CDS             224933..226843
                     /gene="NDAI0B00970"
                     /locus_tag="NDAI_0B00970"
                     /inference="similar to DNA sequence:INSDC:YGR246C"
                     /note="similar to Saccharomyces cerevisiae BRF1 (YGR246C);
                     ancestral locus Anc_5.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668374.1"
                     /db_xref="GeneID:11498102"
                     /db_xref="GOA:G0W5S0"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:G0W5S0"
                     /translation="MPVCKSCKGTEFERDHSNANSDLVCKSCGFVSEDNPIVSEVTFG
                     ETSAGAAVVQGSFIGAGQSHASFMSHGGSSALDSRENTLNNARRKLRAVSHALSIPEY
                     ITDAAFQWYKLALAYNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSI
                     GATFLKMVKRLHISKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQRMSHDWMF
                     EGRRPAGIAGACVLLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKNTNSGKLSIH
                     EFRKASEELPDPNTEEQMKKGGCRSNTSFPPSFNRNRKNEKKIKEHLETENELLETSE
                     DAVNRNPILSQILGEQELSSKEVLFYLKQFSKRRESAIQRIKSTHGIDGSNLYGNSEN
                     PTSRSRSGSKSLSKETPDGVATTQDGTEEAVKDNIDGQASIRGAELGDGDSDDDNDND
                     NEEDEEDTRFQDKIDGYSLERDPYRPKNLHLLPTTESFLHKVNDDPENLEDVDDDELD
                     ALLLDEEASQLKERIWIGINSDYLLEQENKRLKEEADLLTGNTATKKRRRNNGGSRKR
                     AKTEPDSKANLAHSAMGLMSQFQDRTGLQAALKAAEESGDLTAADSVKNMLQKATFSK
                     KINYDAIDGLFS"
     gene            <227462..>229843
                     /gene="NDAI0B00980"
                     /locus_tag="NDAI_0B00980"
                     /db_xref="GeneID:11498103"
     mRNA            <227462..>229843
                     /gene="NDAI0B00980"
                     /locus_tag="NDAI_0B00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668327.1"
                     /db_xref="GeneID:11498103"
     CDS             227462..229843
                     /gene="NDAI0B00980"
                     /locus_tag="NDAI_0B00980"
                     /inference="similar to DNA sequence:INSDC:YGR245C"
                     /note="similar to Saccharomyces cerevisiae SDA1 (YGR245C);
                     ancestral locus Anc_5.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668375.1"
                     /db_xref="GeneID:11498103"
                     /db_xref="GOA:G0W5S1"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:G0W5S1"
                     /translation="MVKRSRAAVLPNNIILLQNLVKRDPESYHEEFLQQYSHYESLRD
                     IFLLNGMDTTTTTATTTVSGSTNETTSSVSTTNSLSEGSTTQLMELIGFVSQVCSCFP
                     RETANFPAELKQLILEHHVSLPFELKEKILTSLTILRNKSVISAEELIQTLFPLLVAY
                     SNQGNSLGVNSHAKELRTLVYKNVVSLMRSCNVGSKNQRLNKSTQAICFNLLDEDGDG
                     RGIWAAKLTRELWRRGIWDDSRTVEIMTQAALHDDVKVALSGIMFFLDADREREENFE
                     ENSDDDNDGIDVESLKHKLQVNKKSGKRGKKLENAIKTVKKKNKNMNNNGTPNGYLNF
                     SAIHLLRDPQGFAEKLFKGHLSGKKSNKFDIEQKISIMQLLSRLIGTHKLMVLGIYTF
                     FLKYLTPKQRDVTRIMSAAAQACHDMVPPEVLTVMVRKIADEFVSDGVASEVAAAGLN
                     TIREICSRAPLAIDETLLQDLVEYKGSKAKGVNMAAKSLISLYREVAPEMLKKKDRGK
                     TASLELQSLNKDGNDKRSRRPQYGVENNVQGIQGIELLVKWKREQQEAAGGENDDDDD
                     NDANWEVAENSGSDSESDDDDNGWVAVESDKEYDVDMDDDDDEDGTKKGNGKDEEEDS
                     DLDLESEDEEKERKGKDNISVDFDSEAAFRELASTRILTPADFAKLKELRTEESVSKI
                     MGVDNSSNRKKILGKNEELVDAATLTGPVKYKQTREERIQQAMEGREGREKFGSRRGK
                     RENAHSTTNREKARKKNYVMMIHKRSVRGKQKMSLRDKQKVLRAHITKQKKGK"
     gene            <230538..>231830
                     /gene="NDAI0B00990"
                     /locus_tag="NDAI_0B00990"
                     /db_xref="GeneID:11498248"
     mRNA            <230538..>231830
                     /gene="NDAI0B00990"
                     /locus_tag="NDAI_0B00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668328.1"
                     /db_xref="GeneID:11498248"
     CDS             230538..231830
                     /gene="NDAI0B00990"
                     /locus_tag="NDAI_0B00990"
                     /inference="similar to DNA sequence:INSDC:YGR244C"
                     /note="similar to Saccharomyces cerevisiae LSC2 (YGR244C);
                     ancestral locus Anc_5.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668376.1"
                     /db_xref="GeneID:11498248"
                     /db_xref="GOA:G0W5S2"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:G0W5S2"
                     /translation="MLSRAKAIIDKKLPFPHPLTITPTRNLSIHEYRSTELLNKYGIP
                     TAKGIVAFTPDEAFQAAKKLSPSTGLVVKAQALTGGRGKGHFNTGYKSGIHMIKSAEE
                     AFQVSQEMLGNNLITKQSGSKGKKVSSVFIVEKCNVLHESYLSILFDRQARLPLIIAS
                     RDGGMNIEEIAEEKPDSIKKFHVKEEIINDELAMEIAKSLGFTHTDLRETAKTIQNLY
                     KLFKDKDATQIEINPISEIEKHENGEYDVVCMDAKFGFDDNAEFRQHEIYSWRDITQE
                     DPNEVEAKKYELNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPE
                     TIKKGFELILSNEKVDAIFVNIFGGIVRCDLVAEGLVAAAKDLNLKIPIIARLQGTNL
                     DEGRAIIKESGVKIFSFDELDPAAKKAVELANKFHGKH"
     gene            complement(<232289..>232729)
                     /gene="NDAI0B01000"
                     /locus_tag="NDAI_0B01000"
                     /db_xref="GeneID:11498249"
     mRNA            complement(<232289..>232729)
                     /gene="NDAI0B01000"
                     /locus_tag="NDAI_0B01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668329.1"
                     /db_xref="GeneID:11498249"
     CDS             complement(232289..232729)
                     /gene="NDAI0B01000"
                     /locus_tag="NDAI_0B01000"
                     /inference="similar to DNA sequence:INSDC:YGR243W,YHR162W"
                     /note="similar to Saccharomyces cerevisiae YGR243W and
                     YHR162W; ancestral locus Anc_5.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668377.1"
                     /db_xref="GeneID:11498249"
                     /db_xref="GOA:G0W5S3"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G0W5S3"
                     /translation="MSAARSTIGTTFKRFWNSQTGPKTVHFWAPTLKWSLVIAGLNDM
                     QRPVDTLSGTQNLSLLATGLVWTRWSFVITPRNYLLASVNFFLAGVAGTQMTRIIKYR
                     LENGDSKMQVLNYIVNGTTSKNKGDMNIMTHDDKSSNNVLVTHS"
     gene            complement(<233579..>235975)
                     /gene="NDAI0B01010"
                     /locus_tag="NDAI_0B01010"
                     /db_xref="GeneID:11498250"
     mRNA            complement(<233579..>235975)
                     /gene="NDAI0B01010"
                     /locus_tag="NDAI_0B01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668330.1"
                     /db_xref="GeneID:11498250"
     CDS             complement(233579..235975)
                     /gene="NDAI0B01010"
                     /locus_tag="NDAI_0B01010"
                     /inference="similar to DNA sequence:INSDC:YIR003W"
                     /note="similar to Saccharomyces cerevisiae YIR003W;
                     ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668378.1"
                     /db_xref="GeneID:11498250"
                     /db_xref="InterPro:IPR021582"
                     /db_xref="UniProtKB/TrEMBL:G0W5S4"
                     /translation="MSQSDLPHIPERPRRRKTSPMQSSLSQEELNEVEPSLPATGQAS
                     VKETTPSIPSRRPIRKAQTIQTIGNNDINTTDVETQIPLLPERRPMKHSVTEEIDNLI
                     QNTDSELKEMENMLSSVHAQIPHPPRRPNKNHGTATSNHGHEENINSQGDENDTKQQN
                     LVHEMGEDGLQGKKSSNKSFSSIKEPVPDGSSEGNVVESIGNIFSEPMLQTSQPKIAE
                     EGQVDNSIEVTEGTKEETKDQSVDTTDSVAMPSPESEVVTTDPASKVKEVVEEHENEN
                     KNEEQLQEKVYKDEDDITVKNDIATSGISSKAEPAITPKIPERRPTIGRVDTPKMESI
                     SHDNIVEVIHADVKEEGLQGKAETETIEAVPSDDATPTILPKMPERRPAISSTNSSAK
                     EESIFEKKNEGHDIVPHKEEKENKSEMEPKVDILSNVPESTPVHKVDNEGEAVSEDID
                     TDLRTGQEPSVEEPAVSPSKGNDELLSEGKEEEAPEEEAHTEEAHKQEAPEEEAHNEE
                     KVEPKIPERPKKRAPPPVPKKPSSRIAALHEMLKKQQEENMAKVNEPFSKGSEKENDS
                     KDTDNEGKAEFVKNLNGLFALPGMAPGGPILNKKLSPDAASNAVEEQLNLKQAEEAMG
                     DESTGMGTRRRARGPRGRKLPSKIAKTEKIVDIKEDENVIQIFNTWKIVCRSEGAVVK
                     SDGLGSLDKEGKEGQEEHEEEVENDDDEFIDALEIKEIESHHGKRHVSESVAIKKNHT
                     GLELEEAVADAIDSRDQDDSIEILEQGLEDEAQSAMERQMMEEDKPIDELLKDQSGLN
                     "
     gene            <236444..>239377
                     /gene="NDAI0B01020"
                     /locus_tag="NDAI_0B01020"
                     /db_xref="GeneID:11498251"
     mRNA            <236444..>239377
                     /gene="NDAI0B01020"
                     /locus_tag="NDAI_0B01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668331.1"
                     /db_xref="GeneID:11498251"
     CDS             236444..239377
                     /gene="NDAI0B01020"
                     /locus_tag="NDAI_0B01020"
                     /inference="similar to DNA sequence:INSDC:YIR002C"
                     /note="similar to Saccharomyces cerevisiae MPH1 (YIR002C);
                     ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668379.1"
                     /db_xref="GeneID:11498251"
                     /db_xref="GOA:G0W5S5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5S5"
                     /translation="MDDDDDDFSNFEDDELDSLYEKNINKNVQEITFRRSVAVQRDLM
                     NNILPGEKPIYEEIQRKVTFGPTHHKFNEESLSTYLYPTNFEVRDYQFDIVKKSLFTN
                     ILCAIPTGMGKTFIASTVMLNYFLWTQTGKIIFTAPTRPLVAQQIKACLGITGIPSDE
                     TAILLDKSRKNREEIWANKRVFFTTPQVVENDLKRGVLNPKDIVCLVIDEAHRATGSY
                     AYTNVVKFIDRFNSSYRILALTATPGSDLDSVQEVVNNLDISKIEIRTEESIDIVKYM
                     KQREKVKIQTGLTTEIEDVIEQLGIAIQPVLQQAVELGIYEECEPSRINSFKAMQLSQ
                     KIIANPTLPEGIKWRNFFILQLLNHVGQMLKRIKIYGLRTFYNYFINKHKEFTTKYNL
                     GKSTNKIAAGFYFHPILKTLRENCDKHVANPKFLGHEKLQNIRDELIDFFENGAPDSR
                     VIIFTELRESALEIVKCVDSMNDKRIRPHIFIGQARGKEGFDEVTYSRKHKPKGRKKE
                     DKLRRQEEERRIEEQRKLEKEQQKLERSVSRTGSSEDAQINGMNQKRQKETIKEFKEG
                     IYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGKIILLFSSNE
                     ATKFEQAMENYSNLQKLITKNFIEYKKSDRILPTSINPECVKKFIEINESDKEVNNME
                     SDEIIKYATQRMMGKTPKKKTTKSRKVSKEPKSKQKQFFMPDNVVTGIIKASTLVNKY
                     NTDENGNKVRQEIKAKPVEKKKLATLDSIENDPSSSDLEDFDLQDYGTLKHDQKTLVD
                     ILGTVKEETQAQVLPNDNYSGSMENSMVLPVKREKREKDVPQTIGKLDSRSGDSRVSS
                     AKPLATEEVRLPIEDMSYFAKHYSKQDSISINSIPNLSEANKASLIPHTSFTQGIIGL
                     FRDMRENKPEQNIEFNRIKCIGKGLQNGVLKQKNILARALWIITISVTFKNCRCRQCT
                     KIHRN"
     gene            complement(<239852..>241375)
                     /gene="NDAI0B01030"
                     /locus_tag="NDAI_0B01030"
                     /db_xref="GeneID:11498252"
     mRNA            complement(<239852..>241375)
                     /gene="NDAI0B01030"
                     /locus_tag="NDAI_0B01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668332.1"
                     /db_xref="GeneID:11498252"
     CDS             complement(239852..241375)
                     /gene="NDAI0B01030"
                     /locus_tag="NDAI_0B01030"
                     /inference="similar to DNA sequence:INSDC:YER007W"
                     /note="similar to Saccharomyces cerevisiae PAC2 (YER007W);
                     ancestral locus Anc_7.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668380.1"
                     /db_xref="GeneID:11498252"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0W5S6"
                     /translation="MAYEVGDRLQIDNELGTILFKGKIKEWPSEEAYGIEWDNPNRGK
                     HSGTVHGESYFKTLIPDSATFIKEPKLLVNARKNVTFYGALQGKYGDSSYISGLVMGT
                     KEVEALGFEQLNYRNKDFSSLRHVSLSRSCICKTREKLSDIILIKNSCNNVETLDLSY
                     NTFSSFKDVVLILECLSKLKTLNLNGNRFISWEGLDGFKITTLEHLSMSSCYLSPDNV
                     QLLLQLFPNLKQLDISYNLLESLPDKSFTIPKCLKGLNLSCNQLYNMPKCLGQWKLEE
                     LNLSHNLFSEVSSINSETLRDLDISDNKFVDWTICDELNKNLAQLNSLRINGNPLFTS
                     SSKPETELLYETLARFDHLHIVNGSSFSLQERKEAELYFVSKILSDEIRFEKNLGRWE
                     YFNAKYDIEMKLEHEKKSWLDNLLLEIEIHYHGNHFPILVMTNYTIRHLKTIIIKRLA
                     LHVNDVKLSFRISNDIVFEIDKNFSTIEDTGIQEKTKVFVTHNGQEIENRQTFSKRK"
     gene            complement(242368..242439)
                     /gene="NDAI0Btrna16R"
                     /locus_tag="NDAI_0Btrna16R"
                     /db_xref="GeneID:11498109"
     tRNA            complement(242368..242439)
                     /gene="NDAI0Btrna16R"
                     /locus_tag="NDAI_0Btrna16R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11498109"
     gap             242822..242841
                     /estimated_length=20
     gene            complement(<244825..>245511)
                     /gene="NDAI0B01040"
                     /locus_tag="NDAI_0B01040"
                     /db_xref="GeneID:11497652"
     mRNA            complement(<244825..>245511)
                     /gene="NDAI0B01040"
                     /locus_tag="NDAI_0B01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668333.1"
                     /db_xref="GeneID:11497652"
     CDS             complement(244825..245511)
                     /gene="NDAI0B01040"
                     /locus_tag="NDAI_0B01040"
                     /inference="similar to DNA sequence:INSDC:YIL007C"
                     /note="similar to Saccharomyces cerevisiae NAS2 (YIL007C);
                     ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668381.1"
                     /db_xref="GeneID:11497652"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:G0W5S7"
                     /translation="MSNITENGVDFPAPSTELTNLQLDPSLLSLIENLNSLKLSEIQV
                     LKGKVETELSKNLELLSSEGTDLHSSLITPDGYPRSDIDVLQITMARRNVNMLRNDLH
                     KIIERSHELLNQHFQKRPSPPPSQHSAQTNLNLDYKIPFAVFDEIVSGSPIQQAGVQN
                     GDKLILIGDINAGNHNRLQNIQRVVLQSEDRRIPLKISRENDGILDLWLVPSRNWSGR
                     SLLGCKVQQL"
     gene            <248345..>249787
                     /gene="NDAI0B01050"
                     /locus_tag="NDAI_0B01050"
                     /db_xref="GeneID:11498110"
     mRNA            <248345..>249787
                     /gene="NDAI0B01050"
                     /locus_tag="NDAI_0B01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668334.1"
                     /db_xref="GeneID:11498110"
     CDS             248345..249787
                     /gene="NDAI0B01050"
                     /locus_tag="NDAI_0B01050"
                     /inference="similar to DNA sequence:INSDC:YEL007W"
                     /note="similar to Saccharomyces cerevisiae YEL007W;
                     ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668382.1"
                     /db_xref="GeneID:11498110"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:G0W5S8"
                     /translation="MNVLPTFRGLIDDEFDAALLIQAVLDGKLQHVLRRPSDFERQSL
                     IVPGNVFVFIEEMSGIKRWTDGINWSPSRISGKFLIYKELNRDYPSLISSSGPIPPRV
                     NMPNFQSPKNNVNTDMNIHLNNNRVPYAMYSQESMANYPSIHTGFVKKTFSIKLPTGT
                     NNQVYHNIHIISYYNESDNEDGKLETPKKHFLFKSVTPSPILIKTIEQITLGNSRTNP
                     SKPIDKPRKVTKDTVHRTKSDTALAQRIMDPIENRRPKKYRLPVPYCVSQPVCEHPTV
                     SSPQLDISNPVLYSVTDPPISFSVSSVNPHVEGGSNSSSKNNSNDNITTAAIRYQSSS
                     SQRLPPLNRDTTQFVTPTFARRTGNISSLIHHDSTPESPRIIKSTLMNHIEPATIMNI
                     IDNKNGIITSNILPPLNISDPQTGTPKPNNNINNHHHHSSPRINQISPTTSGGSDVGN
                     NRYILENPNLKSAQLPTKIMNVLDTNVMYS"
     gene            <250970..>252154
                     /gene="NDAI0B01060"
                     /locus_tag="NDAI_0B01060"
                     /db_xref="GeneID:11498111"
     mRNA            <250970..>252154
                     /gene="NDAI0B01060"
                     /locus_tag="NDAI_0B01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668335.1"
                     /db_xref="GeneID:11498111"
     CDS             250970..252154
                     /gene="NDAI0B01060"
                     /locus_tag="NDAI_0B01060"
                     /inference="similar to DNA sequence:INSDC:YEL006W,YIL006W"
                     /note="similar to Saccharomyces cerevisiae YEA6 (YEL006W)
                     and YIA6 (YIL006W); ancestral locus Anc_7.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668383.1"
                     /db_xref="GeneID:11498111"
                     /db_xref="GOA:G0W5S9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W5S9"
                     /translation="MPHDDDKLNGLKTDFPNGISAPALHNTNITNSTTHIDEVSYVSK
                     ERNNIFSSRLIDPIIQLNDKNHNMSSPPSDEPLKSSSPLIFPFKNPLRSIKLSDTKIT
                     ALSGALAGFLSGVTVCPLDVTKTRLQAQGIEGIENPYYRGLLGTMSTIVKDEGVKGLY
                     KGIVPIIMGYFPTWTIYFSVYEISKDMYSKLLPYSEFLSHSCSAITAGAASTILTNPI
                     WVVKTRLMLQTPMAKHPTYYSGTIDAFRKIIRQEGIRTLYTGLVPSLFGLLHVAIHFP
                     VYEKLKRKLHCDSKETDHSIQLKRLIIASSVSKMIASSITYPHEILRTRMQIKLKSPN
                     PTQRKLFTLIKKTFVQEGIMGFYSGFATNLIRTVPASAITLVSFEYFRNTLIRLNEDS
                     NL"
     gene            <252666..>254753
                     /gene="NDAI0B01070"
                     /locus_tag="NDAI_0B01070"
                     /db_xref="GeneID:11498112"
     mRNA            <252666..>254753
                     /gene="NDAI0B01070"
                     /locus_tag="NDAI_0B01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668336.1"
                     /db_xref="GeneID:11498112"
     CDS             252666..254753
                     /gene="NDAI0B01070"
                     /locus_tag="NDAI_0B01070"
                     /inference="similar to DNA sequence:INSDC:YIL005W"
                     /note="similar to Saccharomyces cerevisiae EPS1 (YIL005W);
                     ancestral locus Anc_7.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668384.1"
                     /db_xref="GeneID:11498112"
                     /db_xref="GOA:G0W5T0"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G0W5T0"
                     /translation="MTCLKHIQLLLCFSITLILQGTQVAASDDKHPEGFPKPLTGSTF
                     DNEMKNGLHIVEFFSPYCHHCKSLAPIWEKTWESFHEEGSKLNITLSQVNCVEDGDLC
                     SKENIEYFPYIKLYGPSGFIKNYDGARKEEAFIKFARKEALDPLNVDISHVESQSILL
                     SKLEFAKYLAGKGKDPILISFWPTNEMKNSDDRIAFENCADCTTFQRAWKMLSKNLLA
                     DGVLTGHMNCEENPLICNELGFGELSKIKNHRSDRVPRVALVLPNRATNNLFIFKGDI
                     ASPLSQYQDFATRTYANSIAPEINKDDVISIINTEVMNMEGRPGPKMHLVFNYDAKIT
                     FSEDFDILEYLIEPLSKIPNLYLYKSKEDLKSLTHTSFEEMYKMINYNETEPEKVLDE
                     NQFALNTITQFPTFFLFKDGDKIPHVFPGYSTTEMRNVETIMNWVKEFAIPMITEVNE
                     DNFWDLMNSQHERYSDIAILLIDSARMKESVNSVNNLVTGNYDYEHVRMSQMFQWIMG
                     ERNDKLEYVQKLKNKKAQSAKIVAALRKEIPHKDDRSVILTYLDIYKNKNTLSKLGFD
                     CTVPQKSGNVIIVDRSKSSFFEVNRDGKPLTDNPYDIREILTTLNFPQSSFSKFVNHG
                     RRINSPYSRQLRHLDFIHSYGIFGYIMLAVVVTMIYKSKSLVHIYRSKRKYQAKRDTR
                     GLLGWSDKKEFQD"
     gene            complement(<254971..>255477)
                     /gene="NDAI0B01080"
                     /locus_tag="NDAI_0B01080"
                     /db_xref="GeneID:11498121"
     mRNA            complement(join(<254971..255388,255467..>255477))
                     /gene="NDAI0B01080"
                     /locus_tag="NDAI_0B01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668337.1"
                     /db_xref="GeneID:11498121"
     CDS             complement(join(254971..255388,255467..255477))
                     /gene="NDAI0B01080"
                     /locus_tag="NDAI_0B01080"
                     /inference="similar to DNA sequence:INSDC:YIL004C"
                     /note="similar to Saccharomyces cerevisiae BET1 (YIL004C);
                     ancestral locus Anc_7.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668385.1"
                     /db_xref="GeneID:11498121"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G0W5T1"
                     /translation="MSTRYGEDQLNQRDSKRTRLFGSSMNFEDETGKRSSPYQSSTHL
                     DYSQDRLAQLESQSEEQVGIMAEKLRSLKTLSLKMGDEIRGSNKTLDQLGDSFDTTSL
                     KLKNTFSNMMEMAKRSRISIKTWLLIFALVILVFFWVWIT"
     gene            <255827..>258679
                     /gene="NDAI0B01090"
                     /locus_tag="NDAI_0B01090"
                     /db_xref="GeneID:11498122"
     mRNA            <255827..>258679
                     /gene="NDAI0B01090"
                     /locus_tag="NDAI_0B01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668338.1"
                     /db_xref="GeneID:11498122"
     CDS             255827..258679
                     /gene="NDAI0B01090"
                     /locus_tag="NDAI_0B01090"
                     /inference="similar to DNA sequence:INSDC:YIL002C"
                     /note="similar to Saccharomyces cerevisiae INP51
                     (YIL002C); ancestral locus Anc_7.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668386.1"
                     /db_xref="GeneID:11498122"
                     /db_xref="GOA:G0W5T2"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G0W5T2"
                     /translation="MRLFIGRNPRSIVLASNNYYLSFQKYHRPSGPIQPQQPSKSSSV
                     VIKILSEAEVLDEARFTEIKSCIYNGLLGLISTNGSVFLAIISGVQNVGFPRWKNEGS
                     RVVPNETIYKVLDVDFYSIENDAYDPLFFERNEQNYDKLIHEHPCGSFKKLFGDGTFY
                     FSRDFDISNTVKNHGLLHNLEYTIDNQDLGFIWNTSLTSEIISWRNRVPIEKRHLFDN
                     SNFLTFVVRGFCKTAVVEDGDNTASVTIISRISAENKLNAFEDGLNDEGKVGCFVETE
                     VVVTTKKFIFSYTQVEANIPLFWESVENQLLYGRKIKMTRTPDQSQTAFDKHFDSMES
                     KYGVVSIVNLIKPKSETQESLALVYQKCAEARGTKITNLEYTSGIFNKAPHKLIYLLQ
                     QDIYEFGAFAYDMSRGVYFGKQTGVLRISAFDSIEKPLQVAKIVSKEVLELATKELQG
                     FEITSLFIDAHDRIWSENYYWLDRTYSKNGKNPMKYAKIYYKLFSSKVKLFYPLHYYV
                     SQHLRQMKSNFTFQKDITIFAGTFNISGKVSKDDITEWIFPKGSNLENPASIYIIGLE
                     EVVELTPGHMLSTDPFIKQFWERKIITLLNNSGGKEKYVCTWSNQLGGLLLMLFMSSS
                     EYLKIKHIEGDVKKTGFGGIASNKGAVAVSFNYSATKFCVLVSHLAAGLDNVEQRHND
                     YKTIVKNINFGRGLRIKDHDAVIWMGDFNYRILMSNEDVRRLIASKEYTNLFLKDQLN
                     QQMIAGESFPYYHEMAIDFPPTYKFDPGTKTYDTSEKMRIPAWTDRILSRGEVLKQLS
                     YGCAEDILFSDHRPVYATFNARVTVVDEQKKEALSIELHEKIMEKLANLTEEEKDAVL
                     SERILLFDGEERSDSNLLPNGESLPSVADSKRGKLLPPPSSDTRKWWIGNGKQVKVTL
                     DIDPNKYMINPKRNPNPFIEMDEEGANIPFFIPRTK"
     gene            complement(<258966..>259229)
                     /gene="NDAI0B01100"
                     /locus_tag="NDAI_0B01100"
                     /db_xref="GeneID:11498123"
     mRNA            complement(<258966..>259229)
                     /gene="NDAI0B01100"
                     /locus_tag="NDAI_0B01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668339.1"
                     /db_xref="GeneID:11498123"
     CDS             complement(258966..259229)
                     /gene="NDAI0B01100"
                     /locus_tag="NDAI_0B01100"
                     /inference="similar to DNA sequence:INSDC:YIL002W-A"
                     /note="similar to Saccharomyces cerevisiae YIL002W-A;
                     ancestral locus Anc_7.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668387.1"
                     /db_xref="GeneID:11498123"
                     /db_xref="UniProtKB/TrEMBL:G0W5T3"
                     /translation="METNVYISIFDTWVSEEMTMEEMDLPELTPTTFKDALDLVNDGE
                     KAMDDLEKRLDNMEKNMNDLLQQLEKLEDENKPSASKEEAEEK"
     gene            <259690..>260346
                     /gene="NDAI0B01110"
                     /locus_tag="NDAI_0B01110"
                     /db_xref="GeneID:11498124"
     mRNA            <259690..>260346
                     /gene="NDAI0B01110"
                     /locus_tag="NDAI_0B01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668340.1"
                     /db_xref="GeneID:11498124"
     CDS             259690..260346
                     /gene="NDAI0B01110"
                     /locus_tag="NDAI_0B01110"
                     /inference="similar to DNA sequence:INSDC:YJR056C"
                     /note="similar to Saccharomyces cerevisiae YJR056C;
                     ancestral locus Anc_1.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668388.1"
                     /db_xref="GeneID:11498124"
                     /db_xref="InterPro:IPR029196"
                     /db_xref="UniProtKB/TrEMBL:G0W5T4"
                     /translation="MDHLKSLESSLPPEQPPTENAIQSLSSDSSQEFKIAANAVTKLY
                     RVANEKNSLLKHQGYISCLDDISELIEKRQVSSLDEIRHWCMKQKIEKYTQKMDKPNT
                     NISTNINADQNQNNKYNFQFSSNGKTGNIDNSIQQIVSPKFKPSMAPMSVEHSFNEAD
                     TYRFKKKWSVTRRHANNAQKDNENSMIDSLNYDMASSLEIGDDSVKYGHTPKKPKYSN
                     "
     gene            <261401..>262843
                     /gene="NDAI0B01120"
                     /locus_tag="NDAI_0B01120"
                     /db_xref="GeneID:11497510"
     mRNA            <261401..>262843
                     /gene="NDAI0B01120"
                     /locus_tag="NDAI_0B01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668341.1"
                     /db_xref="GeneID:11497510"
     CDS             261401..262843
                     /gene="NDAI0B01120"
                     /locus_tag="NDAI_0B01120"
                     /inference="similar to DNA sequence:INSDC:YML051W"
                     /note="similar to Saccharomyces cerevisiae GAL80
                     (YML051W); ancestral locus Anc_1.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668389.1"
                     /db_xref="GeneID:11497510"
                     /db_xref="GOA:G0W5T5"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W5T5"
                     /translation="MGLPTNNIKSNNNSNNNNGSNNNTGISKNRIWKRRSLITNKRNS
                     ISGMTYNLRSKVSTIPNTGSIKVGFVGLSFKKGWALKTHYPAILQLSSQFEITALYNP
                     TIDSSISTIRELKLRNATAFPTIESFASSSGVDMIVISIENMNHYEIIMSLLKYSQNN
                     ANLKYLFVEWGLKCSEKELETICAETTKNGIQTIISLQGRKSPYILRAKELIAQGYIG
                     EINSIEVAGNGGWYGYERPQKSPAYMFDIKNGTNLVTTTFGHTIDVLQYITSSYFSTI
                     NAMVINNIPEQELVDDFGNKIGQKAPKTVPDHLLFQGTLLNGNVPVSCSIKGGKPIKK
                     FTKNLVIDIHGTKGDIKLEGDAGFVEITNLVLYYGGIKPNNSPIYKTSDREPTTGDSG
                     KETMEVYHLRNYNALVGNIFRLYQSIADFHFNTKQIENLPSQFAMQEFEFEGFPTLMD
                     ALFLVRLIDNVYKSNDLGSTLDVSKIYQYP"
     gene            complement(<263319..>263801)
                     /gene="NDAI0B01130"
                     /locus_tag="NDAI_0B01130"
                     /db_xref="GeneID:11497511"
     mRNA            complement(<263319..>263801)
                     /gene="NDAI0B01130"
                     /locus_tag="NDAI_0B01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668342.1"
                     /db_xref="GeneID:11497511"
     CDS             complement(263319..263801)
                     /gene="NDAI0B01130"
                     /locus_tag="NDAI_0B01130"
                     /inference="similar to DNA sequence:INSDC:YJR055W"
                     /note="similar to Saccharomyces cerevisiae HIT1 (YJR055W);
                     ancestral locus Anc_1.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668390.1"
                     /db_xref="GeneID:11497511"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:G0W5T6"
                     /translation="MRESGIKCGICQLQDAKYKCPKCGIRYCSLKCFKDELKHNHNTV
                     EKKDEVKEANKSEQTAAAVEVKSGEFGQIYNETPELKELLKYNTVKFHLSKVYRILNT
                     NTGNGGSLSTEMKNQLAIDYLNTLRYGGVHYNEAIEEFCQICLRKLETADTGEELSLA
                     "
     gap             264199..264535
                     /estimated_length=337
     gene            complement(<268360..>268812)
                     /gene="NDAI0B01140"
                     /locus_tag="NDAI_0B01140"
                     /db_xref="GeneID:11497512"
     mRNA            complement(<268360..>268812)
                     /gene="NDAI0B01140"
                     /locus_tag="NDAI_0B01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668343.1"
                     /db_xref="GeneID:11497512"
     CDS             complement(268360..268812)
                     /gene="NDAI0B01140"
                     /locus_tag="NDAI_0B01140"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668391.1"
                     /db_xref="GeneID:11497512"
                     /db_xref="GOA:G0W5T7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G0W5T7"
                     /translation="MRTLLPPNYFSDEAYLNKYIGGLKPELRKDLRLHNPMSLFDATE
                     IAMRSTALTTSAPGTKPWAIDFSTPASVANNNAGSDPMEIDFVRTSHPKRSFNKRGRN
                     FNANKKGDQSNNWRNKFREVCLANGFCLNCGKPGHTKAQCKEASNPQY"
     gap             269864..269883
                     /estimated_length=20
     gene            complement(<275054..>275815)
                     /gene="NDAI0B01150"
                     /locus_tag="NDAI_0B01150"
                     /db_xref="GeneID:11497513"
     mRNA            complement(<275054..>275815)
                     /gene="NDAI0B01150"
                     /locus_tag="NDAI_0B01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668344.1"
                     /db_xref="GeneID:11497513"
     CDS             complement(275054..275815)
                     /gene="NDAI0B01150"
                     /locus_tag="NDAI_0B01150"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668392.1"
                     /db_xref="GeneID:11497513"
                     /db_xref="GOA:G0W5T8"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR024650"
                     /db_xref="UniProtKB/TrEMBL:G0W5T8"
                     /translation="MSIYKNITVHNPVTLCPIVQTANPKIGSTLTKTLNCNGEPCKVL
                     FDTGSPTSLIRTDVDQKLKLKLAAAPPFEFRGMVSAEKAATKEAAKVNIAAGNTAIKL
                     AAYVTDAMPHDIIVGNPVIDEYKDVIYNLRSDTDLGSLTCPDYELNAINMTDINDMTD
                     ITESTENKNDIVFATNITASEKENDGFANLPVGLQEKYKITVRNDLPPKTSNKNTIVE
                     HEIEIKEDSRLPRFQPYHTTPKLEKEITLIVDDLL"
     gene            complement(<275852..>276778)
                     /gene="NDAI0B01160"
                     /locus_tag="NDAI_0B01160"
                     /db_xref="GeneID:11498422"
     mRNA            complement(<275852..>276778)
                     /gene="NDAI0B01160"
                     /locus_tag="NDAI_0B01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668345.1"
                     /db_xref="GeneID:11498422"
     CDS             complement(275852..276778)
                     /gene="NDAI0B01160"
                     /locus_tag="NDAI_0B01160"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668393.1"
                     /db_xref="GeneID:11498422"
                     /db_xref="GOA:G0W5T9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="UniProtKB/TrEMBL:G0W5T9"
                     /translation="MTVIDANFMYDANDGLDKFTFTGPTVLKGNAPATFSGLQDIMTL
                     PTFLTTMKLQFITRSITTDSDKIAFFGRNLSGPAVNWFLHWFENAAPATTYETFLDCF
                     RDHFFKRLDPNKIINEMNSISQAQLGVEQYNARFSQLWALMPPHVWTEQGAILAYLRG
                     LSGDTARLVMLAHPKTLNEALEYAYETTAIGERFINGQHTNYVDADGDITMAPVLSPT
                     YGHSVSAVYPRGNSFPNRNRSNGRYNNNYDKTHTRPRTTANYPKPNNSNPRYQHSGEI
                     SRNECIQRHLCFRCKRGGHSARECRAPQASNP"
     gene            277420..277491
                     /gene="NDAI0Btrna17R"
                     /locus_tag="NDAI_0Btrna17R"
                     /db_xref="GeneID:11498423"
     tRNA            277420..277491
                     /gene="NDAI0Btrna17R"
                     /locus_tag="NDAI_0Btrna17R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGG"
                     /db_xref="GeneID:11498423"
     gene            complement(<277629..>279044)
                     /gene="NDAI0B01170"
                     /locus_tag="NDAI_0B01170"
                     /db_xref="GeneID:11497655"
     mRNA            complement(<277629..>279044)
                     /gene="NDAI0B01170"
                     /locus_tag="NDAI_0B01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668346.1"
                     /db_xref="GeneID:11497655"
     CDS             complement(277629..279044)
                     /gene="NDAI0B01170"
                     /locus_tag="NDAI_0B01170"
                     /inference="similar to DNA sequence:INSDC:YJR054W,YML047C"
                     /note="similar to Saccharomyces cerevisiae YJR054W and
                     PRM6 (YML047C); ancestral locus Anc_1.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668394.1"
                     /db_xref="GeneID:11497655"
                     /db_xref="UniProtKB/TrEMBL:G0W5U0"
                     /translation="MFKNDWKYSINSKVFDDIDPLLFLNHRFKTIIKYILSMWLMNLL
                     QLALFISDIYTCIKLLAFNSWSNNLIKPYVSFKVSKWIFSGCILGSIALLLWEIICGI
                     GIYRTRNISLTFVNNFSRNVYSMTEYPKFCIYDKISSKGAFQKIAFFTFFELKDCMRL
                     LLTDTPRQVINGLTLWSALVTVHANADLGDLESFSGLINKLQRIAETNHQEAVILSFM
                     LFSFIVWAFFMARLIVAMFCAFFVYFRLIKEQEYNGLKEYVCITVSRHVDELTETETR
                     KKMGQDIYRTSLLAPSTSLLELELSDLERNPLSSVSNTAYASYNDSSMSLSNTQTNIK
                     KHEKIVTNEFNYDSEHDFTPATAPIPIGSTLNNTFGGYHNNPSIEVPGLSGSNVYYNK
                     SPQGSNAELYRNQAINNHKIRPTPIDQNVTLDSGPNSEVYMLKQSQHRHFNNDELEEP
                     DEYNSQAIVTEEPSIIGYKNY"
     gene            complement(<279459..>281150)
                     /gene="NDAI0B01180"
                     /locus_tag="NDAI_0B01180"
                     /db_xref="GeneID:11498424"
     mRNA            complement(<279459..>281150)
                     /gene="NDAI0B01180"
                     /locus_tag="NDAI_0B01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668347.1"
                     /db_xref="GeneID:11498424"
     CDS             complement(279459..281150)
                     /gene="NDAI0B01180"
                     /locus_tag="NDAI_0B01180"
                     /inference="similar to DNA sequence:INSDC:YJR053W"
                     /note="similar to Saccharomyces cerevisiae BFA1 (YJR053W);
                     ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668395.1"
                     /db_xref="GeneID:11498424"
                     /db_xref="UniProtKB/TrEMBL:G0W5U1"
                     /translation="MSIEQHYSQDFAESSFEDMDTSFSHLQPRRQRRRQLPSSYCQEQ
                     NIPTPQSLVSSDGSTFSRITYDKSQSLDNYTPDLDTNQEMTAEDEEFFSDFQEFRNNK
                     DNFDLAIRNHFRLPLKPTYKEPTLENDFTKKLKIGPTAKVLRQPRSMFELKSQLKDRL
                     LTPTNTTLGPSSNNRNTGKTAAMSYGNIKGPERGYSNLKVKKSMPSLSSYSPIVQNVD
                     DHTFTLNDRQFDEVTDTNNFHTETTEIYNDSDFMDIEAEIIKPQFLNKEHISPLNLNE
                     SAHILEGTKPFSNSHRREEHNDTNRPTLMRADSKIRNNKEQRSKIETIKQQIDSNALM
                     SKERSSYNPYTKKWDGGNKPLRKFQSMGTLNENSSPFESEIPRYTAKDIRYPSNNIRS
                     ITVNPKIVGKMAFDEKNLRWVSLNENEIDPFAELKDILPSIDKEKRDPYISSKSQGQL
                     DRRHSNIQRFSRASSEPIRLNGNGRTHESTKRNDNNTKSADIFELNSKLLESFYHHEN
                     RWTKKVGRWFTMKNNRTEWDTLATFEDESVISNENNRNYLYEIRDMVINSSKTRP"
     gene            complement(<282299..>283987)
                     /gene="NDAI0B01190"
                     /locus_tag="NDAI_0B01190"
                     /db_xref="GeneID:11498425"
     mRNA            complement(<282299..>283987)
                     /gene="NDAI0B01190"
                     /locus_tag="NDAI_0B01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668348.1"
                     /db_xref="GeneID:11498425"
     CDS             complement(282299..283987)
                     /gene="NDAI0B01190"
                     /locus_tag="NDAI_0B01190"
                     /inference="similar to DNA sequence:INSDC:YJR052W"
                     /note="similar to Saccharomyces cerevisiae RAD7 (YJR052W);
                     ancestral locus Anc_1.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668396.1"
                     /db_xref="GeneID:11498425"
                     /db_xref="UniProtKB/TrEMBL:G0W5U2"
                     /translation="MIYRGRNRSSRSNIKGPNSALTQFLQEEGISAETIRQRWLEQQQ
                     KSASASPAPGDGTANAAQADKVEDEREKSEALPSSDEEIILEKSSINLEKRMNLVQDD
                     SDEEEYEDTSLTTISRSPSVVALDDELRKKRTREVLKTRQRKRKRAAKLLDRRTTKIA
                     TLQDMAIAKISESITSWEREKDQGENTVFAHLRDVLGGISIDNMNNLAKTLSKNRALD
                     DKTLQLFLKTDLTDLAFHDCSKLSFEGYKTLAIFSPHLTKLSLQMCGQLNNESLLYIA
                     EKLPNLTSLDLDGPFLINEDTWDTFFVEMKGRLKAFRISNTHRFNDKSLASLLVNCGE
                     ELVSLGLSRLDSISNYALLPQYLKNEHFHSLSLEYPFNEDDITDEVVINILGQVGKNL
                     KTLVLDGCLELTDSMIINGMCAFLHDGNNCSLLETLSLAELDQITNDSLVYFFSEISL
                     PHLVKCSLKRCLQVGDAAIIELMLNKGQQSLKELSLNSLKELTCEAFISLSCENLQSL
                     DLGFVRCVDDKVIEEISSRNPNLELIDVFGDNLVTEKAKIKQRLVLIGRQSDSI"
     gene            complement(284232..284302)
                     /gene="NDAI0Btrna16G"
                     /locus_tag="NDAI_0Btrna16G"
                     /db_xref="GeneID:11498446"
     tRNA            complement(284232..284302)
                     /gene="NDAI0Btrna16G"
                     /locus_tag="NDAI_0Btrna16G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11498446"
     gene            complement(<284935..>286449)
                     /gene="NDAI0B01200"
                     /locus_tag="NDAI_0B01200"
                     /db_xref="GeneID:11497651"
     mRNA            complement(<284935..>286449)
                     /gene="NDAI0B01200"
                     /locus_tag="NDAI_0B01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668349.1"
                     /db_xref="GeneID:11497651"
     CDS             complement(284935..286449)
                     /gene="NDAI0B01200"
                     /locus_tag="NDAI_0B01200"
                     /inference="similar to DNA sequence:INSDC:YEL047C,YJR051W"
                     /note="similar to Saccharomyces cerevisiae YEL047C and
                     OSM1 (YJR051W); ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668397.1"
                     /db_xref="GeneID:11497651"
                     /db_xref="GOA:G0W5U3"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G0W5U3"
                     /translation="MLSRTIKRVFVYLAIIALILTIRNTTQNMSSKKLITSPVVIIGS
                     GLAGLTTGNQLVTKHKIPIILLDKASSIGGNSIKASSGINGALTNTQEKFHINDSPAA
                     FYRDTLKSAKGKGVPDLMNKLSRDSKSAISWLQNGFDLKLDLLAQLGGHSFPRTHRSS
                     GKKPPGFEIVSTLSEKLKDIQKQNPKLVQIKLDSKVIGVNVDTKGQVSNVEYTDSDGS
                     VQKIETSNVVFASGGFGFSKEMLQEYAPHLINLPTTNGQQTTGDGQKILQKLGADLID
                     MNQIQVHPTGFIDPNDRSSNWKFLAAEALRGLGGILINPLNGKRFVNELETRDNVTRA
                     IQTYCPQDENKALLIMSEKVYENYKPNMDFYMFKNLIRKMSVSQCLKEFKLPISEIDF
                     IDDLKLYSSTEAADPFERQSVINTFGSNINHETMIYVGEITPVVHFTMGGARINEKSQ
                     VVNKRGEVLAHGLYAAGEVSGGVHGANRLGGSSLLECVVFGRTAADNIASSYKK"
     gene            complement(<286958..>288121)
                     /gene="NDAI0B01210"
                     /locus_tag="NDAI_0B01210"
                     /db_xref="GeneID:11498447"
     mRNA            complement(<286958..>288121)
                     /gene="NDAI0B01210"
                     /locus_tag="NDAI_0B01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668350.1"
                     /db_xref="GeneID:11498447"
     CDS             complement(286958..288121)
                     /gene="NDAI0B01210"
                     /locus_tag="NDAI_0B01210"
                     /inference="similar to DNA sequence:INSDC:YEL046C"
                     /note="similar to Saccharomyces cerevisiae GLY1 (YEL046C);
                     ancestral locus Anc_1.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668398.1"
                     /db_xref="GeneID:11498447"
                     /db_xref="GOA:G0W5U4"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:G0W5U4"
                     /translation="MVEAELPPQYTTASNDLRSDTFTTPTKEMIAAAMNASIGDAVYG
                     EDVDTVKLEQHVAKLAGKEAGIFCVSGTLSNQIALRTHLYQPPYSILCDYRAHVYTHE
                     AAGLAILSQAMVVPVIPSNGDYMTLEDIKSHYIPDDGDIHGAPTKVISLENTLHGIVY
                     PLEELVRIKAWSMENGLKLHCDGARIWNAAAETGVPLKQFGEIFDSISICLSKSMGAP
                     MGSILVGNTKFIKKCNHFRKQQGGGVRQSGMMARMALCNVDDDWKSKLLYSHKLAHSL
                     ADFCEKNGIPLESPADTNFVFIDLRKARMDPDVLVKKGLKYNVKLMGGRVSFHYQVTE
                     QTLEKVKLAILETFEYAKQHPFDQNGPTQIYRSESTEIDIEGNAIKEIKTYKY"
     gene            complement(<288902..>289660)
                     /gene="NDAI0B01220"
                     /locus_tag="NDAI_0B01220"
                     /db_xref="GeneID:11498448"
     mRNA            complement(<288902..>289660)
                     /gene="NDAI0B01220"
                     /locus_tag="NDAI_0B01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668351.1"
                     /db_xref="GeneID:11498448"
     CDS             complement(288902..289660)
                     /gene="NDAI0B01220"
                     /locus_tag="NDAI_0B01220"
                     /inference="similar to DNA sequence:INSDC:YJR050W"
                     /note="similar to Saccharomyces cerevisiae ISY1 (YJR050W);
                     ancestral locus Anc_1.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668399.1"
                     /db_xref="GeneID:11498448"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:G0W5U5"
                     /translation="MSRNVDKANSVLVRFQEQKAYEETNYKDYSRYKRPTRVTKVKSL
                     EEALEWKRQVQLEINNKTSRIFDITSSDRQIRDLNDELNDLIKERNRWNWHISNNLNG
                     GTIVKNAQNKEKILGGKLIHGVRYFGRALELPEVQELIKNEKKERESRHSKIAKYIDL
                     KRIPKYTKKTLYYNSRCLRKADLENIEKFEDHWRPILREYYKKEKIEEDTNETDEKGI
                     DEGTKQLTRIPTIKEMETWLVERRRRKLLEELSL"
     gene            <290612..>292261
                     /gene="NDAI0B01230"
                     /locus_tag="NDAI_0B01230"
                     /db_xref="GeneID:11498449"
     mRNA            <290612..>292261
                     /gene="NDAI0B01230"
                     /locus_tag="NDAI_0B01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668352.1"
                     /db_xref="GeneID:11498449"
     CDS             290612..292261
                     /gene="NDAI0B01230"
                     /locus_tag="NDAI_0B01230"
                     /inference="similar to DNA sequence:INSDC:YEL041W,YJR049C"
                     /note="similar to Saccharomyces cerevisiae YEF1 (YEL041W)
                     and UTR1 (YJR049C); ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668400.1"
                     /db_xref="GeneID:11498449"
                     /db_xref="GOA:G0W5U6"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G0W5U6"
                     /translation="MKEDHNSNLYQTRVSPVTAAISTTYEHKPINILKNQTDDDDYHH
                     HSKRNNYSPSQSHNNNANRLYNIDQTRDMIRKLSEEPKNHTASSSSPPPSSSSSVSFS
                     SLSNQQPPTQSTTTPPPPIRTKGSNTHFQYATTAYGVRMLSKDISNTKIDLEVENLMI
                     VTKLNDVSLYYLTRELVEWILINFPSITVYVDAALKDSKKFAASDIYKDSKCKESRIK
                     YWTPEFVDQNDVFFDLCVTMGGDGTVLFVSSIFKRHVPPILSFSLGSLGFLTNFKFEN
                     FRQDLKKILSSKIKTNLRMRLECNLYKRHEPEFDPKTGKKICVVELISTHHVLNEVTI
                     DRGPSPFISMLELYSEDNLMTVAQADGLIIATPTGSTAYSLSAGGSLIYPTVNAIAVT
                     PICPHTLSFRPIILPESMTLKVKVSTKSRGTAWASFDGKDRVELQKGDFIKISASPYF
                     FPTVECSNTEFINSISRTLNWNQREQQKSLTHMLSRKNQEKYATEAKVIKHQNNSDSS
                     YIEEVEKCDDTDSETAADEDNEEGEEIEEDDSKKDAVKFVL"
     gene            complement(<292907..>293245)
                     /gene="NDAI0B01240"
                     /locus_tag="NDAI_0B01240"
                     /db_xref="GeneID:11498450"
     mRNA            complement(<292907..>293245)
                     /gene="NDAI0B01240"
                     /locus_tag="NDAI_0B01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668353.1"
                     /db_xref="GeneID:11498450"
     CDS             complement(292907..293245)
                     /gene="NDAI0B01240"
                     /locus_tag="NDAI_0B01240"
                     /inference="similar to DNA sequence:INSDC:YEL039C,YJR048W"
                     /note="similar to Saccharomyces cerevisiae CYC7 (YEL039C)
                     and CYC1 (YJR048W); ancestral locus Anc_1.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668401.1"
                     /db_xref="GeneID:11498450"
                     /db_xref="GOA:G0W5U7"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:G0W5U7"
                     /translation="MPAAAEYKPGSEKKGATLFKTRCLQCHTVEEGGPHKVGPNLHGI
                     FGRRSGQAVGYSYTDANIKKNVEWNVNNMSEYLTNPKKYIPGTKMAFGGLKKEKDRND
                     LITYLKKACE"
     gene            complement(<293756..>295096)
                     /gene="NDAI0B01250"
                     /locus_tag="NDAI_0B01250"
                     /db_xref="GeneID:11496212"
     mRNA            complement(<293756..>295096)
                     /gene="NDAI0B01250"
                     /locus_tag="NDAI_0B01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668354.1"
                     /db_xref="GeneID:11496212"
     CDS             complement(293756..295096)
                     /gene="NDAI0B01250"
                     /locus_tag="NDAI_0B01250"
                     /inference="similar to DNA sequence:INSDC:YEL036C"
                     /note="similar to Saccharomyces cerevisiae ANP1 (YEL036C);
                     ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668402.1"
                     /db_xref="GeneID:11496212"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W5U8"
                     /translation="MKASISINGYEVDTRIPLSICAIFLFLNKLLHSWIIDEFTRNEH
                     RIPDFQDIPSVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYP
                     HELIDLSFLVSDSSDNTMYNLLNMLKRLQIDGGTSGKFGNIEIYEKDFGQVIGQGFSD
                     RHGFAAQGPRRKLMGKARNWLNTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDV
                     IVPNVWRPLPDWLGNIQPYDLNSWKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLA
                     YMRDPNGDPEREMELDGVGGVSILSKANVFRSGSHFPAFSFKKHAETEAFGKLSKHMN
                     FTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKERLKRNDPDEREIYEEKWDDKFKYEVT
                     DWQTEKRSILLESKIKPETEKPIDWSDNSVDDDNVPFLDLDLGSEPFRADIMHL"
     gene            <296125..>296601
                     /gene="NDAI0B01260"
                     /locus_tag="NDAI_0B01260"
                     /db_xref="GeneID:11496213"
     mRNA            <296125..>296601
                     /gene="NDAI0B01260"
                     /locus_tag="NDAI_0B01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668355.1"
                     /db_xref="GeneID:11496213"
     CDS             296125..296601
                     /gene="NDAI0B01260"
                     /locus_tag="NDAI_0B01260"
                     /inference="similar to DNA sequence:INSDC:YEL034W,YJR047C"
                     /note="similar to Saccharomyces cerevisiae HYP2 (YEL034W)
                     and ANB1 (YJR047C); ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668403.1"
                     /db_xref="GeneID:11496213"
                     /db_xref="GOA:G0W5U9"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:G0W5U9"
                     /translation="MSDEEQHVFETADAGSSETYPMQCSALRKGGFVVIKGRPCKIVD
                     MSTSKTGKHGHAKVHLVALDIFTNKKLEDLSPSTHNMECPFVKRTEYQLLDIDDGYLS
                     LMTMDGETKDDVKSAEGELGDSMQAAFDEGKDLMVTIISAMGEEAAISFKEAPRSD"
     gene            complement(<297462..>298814)
                     /gene="NDAI0B01270"
                     /locus_tag="NDAI_0B01270"
                     /db_xref="GeneID:11496214"
     mRNA            complement(<297462..>298814)
                     /gene="NDAI0B01270"
                     /locus_tag="NDAI_0B01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668356.1"
                     /db_xref="GeneID:11496214"
     CDS             complement(297462..298814)
                     /gene="NDAI0B01270"
                     /locus_tag="NDAI_0B01270"
                     /inference="similar to DNA sequence:INSDC:YMR044W"
                     /note="similar to Saccharomyces cerevisiae IOC4 (YMR044W);
                     ancestral locus Anc_2.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668404.1"
                     /db_xref="GeneID:11496214"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:G0W5V0"
                     /translation="MMIEEEQHIYQPTDIVLAKVKGFSAWPAMIVPTELIPEHILRTN
                     THTDEESETEDNTDTQDADDTKFIHYSKLLKFRKFEQLKNSYCVKFFCDDSYIWVKPS
                     DLKLLTVEQCREWLKSTNKKKKNKKLIPAYEMASKGSDNIDVWEFIEYGSYGKPDDDE
                     YVEEQEEEQEEQEEEEEVPKTTASIRSTRSRNKKTIAKKVMTKPKPRTRSKHVVKEEK
                     QVEPVEKGEEEEQLEEVLPKKRRGRPASKSATKTTTKKQKLKVKEESPKIEEYNYEDD
                     EDWALVGLGPQDVTIQDNVSSVVKKLSQKQNMEKHWDQRLNIIDKIAGINKMMLTLIN
                     SIISEESGKTQPVRDDYELLLDELDQALSMRGAKTEFITIFQWNTELLLNLRAIMSLK
                     YLQLIDWDIFDQFQAFFRIIFKYDLILDQTEWKYGEKEEEKETTTIPNGGVNNAEVAV
                     "
     gene            complement(<299289..>300164)
                     /gene="NDAI0B01280"
                     /locus_tag="NDAI_0B01280"
                     /db_xref="GeneID:11496215"
     mRNA            complement(<299289..>300164)
                     /gene="NDAI0B01280"
                     /locus_tag="NDAI_0B01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668357.1"
                     /db_xref="GeneID:11496215"
     CDS             complement(299289..300164)
                     /gene="NDAI0B01280"
                     /locus_tag="NDAI_0B01280"
                     /inference="similar to DNA sequence:INSDC:YMR043W"
                     /note="similar to Saccharomyces cerevisiae MCM1 (YMR043W);
                     ancestral locus Anc_2.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668405.1"
                     /db_xref="GeneID:11496215"
                     /db_xref="GOA:G0W5V1"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G0W5V1"
                     /translation="MSDVENTPEGSQQSGSTKERRKIEIKFIENKTRRHVTFSKRKHG
                     IMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDEE
                     EEEEEEEGEEEDNNDHITNQGAEILGSSITEQDPSARHNSTSSMTNIGMDSMNAINSM
                     KQAIAGSTNAMVPPGQLPLQMQQVGMKREGNSNNMTIGQTSVVSSSGTLGNQFSTQNQ
                     QQLQPTTQQQQQEQQQQHIQQQRQQQQQQQGNPATSHHYQHGQGFPNTNSPYLNAEQN
                     AVYQQYFDEQQQNQF"
     gene            complement(<301076..>301831)
                     /gene="NDAI0B01290"
                     /locus_tag="NDAI_0B01290"
                     /db_xref="GeneID:11497997"
     mRNA            complement(<301076..>301831)
                     /gene="NDAI0B01290"
                     /locus_tag="NDAI_0B01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668358.1"
                     /db_xref="GeneID:11497997"
     CDS             complement(301076..301831)
                     /gene="NDAI0B01290"
                     /locus_tag="NDAI_0B01290"
                     /inference="similar to DNA sequence:INSDC:YMR042W"
                     /note="similar to Saccharomyces cerevisiae ARG80
                     (YMR042W); ancestral locus Anc_2.607"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668406.1"
                     /db_xref="GeneID:11497997"
                     /db_xref="GOA:G0W5V2"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G0W5V2"
                     /translation="MVVKKRGLNEDERNDNEYDQSKKMKIVDTISKEQIGTATATATT
                     TTKSVTNAVSFVNQNEPVEGENEEDDYEDEDEEDISLNKEELSGNLGGLDEGEGGGKE
                     EDEEEEDEDEEDVAIDSESYRESSASVPATSVDKVTLTNARTPSVPESPRSSSSKQKI
                     PISFIENKSRRHVTFAKRRHGIMKKAYELSVLTGANVLLLILSSSGLVYTFTTPKLEP
                     VIRDDEGKNLIRKCLGAPDNWEYDEGTRANPES"
     gene            <303531..>304532
                     /gene="NDAI0B01300"
                     /locus_tag="NDAI_0B01300"
                     /db_xref="GeneID:11497998"
     mRNA            <303531..>304532
                     /gene="NDAI0B01300"
                     /locus_tag="NDAI_0B01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668359.1"
                     /db_xref="GeneID:11497998"
     CDS             303531..304532
                     /gene="NDAI0B01300"
                     /locus_tag="NDAI_0B01300"
                     /inference="similar to DNA sequence:INSDC:YMR041C"
                     /note="similar to Saccharomyces cerevisiae ARA2 (YMR041C);
                     ancestral locus Anc_2.604"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668407.1"
                     /db_xref="GeneID:11497998"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0W5V3"
                     /translation="MVFPPPLIVGGGTFSEQYNSDPESLPISEILRYAFTNGVNAIDT
                     SPYYGDSEILIGKALKELSDEFPRESYSICTKVGRISLDSFDYSKEHVEFSVRRSCER
                     LNTTYLDLVYLHDVEFVPLEDTLIALRELRRLKDIGLIKRFGLSGYPVHYLYEVTRKC
                     ATEYVDDIGPLDAILSYCNLNLQNVVLDNYYDKLKNECKIGIISNASILSMSLLREQE
                     TVAFHPCSKELRDCADKAADHCQSKGMKLSDLATRYAVSKWIGKGPTVIGVSSVEEMA
                     TAIRNYKKIEERLPNNKLTDEETEMVKEIQESIFGSHFNETWSSGLISGSDTHKPSV"
     gene            complement(<304619..>305158)
                     /gene="NDAI0B01310"
                     /locus_tag="NDAI_0B01310"
                     /db_xref="GeneID:11497999"
     mRNA            complement(<304619..>305158)
                     /gene="NDAI0B01310"
                     /locus_tag="NDAI_0B01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668360.1"
                     /db_xref="GeneID:11497999"
     CDS             complement(304619..305158)
                     /gene="NDAI0B01310"
                     /locus_tag="NDAI_0B01310"
                     /inference="similar to DNA sequence:INSDC:YKL065C,YMR040W"
                     /note="similar to Saccharomyces cerevisiae YET1 (YKL065C)
                     and YET2 (YMR040W); ancestral locus Anc_2.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668408.1"
                     /db_xref="GeneID:11497999"
                     /db_xref="GOA:G0W5V4"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:G0W5V4"
                     /translation="MSIYLLIIFFSLIMEMTILFILVLPLPFSIRRLFFSLFERATKS
                     MQVRTISSIFGLLVSFLFYDSRKRSMVHVLTYQDDVSGQNVTPIHALASRAYHQRNMY
                     LSGFILYFGVCIATVMTILGKLVKVHDDMHMRELGNIEYIAKSRIDDLIKLKHEKEQN
                     LRDLKLQVAKLKTASTSFS"
     gene            <306054..>306953
                     /gene="NDAI0B01320"
                     /locus_tag="NDAI_0B01320"
                     /db_xref="GeneID:11498000"
     mRNA            <306054..>306953
                     /gene="NDAI0B01320"
                     /locus_tag="NDAI_0B01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668361.1"
                     /db_xref="GeneID:11498000"
     CDS             306054..306953
                     /gene="NDAI0B01320"
                     /locus_tag="NDAI_0B01320"
                     /inference="similar to DNA sequence:INSDC:YMR039C"
                     /note="similar to Saccharomyces cerevisiae SUB1 (YMR039C);
                     ancestral locus Anc_2.602"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668409.1"
                     /db_xref="GeneID:11498000"
                     /db_xref="GOA:G0W5V5"
                     /db_xref="InterPro:IPR003173"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="UniProtKB/TrEMBL:G0W5V5"
                     /translation="MSYYNRYRNKRRQDGSQGSGPNNGNNMPGGNGPPTGASDAIFDL
                     GKNKRVTVRQFRNINLIDIREYYLDSSSGEMKPGKKGISLTEDLYDELLKHRLNIDEA
                     LRRFGSKRPRTKTVRVLSDDEDEEDNDNNASNNNTANVDSKTNEQKDGSKEKQTKDGD
                     SKDRKREKNKDSNKNKYEDYSDSEPKAKRKKPAPPTLLPHEENRENAKREANATLITP
                     GVGKAAALLESNKKAEEAETNAAAALKEESEKQVVVEKENLTPININDAAIAASGDSS
                     DEEFAQSLEAEMNRADDDISEEE"
     gene            <307444..>308232
                     /gene="NDAI0B01330"
                     /locus_tag="NDAI_0B01330"
                     /db_xref="GeneID:11498001"
     mRNA            <307444..>308232
                     /gene="NDAI0B01330"
                     /locus_tag="NDAI_0B01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668362.1"
                     /db_xref="GeneID:11498001"
     CDS             307444..308232
                     /gene="NDAI0B01330"
                     /locus_tag="NDAI_0B01330"
                     /inference="similar to DNA sequence:INSDC:YMR038C"
                     /note="similar to Saccharomyces cerevisiae CCS1 (YMR038C);
                     ancestral locus Anc_2.600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668410.1"
                     /db_xref="GeneID:11498001"
                     /db_xref="GOA:G0W5V6"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="UniProtKB/TrEMBL:G0W5V6"
                     /translation="MTAPTAPKTNLTPDSNDDYFEATYAIPMHCENCSNDIKKCLIEH
                     IPQSEKVKDIKFNLEEQIMALNSAIAPSVVIKTLRSCGYDAIVRGAGNKPNMAAVSIM
                     EIFKKYKDDTLLKSPVRGLVRIVQVSDNKTLFDFNVNGVPRPGKYFATLRECGDLSNG
                     VESTGKVMKKFEEPIECKEQSDLDPKLFSGQLFLSSPIQVWELIGRSIVISKEKENEM
                     EEPYEMCGIVARSAGIWENNKKVCACSGKTIWEERKDALANNIR"
     gene            <309326..>311635
                     /gene="NDAI0B01340"
                     /locus_tag="NDAI_0B01340"
                     /db_xref="GeneID:11497837"
     mRNA            <309326..>311635
                     /gene="NDAI0B01340"
                     /locus_tag="NDAI_0B01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668363.1"
                     /db_xref="GeneID:11497837"
     CDS             309326..311635
                     /gene="NDAI0B01340"
                     /locus_tag="NDAI_0B01340"
                     /inference="similar to DNA sequence:INSDC:YKL062W,YMR037C"
                     /note="similar to Saccharomyces cerevisiae MSN4 (YKL062W)
                     and MSN2 (YMR037C); ancestral locus Anc_2.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668411.1"
                     /db_xref="GeneID:11497837"
                     /db_xref="GOA:G0W5V7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W5V7"
                     /translation="MVENRNGAVSSASEPTQLNSDPTTTISFDDLNIPNNGQKGDDNN
                     INEFINNLDNQMTREPTGPNGKSNTSRSKKIPIISDNSMTDFLVNLESPYISSNPSNN
                     NLESTTNSNDLSPNDFAFPLDRDVESFSPFMNLPNRNISGRFEGTTSNNFLDSKVDNT
                     NKNTKNMRSIKNPSPTEYFDLSQFDNLIDNYITPDFVKEEPHLDTGKNYDDDPVHRSW
                     MLKISEDEADQFSTFDFNRRHSTVITNRFPYLNNNDMNGRNSISGSVDFWNLPNSRIN
                     RSIPNVNASLRPFTSPTTSPPSNNNNNNNNNNNLNNRSSISDDPYQHSKAVDAKLAQS
                     LNEFNMNFGSVNTTTNSETTPSAANISGTNHYDFTPHHQQPSYLEHYNQVLQHSKQPF
                     PSGRRYSVTKQQRSSLPTSESVLNSELFTRLYDNSNMPLNLNILDWNNNNNNSNHNNN
                     PSNDNNNEINEKNKGNEDLPTNTSNRDPKIENVSAGINFSNADGSKDPLSPNKKFIKP
                     SMIFNENLQNLNPSLQSNLLNKENNLEISSNSFQNKEPINNNEKNNNINNNNNSNGNN
                     PLLSTVNYNSYFISNPPIANVQPYFTESPVSSTILRPKTTSAAGRRASSIETTLIANS
                     HQRLSRVVSPTAQGNQQVQIQSQRPSSQMPPPNQLPFTDVGFTSLQHLTGAFLQEHGQ
                     HQNQNGQGQGQDRGIKTTTAYNYGDENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERP
                     FACNLCEKKFSRSDNLSQHLKTHKKHGDL"
     gene            <312621..>314684
                     /gene="NDAI0B01350"
                     /locus_tag="NDAI_0B01350"
                     /db_xref="GeneID:11497838"
     mRNA            <312621..>314684
                     /gene="NDAI0B01350"
                     /locus_tag="NDAI_0B01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668364.1"
                     /db_xref="GeneID:11497838"
     CDS             312621..314684
                     /gene="NDAI0B01350"
                     /locus_tag="NDAI_0B01350"
                     /inference="similar to DNA sequence:INSDC:YMR036C"
                     /note="similar to Saccharomyces cerevisiae MIH1 (YMR036C);
                     ancestral locus Anc_2.596"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668412.1"
                     /db_xref="GeneID:11497838"
                     /db_xref="GOA:G0W5V8"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G0W5V8"
                     /translation="MNSNSLQNSPGNLMEHDASRFNKLSLGSPFSQKKKHNIFKNIHV
                     FFKAKNNNNNNRKDNSTGIFNEEYHRQNQPHSSARRSTEDETLYNDEIVSSSRNSSSL
                     KLKLQTAYDENEKENINNGIVSNKLTSIISSENALDDNNILRSPISKSITTNEINILY
                     SPTLQNKHIRTKSISSKVGTPLSLSSSSNSRRNSFSNINNTINNIRIHRSDSIKKERK
                     SSSKINLRRINSMYSSQKDIKQPIQLHPHYNDHNNMNEKYTYLEDNKYTSYNPTTDTQ
                     SLKFSNKMVTPRNSFDSVLSGSHIPHYEDDNNSHDFFKRISPETLNEIINKKTYKPYY
                     DSYTIIDCRFDYEYKGGHIKNAINLSTRDDLETELLKKYYHSIASLPTLLIFHCEFSA
                     HRGPKLASHLRNCDRMLNYETYPKLYYPDILILDGGYEQFFEKFPESCYPQNYIAMDS
                     QENLLASEKSMDLFRSDSKKFSTRNNSLRKLTSVSISTTNSLKSKLINNNTTSASCLL
                     FNNTKGNDGSNITSPSTSSFPLVQPPKLSLAQYPDSENDAIGDRSSPTTSASRLSMHS
                     TTSSFGSSRSRLLLMEECNGILDDTHSYFSFQDGCSENNKNNDRTLEDDDDDDDDDAN
                     LLQGAELTMTNSNSNLMSNNIFNVNQFLSSKPVKRSLFPNIPMEEEEVEGKTERRNDN
                     KLNFI"
     gene            complement(<314929..>315447)
                     /gene="NDAI0B01360"
                     /locus_tag="NDAI_0B01360"
                     /db_xref="GeneID:11497839"
     mRNA            complement(<314929..>315447)
                     /gene="NDAI0B01360"
                     /locus_tag="NDAI_0B01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668365.1"
                     /db_xref="GeneID:11497839"
     CDS             complement(314929..315447)
                     /gene="NDAI0B01360"
                     /locus_tag="NDAI_0B01360"
                     /inference="similar to DNA sequence:INSDC:YMR035W"
                     /note="similar to Saccharomyces cerevisiae IMP2 (YMR035W);
                     ancestral locus Anc_2.595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668413.1"
                     /db_xref="GeneID:11497839"
                     /db_xref="GOA:G0W5V9"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:G0W5V9"
                     /translation="MFHSNHTKRFLKTALITITWVPVLMAINDKICYISQIHGNSMRP
                     TLNPTDSSKDWVFLWKLNKESIDVDDIILLKSPMDPKKILCKRIKAKSYDKVQTIFPY
                     PKDSAIIPRNHSWVEGDNVTHSIDSNTFGPISNGLILGKVTRVIWPPYRWGVNLQDNI
                     GREGIIIKDDNH"
     gene            <316721..>318184
                     /gene="NDAI0B01370"
                     /locus_tag="NDAI_0B01370"
                     /db_xref="GeneID:11497840"
     mRNA            <316721..>318184
                     /gene="NDAI0B01370"
                     /locus_tag="NDAI_0B01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668366.1"
                     /db_xref="GeneID:11497840"
     CDS             316721..318184
                     /gene="NDAI0B01370"
                     /locus_tag="NDAI_0B01370"
                     /inference="similar to DNA sequence:INSDC:YMR034C"
                     /note="similar to Saccharomyces cerevisiae YMR034C;
                     ancestral locus Anc_2.594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668414.1"
                     /db_xref="GeneID:11497840"
                     /db_xref="InterPro:IPR016833"
                     /db_xref="UniProtKB/TrEMBL:G0W5W0"
                     /translation="MKPKMLSILENNKNFKIFWNHKITNYLKAQWFFYCLAIFIVIAR
                     FAPNFAKDGGLIKGQYSIGYGCVAWIFLQSGLSMKTKKLMANMSNWRAHLIILMLSFL
                     ITSSIAYGLCCAIKAANDKKIDDWVLIGIILTTTCPTTVASNVIMTTNAGGNDLLCVC
                     EVFIGNLLGAFITPALVQLYTGRAPFQYGNPATGDGIGALYGRVMKQVGLSVFLPLFV
                     GQVIQNVFSKITEKYLAFLKKYHLKIGSYMLLLIMFSTFSTAFDQKAFSSVSHVCIVF
                     ICFFNLGLYLFFTGITYLCARPWFILKLFPTEPIPGESSKLYYYSYKIFRPFYYNKRD
                     AICIMFCGPAKTAALGVSLITSQYGDKKEHLGKLLVPLVLYQGEQVLTASIFVGIFKK
                     WVRDELEEEEEEDVGDGTNNDTKLTEPDLEKGIITSEDCERQLQLRQQEQQEQENKHE
                     LRLSRIDSHVSSSLTSSSTTGKRSDTNPTDQSSEYQK"
     gene            complement(<318357..>320486)
                     /gene="NDAI0B01380"
                     /locus_tag="NDAI_0B01380"
                     /db_xref="GeneID:11497828"
     mRNA            complement(<318357..>320486)
                     /gene="NDAI0B01380"
                     /locus_tag="NDAI_0B01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668367.1"
                     /db_xref="GeneID:11497828"
     CDS             complement(318357..320486)
                     /gene="NDAI0B01380"
                     /locus_tag="NDAI_0B01380"
                     /inference="similar to DNA sequence:INSDC:YMR032W"
                     /note="similar to Saccharomyces cerevisiae HOF1 (YMR032W);
                     ancestral locus Anc_2.591"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668415.1"
                     /db_xref="GeneID:11497828"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G0W5W1"
                     /translation="MTYDFETCFWDKDDKGVNVLLSHISAGIKSCDTMITFFKQKCEI
                     EKDYARRVGAINEKLNKDLKINVEFGQLAESFNLLYETEVSKAQSHSKQSELIYRQIF
                     NDLKDFTSELQARYTTLSGKIEGLRLDKFNKMKGCEDLTQRLEKAEIRVRDLQLNQNN
                     IIGSKRVEQNKRDLIKWESNTQEIKNQLSLLKQEYKASKKYWLHEWAGLTIEFQRMET
                     ARISFLQSKLQQYLQTATETSLLEQTKMEILNNKLMNFASNDDISKFSSEYGTGRLKK
                     EKRSKNRETSSHTNHTVKDTTQLRNSTQPKRNSLNISNISNSKRESYIDNIRTLSSQI
                     QESVNSKPKITQNLNNLMYQSLQEKPLPIPVEKTTINGQKSITDNDDNNNRPATQITE
                     TIKLRQDQLSKDTPRAYKEIVIDLEEESEKEKEKEKEKEEEIIKNNKMSILPYNKASR
                     HTNSLTSTEIESNSVSPSASTSSGSNPTDFTTHVKNKQSIDSMTTSVSTMASTIDDSQ
                     RFAKSWNSMNRKRKSISYLQSLSNSTSPTSSSSSPPIDRRSTFLEQQQQQEEVKTNEQ
                     ELRNVSSTNSIRINPNIRQSQNIEKVPDPYRQSLISGHSESIQRKDPQTDTLGKGQIN
                     DNGIIITLPLTTRNGEHVIKYAKALYPLMTDQTSTEVINFDTNDYILINEVINENWFR
                     GEVYDNDRIPEDRRSGLIPFNFIRLLS"
     gene            <321257..>324073
                     /gene="NDAI0B01390"
                     /locus_tag="NDAI_0B01390"
                     /db_xref="GeneID:11497829"
     mRNA            <321257..>324073
                     /gene="NDAI0B01390"
                     /locus_tag="NDAI_0B01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668368.1"
                     /db_xref="GeneID:11497829"
     CDS             321257..324073
                     /gene="NDAI0B01390"
                     /locus_tag="NDAI_0B01390"
                     /inference="similar to DNA sequence:INSDC:YKL050C,YMR031C"
                     /note="similar to Saccharomyces cerevisiae YKL050C and
                     YMR031C; ancestral locus Anc_2.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668416.1"
                     /db_xref="GeneID:11497829"
                     /db_xref="InterPro:IPR024527"
                     /db_xref="UniProtKB/TrEMBL:G0W5W2"
                     /translation="MSLVSAIHERKETTKETTTATTTAGRTTGSVKKNSVQSSSRNNS
                     LTSNASIVSKRSSIYQTAGEPLSREALYRARLKYGYYQSPAKQSNLGVSNAKLASDTA
                     AYLANENTKSIPETHTQTRNRSYSMDNNNNNNNNNTNITSPSGHAASRAYSMTITGAT
                     VSSPVKAPNPNTNKTYSINSASSALKASYLNITLREQQRQEREQDVANVKKSLNLTKV
                     LQGAQLKAESRIKDRWEPPVHSSSHGIKTNAAEYNNKFKLTKGVMSGIVSQVDLSHVD
                     ERKRLEADKAESVKSMGFARNAAHAIKDLEKPSTSIDEDLEAKRKQRDVYLKQLTSSE
                     VLSMARANVDRELKLIADSDYQTRLFSNEEFNKAAVVTAQGNLAKKVPYHNKINMGGG
                     LWLTPEDIQNIAKDLVEPVLGEVDTRAKEQRAMDEDLAKRNLEYKNGINEWNNLQRTK
                     LNNNAKFPPIELARQTKEKEDLQKSLADKFNEMVAKMEKELELKRQEVAEANKHQEEF
                     AKEMEQKIVDEQIRIDNEFDNWKAKCESDLTTTREEQELLLKPYYLDLQNAQAKHEQL
                     LEEKDQIGNKIENLNSQILLHKSKIDQYGKDIEGQENQKEREHAKLDDLDQKKEELET
                     DLNEHIITLANKTKEEAELSSKQARLKQLEVDALVNERKSELNNTEIMLKKEKLDLLE
                     SMKNLASARGDDELNEEKVKALVGMTSKEYLEKIKESERQTSQPTMIEIHEEEEEDPE
                     VNFVRPEIEQSVTPQKMKANPEIEVETETKTKTKTPISLTEEIKSLSKSPPSSPIISK
                     PMTVNKQEPVSPVTTPSKKGNLFKKFFIGSSQDHKDKMSSPTQTNNNNDVKELLKMNT
                     TIDENEHIQKIEHLSVDNTKPKPTTTEGEGLQRVELKPTFSGFSQGSIADDQVSSVNE
                     KDVNDTQAVPSDESEEGYFKEVFN"
     gene            complement(<324376..>325383)
                     /gene="NDAI0B01400"
                     /locus_tag="NDAI_0B01400"
                     /db_xref="GeneID:11497830"
     mRNA            complement(<324376..>325383)
                     /gene="NDAI0B01400"
                     /locus_tag="NDAI_0B01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668369.1"
                     /db_xref="GeneID:11497830"
     CDS             complement(324376..325383)
                     /gene="NDAI0B01400"
                     /locus_tag="NDAI_0B01400"
                     /inference="similar to DNA sequence:INSDC:YKL051W"
                     /note="similar to Saccharomyces cerevisiae SFK1 (YKL051W);
                     ancestral locus Anc_2.589"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668417.1"
                     /db_xref="GeneID:11497830"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="UniProtKB/TrEMBL:G0W5W3"
                     /translation="MPSFPKPKNLFFLLPWIAFIPWYGMLIAMLICWAAQGHPIYWFM
                     HSEQFPVYISDIGATNLRPLFISCVAWEGLGYALTVFAEFYQRSGGNLLNRPNKRTKF
                     YMPPWYHKDERNLIIAACVLGAFGEIALLMCTIFSTALYHHVHLAMVAVFVVLMFFSV
                     VCLSTEYFLMGRHYALLHPLASNTDGVHFEDLKWYQWKGHYWNKFTISGLAKALWLAF
                     AVIWAICFGAISNDSKSACFEWLLAFWFGVLFVIISIDFYMGSIYQSSRYFNQIESFD
                     GYYKYDELFANNIQGKSNTKNTSIDITPHDHEEEDLSSGHSVDKASTNSATTNDGISP
                     V"
     gene            <326621..>328690
                     /gene="NDAI0B01410"
                     /locus_tag="NDAI_0B01410"
                     /db_xref="GeneID:11497831"
     mRNA            <326621..>328690
                     /gene="NDAI0B01410"
                     /locus_tag="NDAI_0B01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668370.1"
                     /db_xref="GeneID:11497831"
     CDS             326621..328690
                     /gene="NDAI0B01410"
                     /locus_tag="NDAI_0B01410"
                     /inference="similar to DNA sequence:INSDC:YKL054C"
                     /note="similar to Saccharomyces cerevisiae DEF1 (YKL054C);
                     ancestral locus Anc_2.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668418.1"
                     /db_xref="GeneID:11497831"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G0W5W4"
                     /translation="MPSQYRKSNQNSKQDPELKFKLETLTELFPDWTNDDLIDLVQEY
                     DDLETIIDKITSGAVTRWDEVKKPTKKGKKVDTTHTHHHHLNQHDLEHIYDNDTDVTY
                     NSNSNNKHNRISYRSNNTRSQQQQTNNKKKQATTTSTTTTPASRYIDTENLKPATTPA
                     KTVSHTTSWAAAIASSNPPKEKEQPEAQDDQGSDTITTGEQQQSEKEKSSEKEEEEPN
                     VEEQPSAEENEEPSAGAEEEKPAKKMTWAAVAAPKKPKESALENVDDLKKGIEKVENE
                     EPNENVESSEEESSEEEEEESSEEEEEESSEEESNEEEEEEEEEESSEEEKAKEEEET
                     AKKEGEKSAKKEEVKIAKKAETSKPAVETPPAQAPVQTQPETVQPQEQQQQPQQVSQQ
                     DYYQQQQYPQAQYGQQQQSSQRIPPQQQNPAAAAAAAQQQYYMYQNQFPGYSYPGMFD
                     SQSYGYGQQQQAGQQPQQAAQPGISAATGMSSPYASMQQAYVQSTPGTANADLTSAGT
                     GASPATSHIQPQQQQAAAAAAQQQQPYGGSFMPYYGHFYQQSFPYGQPQYGMAAGQYP
                     YQVPKGSNYYQPQQGQEQQGQPAQQGQSQEDQQQQGQAQVQAQAQAQAQAQAQAQAQD
                     QQGQSQGQQDQNLTAQQLQYQQYYQFQQQQQQAAAAAAAAAAQQGGLPYNYSGYDYSS
                     QNSRGFY"
     gene            <329244..>331058
                     /gene="NDAI0B01420"
                     /locus_tag="NDAI_0B01420"
                     /db_xref="GeneID:11497832"
     mRNA            <329244..>331058
                     /gene="NDAI0B01420"
                     /locus_tag="NDAI_0B01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668371.1"
                     /db_xref="GeneID:11497832"
     CDS             329244..331058
                     /gene="NDAI0B01420"
                     /locus_tag="NDAI_0B01420"
                     /inference="similar to DNA sequence:INSDC:YMR029C"
                     /note="similar to Saccharomyces cerevisiae FAR8 (YMR029C);
                     ancestral locus Anc_2.583"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668419.1"
                     /db_xref="GeneID:11497832"
                     /db_xref="InterPro:IPR013258"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W5W5"
                     /translation="MLPNQSFLQTTSAPHYTLPGVMHYLQTEFTKNERDRITWELERS
                     EMKAKISQLEGENRDLRYKLAKLELKKESKKSNCESDLQETGKEQDEASLSSLIKSRT
                     VIQENVKEIVYLLKNADVSNQLNLLNAKNDNMVHNMENLNLNLNSQPNVTIDPNHNII
                     EPNNDNANMLNTSQMFNLGHDQNSSNLQQNTAPMEDIGNIDEGGEQSETETIVLDDDS
                     HPVSSSSSSLFKEPNFNKKMINNTVESFTRNDEDDINSTTERSDCDDINSKRIIWSSS
                     PIKNLNVLKNNILTSSNDNSLKYGKIINENLDCKSMNVINENGKENYIKIFLIDSSIF
                     LTITNVGVQLHNINEQKILSSLNIFEQESIDNIESIDFKNNRLLIGTNNRVYIWELKI
                     STKEYNLEIINSYVIQIDTSKSILSAILGMTEKSLIILTSSPYEMIIYSFQGKLLQSI
                     KLSENGSLTRRSESSASNTTNGKLYLNKETSKIIIQLNKHLSTYSFDHKKVIMQEHLE
                     FEPIDMIFQNSKDIICFAFANGSIEVRKLNTFQNIIKQYNHYDETIGETGDTDGLVIQ
                     LLWQGQNKSHNQDQNQIPVIVSGGEDGILRLERIDDYI"
     gene            <331560..>334751
                     /gene="NDAI0B01430"
                     /locus_tag="NDAI_0B01430"
                     /db_xref="GeneID:11497956"
     mRNA            <331560..>334751
                     /gene="NDAI0B01430"
                     /locus_tag="NDAI_0B01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668372.1"
                     /db_xref="GeneID:11497956"
     CDS             331560..334751
                     /gene="NDAI0B01430"
                     /locus_tag="NDAI_0B01430"
                     /inference="similar to DNA sequence:INSDC:YKL057C"
                     /note="similar to Saccharomyces cerevisiae NUP120
                     (YKL057C); ancestral locus Anc_2.582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668420.1"
                     /db_xref="GeneID:11497956"
                     /db_xref="UniProtKB/TrEMBL:G0W5W6"
                     /translation="MSYLSKIDVDLTQFNDQYTKPHVVNLFLDGQHSVTELNTTNTLS
                     YFLENDYSNTIRLSNGECICYQLSIDYKKLTIYRLTDPINGKTICIHFPDPIMNSHHH
                     MLTVLETDNSIDDPSLMINTILTNGIYLTIKLPIDYLITNSSNDINISNYEWFNIQRP
                     YDFTIRSPHMLMTISEKLSVICLDDGGLLGLVSTQDDGKELQPILFNDNSYLKSVATL
                     LFRRNKDNITSSKAISYIVFEQKFLIILTQSCHLKIWNLSTFILVQNYELPKDFQQQN
                     TTIRGYDLIGSYLSIFNNNLAIFLPFENGMFQLGNLLFDSNGNLSYTPMTTLETNLPT
                     SSIWSLCDMKLLRPFNLSISSSYLNLVLLWKSGSLSKLQILNITDNTFKNYQWIEATN
                     KSLSDIQSELLQDIDSTDPATTYFNLKARYSMNLFQKAEQILNENNMTIIHNDLTSNH
                     EYLTNLETILRDLKIKCDEASSLTIYNDDIIMINCLQRYNHSVYKINSSLEHVFYNIN
                     SRLGQKNSDILRYWKILNEFSSLFSKETLSTVSEKFINIVTNGSMKSVTSLQENFNEI
                     FQLTIKPQLLDTATINTLFQDLNSIDIVSLLNDLINNYIIISSQQHHNLVNAIQKDRF
                     SMTVCMSSLQQSIIIQKKIIFEILLSFIALDFDFKNLQNQLNDFLKLYYNQNLFLQLY
                     KQDKFLLMNDINYSDTIIITTASEEFNFGIKLQGYSDLDNYLEYVTNRIYNFPIEENP
                     LFFKFFEMYVIKDKTRTNNIISSTSESFLKYVHLPFYIHNNETYEFMLAMDFFICGDY
                     KQSFEFFQKHEYTSLKDAPLPQTLRLICENEAQSTIWSPLIYSFKEAYKYPLYQFELA
                     KLFSKRNSMEFALRAIKKSIEYSMQNVELNVPSDFTVEQYKLHLDLLIHFNMFNEVLD
                     VLRLSHDILSTSIRTRYYKELLDDNSKTAKFFSTLLNSCQNGKDGLYLPPADYKIVDQ
                     IFLSYLSSKNWIDYKKLYGFRMANKQERAAAEIIFHYLIKLGNDDPQEKRKCYLIIIN
                     ILSTFEDEYDQWLLSGNSVVTLTELKHELKSLY"
     gene            complement(<334854..>336005)
                     /gene="NDAI0B01440"
                     /locus_tag="NDAI_0B01440"
                     /db_xref="GeneID:11497957"
     mRNA            complement(<334854..>336005)
                     /gene="NDAI0B01440"
                     /locus_tag="NDAI_0B01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668373.1"
                     /db_xref="GeneID:11497957"
     CDS             complement(334854..336005)
                     /gene="NDAI0B01440"
                     /locus_tag="NDAI_0B01440"
                     /inference="similar to DNA sequence:INSDC:YMR028W"
                     /note="similar to Saccharomyces cerevisiae TAP42
                     (YMR028W); ancestral locus Anc_2.581"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668421.1"
                     /db_xref="GeneID:11497957"
                     /db_xref="GOA:G0W5W7"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:G0W5W7"
                     /translation="MLVSEKYDSIIKIYNEKLEHSSFRQDSEEYQTLLTTNLNDLLKF
                     KSIIVDKMGLFSVNENIDDLSTKSLKYLSMDYYLGLMLSKRQMPSTSPAHTTTSQLQN
                     TDIVERNKFKLDCLKSAIQSFIAFLILLQNYSILDDFLSKKINSFENKYNPKLNELYS
                     SNKDITANAQLKRDQKIEIFKRNKELSSKLKLLESKLHSHNQSEDDLNDSNEELLRDL
                     YVEQLKSLSYKSFNEIEQILMESELLLNFIKMGPEDPKKVNGDREKQDKAEFTDRLES
                     LDKPLLSETGKILRNFTLIDQRTKLQNKVKGYGQYGPTMTVEEFLDKEWEEGRVLQGG
                     EDELIREQQRKEDMEDNYKWNDEETYKAREWDEFKEANPKGSGNTMNRG"
     gene            complement(<336423..>337808)
                     /gene="NDAI0B01450"
                     /locus_tag="NDAI_0B01450"
                     /db_xref="GeneID:11497958"
     mRNA            complement(<336423..>337808)
                     /gene="NDAI0B01450"
                     /locus_tag="NDAI_0B01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668374.1"
                     /db_xref="GeneID:11497958"
     CDS             complement(336423..337808)
                     /gene="NDAI0B01450"
                     /locus_tag="NDAI_0B01450"
                     /inference="similar to DNA sequence:INSDC:YMR027W"
                     /note="similar to Saccharomyces cerevisiae YMR027W;
                     ancestral locus Anc_2.578"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668422.1"
                     /db_xref="GeneID:11497958"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="UniProtKB/TrEMBL:G0W5W8"
                     /translation="MTTSIARRYKTNDKGTFGEYTASTRWPIIIQNSIDDITAELAKN
                     SSQGDYKKQGEIIKQELIKYRQELLDHIPLRKFTQEECKIANVPLSFNEYLDSHKGVT
                     WNNVEWLFSEIYLYRRINVMFQLQPLWKHFDIFNSLKQSTFKASLYGVIELALRYQSL
                     ITKFDSIANDNDKEILEILFKEFVEISLWGNATDLSLLTNATLDDIKSIQGAKAREES
                     ESKILINDTKKAWDTLIKLQGSNSRVDFILDNSGFELYADLMLASFLLHTKLANKIIF
                     HAKDTPYMVSDVMLKDFDILLEDLKDRSFFNIDPNSNDSRALDLFADNIKKFNVEGAI
                     EVRTDSFWTNNLDYWNLDPSETKYHGAELHKDLLNSNLVIFKGDLNYRKLTGDRKWAH
                     TTSWDDAIGPLSSNGITLLSLRTIKADVLVGLPEGLNEELSELWEKDHPGHGSWWRSS
                     GKWAVICYASS"
     gene            <339094..>340320
                     /gene="NDAI0B01460"
                     /locus_tag="NDAI_0B01460"
                     /db_xref="GeneID:11497959"
     mRNA            <339094..>340320
                     /gene="NDAI0B01460"
                     /locus_tag="NDAI_0B01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668375.1"
                     /db_xref="GeneID:11497959"
     CDS             339094..340320
                     /gene="NDAI0B01460"
                     /locus_tag="NDAI_0B01460"
                     /inference="similar to DNA sequence:INSDC:YMR026C"
                     /note="similar to Saccharomyces cerevisiae PEX12
                     (YMR026C); ancestral locus Anc_2.576"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668423.1"
                     /db_xref="GeneID:11497959"
                     /db_xref="GOA:G0W5W9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:G0W5W9"
                     /translation="MSFYSNLPTSSSTSTSTSTPISKLYPTVFEIFSSQEIDALLPDS
                     VRYILTNYWIARHPTKFTLSVNNYFDEWFNLILKGLVEWYHLKRFNSTFVDKFYGLQR
                     FSSANTLVLNSIVSPSTSNFASSSWPIELQLTKVQRLIILLQKIIIPYLKNKLDVLYN
                     KYLTRLTFNNSKDENDTPTSLRVKKIFINVYPIWKKCWNLMDIIVKLSFLTGKTGSIS
                     IMEYLFNIQYTRMTPPLQQQQQQLRGKAASISTDPDERIRKLNKYSFLNESSKILSSS
                     KNALSFVGSQMFPSFIFMLRVYQWWTTEDLTTKLQKRIDNLDEVIPKPPIANDKSIET
                     TNHYHDKECPICHSEIQNPCVIETGYVLCYPCAIKYLTENEGKCPITHKKVLGCQFDP
                     ITNQWQVNNGIRKLLI"
     gene            complement(<340322..>341233)
                     /gene="NDAI0B01470"
                     /locus_tag="NDAI_0B01470"
                     /db_xref="GeneID:11496220"
     mRNA            complement(<340322..>341233)
                     /gene="NDAI0B01470"
                     /locus_tag="NDAI_0B01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668376.1"
                     /db_xref="GeneID:11496220"
     CDS             complement(340322..341233)
                     /gene="NDAI0B01470"
                     /locus_tag="NDAI_0B01470"
                     /inference="similar to DNA sequence:INSDC:YMR025W"
                     /note="similar to Saccharomyces cerevisiae CSI1 (YMR025W);
                     ancestral locus Anc_2.575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668424.1"
                     /db_xref="GeneID:11496220"
                     /db_xref="UniProtKB/TrEMBL:G0W5X0"
                     /translation="MLVVTLESHVLMDINYSYNLESLTNSTKQPGCHLLLGQEIATPA
                     CEEITIHVTRSVEVPLQLGVDDPYHFKIDIEQVQQRLNLINKIYDNVVVVGLMILNVE
                     FYNYSNVIEELKSQPSLQSAKVIFHYEPTIKNIKVDHHQRNAVDAELILNCYLFDTGD
                     RIGYILKQNVIDIVPSDIVVNNGIGISNYTFASSSSSRNKNPQATTLQDNDEEENNRD
                     EIKLRKLIKMIDNMIHYLEMFENGEYIIKEKKGIKINDKILRRISILISDLQKSPTKD
                     IEDEIMNKENEIRIIQIACEQWEMLNK"
     gene            complement(<341596..>342771)
                     /gene="NDAI0B01480"
                     /locus_tag="NDAI_0B01480"
                     /db_xref="GeneID:11496221"
     mRNA            complement(<341596..>342771)
                     /gene="NDAI0B01480"
                     /locus_tag="NDAI_0B01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668377.1"
                     /db_xref="GeneID:11496221"
     CDS             complement(341596..342771)
                     /gene="NDAI0B01480"
                     /locus_tag="NDAI_0B01480"
                     /inference="similar to DNA sequence:INSDC:YMR024W"
                     /note="similar to Saccharomyces cerevisiae MRPL3
                     (YMR024W); ancestral locus Anc_2.574"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668425.1"
                     /db_xref="GeneID:11496221"
                     /db_xref="GOA:G0W5X1"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G0W5X1"
                     /translation="MSLRSNCRLLIQPLTRAGPSASISLLSSSNNIVNVSQSCNNRTL
                     LALTRQASYSSSSTSPRLKDSEFAKYKEYYRNLKSLTINEIPEEIASKSPLLITLHSR
                     LQLPESFKYSTLSRCLTCRSSQLPTLPSSTSPKTVTFSKDYCDNHGLNIFGKNILSYY
                     VTKKLLEKYPRLPTVILNAAIDSYISDYVLSSIGSQWGIDIEKQTVMERYLQNEPFEI
                     TLGKLRFYNNSLNYNDGIEIVSWKKKFNQVKAMSLAVRSIIGSLWIESDQMAEQQQIK
                     KNLAFKFIDDHIISRKLDVSKLFMFEQPTRELSKLCEREGLERPISKLLAESGRASKA
                     PVFIVGVFSDKEKLGEGYGSSLKEAKARAATDALLKWYCYEPTNLQSPVIDPGTVIV"
     gene            343816..343888
                     /gene="NDAI0Btrna13A"
                     /locus_tag="NDAI_0Btrna13A"
                     /db_xref="GeneID:11496222"
     tRNA            343816..343888
                     /gene="NDAI0Btrna13A"
                     /locus_tag="NDAI_0Btrna13A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11496222"
     gene            <345205..>348393
                     /gene="NDAI0B01490"
                     /locus_tag="NDAI_0B01490"
                     /db_xref="GeneID:11497643"
     mRNA            <345205..>348393
                     /gene="NDAI0B01490"
                     /locus_tag="NDAI_0B01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668378.1"
                     /db_xref="GeneID:11497643"
     CDS             345205..348393
                     /gene="NDAI0B01490"
                     /locus_tag="NDAI_0B01490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668426.1"
                     /db_xref="GeneID:11497643"
                     /db_xref="GOA:G0W5X2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5X2"
                     /translation="MGVCAMWMVYFFATSPYRFPDVLILKYAGNNRNLFIDPNSRCFI
                     SYLKTRCANLMCKSLDKKTSDYLFHYIFVVRAILKHSLGQDYDGMKRDFFNETEGEPA
                     SYLLNNFLARSAGGGDSEDDFDPVKYSSNVLNSFVFVDGLSHTLMHYHKFQSLLKVYP
                     MSVHRSSRLSFRELRHGMIKLVRKYVKVEGEDIDMMNVKERLAGHSAATGQGIYGNDV
                     ESGVGADASLEEKYASLINSAWQNWLGLGYGKEREEGGSAVARNACVKKYFSSNGSIK
                     DLFVAGKKLYGKEFQFREGQFDVAVEIYLSGTQIIPIQALPGFGKTALFQIPLVALSY
                     GEQKTVSFVFVPYVCLLSNIKLRLSSCGINCGILKDLFVNGPAIEEKNLFCDVYVGTF
                     NDLGSENFVRLVNNWYNIYQDCILGMIVIDEFHNLETEQSYRGQSFRLIPEINFNLAW
                     KVVVMTGTAGEKGMVKPMKFIGYDKEMCTSMVSNKNRILYFDLVKQIPLKNIVKKFQV
                     FERSTVAETEVEKLVDRFMEYDTKSKVNIVCIQKVTVEKLISDMNMTGFDGDLPSEEK
                     IRKSKRFIEDEKCRIMIGTKLVSEGIDIKAVKLVIMHDYLPSIWEYIQTAGRLREGGV
                     CLSYWTKRSVQTCSVKPDVCIIKQVSKFYELNYDGHDLCCGHHHNISEAVANLYHYLN
                     GDGRPRVVEVDASIGDSEHVGNVPSFSSANESSIFEDLRPDMDQSENFIASNDSSFPG
                     LSNEVDMLDNLEKSTRGLVNEDSTNDGNNSDEVLPAPRIVLLPFDHGPNKRRRIISMK
                     DEINNLFGSAKNVFEFIGIPSKLCSQFIFYGLNESCLDFPLSVVDNPCPDCLGAKDGG
                     CVCWELGPAKVRRFGFEFILLLKMIMSEKEFDGVRKHCLDRGLHAVMLKYGGSKSLLF
                     DKFKTSALAKFCEIIVSKPKLPVSGELFSNDMVMTRCYNMMWEDIQGRKLDILMFFSV
                     KDCRDQMKGLWEADNGDDLAFKDIEADVKRASTTRYQSLPFIINFGGRPNYLVSTCGY
                     VFEEYMILYSIDKDFKSRSLYDSRDVLGNHPK"
     gene            349673..349745
                     /gene="NDAI0Btrna14A"
                     /locus_tag="NDAI_0Btrna14A"
                     /db_xref="GeneID:11496223"
     tRNA            349673..349745
                     /gene="NDAI0Btrna14A"
                     /locus_tag="NDAI_0Btrna14A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11496223"
     gap             351228..351971
                     /estimated_length=744
     gene            <352911..>354458
                     /gene="NDAI0B01500"
                     /locus_tag="NDAI_0B01500"
                     /db_xref="GeneID:11497647"
     mRNA            <352911..>354458
                     /gene="NDAI0B01500"
                     /locus_tag="NDAI_0B01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668379.1"
                     /db_xref="GeneID:11497647"
     CDS             352911..354458
                     /gene="NDAI0B01500"
                     /locus_tag="NDAI_0B01500"
                     /inference="similar to DNA sequence:INSDC:YMR023C"
                     /note="similar to Saccharomyces cerevisiae MSS1 (YMR023C);
                     ancestral locus Anc_2.573"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668427.1"
                     /db_xref="GeneID:11497647"
                     /db_xref="GOA:G0W5X3"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5X3"
                     /translation="MFNRNTSAILNNICYYSTRSITEGFPTIYALSTPPGQRSAIAII
                     RISGQQSLHVYQSITGNLSIPKPRTAILKNIYEPSSLLANSKKKKNLIDSSLFLYFQS
                     PNSFTGENLLEIHCHGGKAVTSAILKSIQSLNDPQRGVEIRYAGPGEFSRRAFQNNKF
                     DLTELESINQLIEAETEIQRKCIISSFTGENNLKFEIWRQDLIKCVANLTAIIDFGED
                     IEMSDVDSLVNKVKAEITQIKVQIESFLNRLKKSRILKDGIKISLIGKPNAGKSSLVN
                     CLTSNETSIVSDIPGTTRDVVDSYLDIDGYKVILTDTAGIRQNSTDIIEKMGIAKALK
                     SIKSSDVSLLIIDISEEKEEEEEEITNAINNLIELSEAEDKRSMIILNKKDLVNDEDK
                     MENITERLTKSFGTKYPIVPVSCITGDGIKDLTDMLTKEFKTLSEDLDESSPILMSQR
                     VTDILQNDVLFGIESFINSVANEKDIVMATEDLNVAIDGIGKITGQAVGVDEILDFVF
                     SKFCVGK"
     gene            complement(<354643..>355986)
                     /gene="NDAI0B01510"
                     /locus_tag="NDAI_0B01510"
                     /db_xref="GeneID:11496224"
     mRNA            complement(<354643..>355986)
                     /gene="NDAI0B01510"
                     /locus_tag="NDAI_0B01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668380.1"
                     /db_xref="GeneID:11496224"
     CDS             complement(354643..355986)
                     /gene="NDAI0B01510"
                     /locus_tag="NDAI_0B01510"
                     /inference="similar to DNA sequence:INSDC:YKL046C"
                     /note="similar to Saccharomyces cerevisiae DCW1 (YKL046C);
                     ancestral locus Anc_2.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668428.1"
                     /db_xref="GeneID:11496224"
                     /db_xref="GOA:G0W5X4"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:G0W5X4"
                     /translation="MKRVFNILFLLTFTHRANALSLDLNNYQSLENDTALVAYGLMDY
                     YNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENND
                     YIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQ
                     NCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDV
                     GLISNGTQKYVYDGTSIETNCTTITSYQWSYNQGLMLAGAAYLYNFTGSTIWLNRTMD
                     LLDATSVFFNNSIMYEVACQPTGTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWL
                     NTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYN
                     STNGGSSIGDGAAGTEATPTNLAPLHITKGSKVGAAFITAAIGLSIVFTSIWIIL"
     gene            complement(<356566..>357063)
                     /gene="NDAI0B01520"
                     /locus_tag="NDAI_0B01520"
                     /db_xref="GeneID:11498540"
     mRNA            complement(<356566..>357063)
                     /gene="NDAI0B01520"
                     /locus_tag="NDAI_0B01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668381.1"
                     /db_xref="GeneID:11498540"
     CDS             complement(356566..357063)
                     /gene="NDAI0B01520"
                     /locus_tag="NDAI_0B01520"
                     /inference="similar to DNA sequence:INSDC:YMR022W"
                     /note="similar to Saccharomyces cerevisiae UBC7 (YMR022W);
                     ancestral locus Anc_2.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668429.1"
                     /db_xref="GeneID:11498540"
                     /db_xref="GOA:G0W5X5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G0W5X5"
                     /translation="MSKTAQRRLLKELQQLNKDSPPGIVAGPANENNLFVWDCLVQGP
                     PDTAYEGGIFNARLDFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNM
                     YELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRKEFERQVKLSVL
                     KSLGF"
     gene            complement(<357616..>359154)
                     /gene="NDAI0B01530"
                     /locus_tag="NDAI_0B01530"
                     /db_xref="GeneID:11498541"
     mRNA            complement(<357616..>359154)
                     /gene="NDAI0B01530"
                     /locus_tag="NDAI_0B01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668382.1"
                     /db_xref="GeneID:11498541"
     CDS             complement(357616..359154)
                     /gene="NDAI0B01530"
                     /locus_tag="NDAI_0B01530"
                     /inference="similar to DNA sequence:INSDC:YMR020W"
                     /note="similar to Saccharomyces cerevisiae FMS1 (YMR020W);
                     ancestral locus Anc_2.567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668430.1"
                     /db_xref="GeneID:11498541"
                     /db_xref="GOA:G0W5X6"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:G0W5X6"
                     /translation="MTQDKQVIIIGAGIAGLKAASQLYANGIKNCLVVEARDRLGGRL
                     QTVSGYNCSKYDLGAAWHHDILMNGLFTEELELNKKCKDSESKRFVFDDNQPIFVDEE
                     RGRLDHDPEMILEFIDKEIDKYTELEFYQSLDVKDCSFHDIILKYLFERRDTLTDDQI
                     RYSAQICRYLELWHGIGWKDMSAKGTYFDHQGRNALVTNFDSIIERISSSFPKEWIVL
                     NTEVKTIERKGKIVVVKLNNGEEYTCEYTVVTVPQSVLELSTKDPNDITNTKGRIEFI
                     PPLNARIQEAFRKMHFGGLGKVIFEFDACCWTKKGSRIFTLAHSKETFVNNVREAGSW
                     DELIKKSESVNSTDKPKDLTCWDYPLLFVDLAKSTDVPTLVMLMQRPLSNYIESIGDD
                     KQRIFEFFQPVLDKIMSTLDTESVINEMFGATTASNKIGPKLKNIMTTNWSIDPYSRG
                     SYSTCFPEDDALEMIIAMSSGQDSRIRFAGEHTIMDGAGAVHGSWESGKREAAYISKN
                     LYNK"
     gene            complement(<359639..>362050)
                     /gene="NDAI0B01540"
                     /locus_tag="NDAI_0B01540"
                     /db_xref="GeneID:11498542"
     mRNA            complement(<359639..>362050)
                     /gene="NDAI0B01540"
                     /locus_tag="NDAI_0B01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668383.1"
                     /db_xref="GeneID:11498542"
     CDS             complement(359639..362050)
                     /gene="NDAI0B01540"
                     /locus_tag="NDAI_0B01540"
                     /inference="similar to DNA sequence:INSDC:YMR019W"
                     /note="similar to Saccharomyces cerevisiae STB4 (YMR019W);
                     ancestral locus Anc_2.565"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668431.1"
                     /db_xref="GeneID:11498542"
                     /db_xref="GOA:G0W5X7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W5X7"
                     /translation="MNMTDINGKEVTNKNRQRLRVQRACAICKKRKVKCDGMKPCSNC
                     IKRSKDCTYTTAYKIPNMKYSPSLSPSSKTHSVSIENSPAAPDASLDIRLHQKKANHV
                     TKILRNTERKPEEALVIDLLLGLGNNAPSSSTSSTAVSINNKNNNNNNNQSTEDDLIR
                     NDKLSAIVSPSKREQQQQNCQPIHHFSQLSFSHEKYRFHRRYQNLLPYYFGKSLISEL
                     SDKIIKDNNLEIPRIQNYAWNLSGGHYLKFDITTLQCSFSNSLSSSTTTATSSQFFDF
                     ENIIHLSIIRKLLTFYFKEINKPFNIIHESMFWDQYNNVFIQQEKQKNIESTKLFKSM
                     LYLIIITTLRFQEGFLEENDNDIPHTKLTKEEKIILESLKSEKALEDSMFNYSYSIIS
                     KLTFEWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMSLHLNEFPHIHSK
                     YEESKLFHCFWACFIIDKFISFQLGRFYLLPLPIHHMEFPSESNRCNDGTDWFSKETI
                     QLFHLSLIIMELQNRNAEELTFEQCVKIRNDLANWFDVHIATTVDEFLSSSKSPAQIQ
                     PLISYLDVRLSFEIKYLFHLINPPDLTTPWSHNFPTDIRILINNIELSITLIQYLLDE
                     KLFFVPWWLNLSQLFTASLSCIILIHSGIQSSKVNILLKKAIDIWNSLENSNPKNKPT
                     MISQCLWCLRMLSKLSRLGLMNSHSILENLVGENNGDNSPNKNKFSQFGKVDEKEDES
                     SERVNENGYTNDNAQSSIHQLLNDPSLSATLSSSVAVFENNSTNLLEDGLFSNLQWFD
                     QDFAL"
     gene            <363640..>366615
                     /gene="NDAI0B01550"
                     /locus_tag="NDAI_0B01550"
                     /db_xref="GeneID:11498543"
     mRNA            <363640..>366615
                     /gene="NDAI0B01550"
                     /locus_tag="NDAI_0B01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668384.1"
                     /db_xref="GeneID:11498543"
     CDS             363640..366615
                     /gene="NDAI0B01550"
                     /locus_tag="NDAI_0B01550"
                     /inference="similar to DNA sequence:INSDC:YKL043W,YMR016C"
                     /note="similar to Saccharomyces cerevisiae PHD1 (YKL043W)
                     and SOK2 (YMR016C); ancestral locus Anc_2.564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668432.1"
                     /db_xref="GeneID:11498543"
                     /db_xref="GOA:G0W5X8"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G0W5X8"
                     /translation="MSNNSNNNNNNNNNNNSTNNGGSSINRSTTPLAISAITNNYEEN
                     NSNTNNNNNKNNNNNNNNSNNDRNNTNNESITSNNTGNSTRPTANMNSASSQSAATSG
                     STVNYQYISPEQWQYHQPQQQYYQDQLQQQQQQQQQQQQQLQQPFMNNENNATSQVMQ
                     SQQPQQQYYVSNQDNTNTAVQSPAMTYYYYYPTPQFQIQPPTTVNYQYANPVAAVTAP
                     PPTNGPPALNASTGATVAAAPPPPPPPGATTTQYYYYPPSQSQSQAQMQNNNNNTNSN
                     ENIRSYEATNDRNSYYENYQAAYYNQQQQQQQQQQQMQAQAQAQAQQQHLLHHPQTQP
                     QQIVYGSPLPSNNSDMNQYQSYQTIEGRATSITPPFNNNNNNTNTMAQSHPVQLPVPS
                     GQLFSKNQNQNQIQNQIQNQALTDYPSPSTYQYPGFQQQQAAAAAAAAAADAAANQKQ
                     DSQSPSQQQQQQQQQTSELSATNPQIHQPQPQSYNQTSTYQSSYITSPLPPLSTTPDL
                     LQQQQQQQQQGSLPTSTALPLSRTTINKNISASSPSNTTTTKNIKKKRKQRKKNNSIS
                     STTTKSQQQDENDTVATTATSMTTPASIANNNVVDSSYIKPRVTTTMWEDERTICYQV
                     EANGVSVVRRADNDMINGTKLLNVSKMTRGRRDGILKAEKIRHVVKIGSMHLKGVWIP
                     FERARIMAEKEKILELLYPLFVRDIETVLKQTRPLVYHHVDNTNNNTYANANANVDAN
                     ANGENSNGYSMNATSSHELTYNQYEIANSNDNKQRQMMYQPQPQQQPQQQVHGQLPSV
                     PQQYQQQQQQPMMYTQSPLTQNNNNNNKLIPNQVSNYTNTNNSNGIPINAITTTSNGM
                     MYYNPQVQYNIQPQAQPQAQPQLQPQLQSPLIRQAYPTSSSSNGHALMNNNNNNNVHT
                     GIAPQQEHINTQSVSQKGQTKGKTNNTNTEENKNTFLSPSSNNTNNRIDNLMKEKLDS
                     SKNTNSNTSSINNDKKILH"
     gene            <367668..>369263
                     /gene="NDAI0B01560"
                     /locus_tag="NDAI_0B01560"
                     /db_xref="GeneID:11498095"
     mRNA            <367668..>369263
                     /gene="NDAI0B01560"
                     /locus_tag="NDAI_0B01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668385.1"
                     /db_xref="GeneID:11498095"
     CDS             367668..369263
                     /gene="NDAI0B01560"
                     /locus_tag="NDAI_0B01560"
                     /inference="similar to DNA sequence:INSDC:YMR015C"
                     /note="similar to Saccharomyces cerevisiae ERG5 (YMR015C);
                     ancestral locus Anc_2.562"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668433.1"
                     /db_xref="GeneID:11498095"
                     /db_xref="GOA:G0W5X9"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G0W5X9"
                     /translation="MDTIISNTTEFVNSNPTLINNVELQSTTIIQYLKSFSNWQIALA
                     FIIIILTWDQISYQMKKGSIVGPKFKWYPIIGPFLESLDPKFEEYKAKWYSGDLSCVS
                     IFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAVKILRPTNWVFLDGKPHIDYRKSLN
                     GLFTKSALAKYLPSQQKVMDKYLEKFIQLSKENNYEPQIFFHEMREILCALSLRAFCG
                     DYITEDQIRKIADDYYLVTAALELVNFPIIIPYTKTWYGKRTADNAMKIFESCAQKSK
                     DYIAAGGEPICVMDAWCKLMHDAKNENDENSRILHRDFSNKEISEAIFTFLFASQDAS
                     SSLACWLFQIVADRPDVLQKIREEQLAVRNNDLSTEITIDLIDQMKYTNMVIKETLRY
                     RPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPALHDPEVYENPDEFIPERWVEGS
                     KASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKVTPLSEKIKVFAT
                     IFPKDDLLMTFKRRDPLTGEVFE"
     gene            complement(<369509..>371053)
                     /gene="NDAI0B01570"
                     /locus_tag="NDAI_0B01570"
                     /db_xref="GeneID:11498096"
     mRNA            complement(<369509..>371053)
                     /gene="NDAI0B01570"
                     /locus_tag="NDAI_0B01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668386.1"
                     /db_xref="GeneID:11498096"
     CDS             complement(369509..371053)
                     /gene="NDAI0B01570"
                     /locus_tag="NDAI_0B01570"
                     /inference="similar to DNA sequence:INSDC:YMR014W"
                     /note="similar to Saccharomyces cerevisiae BUD22
                     (YMR014W); ancestral locus Anc_2.561"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668434.1"
                     /db_xref="GeneID:11498096"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y0"
                     /translation="MVKDNLLFKLDNLEYQYHYLTNSLNSFEPRFVQTRIHYNSKGKK
                     NAKKIAKILNEITLDDVELQMDQIKLEVFNKKIHHFEKKFSKFFNKFLTTSSKSSVWK
                     KKKLDVVLDDVKKNYDLDLFIKLICMSKSIKISINKLKFAQKKKNLKVSNDEGKQTLV
                     PKWFTLHSYWIINQDKSNEFNPSRIWNEVVMNIKNCDSLISLVMNDKECKEIIENFEN
                     GLDFFLGINKQNRLKQKQEQEQEQEQEQEKSKKSTKDENESVSDNSVNEREDEEEDES
                     GSEIDNQDHADIDEEELARHYEGLLAASSDEEEEEGNAVEDTLDTTINYNEVTDEEPS
                     SDEDEDTSDEPSRKKAKKNVVKLPELMAGYYSGGESSEDEKREDRVAKEQMSNKPQRK
                     NRRGQRARRKIWEQKYGSGAKHIQKEVEAKVAERQKRQEEYEERAAKRAAKAEAYEKV
                     MEEKRLRNRDNGWAARDSAVAKIKKTTPMLEKPPLEEHPSWVAKKLAEEKQKNAKFAG
                     KKITFD"
     gene            <373829..>375466
                     /gene="NDAI0B01580"
                     /locus_tag="NDAI_0B01580"
                     /db_xref="GeneID:11498097"
     mRNA            <373829..>375466
                     /gene="NDAI0B01580"
                     /locus_tag="NDAI_0B01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668387.1"
                     /db_xref="GeneID:11498097"
     CDS             373829..375466
                     /gene="NDAI0B01580"
                     /locus_tag="NDAI_0B01580"
                     /inference="similar to DNA sequence:INSDC:YMR013C"
                     /note="similar to Saccharomyces cerevisiae SEC59
                     (YMR013C); ancestral locus Anc_2.560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668435.1"
                     /db_xref="GeneID:11498097"
                     /db_xref="GOA:G0W5Y1"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y1"
                     /translation="MAATISQQETVQDQSELDKHAKNSMQLSPDVSPPNETKSSTSYF
                     SSKKFIQLAITFSTLYLAYTKHKDTKDELDCVTIFKDASRVIVILLANIFMNYANNVN
                     KIAISNGAVDNNVKTNLLPPFDVCYLVYLPFMVSFLFCPSLAIFNTTLTLNVLDVNIF
                     KKLTFQVCFIIFDQVMSSSSTKDDIDKLPLIGIAVNYTISELLMKIGEKKSLDLIDSN
                     LFSIILTNILIMLPIQNDNMDYLPLIILRNTLYAFIIIVSFNWMVSTLLIKLKFNQKS
                     LHITLLINFIIALPLTINVLVEIPSSSEKSSLSPSIWLFDFINSSSIRKTILILWLSF
                     LLVLIPNIIFFKSNFSLNTSRKIWHFLIFLLLIKPFQMDPFFIKIALSGTIVLFLSIE
                     YLRFINLHPIGPILNEHLKTFTDYRDNKGPLIISYIYLIIGISIPLLVNNSPIGLISL
                     GIGDSMASIIGGKFGHFKWPGSKKTLEGTMAFILTTSFTCYCLKTYFQGFYFNQISMI
                     NLFYVCTLSGILEGNSQLNDNILIPTFMMIIEELLSN"
     gene            complement(<375612..>379610)
                     /gene="NDAI0B01590"
                     /locus_tag="NDAI_0B01590"
                     /db_xref="GeneID:11498098"
     mRNA            complement(<375612..>379610)
                     /gene="NDAI0B01590"
                     /locus_tag="NDAI_0B01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668388.1"
                     /db_xref="GeneID:11498098"
     CDS             complement(375612..379610)
                     /gene="NDAI0B01590"
                     /locus_tag="NDAI_0B01590"
                     /inference="similar to DNA sequence:INSDC:YMR012W"
                     /note="similar to Saccharomyces cerevisiae CLU1 (YMR012W);
                     ancestral locus Anc_2.559"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668436.1"
                     /db_xref="GeneID:11498098"
                     /db_xref="GOA:G0W5Y2"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="InterPro:IPR028275"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y2"
                     /translation="MSAATTDAVSTSDSIKTEQNENVQVSIKLPVLSIPRHHHHNNND
                     TKGKKSNRNHKASSTTADNTKKNELLFQFNKDVKIRTVVDVLAISEQSKYLTNIQLTH
                     NGKILSEEATLGESLANNNDKVAKLNVSLKPYTTRSGLHHLLTVRDFVGFSSESIDGL
                     SEFAISTHSKFNSLPLDDIKEKKIPIEEKKDQEKEEGTKEEEPKKKNVFEVNDEEKSK
                     FASMVHEIFEASANSSINKLLSAETDIITPCLRSLSLSGYNPVPVFYKSKGHLFYIQV
                     VTLESETFHITVTPSGFFVNKSSATKFDPNEKIFEEEDNKTQIKSGTFYTLYDLLAYH
                     SKKFTSHVEALEKKLSNLESVSYVKPLTTFLHKPWMVSSPTNPSDFLRLQLTSQDLSP
                     ITKSNDTTFNDQYQAIKDLPLDSIPNRIEFEKLQTKITHDFTIAAIKGAMSIFTNDSI
                     PLNPESVTNEHIYLIDDIFYSFADKVSNKDLIVDEETARVSATQDLKTINVLNRVKLD
                     QVRYVLTTIVDFAGKRLIAQTPVPGLLSSMGAKLEKDPVTDETILKDFKNDVMVQYGL
                     DEEEGKILYDEEFDAALGAEFAKIFHLQKHHAKVSADDDDNKIWFSSKSRGLIGFDKR
                     KYVLDLANTYPIDINFVKEHFDSFKGDTSRRYPHRQTLLRPELVDKWWTEKVEKEDGL
                     DMVTAFNENKFNYNPDAYHIEGVEDKTIDNMSTYLNDDIIPNVMKDYFEGKANIPYNG
                     EHLVDTLHKHGINLRYLGKIIEITKEYLESENTKHSAKLEEVAKDNADYEDWEASYLM
                     KIEKMIAERQAKINKYVQEGKEVPPELTGDLKLNEDELRKPTNEEPVIVAKDELETLI
                     HVAEVEVISRSIKHFLRAFAKPLPVALVPSLISFVFNLLFGEQYNADPKPEEVNEFYP
                     TKSYEFVNLTRASILEFIQKEAFLRFRYELPENWINKHTGNPFQLIRSICYKFGIQLI
                     NKEYFLRREQYEYYKQSQDKKIRNKLVEPTTTFAVNDFVIIPKVKTSECTSLIAQEYW
                     QQGLSLINEDQTTALTSFAQSIAVLEEVNSVLHPTVAEKYLALSTIYNQLGLSSEAVA
                     FCRKSCKIYERVCGIDSFEMLRAMINLTLSEISNESPYNASVIYKRIISTLQAFQIGS
                     DQYVHPSITNIYTSLEQLSLGVENPKLTIEILKKLSDLISTSVGDDSLAYAYTGSRLS
                     NMYVTLKEYRHGLEHVVMAEKVFTKELGANHVQTAQAKQWVTGLTNLLNNIQNKINEE
                     QKQVQESHQSKAKASSTGSSSSNNNSHSKKNKKNNEPNPELAKKSVDELLDFIEGDSG
                     KKSKKNKKNGKK"
     gene            complement(379930..380001)
                     /gene="NDAI0Btrna13E"
                     /locus_tag="NDAI_0Btrna13E"
                     /db_xref="GeneID:11498099"
     tRNA            complement(379930..380001)
                     /gene="NDAI0Btrna13E"
                     /locus_tag="NDAI_0Btrna13E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11498099"
     gene            complement(<382282..>383592)
                     /gene="NDAI0B01600"
                     /locus_tag="NDAI_0B01600"
                     /db_xref="GeneID:11497645"
     mRNA            complement(<382282..>383592)
                     /gene="NDAI0B01600"
                     /locus_tag="NDAI_0B01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668389.1"
                     /db_xref="GeneID:11497645"
     CDS             complement(382282..383592)
                     /gene="NDAI0B01600"
                     /locus_tag="NDAI_0B01600"
                     /inference="similar to DNA sequence:INSDC:YHL020C"
                     /note="similar to Saccharomyces cerevisiae OPI1 (YHL020C);
                     ancestral locus Anc_2.557"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668437.1"
                     /db_xref="GeneID:11497645"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y3"
                     /translation="MSSSPPSSITKHGNLSEEEVRAAEVLGVLRHSNRTRTNSNAAVL
                     SIKNIIEPTTEVDATNNNLDNRRISNEANIEISDKDPHSENENENEQEQEQEQEQEQE
                     TETLLDRVCKNVVTFYDDFNSKKRVSSIARLLDDAYEENYTDSENDNEDEEDDDDESD
                     NEEEYFRISKRQKISEAIAKSKDNLKEYKLNMSIESKKSLIACLHLLKLANKQLSDKV
                     SYLQDMVTEEQVARTTHITNHNNGNRHHIRHPKNITKKSNDDTSSATDSEDDEDDDDE
                     EYFDANEPSKDYDEQSTIIKMEIVGTIKKVYSLVSKYTGSSLPEPARTQVRETLLNLP
                     TNWTISVNNSFFSTPAATSEQNQPTLNSSSNYISTNGKVLILAKESLDVVRNVIDVVD
                     SSLGRAEEYVKQKQEIKEMLRERFLKQQQEQLQLQQSQSQVKDE"
     gene            complement(<384287..>386305)
                     /gene="NDAI0B01610"
                     /locus_tag="NDAI_0B01610"
                     /db_xref="GeneID:11498295"
     mRNA            complement(<384287..>386305)
                     /gene="NDAI0B01610"
                     /locus_tag="NDAI_0B01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668390.1"
                     /db_xref="GeneID:11498295"
     CDS             complement(384287..386305)
                     /gene="NDAI0B01610"
                     /locus_tag="NDAI_0B01610"
                     /inference="similar to DNA sequence:INSDC:YHL019C"
                     /note="similar to Saccharomyces cerevisiae APM2 (YHL019C);
                     ancestral locus Anc_2.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668438.1"
                     /db_xref="GeneID:11498295"
                     /db_xref="GOA:G0W5Y4"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR027200"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y4"
                     /translation="MSSCIFILDENLEPILNKNIRSIGNNFELLLKFQEIYRKQQNEI
                     HNNDDSKVLPILNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMI
                     IFSYLEEFYKLLKSYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI
                     RVKINLPELNYDGSRIDGNDEVSSDDDDDNKHKRKHKHKHKHEKSKAKGKQADNVGTG
                     AGAGLNLSNLTKLEKDKILETIKKNKDKVLDGTRLRIGGGNRQDTDTDTDIELGTLGE
                     GNNDIYMNSYIAKTTIMPISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIH
                     GEIVCKCYLSGMPKLKISINKILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNA
                     NVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKYK
                     LKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNF
                     LIWEIGSMKGGHGEVTMSMMAEFPIFNEEEYERLQEEMKTSMNPPPLREGPKLEELYK
                     KIHHHNDEDEDEVEAEVEAEEEEEDVGSQEATGTHARKTKEERKDKDLRKRTRSPNLL
                     KIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYAYIV"
     gene            <386571..>386963
                     /gene="NDAI0B01620"
                     /locus_tag="NDAI_0B01620"
                     /db_xref="GeneID:11498296"
     mRNA            <386571..>386963
                     /gene="NDAI0B01620"
                     /locus_tag="NDAI_0B01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668391.1"
                     /db_xref="GeneID:11498296"
     CDS             386571..386963
                     /gene="NDAI0B01620"
                     /locus_tag="NDAI_0B01620"
                     /inference="similar to DNA sequence:INSDC:YHL018W"
                     /note="similar to Saccharomyces cerevisiae YHL018W;
                     ancestral locus Anc_2.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668439.1"
                     /db_xref="GeneID:11498296"
                     /db_xref="GOA:G0W5Y5"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y5"
                     /translation="MYNKIVKVKPIPIDPKNLSSKLSDLKLSPNWKTIPPLESKDSNI
                     KIGHKLVRETIKFKNFEITWAFLNQLAMRCHLWGHHPTISTTYNKVDLQLFNHDLNMI
                     TDIDLKLASKIESYINLYNQASQEIKKE"
     gene            complement(<387070..>387873)
                     /gene="NDAI0B01630"
                     /locus_tag="NDAI_0B01630"
                     /db_xref="GeneID:11498297"
     mRNA            complement(<387070..>387873)
                     /gene="NDAI0B01630"
                     /locus_tag="NDAI_0B01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668392.1"
                     /db_xref="GeneID:11498297"
     CDS             complement(387070..387873)
                     /gene="NDAI0B01630"
                     /locus_tag="NDAI_0B01630"
                     /inference="similar to DNA sequence:INSDC:YKL040C"
                     /note="similar to Saccharomyces cerevisiae NFU1 (YKL040C);
                     ancestral locus Anc_2.553"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668440.1"
                     /db_xref="GeneID:11498297"
                     /db_xref="GOA:G0W5Y6"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y6"
                     /translation="MFRSVISRNGIMFTKGQSRSLLPTFRRWLNINVLTTPNEHALKF
                     LSVDGELFQTPGSKSIVIKNTDTTLINNCKLAERIFLECSGAESLMIGDDFVSVNKDS
                     MIDWNQLRPDVVRILLEHLKSGENVISDDFFTVKELSEKAGGGYNINTPKFEYDEEAE
                     EISEIIDELIDTRIRPAILEDGGDVDYLGWDSKTGTVYLRLKGSCSSCSSSEVTLKYG
                     IESMLMHYVDEVKEVIQLLDPQQEIALKEFDKLEKKLSSNGSDATKVSV"
     gene            complement(<388367..>390589)
                     /gene="NDAI0B01640"
                     /locus_tag="NDAI_0B01640"
                     /db_xref="GeneID:11498298"
     mRNA            complement(<388367..>390589)
                     /gene="NDAI0B01640"
                     /locus_tag="NDAI_0B01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668393.1"
                     /db_xref="GeneID:11498298"
     CDS             complement(388367..390589)
                     /gene="NDAI0B01640"
                     /locus_tag="NDAI_0B01640"
                     /inference="similar to DNA sequence:INSDC:YHL016C"
                     /note="similar to Saccharomyces cerevisiae DUR3 (YHL016C);
                     ancestral locus Anc_2.551"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668441.1"
                     /db_xref="GeneID:11498298"
                     /db_xref="GOA:G0W5Y7"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR019900"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y7"
                     /translation="MGEFKPILPQGAGYAIILGLGAVFAFGMVLVTYMLRRYQKEIIS
                     AEEFSTAGRSVKTGLVAAAVVSSWIWCSTLLTSVSKQYTGGMFGGYSYSAGACFQIIA
                     FAIIAIKTKQKAPNAHTYLEIVRARYGKYGHICFLFYALATNILVTAMLLTSGSAVFS
                     DITGMSATAACFLLPVGVIIYTLFGGIKATFLTDYLHTIVIIIIVMIFAFKVFATGDV
                     LGSPGKVYDLVREAAKRHPVAGNAGGEYMTMSSRTSGIFLVINLVGNFGTVFLDNGYW
                     NKAISASPAASMPGYVMGGLSWFSIPCLVSLTMGFACLAVETLPNFPTYPDPLSSSQV
                     TAGLVLPAAAITVLGKGGAVATLLMVFMAITSAMSAELIAVSSVFTYDIYRIYINPKA
                     TGKQLILSSHGACIFFGVAMSAFAVGLNAGGVSVGYLYEIMGIIISSAVLPVILTLCW
                     KQQNIHAAIISPILGTGLAIMSWLVCTKSLFTNLTIDTTFMDYPMIAGNVVALLSPGI
                     FIPILTYVFKPQNFDWEILKTISRVDETEEIAKDLEDIDGIVVQDIESVSSSSKSLKN
                     DVTNDADYTNNNNDKIQAVRTIMSSILEDVNPTVAQRELEEEKQELAKGLKIAYFLCI
                     FFALAFLVVWPMPMYGTHYIFSKRFFTGWVVVMIIWIFISAFCVCVYPLYEGRHGIYT
                     TCRGIYWDLSGQTYKLREWQNDNPEELHVVKSQMSAKIHKQTSRLGTLENNLDDVIEG
                     "
     gene            <391667..>392122
                     /gene="NDAI0B01650"
                     /locus_tag="NDAI_0B01650"
                     /db_xref="GeneID:11498299"
     mRNA            <391667..>392122
                     /gene="NDAI0B01650"
                     /locus_tag="NDAI_0B01650"
                     /product="ribosomal protein S20"
                     /transcript_id="XM_003668394.1"
                     /db_xref="GeneID:11498299"
     CDS             391667..392122
                     /gene="NDAI0B01650"
                     /locus_tag="NDAI_0B01650"
                     /inference="similar to DNA sequence:INSDC:YHL015W"
                     /note="similar to Saccharomyces cerevisiae RPS20
                     (YHL015W); ancestral locus Anc_2.550"
                     /codon_start=1
                     /product="ribosomal protein S20"
                     /protein_id="XP_003668442.1"
                     /db_xref="GeneID:11498299"
                     /db_xref="GOA:G0W5Y8"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR018268"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y8"
                     /translation="MRFKTFNLPRLARNSCKTIGKENQELIKRYITMSDFQKEKVEEQ
                     EAPQIIKIRITLTSTKVKQLENVSNNIVLNAEQHNLVKKGPVRLPTKVLKISTRKTPN
                     GEGSKTWETYEMRIHKRYIDLEAPVNIVKRITQITIEPGVDVEVVVASN"
     gene            complement(<394184..>395422)
                     /gene="NDAI0B01660"
                     /locus_tag="NDAI_0B01660"
                     /db_xref="GeneID:11497787"
     mRNA            complement(<394184..>395422)
                     /gene="NDAI0B01660"
                     /locus_tag="NDAI_0B01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668395.1"
                     /db_xref="GeneID:11497787"
     CDS             complement(394184..395422)
                     /gene="NDAI0B01660"
                     /locus_tag="NDAI_0B01660"
                     /inference="similar to DNA sequence:INSDC:YHL014C"
                     /note="similar to Saccharomyces cerevisiae YLF2 (YHL014C);
                     ancestral locus Anc_2.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668443.1"
                     /db_xref="GeneID:11497787"
                     /db_xref="GOA:G0W5Y9"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W5Y9"
                     /translation="MSHISKHILGRPSNNLTSGIVGLANIGKSTFFQAITNSKLSNPA
                     NYPFATINPEECLIQIPNDKLTQLQQIYNSSKTIKSTLTVTDIAGLIRGASQGNGLGN
                     KFLNDIRFVDGIFHLVRGFIKDDVEHVERTIDPVRDLAIVQDELILKDLEYLENAVSH
                     LQTKAIKKKSLQYQKVNEEIKLLNGLEQHLYSGKKIIHYKDDWTKEEVDIINKHHFLT
                     AKPTIILLNTSPRDFLLRPIKEVPFEKGVVDWADEYSSGDKVITISAEYETKYIEYMD
                     ANNEEGFQDYCKNQVGKEYIDRISECDMTSSMPLIIQEMKKALDLISFFTCGPLEVRE
                     WNLRKGSTAKEAAGIIHTDLEDTFINADIIHYLDLLGTKMPYNESYLKSKSFIHRVGK
                     QYIIQDNDIALFKATKGKKR"
     gene            complement(<395630..>396553)
                     /gene="NDAI0B01670"
                     /locus_tag="NDAI_0B01670"
                     /db_xref="GeneID:11497788"
     mRNA            complement(<395630..>396553)
                     /gene="NDAI0B01670"
                     /locus_tag="NDAI_0B01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668396.1"
                     /db_xref="GeneID:11497788"
     CDS             complement(395630..396553)
                     /gene="NDAI0B01670"
                     /locus_tag="NDAI_0B01670"
                     /inference="similar to DNA sequence:INSDC:YHL013C"
                     /note="similar to Saccharomyces cerevisiae OTU2 (YHL013C);
                     ancestral locus Anc_2.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668444.1"
                     /db_xref="GeneID:11497788"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z0"
                     /translation="MEELLSRHRKEKKDLQNQITGMKKQATKSQRKQVNSKCIELQES
                     LELKHSNEIKEWKSQNNMIDEIDKVEFEEDEITPEKLLEQLKLSAGEEEKTKKDDTAT
                     PALNQQPKKRRNRQKEKLAKRDAEIARMKEEARLEASKQPDLKKIEQDSLNHLYQLNK
                     VKEFDIQPDGHCLFASILDQLQIRHKKNITEKDNPKYKDLDVYKLRKLACDYIRENKN
                     DFIPYLFDESTMSLKDIDEYTKEMETTAKWGGEIEILALSKVFDCPISILMSGRATHK
                     VNEQGTNPELKLVYYKHTYALGEHYNSLHDL"
     gene            complement(396812..396867)
                     /gene="NDAI0Btrna12P"
                     /locus_tag="NDAI_0Btrna12P"
                     /db_xref="GeneID:11496219"
     tRNA            complement(join(396812..396848,396812..396867))
                     /gene="NDAI0Btrna12P"
                     /locus_tag="NDAI_0Btrna12P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11496219"
     gene            <398598..>401372
                     /gene="NDAI0B01680"
                     /locus_tag="NDAI_0B01680"
                     /db_xref="GeneID:11497642"
     mRNA            <398598..>401372
                     /gene="NDAI0B01680"
                     /locus_tag="NDAI_0B01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668397.1"
                     /db_xref="GeneID:11497642"
     CDS             398598..401372
                     /gene="NDAI0B01680"
                     /locus_tag="NDAI_0B01680"
                     /inference="similar to DNA sequence:INSDC:YKL038W"
                     /note="similar to Saccharomyces cerevisiae RGT1 (YKL038W);
                     ancestral locus Anc_2.547"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668445.1"
                     /db_xref="GeneID:11497642"
                     /db_xref="GOA:G0W5Z1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z1"
                     /translation="MSRTSLFISPIIPHRAKLNDTMNMSNSNNEPTSPKSLTETSKKR
                     SKVSRACDQCHKRRIRCNYNKVTNMCAGCKRIGEHCLFTRIPLKRGPVKGYTKSRRNS
                     SLSSDGSSSAFNTINQLSRVISLNDSIQLPPLNVTNKLTTQQPLSYPVIQQLPTAQVS
                     VIQQQQQQQQQQQQQQQQQQQQQQQQQQQPFWKVPYRDITSQYRDSTLNNNNNKIIIP
                     SEKQLYPMEQNYPISNGNYNTNYNVMRQQSLGTNINSYSNSLQQQQQQQQIKSDHYQN
                     AIPRKLSSNISPRTGSSPSSASSSSNSPTSATIYPCFGKDQQLLLLSSSSPSSTIYPY
                     SQFNKRKENNNIPKKAATRVTRSSLPNAIVSTSYEPTSNNKLVIANEKEEISKTLSKE
                     RLITQRQQELSHNGNDSMNNNSNSNSNPERLINEYYKLIHIELPIIPMNESTFKSMIL
                     PHLLKTASSSSSSVLNVARTINECFISSLELLLSHTEHDDMIKYMMNIFEKLLQIYPN
                     VSSSSSSSSSSSSSSSSSSSSSSSSLCGDDEDDELSWVNKLLFVNSLIILNYLNMLIG
                     FISTILLGMSLSLFNGLKLNHHHHHHHHHGHGVVDKDGMGKKIQYDKIMKRCYVLIIF
                     FDCLQCFDDVDICKFSNHKISKDVIMNVFIDDDNDDLTEGVSLLNDKLRLFCLINDIT
                     NERNKSMLLFGSILDDQENRIWLPDFEHNNDDDNNKEEEREGEKGKNNVIEYFQNVLI
                     IKQYLMKSLLSLKENSFDSRGQNNKKFKDISSKLCSIISQIVKILQIYEGDIIAKGRK
                     INDNTRKYFFFRHLIIQEIIKLIDSIKYMPSVLISKLLMKDGNRQGIDDDDDADQEKE
                     EHNSIIVKLSNSMNDMVQITAFLSDKIYQDEWIGKGRGKDTKKQENNDIVKAVDDISR
                     FINTGMELSR"
     gap             402411..402604
                     /estimated_length=194
     gene            <402710..>404209
                     /gene="NDAI0B01690"
                     /locus_tag="NDAI_0B01690"
                     /db_xref="GeneID:11497790"
     mRNA            <402710..>404209
                     /gene="NDAI0B01690"
                     /locus_tag="NDAI_0B01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668398.1"
                     /db_xref="GeneID:11497790"
     CDS             402710..404209
                     /gene="NDAI0B01690"
                     /locus_tag="NDAI_0B01690"
                     /inference="similar to DNA sequence:INSDC:YHL012W,YKL035W"
                     /note="similar to Saccharomyces cerevisiae YHL012W and
                     UGP1 (YKL035W); ancestral locus Anc_2.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668446.1"
                     /db_xref="GeneID:11497790"
                     /db_xref="GOA:G0W5Z2"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z2"
                     /translation="MSGSKRHTKTQSTYAFESNTSNVAASQMRNALNKLADSVKDEQL
                     RFQFENQLDSFFSLFRRYLVEKSSGSTLEWEKIKSPNPNEVVDYNVISQQPENVTNLS
                     KLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEHLNRQYDSDVPLLLMNS
                     FNTDKDTEHLIKKYSANRIRIRSFNQSKFPRVYKDSMLPVPTTINDPLDAWYPPGHGD
                     LFESLHASGELDALIAQGREILFVSNGDNLGATVDLKILNHMLETGAEYIMELTDKTR
                     ADVKGGTLINYDGQVRLLEVAQVPKEHIDEFKNIRKFKNFNTNNLWINLKAIKRLIES
                     SALQMEIIPNGKTIVRNGHEINVLQLETACGAAIRHFEGAHGVVVPRSRFLPVKTCSD
                     LLLVKSDLFYLQHGALKLDPTRFGPNPLIKLGSHFKKVSNFNSRISHIPKIVELDHLT
                     ITGNVFLGKDVTLRGTVIIVCSDGQRIDIPNGSILENVVITGNLQILEH"
     gene            <405044..>407254
                     /gene="NDAI0B01700"
                     /locus_tag="NDAI_0B01700"
                     /db_xref="GeneID:11498574"
     mRNA            <405044..>407254
                     /gene="NDAI0B01700"
                     /locus_tag="NDAI_0B01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668399.1"
                     /db_xref="GeneID:11498574"
     CDS             405044..407254
                     /gene="NDAI0B01700"
                     /locus_tag="NDAI_0B01700"
                     /inference="similar to DNA sequence:INSDC:YIR010W"
                     /note="similar to Saccharomyces cerevisiae DSN1 (YIR010W);
                     ancestral locus Anc_7.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668447.1"
                     /db_xref="GeneID:11498574"
                     /db_xref="GOA:G0W5Z3"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z3"
                     /translation="MSVELPPNKRKMYPTRIQTIKTDHLDNPSKSIQSDIQIETANDN
                     NNDDDNHTGITKNKNKNNKNKNKNKNELKRSSPFNTDQDKQDINNVDDHDFKFKRHRI
                     KNSNDIPSLGERLDNLQDINRARRIDNFNSSIQVPPSSKADNRTNNTDHVNIPTDHAS
                     VSQLRHQQQLKKQVDNPFQASGSVSSDSSTGNDGMNIQNAAPGLGPTPYMPYMYYYPP
                     PPPPAQLLPPNSNFSPKNYQSFPPSFPPPHPPFSVPNYLLSPVQNSQYLPNSSLQPFY
                     PTSNQNMMMTSPMYPSSSSRIPSSSLQTQAPQHLLPPASLYPYDIAYQNYHQTNLTNQ
                     TRNKRKSLTQQRGKRLSILSQDNNNIISPHKDIPQDEFYKHIANISFGKNLQLKQLFN
                     WCMIRSLEILQSKSKSISKSRARQNNTTANNNNNTDMITLNIIKNFVTDLRRGIIDID
                     WEPEPVENEDDNEQENADDDEEEEENEDEKEDLTNGFESYEDTELRQLFPDDTTTIRR
                     KQEEAIMNKNRKQNQSNKKTMKKKTKNKVIRSAVTNDVDDDCYNNNNYNNNKKKKKLL
                     PNSKNVQNLNNLNILNEKINKIKSEIDQWATSLDAVDPEFGWKYIKSIVNDNIDVDVE
                     NNRKEDELSIKTKSTQVEPAEMMSSLYEDLMTKLDALHMNSHYVNSHSTALDKISSQK
                     LLKLSDHINESNMHKRYEDNNAKNGRVDMNKLLLRGLSESILNKKQFLQEQHRR"
     gene            <407575..>408939
                     /gene="NDAI0B01710"
                     /locus_tag="NDAI_0B01710"
                     /db_xref="GeneID:11498575"
     mRNA            <407575..>408939
                     /gene="NDAI0B01710"
                     /locus_tag="NDAI_0B01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668400.1"
                     /db_xref="GeneID:11498575"
     CDS             407575..408939
                     /gene="NDAI0B01710"
                     /locus_tag="NDAI_0B01710"
                     /inference="similar to DNA sequence:INSDC:YIR012W"
                     /note="similar to Saccharomyces cerevisiae SQT1 (YIR012W);
                     ancestral locus Anc_7.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668448.1"
                     /db_xref="GeneID:11498575"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z4"
                     /translation="MSQEEIEPQEEFITNEDVDQEIVLTNDGTDLPLPEEEEEEEEVT
                     EQHTEHDGDIAMGEAEGQNGEDIIEIDMSNNSVSYFDKHTDSVFTISHHPTLPLICTG
                     GGDNVAHLWTSHSHPPKFAGTLQGHTESVIASGFTMDGKFLITGDMNGKILLHKSNKS
                     GSQWKQVSQLQEVDEVVWLKCHPTVPGIFAFGAADGSVWCYQINDNGSDDVSLEQLMS
                     GFAHQQDCTMGEFINLDKAANGESLELISCSLDSSIVGWNCFTGQQLFKITPAELKGL
                     QAPWVSLSLAPSSLTNGNSGIIAAGANNGVLAIINCNNNGAILQLSTVIELKPEQEEL
                     DASIESIAWSQNFPLMALGLVSGEILLYDTTTWRVRHKFVLDDSITKLIFDNNDLFAS
                     CINGKVYQYDSKTGQEKFVCTGHNMGVLDFVLIKPQQNSTTGLRRLVTAGDEGVSLVF
                     EVPN"
     gene            complement(<409125..>410768)
                     /gene="NDAI0B01720"
                     /locus_tag="NDAI_0B01720"
                     /db_xref="GeneID:11498576"
     mRNA            complement(<409125..>410768)
                     /gene="NDAI0B01720"
                     /locus_tag="NDAI_0B01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668401.1"
                     /db_xref="GeneID:11498576"
     CDS             complement(409125..410768)
                     /gene="NDAI0B01720"
                     /locus_tag="NDAI_0B01720"
                     /inference="similar to DNA sequence:INSDC:YIL015W"
                     /note="similar to Saccharomyces cerevisiae BAR1 (YIL015W);
                     ancestral locus Anc_7.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668449.1"
                     /db_xref="GeneID:11498576"
                     /db_xref="GOA:G0W5Z5"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z5"
                     /translation="MTQSRINPFICCIYVLSLLCLSSNVSSRPLSNRINKRNDISGHL
                     HMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCMENYCNSTEIPK
                     YNNDLITQNLTIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQ
                     IDNYNITSLQLAVANYATTPVGGLLGISFPRRESVKGYDGALNEYYPNFPQVLKNENI
                     IDIVLYSMYLNDLNQDGSLLFGAIDTSKFEGDMITYPMVNVYPNVVDKPATLALTIQG
                     VAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYIL
                     NCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDI
                     FLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIPSNGAIPGAKVATVKPWSTHE
                     PITVTTNIVSSCKAPSHSTIHKESSSKLTDQSTATATSVNIISKSTNIVTSTPTVPSS
                     QKGNLKNSISMKYVTKTETALSTVLIGVCSNVAYTKILL"
     STS             409669..411356
                     /standard_name="ha2836"
                     /db_xref="UniSTS:515599"
     gene            complement(<411644..>412273)
                     /gene="NDAI0B01730"
                     /locus_tag="NDAI_0B01730"
                     /db_xref="GeneID:11498577"
     mRNA            complement(<411644..>412273)
                     /gene="NDAI0B01730"
                     /locus_tag="NDAI_0B01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668402.1"
                     /db_xref="GeneID:11498577"
     CDS             complement(411644..412273)
                     /gene="NDAI0B01730"
                     /locus_tag="NDAI_0B01730"
                     /inference="similar to DNA sequence:INSDC:YIL016W"
                     /note="similar to Saccharomyces cerevisiae SNL1 (YIL016W);
                     ancestral locus Anc_7.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668450.1"
                     /db_xref="GeneID:11498577"
                     /db_xref="GOA:G0W5Z6"
                     /db_xref="InterPro:IPR003103"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z6"
                     /translation="MEAVEDILQDQTMSAIISETITSTSTVATNTITMTSASTTTSTS
                     TSTMSNIIPSAVAKMGCIKKYLSSCSCCSNTSCFKICSGIAVAILSFLLWKLFNRSST
                     YVKSNAKLDEKPVPITKESQIDNIQLRFQNEFVTKIDPLLESFDSSDEQHIYNRNYYN
                     EMLLKLLIELDDIDLTTIDDKQTKMDMKEKRKLVIKDIQTYLKTLDSLK"
     gene            <415810..>418875
                     /gene="NDAI0B01740"
                     /locus_tag="NDAI_0B01740"
                     /db_xref="GeneID:11498578"
     mRNA            <415810..>418875
                     /gene="NDAI0B01740"
                     /locus_tag="NDAI_0B01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668403.1"
                     /db_xref="GeneID:11498578"
     CDS             415810..418875
                     /gene="NDAI0B01740"
                     /locus_tag="NDAI_0B01740"
                     /inference="similar to DNA sequence:INSDC:YIL017C"
                     /note="similar to Saccharomyces cerevisiae VID28
                     (YIL017C); ancestral locus Anc_7.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668451.1"
                     /db_xref="GeneID:11498578"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z7"
                     /translation="MVSSHPSSAPLNSSSQLTIDDLQQLITTLVGNPMNKITYYVLPN
                     VQLLDHILSISHTDPFNEQSMKLDLLYLILNLEQNIRDSLGTLYLNLVQRIYSIVSNT
                     HNHNNLELYKTIPLNHPIINYKFFKLLKLTIQNCSIEQYPHIDYLQEGLVHLINSLIN
                     NPKEKQDQDQNQSQTNSIITLLDIFLILNKLDQFIPLSNLIMSIENLLLNYSNKYSYQ
                     IDFKYILPIKLQQQKQQTMTTDDDEQLKNKKMRKLPKYSPYSNKGIHFVTTIPNPIII
                     NNQLDSQLISSSLVIYMAIYSNSYQTSDGFLSLFSSPTLWINIPFDIFIKSLLKNKNN
                     IQLRCSALQFQIFPLLNPHLKQNKWKSLKTLKSLLPFILESFDYDSIPWWYDPFDVLL
                     QLISLYNDNNMNTNVNIDTINNITPVKTANPMVFLLSKVDMIDKFLTIFRNCLKIELK
                     SKDRKNYHISKTLTKIVKIFAALSSNDDFYRSLLLKHNAFIISLEDSLQTHIKLIDQF
                     ELNSKQFISIADLNQHLPSFYDSKLILSWLSLLKSLSRSPMALKTSLRKFNLIHLQLT
                     LLEKDLSFFQNHTRNNNDKTILNELINMELQIMSNSLACICNFVMEFSSLQTFIVKNG
                     IIDIIQAILNEPFFIDSGISSDQKNIQHINQIKTNSLWILRNLMYNCQNSEKFQLLDK
                     ISMDLILKFINDPNWSVQSQCFQLIRNLTSNSRKIIKLLIENFNEAPGFTITTTTTNV
                     HEHESKSNNLFEFLSMKIKQISPYNADQRKALEGILYIIVNLAALNENKKKLIMNQNE
                     ILKVISEILSSGDNINYHTAVERRFNNDPSLKLASLWILNNLLWDSTVSHYSQFGLDI
                     SQRRRHGASNHDADSSSLPSSSSSSSSSSSLGANHEQQHHPHHHHQSIRAESDGTLLD
                     LRTRTNENNGNVFVTTAKENTNDKPISADDETMYAHPNNNDNDTTLSSSNLPTNFAAI
                     KRCQTLEDLGIRELVKQNIFDKTLAVREKSRTLLYHMDLLIKEGLAPYK"
     gene            complement(<419370..>420678)
                     /gene="NDAI0B01750"
                     /locus_tag="NDAI_0B01750"
                     /db_xref="GeneID:11498080"
     mRNA            complement(join(<419370..420130,420675..>420678))
                     /gene="NDAI0B01750"
                     /locus_tag="NDAI_0B01750"
                     /product="ribosomal protein L2"
                     /transcript_id="XM_003668404.1"
                     /db_xref="GeneID:11498080"
     CDS             complement(join(419370..420130,420675..420678))
                     /gene="NDAI0B01750"
                     /locus_tag="NDAI_0B01750"
                     /inference="similar to DNA
                     sequence:INSDC:YFR031C-A,YIL018W"
                     /note="similar to Saccharomyces cerevisiae RPL2A
                     (YFR031C-A) and RPL2B (YIL018W); ancestral locus
                     Anc_7.187"
                     /codon_start=1
                     /product="ribosomal protein L2"
                     /protein_id="XP_003668452.1"
                     /db_xref="GeneID:11498080"
                     /db_xref="GOA:G0WDX0"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G0WDX0"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGI
                     VKQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIVSNVEERPGDRGAIARASGNYVIIIGHNPDENKTRVRLPSGAKKIISS
                     DARGVIGVVAGGGRVDKPLLKAGRAFHKYRLKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<421395..>421586)
                     /gene="NDAI0B01760"
                     /locus_tag="NDAI_0B01760"
                     /db_xref="GeneID:11498081"
     mRNA            complement(<421395..>421586)
                     /gene="NDAI0B01760"
                     /locus_tag="NDAI_0B01760"
                     /product="ribosomal protein L29"
                     /transcript_id="XM_003668405.1"
                     /db_xref="GeneID:11498081"
     CDS             complement(421395..421586)
                     /gene="NDAI0B01760"
                     /locus_tag="NDAI_0B01760"
                     /inference="similar to DNA sequence:INSDC:YFR032C-A"
                     /note="similar to Saccharomyces cerevisiae RPL29
                     (YFR032C-A); ancestral locus Anc_7.189"
                     /codon_start=1
                     /product="ribosomal protein L29"
                     /protein_id="XP_003668453.1"
                     /db_xref="GeneID:11498081"
                     /db_xref="GOA:G0W5Z9"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:G0W5Z9"
                     /translation="MAKSKNHTAHNQTKKAHKNGIKKPKTYKYPSLKGVDPKFRRNHK
                     HALHGTAKALAAKRAAAKN"
     gene            <422528..>423331
                     /gene="NDAI0B01770"
                     /locus_tag="NDAI_0B01770"
                     /db_xref="GeneID:11498082"
     mRNA            <422528..>423331
                     /gene="NDAI0B01770"
                     /locus_tag="NDAI_0B01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668406.1"
                     /db_xref="GeneID:11498082"
     CDS             422528..423331
                     /gene="NDAI0B01770"
                     /locus_tag="NDAI_0B01770"
                     /inference="similar to DNA sequence:INSDC:YIL020C"
                     /note="similar to Saccharomyces cerevisiae HIS6 (YIL020C);
                     ancestral locus Anc_7.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668454.1"
                     /db_xref="GeneID:11498082"
                     /db_xref="GOA:G0W600"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011858"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W600"
                     /translation="MTRFIGCIDLHNGEVKQIVGGTLTETNKKTESDTLKTNFVSQYP
                     SSHYAKLYKTHNVTGSHVIKLGPNNDTAALEALKEAPNFLQVGGGINDTNCLEWLVYA
                     SKVIVTSWLFDKDGSFQMDRLKKISQICGKDRLVIDLSCRRTPSNKWVVAMNKWQTLT
                     NLELNEEVFKLLSEYSDEFLIHAADVEGLCKGIDEELVTKLYEWTKDIKHSESIKIVY
                     AGGAKSVTDLNLVEKLSNAKVDLTYGSSLDIFGGKLVKFADCCQWNEEH"
     gene            complement(<423642..>424946)
                     /gene="NDAI0B01780"
                     /locus_tag="NDAI_0B01780"
                     /db_xref="GeneID:11498083"
     mRNA            complement(<423642..>424946)
                     /gene="NDAI0B01780"
                     /locus_tag="NDAI_0B01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668407.1"
                     /db_xref="GeneID:11498083"
     CDS             complement(423642..424946)
                     /gene="NDAI0B01780"
                     /locus_tag="NDAI_0B01780"
                     /inference="similar to DNA sequence:INSDC:YIL022W"
                     /note="similar to Saccharomyces cerevisiae TIM44
                     (YIL022W); ancestral locus Anc_7.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668455.1"
                     /db_xref="GeneID:11498083"
                     /db_xref="GOA:G0W601"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="InterPro:IPR017303"
                     /db_xref="UniProtKB/TrEMBL:G0W601"
                     /translation="MLHNRSIIQSSSYVRLLNVQRSSSVPSSYTVGKVLFSTTRTTLN
                     NNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAH
                     KGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYK
                     DVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAK
                     ESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAKV
                     YTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKV
                     FREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGD
                     ESNIVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPFN"
     gene            <426597..>427649
                     /gene="NDAI0B01790"
                     /locus_tag="NDAI_0B01790"
                     /db_xref="GeneID:11498084"
     mRNA            <426597..>427649
                     /gene="NDAI0B01790"
                     /locus_tag="NDAI_0B01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668408.1"
                     /db_xref="GeneID:11498084"
     CDS             426597..427649
                     /gene="NDAI0B01790"
                     /locus_tag="NDAI_0B01790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668456.1"
                     /db_xref="GeneID:11498084"
                     /db_xref="UniProtKB/TrEMBL:G0W602"
                     /translation="MNLFPVYFLITYLATFVVPSPVNVTAIVNFPIVQSTHDESNFFR
                     VQRILERIKSQEINNNNGNASIQNNYVSLLLTLNGGSKSSSNLNLTETLRSTITTLEK
                     NVVLGSGYLNDTTTAIIPIGCLSYLKMKDDIENSLKGLEYMIDSMEQFSLSGLGDSIR
                     DVVLIKPMKRLTEYIVNSHLLYLDWKSRYMMRNYLVDRNRVDLLEGCFKDLITIERMI
                     TIFNEALSNLTANGLEKYTKSLLESKDFKEFRSTFHEAEEKEQEVLVDALSSKILNNQ
                     SREIIATASPVRWFLYGIILLLTMGYFYTLCIPFAPACFGLLVIFVLYHLLALYRLFR
                     GQTAILEYVESQGIFY"
     gene            <429150..>430490
                     /gene="NDAI0B01800"
                     /locus_tag="NDAI_0B01800"
                     /db_xref="GeneID:11498426"
     mRNA            <429150..>430490
                     /gene="NDAI0B01800"
                     /locus_tag="NDAI_0B01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668409.1"
                     /db_xref="GeneID:11498426"
     CDS             429150..430490
                     /gene="NDAI0B01800"
                     /locus_tag="NDAI_0B01800"
                     /inference="similar to DNA sequence:INSDC:YHL009C"
                     /note="similar to Saccharomyces cerevisiae YAP3 (YHL009C);
                     ancestral locus Anc_2.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668457.1"
                     /db_xref="GeneID:11498426"
                     /db_xref="GOA:G0W603"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G0W603"
                     /translation="MNYNQQPISPQELLNMFQHRNMIPESQYMASQGYYPNQYQNDPR
                     TDDNNNSMPPASSDVPPPPAAVASATPTFLDPMGFNNECPLLNNSPVQTVLPQQQQLQ
                     HRSSSPSLMNPYSSIPLTKENNNNQQYQVPHNHQVQNNINSFKDALPSPRSKKNSLNS
                     SNTINPNYNIIDNNNNNTLDLTEEEIKAKKKAQNRAAQKAFRERKDAKLKELREKLNE
                     SEQNRQDLLKEVDSLRKLNMEINAESKKILLQTTNNIDNIKKLLIEEAQSAPSSSSSV
                     NNVIIKKNSSDESLNDHQFLLSGANNPMEKHYHHRTSSSSSPHLQNDSKFSFPTEDQN
                     FNIIDDLQDKLYSYASAYTDNSTNNNNSNDINSLASPNTMDSNTSTGTLAPREPLLTI
                     PATWEYLHKLSEHQDFDVFVVMQMLKGKEACDEYGPAYPKALVNEMVEKCINEN"
     gene            complement(<431291..>433462)
                     /gene="NDAI0B01810"
                     /locus_tag="NDAI_0B01810"
                     /db_xref="GeneID:11498427"
     mRNA            complement(<431291..>433462)
                     /gene="NDAI0B01810"
                     /locus_tag="NDAI_0B01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668410.1"
                     /db_xref="GeneID:11498427"
     CDS             complement(431291..433462)
                     /gene="NDAI0B01810"
                     /locus_tag="NDAI_0B01810"
                     /inference="similar to DNA sequence:INSDC:YHL008C"
                     /note="similar to Saccharomyces cerevisiae YHL008C;
                     ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668458.1"
                     /db_xref="GeneID:11498427"
                     /db_xref="GOA:G0W604"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:G0W604"
                     /translation="MVDDSYYITPHEAALATVATSMKKARLHIETLILNSILGGFLFS
                     IGGLLYTAIHADNPDLLEKNPGILNLLGGCCFGIGLFYVVIMGVDLFNSNILFFSVGL
                     LRGAVTIYDVLLSWSISLIGNLAGSLFVCYLFVHVSKVGQNPHWIAGSRKIAEDRASF
                     SFMETFLKGIAGNFMVCLAIYLQLLAKPTHVKALLLNLPIMSFVTIGWTHVVADMTLL
                     FTGMLNGANVSVGKYIWKLLIPSSIGNIIGGTVFGLLIPFYLHLLVVERDRKNLSLPE
                     YDARDEQPELNVDSRVVRITKRDDEDIAPNDIVTVSDSDSDSGSDSYTDYNEKSRTSV
                     DNTNEGHLETNKSVNGNNNIDPNLYHSITEQGSLNSTGSTISAAASLSPVSTYTDQTT
                     GNLSQQYTNRNGSASLEPLPFRPERTHINMSKIPSIGDISSYQVSRNQTYSVGKAQRV
                     KSRNNVTNNILRVKSSNPRRHSFSILRSPPGVFPVRGMGVPLDRERTIEDSTYQGNNE
                     LQHKTSKLSTKKSPKHLNDELLRMKSNTSPKKASIHSDIGAQNGGNFQRVYSVLDEKP
                     GAKLEKAITRLLERTPSNNVIGSSKDLEMGELDPPESVPTTATTTTTTQDMFPHNEPN
                     ACENYGKVSKSSIFKTATDGGSSNNIFRKFTRQFEPTSSSPDVNKLEEDMHRVGINKS
                     AAIAANNVAGAENFSNINTFNTAHVKSKRRSSLVSNRSAAN"
     gene            <433938..>435815
                     /gene="NDAI0B01820"
                     /locus_tag="NDAI_0B01820"
                     /db_xref="GeneID:11498428"
     mRNA            <433938..>435815
                     /gene="NDAI0B01820"
                     /locus_tag="NDAI_0B01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668411.1"
                     /db_xref="GeneID:11498428"
     CDS             433938..435815
                     /gene="NDAI0B01820"
                     /locus_tag="NDAI_0B01820"
                     /inference="similar to DNA sequence:INSDC:YHL010C"
                     /note="similar to Saccharomyces cerevisiae YHL010C;
                     ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668459.1"
                     /db_xref="GeneID:11498428"
                     /db_xref="GOA:G0W605"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0W605"
                     /translation="MVIKYRIVVELENREQVNSAYTLFTTSQRDKFKSTVAVQKLNQQ
                     EEEKGQKIDWRLSDWIIETEMFSFDQNQKNKMIVNSNKKRIDQQDKGLLLSEYLGHGI
                     VRLFKLTGGLDVDGTKGKPPQEDGKARSETDVLTIPGDDTMVCILFVPTYFTVHDLLY
                     FYIGDEIVNQISHFRILRNKQGGVGFNFMVLMKFREPLMAKNFKDKFNGKSFSKMDPE
                     TCHVIFIKEIVFKSKLFRRVDLQELPYLMTDPFTNKDSPTTLKKVELPTCPVCLERMD
                     SETTGLITIPCQHTFHCSCLDKWNDSRCPVCRYSNLRLTRESLVKQAGDSNAPCATCG
                     SHDNLWICLICGNIGCGRYNFKHAIKHYETTSHCFAMDIATQRVWDYAGDNYVHRLVQ
                     NEVDGKLVEVSSTSMGTSNSDGHDNVTNEGKESKDYNLAANFLRNKEYHLEYVQVLIS
                     QLESQREYYELKLEDAKNDSSVVEEKNRVELKMVEMQAQISNIEKKYETNIDKMRKQL
                     DIDGLMIKGLQENLDKLTKINETTTEEKKMLLLEKQDLEEQVKDLMFYLESQEKFKDA
                     DESVREGTIVIQQQQVGSTNSQIPLTRNNKKKKKTRNLRNKWNWRSWTNLYLLLHMFK
                     N"
     gene            <436254..>438314
                     /gene="NDAI0B01830"
                     /locus_tag="NDAI_0B01830"
                     /db_xref="GeneID:11498429"
     mRNA            <436254..>438314
                     /gene="NDAI0B01830"
                     /locus_tag="NDAI_0B01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668412.1"
                     /db_xref="GeneID:11498429"
     CDS             436254..438314
                     /gene="NDAI0B01830"
                     /locus_tag="NDAI_0B01830"
                     /inference="similar to DNA sequence:INSDC:YBL024W"
                     /note="similar to Saccharomyces cerevisiae NCL1 (YBL024W);
                     ancestral locus Anc_8.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668460.1"
                     /db_xref="GeneID:11498429"
                     /db_xref="GOA:G0W606"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W606"
                     /translation="MARKRNQKKGNKKTFGARDDTRAKRSWSELIKENEKWETYYKTL
                     NIIPEEEWARFKETCQSPLPLTFRVTGSRKHAHEVLKLFQEKHLPNLTNVEFEGQILK
                     PPMELPWYPNHLAWQLDVPKTVIRKNEQFAKTQRYLVVENAVGNISRQEAVSMIPPIV
                     LEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDADAKRSHMLVHQLKRL
                     NSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGDGTMRKNVNVWKDW
                     NTQGGLGLHTVQLNILNRGLNLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGSKIKL
                     VNCDDKLVGLVRSKGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIR
                     VYPHQQNTGGFFITVFEKIEDEVEQAKRLANELEESSPTPSAKKLKTENGAAAEVQQE
                     PVKKERLPRDANEEPFVFVDPNHESLKVCWDFYGIDSKFDKTTCLVRNATGEPTRTVY
                     TVCPTLRDIIQANDDRLKIIYSGVKLFVAQRSDIECSWRIQSESLPIMKHHMKSPRIV
                     NANLDMLKELLIESFPTFEDVEAKHLDDEFVKKMHDLSSGCAFVEIERGEDKESLFLP
                     VWKGAKCVNLMVSKEDTHELLYRIYGIETTAKDNSKIQKKQVATGTAESTETVDSKET
                     STDA"
     gene            <438776..>439855
                     /gene="NDAI0B01840"
                     /locus_tag="NDAI_0B01840"
                     /db_xref="GeneID:11498430"
     mRNA            <438776..>439855
                     /gene="NDAI0B01840"
                     /locus_tag="NDAI_0B01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668413.1"
                     /db_xref="GeneID:11498430"
     CDS             438776..439855
                     /gene="NDAI0B01840"
                     /locus_tag="NDAI_0B01840"
                     /note="ancestral locus Anc_8.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668461.1"
                     /db_xref="GeneID:11498430"
                     /db_xref="GOA:G0W607"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:G0W607"
                     /translation="MNVQEYIDNQAALEEEARAAMPWEPKKCTYEMGSIRQQIFACRT
                     HENIGICYSCSVMCHTKCDIVELFTKRNFTCDCGTERDKMIKEHNCKCDVRKNVENDI
                     ASLSNKYGQNFKGLFCSCSTEYDPDSKAVMLQCVLGIECDEDWYHDSCIMGIDDSKKD
                     AQVRIDDPVSGESTIEGFPHLDSFDAFICWKCISKYDYYFKRILSHHASDKIIQCKLG
                     RDSEIIPDKINENGKRVIEEGQNNGEYSVFLKSDYSKEFKTLKAKLEKDDKLFIFLDK
                     IAPFLIEDDPIYEPAAEPEDDTDIIQLVSKILQNGASVGGVVDTMVTFNSMKTKLNEY
                     LKSFAENNRVVKEEDVKNFFRSVEE"
     gene            complement(<440321..>441532)
                     /gene="NDAI0B01850"
                     /locus_tag="NDAI_0B01850"
                     /db_xref="GeneID:11498565"
     mRNA            complement(<440321..>441532)
                     /gene="NDAI0B01850"
                     /locus_tag="NDAI_0B01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668414.1"
                     /db_xref="GeneID:11498565"
     CDS             complement(440321..441532)
                     /gene="NDAI0B01850"
                     /locus_tag="NDAI_0B01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668462.1"
                     /db_xref="GeneID:11498565"
                     /db_xref="GOA:G0W608"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:G0W608"
                     /translation="MFSVADSYKPQLQNFLATSQNGNKCGECGSLNPAWCSTTYTVFL
                     CTRCAAIHKKLLNHDPYFSIIKSIQLDHWNNDELQRFLSSGGNRHNMEFWNPKNVQIK
                     YYDKDDDLKCEDFIKNKYILKKFKYEQEKEDRRRFTPSSLRMKRGNYIPKLCKNRMAR
                     DYELSKYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGDELEMAPALP
                     SRPVAANVPKPAVFDGTGILQDATVVENSTPRPAIFDGSTELGGQPIQLDQLNQPRPA
                     VFDGFSNSAPTLQTETLPTNALLPEQTMPQYSQAYTNMNQPPQNAYPQYQQLAPLQNQ
                     MQQSPSMNTMNTMNTMNTMNNMQIPSGSGYQIPPAQNNMQNLPNGYIPQQQPPQPQQQ
                     NFYNYNSNPYM"
     gene            <442562..>443128
                     /gene="NDAI0B01860"
                     /locus_tag="NDAI_0B01860"
                     /db_xref="GeneID:11498566"
     mRNA            <442562..>443128
                     /gene="NDAI0B01860"
                     /locus_tag="NDAI_0B01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668415.1"
                     /db_xref="GeneID:11498566"
     CDS             442562..443128
                     /gene="NDAI0B01860"
                     /locus_tag="NDAI_0B01860"
                     /inference="similar to DNA sequence:INSDC:YER134C"
                     /note="similar to Saccharomyces cerevisiae YER134C;
                     ancestral locus Anc_8.160a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668463.1"
                     /db_xref="GeneID:11498566"
                     /db_xref="GOA:G0W609"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010036"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR024734"
                     /db_xref="UniProtKB/TrEMBL:G0W609"
                     /translation="MTKDTETKSYPDVAAFDLDFTVWPCYCDTNLSPPFKEVYNKNKE
                     VHTLVDSCGYKLSFYKDIPKIIIDLKKNGVRIVSASRTWAPEIAKQCLRQFKIEYEGQ
                     IIPMIELFDDLQWGERSKIGHLKDALVNIYGHNDLKLLKVCLFDDESRNKDVERYGVK
                     FIYVKDSKHGPSWQLYQNYLDEYDIDLA"
     gene            <445573..>446697
                     /gene="NDAI0B01870"
                     /locus_tag="NDAI_0B01870"
                     /db_xref="GeneID:11498567"
     mRNA            <445573..>446697
                     /gene="NDAI0B01870"
                     /locus_tag="NDAI_0B01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668416.1"
                     /db_xref="GeneID:11498567"
     CDS             445573..446697
                     /gene="NDAI0B01870"
                     /locus_tag="NDAI_0B01870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668464.1"
                     /db_xref="GeneID:11498567"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:G0W610"
                     /translation="MFYKNNKYINNKHHTTLLKLKKCPLLKLLFSKKLFLKPTQYISQ
                     RGQILVIFICRLPICSTYLDHKIIKKLTDVIGVSVVHWKLDKKTGWKLLNAGETKLGE
                     NAFKIDGGILSSQDDTSSPLGDLDESSNRLFKDGTFDPHYGVTQIKELYDMTDKQYKG
                     EYFWPILWDLKTKTIVNNNWDQIDAILNSAFNDFDETKGTVDIFPETLSSQIEKYNEW
                     LFPHIIDGVYNVGLAEKQSVYETNLINFFKDMDKIENKLREVHDTLAKEYGASNEEEI
                     LKRFFLFGGQITESDIRLFVTMIRFDSIYAVHFKLNYRLVRSDYYYIHLWMRNLYWNY
                     PAFGHTTDFNHIKLLYTHGMRNINPNGIVPLGPEYDILKL"
     gene            <450558..>450944
                     /gene="NDAI0B01880"
                     /locus_tag="NDAI_0B01880"
                     /db_xref="GeneID:11498568"
     mRNA            <450558..>450944
                     /gene="NDAI0B01880"
                     /locus_tag="NDAI_0B01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668417.1"
                     /db_xref="GeneID:11498568"
     CDS             450558..450944
                     /gene="NDAI0B01880"
                     /locus_tag="NDAI_0B01880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668465.1"
                     /db_xref="GeneID:11498568"
                     /db_xref="UniProtKB/TrEMBL:G0W611"
                     /translation="MWMVYFTGLYRFPDMLVLKYGGNNRNLLIDPNSRCFDVITSYSK
                     TICANFMCKNLDKKTADYLFHYIFVVRGILKHSLGPDYDGMKRDLFNETEGEPANYLL
                     NNFVARSVGDGDSEDDFGPVNIPIMF"
     gene            451609..451680
                     /gene="NDAI0Btrna5H"
                     /locus_tag="NDAI_0Btrna5H"
                     /db_xref="GeneID:11498569"
     tRNA            451609..451680
                     /gene="NDAI0Btrna5H"
                     /locus_tag="NDAI_0Btrna5H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11498569"
     gene            complement(<452361..>452972)
                     /gene="NDAI0B01890"
                     /locus_tag="NDAI_0B01890"
                     /db_xref="GeneID:11497664"
     mRNA            complement(<452361..>452972)
                     /gene="NDAI0B01890"
                     /locus_tag="NDAI_0B01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668418.1"
                     /db_xref="GeneID:11497664"
     CDS             complement(452361..452972)
                     /gene="NDAI0B01890"
                     /locus_tag="NDAI_0B01890"
                     /inference="similar to DNA sequence:INSDC:YGL200C"
                     /note="similar to Saccharomyces cerevisiae EMP24
                     (YGL200C); ancestral locus Anc_8.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668466.1"
                     /db_xref="GeneID:11497664"
                     /db_xref="GOA:G0W612"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G0W612"
                     /translation="MKLNSIILIISCWLTTFTLGHNVLLPAYGRRCFFEKLSKGDEFS
                     VSFQFGDRDPQSSNQLTGDFVLYTPGRTQVLQSIVNQAHGEVTISAPDGGKFEYCFIN
                     ENSNVQTKDVTFNIHGTVYVNVDDPNNESLDGSVRTLSKLIKEVQNEQSYIVIRERTH
                     RNTAESTNDRVKWWSIFQVGVVVANSLFQIYYLKRFFEVTSYV"
     gene            complement(<454169..>455678)
                     /gene="NDAI0B01900"
                     /locus_tag="NDAI_0B01900"
                     /db_xref="GeneID:11498085"
     mRNA            complement(join(<454169..454933,455502..>455678))
                     /gene="NDAI0B01900"
                     /locus_tag="NDAI_0B01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668419.1"
                     /db_xref="GeneID:11498085"
     CDS             complement(join(454169..454933,455502..455678))
                     /gene="NDAI0B01900"
                     /locus_tag="NDAI_0B01900"
                     /inference="similar to DNA sequence:INSDC:YER133W"
                     /note="similar to Saccharomyces cerevisiae GLC7 (YER133W);
                     ancestral locus Anc_8.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668467.1"
                     /db_xref="GeneID:11498085"
                     /db_xref="GOA:G0W613"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G0W613"
                     /translation="MDQQAVDVDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSI
                     FIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
                     AAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSEN
                     DRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFD
                     NAGAMMSVDESLLCSFQILKPAQKSLPRQQGGGRKKK"
     gene            <457444..>462267
                     /gene="NDAI0B01905"
                     /locus_tag="NDAI_0B01905"
                     /db_xref="GeneID:11498086"
     mRNA            <457444..>462267
                     /gene="NDAI0B01905"
                     /locus_tag="NDAI_0B01905"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668420.1"
                     /db_xref="GeneID:11498086"
     CDS             457444..462267
                     /gene="NDAI0B01905"
                     /locus_tag="NDAI_0B01905"
                     /inference="similar to DNA sequence:INSDC:YER132C,YGL197W"
                     /note="similar to Saccharomyces cerevisiae PMD1 (YER132C)
                     and MDS3 (YGL197W); ancestral locus Anc_8.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668468.1"
                     /db_xref="GeneID:11498086"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G0W614"
                     /translation="MPLLQPNSTECYRLELPELPPNVNLDEATKNRLSLNARTGAAVT
                     LARSSIYVHGGLTIPLNISEINSATLQKELILYFSKSKDSSQSFKNLNDWISCEVFYL
                     DLITRTWERIETNATTALARTSSSQFSERLFHSICVNENALYIFGGLAISPQNDYELI
                     ATNELWKLDLYTRKWTLLSKDPRITRRFNHDMFVKYAADDSHDTRLLIVGGLNNMDQP
                     LCTIDVYNLITNEWESISNSNIIKKFDEQPVSIVHNKNLPILIENNEAEVPTLTFYHT
                     NSNDNNDSTEEEEEQLQGEENNYGNSSIKIENELSPIIALPLLPQSQCVRIASEYLQD
                     KDLLKVPYNLQHPKGAYFNRNLLISGFYPNCQASNFYVYIYDISIGKWIQLKASCETC
                     SSSQHRFWNLFVWQSHHQALLLGTMQDDYNLPSVQRFDLITSFSLPIVNSFNNFNNKA
                     STELFQTSFLPSLASDLGSIPTTPIDKRTPPLTTSNSTSKITSQFENYIRYITTPLEL
                     KSTSSVFPPSAMVVGKDALEIFGNTLADFEFITSEGDSIAVSAYLLRKRWGRYFSFIL
                     SNGYAKVCQEYHSTGNQSTLVKIAPSDVSYTDDGSKLNPPPAMTSSNVSLERYFKNNG
                     NNHNSNGNNHTNTLDNNYHRKKHDTTTNRHHEHIPSTSPRGSNVAVPREHTLASMRRS
                     PCNSRYNLHNSPELDFEPIPSNTNLYDDFETTSSKTVNSKTINDSVTSSSTGMIFRVP
                     FQENDKEDILTTTNNINSNTINYNNNNKNLKKKLRAGSATENNNFINVPKKRRSSVVT
                     NPMGSLNKLSPHMEDAKSRRASNPIQPLTEITQISPPPSRRFSLRFTHSGANSRKASV
                     TSQTSSISFVSSTSDRLNNAILTRRNTETVISSNDPLKSGVLNIFLPPQKRLPSVSLP
                     PVPSGQEPLGPFKSRTNSYIEHFHSDRSSPLSSRRSSFLRSSSVPEVRRKSMAALDKK
                     QSRNGSFSSNGSNSHTKKSWSSASNHSDSGSEFSAGQVELEPLLMPRSLYMPWPTATV
                     KAFTEFFYTGQVNGKWMLAPVTLDLLLISKMYEVPLLYDLITEVLYAIIGKKEGNLFV
                     NCNNLDDSFKSTVKKYFNYDEAEVENYLDTHATYKDLKNLKNLLELTDSGMLDVNLIR
                     KISRNFSFSSFESDSIPSTPRTTKHVVSTVYAGGPRDSHNSVGSIVFPSTNVNITSNK
                     RSVSLYTPRMKGKSSLSKEIDPTISEKARNKSTDNLTSKSKSSSKHFDSTLLDLDERD
                     PVLVEQLDQARLQDLSRIETDYPLNSEDTLRTGSTGNIISHTLSDSSQSDSDDFESQI
                     GLLSISRMKKHIREVEIFEDAIDPLHKINNALQSPSKSFDIISSKPSITPLNRALKND
                     LNSNNNNSNIDFESPTLESMISPNSLPPVDYVMKIIYRTSVLVNDTRLMLRCIDCIEI
                     SRKLKIIRKLLTQDINRMNEDVLKRSSEQDKSKRGKPELTIPISSNGTRDTMTSFKIK
                     PYSPTATTFRRSSSKAQISPRTSIPNDMANKTISGRKSSTPQQQRILTKSTGSGRFSN
                     ISAIVSTPSSLNTAVIARPPLLGTNSNSSSSVPPKSKKDSNASTSSSFSFFGIRK"
     gene            complement(<463465..>464985)
                     /gene="NDAI0B01910"
                     /locus_tag="NDAI_0B01910"
                     /db_xref="GeneID:11498087"
     mRNA            complement(<463465..>464985)
                     /gene="NDAI0B01910"
                     /locus_tag="NDAI_0B01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668421.1"
                     /db_xref="GeneID:11498087"
     CDS             complement(463465..464985)
                     /gene="NDAI0B01910"
                     /locus_tag="NDAI_0B01910"
                     /inference="similar to DNA sequence:INSDC:YGL190C"
                     /note="similar to Saccharomyces cerevisiae CDC55
                     (YGL190C); ancestral locus Anc_8.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668469.1"
                     /db_xref="GeneID:11498087"
                     /db_xref="GOA:G0W615"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0W615"
                     /translation="MSRDDYHFKFSQCFGDKADIVVTEADIITAVEFDHTGDFLATGD
                     KGGRVVLFERNKNNKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQLKWLRSSNQRSH
                     FLLSTNDKTIKLWKVYEKNIKLVSENNLSMENDITKGKSSSNSHTLSLQNLKLPRLSQ
                     HDKIIAAAPKRIYSNAHTYHINSISTNSDQETFISADDLRINLWNLDIPDQSFNIVDI
                     KPNNMEELTEVITSAEFHPQQCNLFMYSSSKGTIKLCDMRQNALCDFKTKTFEEYTDP
                     ISHNFFTEITSSISDVKFSPDGRYIASRDYLTVKIWDVNMNNKPLKTINVHDELKERL
                     SDTYENDAIFDKFELNFSGDSSSIMTGSYNNNFMIYPNVVKTAQDENNGIVKNFDENY
                     TTNNSNNIFKKNLPYGNNSNNSNSKRGKNNSKGGGGETEKERNSTKTPDEIILKADKT
                     VFKNKRSSSLLSKSSRNKEWSNDIDFKKSILHFSWHPRENSISVAATNNLFIFSAL"
     gene            complement(<465751..>466110)
                     /gene="NDAI0B01920"
                     /locus_tag="NDAI_0B01920"
                     /db_xref="GeneID:11498088"
     mRNA            complement(<465751..>466110)
                     /gene="NDAI0B01920"
                     /locus_tag="NDAI_0B01920"
                     /product="ribosomal protein S26"
                     /transcript_id="XM_003668422.1"
                     /db_xref="GeneID:11498088"
     CDS             complement(465751..466110)
                     /gene="NDAI0B01920"
                     /locus_tag="NDAI_0B01920"
                     /inference="similar to DNA sequence:INSDC:YER131W,YGL189C"
                     /note="similar to Saccharomyces cerevisiae RPS26B
                     (YER131W) and RPS26A (YGL189C); ancestral locus Anc_8.149"
                     /codon_start=1
                     /product="ribosomal protein S26"
                     /protein_id="XP_003668470.1"
                     /db_xref="GeneID:11498088"
                     /db_xref="GOA:G0W616"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:G0W616"
                     /translation="MPKKRASNGRNKKGRGHVNPVRCVNCSKCVPKDKAIKRMAIRNI
                     VEAAAVRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSRENRKNRAPPQRPR
                     FNRENKVSPADAAKKAL"
     gene            <468399..>469709
                     /gene="NDAI0B01930"
                     /locus_tag="NDAI_0B01930"
                     /db_xref="GeneID:11497489"
     mRNA            <468399..>469709
                     /gene="NDAI0B01930"
                     /locus_tag="NDAI_0B01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668423.1"
                     /db_xref="GeneID:11497489"
     CDS             468399..469709
                     /gene="NDAI0B01930"
                     /locus_tag="NDAI_0B01930"
                     /inference="similar to DNA sequence:INSDC:YER130C"
                     /note="similar to Saccharomyces cerevisiae YER130C;
                     ancestral locus Anc_8.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668471.1"
                     /db_xref="GeneID:11497489"
                     /db_xref="GOA:G0W617"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W617"
                     /translation="MEDDYQYLIIMVIILDILSMNTSTIKKKHETHPIDILTKSQDST
                     LLTNNVMKRHYLNKNGDLNDNNDGDVLMTERTEKNETPLSIDVMKLSINNDVLSSSND
                     IYEYNVNRNKPKISFESIDDFNRITYYGDYAREIVDLNYDNDFDNFDDDSNEMNDNDN
                     IDFPIIDDTLQTPKKKVIDYFKLSIFNNNTNSNKLLSTDVNEEMATNQQSNFKKKYFW
                     KKRNNKKGIIKNDDTDGSSDSIYFNDDSYEDRKGSPCLRDNNDIITEETDVSILINPS
                     KLIVNRDVEENMTSSDQDPSESLSSFDVSVSNSPSQLPLLSSNTNPFKIRTDSNKRHV
                     NEHHCEDKSAVSLEKYSARSHSDNKENINGTLPKTRGRKPSLIPDASKQFGCEYCERR
                     FKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIKTHG"
     gene            complement(<472594..>473604)
                     /gene="NDAI0B01940"
                     /locus_tag="NDAI_0B01940"
                     /db_xref="GeneID:11497490"
     mRNA            complement(<472594..>473604)
                     /gene="NDAI0B01940"
                     /locus_tag="NDAI_0B01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668424.1"
                     /db_xref="GeneID:11497490"
     CDS             complement(472594..473604)
                     /gene="NDAI0B01940"
                     /locus_tag="NDAI_0B01940"
                     /inference="similar to DNA sequence:INSDC:YPR013C"
                     /note="similar to Saccharomyces cerevisiae YPR013C;
                     ancestral locus Anc_8.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668472.1"
                     /db_xref="GeneID:11497490"
                     /db_xref="GOA:G0W618"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W618"
                     /translation="MSREPILPFTNYYQETKKLGSDRIVLPSIAALVSNIDSNVTKTE
                     PLQQHYQHLRTPDRYQYHHKSAEAPKLPAPLAYTHNPTTTTVLTPQPQYIAVSRPPQL
                     CSSAGMPYTFSMVQTPIVQVQAANKFYPQTIPVITQTPQTQWITANFYSTQNPPPPGT
                     LVGPAPRLSALEPLPINVAPRRPFIVTVPYHPLCSNTPSSTSSLSSSSIMSSPTLPTN
                     NYGVANFEENPNSIGCMYGDSSKLANIYRDPKIKNKKQCDICGKICSRPSTLKTHYLI
                     HSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEKKARLSGGVSKVIDKNKHKQRGKRHV
                     NK"
     gene            complement(<475984..>476721)
                     /gene="NDAI0B01950"
                     /locus_tag="NDAI_0B01950"
                     /db_xref="GeneID:11497491"
     mRNA            complement(<475984..>476721)
                     /gene="NDAI0B01950"
                     /locus_tag="NDAI_0B01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668425.1"
                     /db_xref="GeneID:11497491"
     CDS             complement(475984..476721)
                     /gene="NDAI0B01950"
                     /locus_tag="NDAI_0B01950"
                     /inference="similar to DNA sequence:INSDC:YPR016C"
                     /note="similar to Saccharomyces cerevisiae TIF6 (YPR016C);
                     ancestral locus Anc_8.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668473.1"
                     /db_xref="GeneID:11497491"
                     /db_xref="GOA:G0W619"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:G0W619"
                     /translation="MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGD
                     AIPIAHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGL
                     VHPQTTIQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDAHPDAISGNLRDTLIETYS"
     gene            complement(<477552..>478871)
                     /gene="NDAI0B01960"
                     /locus_tag="NDAI_0B01960"
                     /db_xref="GeneID:11497492"
     mRNA            complement(<477552..>478871)
                     /gene="NDAI0B01960"
                     /locus_tag="NDAI_0B01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668426.1"
                     /db_xref="GeneID:11497492"
     CDS             complement(477552..478871)
                     /gene="NDAI0B01960"
                     /locus_tag="NDAI_0B01960"
                     /inference="similar to DNA sequence:INSDC:YLR085C"
                     /note="similar to Saccharomyces cerevisiae ARP6 (YLR085C);
                     ancestral locus Anc_8.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668474.1"
                     /db_xref="GeneID:11497492"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:G0W620"
                     /translation="MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSN
                     QMKKIQEVSEVTLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVS
                     EPCMTLPELSKNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDD
                     DMIGQSENVTISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKK
                     LDIGGRFLTGLLKETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVE
                     YILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVET
                     ILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQRQLPTDWTCRISVPKKE
                     CELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDWLTKHKFGYQNWL"
     gene            <479208..>483455
                     /gene="NDAI0B01970"
                     /locus_tag="NDAI_0B01970"
                     /db_xref="GeneID:11497493"
     mRNA            <479208..>483455
                     /gene="NDAI0B01970"
                     /locus_tag="NDAI_0B01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668427.1"
                     /db_xref="GeneID:11497493"
     CDS             479208..483455
                     /gene="NDAI0B01970"
                     /locus_tag="NDAI_0B01970"
                     /inference="similar to DNA sequence:INSDC:YLR086W"
                     /note="similar to Saccharomyces cerevisiae SMC4 (YLR086W);
                     ancestral locus Anc_8.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668475.1"
                     /db_xref="GeneID:11497493"
                     /db_xref="GOA:G0W621"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W621"
                     /translation="MPESTNIPSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSA
                     VSLSPPAISKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRRD
                     IKVYSQSPPRSPGRSPTRKLELIQLSPVKNNRIRKLQELYNSQIKKERLFINKLVLNN
                     FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKS
                     ESFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSY
                     TEVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYK
                     SSIEKNTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKL
                     LQYNILKEHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIK
                     EDMKNNTSKKRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVD
                     QQERESNLQSLLSELKKEKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKK
                     LEIQVAESQISLLQENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTE
                     FDRGESECANAKSKIKDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRI
                     SGFYGRLGDLGVIDNEYDIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFIL
                     LEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYG
                     ATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELV
                     ERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQK
                     ITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISEKIDKLKKRIMEIGGIDLQ
                     MQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALSGAELDFKTCSKEMDSF
                     SQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEIEGTKFKSYEIDVKD
                     RLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSINGVDRTSHGGGVPL
                     QDQNKVVRENNMRNEKNSTEAEMEIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQ
                     LEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLLDELKKKRYDEFM
                     QGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGG
                     EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR
                     NNMFELAQQLIGIYKRDNKTKSAAIRNKDFLKEADIV"
     gene            complement(<483519..>492398)
                     /gene="NDAI0B01980"
                     /locus_tag="NDAI_0B01980"
                     /db_xref="GeneID:11497841"
     mRNA            complement(<483519..>492398)
                     /gene="NDAI0B01980"
                     /locus_tag="NDAI_0B01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668428.1"
                     /db_xref="GeneID:11497841"
     CDS             complement(483519..492398)
                     /gene="NDAI0B01980"
                     /locus_tag="NDAI_0B01980"
                     /inference="similar to DNA sequence:INSDC:YLR087C"
                     /note="similar to Saccharomyces cerevisiae CSF1 (YLR087C);
                     ancestral locus Anc_8.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668476.1"
                     /db_xref="GeneID:11497841"
                     /db_xref="GOA:G0W622"
                     /db_xref="InterPro:IPR029636"
                     /db_xref="UniProtKB/TrEMBL:G0W622"
                     /translation="MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTL
                     AYGISFILEWFLWKRSNVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWR
                     YWLLNVRKSGYDTPELPDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSK
                     EERNQFEKFLNEQVFTDSKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSE
                     RPQFLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFL
                     LDFKTFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNK
                     VSEEDPFYEKWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFE
                     CDIPGIVPHGAHPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIR
                     LLSPIASRNAKPTKRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRE
                     TNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLK
                     CKSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPY
                     ELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKRE
                     VSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDI
                     DNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQN
                     QFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEG
                     AILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYES
                     VRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGF
                     ITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEMDTFLLCTAEEL
                     YFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLSNFEKPNDIAT
                     HKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLPIPLLPATI
                     DYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFKTETS
                     GDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIGIVNHLS
                     DLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETKITEV
                     TFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADIT
                     IDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDP
                     YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPD
                     PGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVY
                     STGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKK
                     LLPELSMKKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWES
                     PKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQC
                     TDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLT
                     CYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYF
                     RFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQF
                     SSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKI
                     QGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIE
                     SPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFP
                     SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTS
                     DTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIE
                     SSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGV
                     FKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFA
                     KCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLL
                     SLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTS
                     FGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKP
                     MNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTW
                     FATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS
                     ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCS
                     TALVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDV
                     SVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALST
                     SKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCS
                     FGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFS
                     RFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEK
                     EYGSILGHSQAKNTN"
     gene            complement(<493160..>494926)
                     /gene="NDAI0B01990"
                     /locus_tag="NDAI_0B01990"
                     /db_xref="GeneID:11497842"
     mRNA            complement(<493160..>494926)
                     /gene="NDAI0B01990"
                     /locus_tag="NDAI_0B01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668429.1"
                     /db_xref="GeneID:11497842"
     CDS             complement(493160..494926)
                     /gene="NDAI0B01990"
                     /locus_tag="NDAI_0B01990"
                     /inference="similar to DNA sequence:INSDC:YDR111C,YLR089C"
                     /note="similar to Saccharomyces cerevisiae YDR111C and
                     YLR089C; ancestral locus Anc_8.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668477.1"
                     /db_xref="GeneID:11497842"
                     /db_xref="GOA:G0W623"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W623"
                     /translation="MSVASIITFRRSTSTAVTTNFANLKQLNKMATCTYSIKANVSNS
                     NSNNIKTINSNQVKKSPLIIKATTTAIPEYQFFDAKRALMTRSISHHSLKVAKGKDFA
                     PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQ
                     LKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYS
                     ASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIP
                     IPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINP
                     GNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHP
                     GKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQA
                     LVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYL
                     FPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLA
                     PGTEWIKKWEAFHKEFYDNYRD"
     gene            <497023..>498324
                     /gene="NDAI0B02000"
                     /locus_tag="NDAI_0B02000"
                     /db_xref="GeneID:11497843"
     mRNA            <497023..>498324
                     /gene="NDAI0B02000"
                     /locus_tag="NDAI_0B02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668430.1"
                     /db_xref="GeneID:11497843"
     CDS             497023..498324
                     /gene="NDAI0B02000"
                     /locus_tag="NDAI_0B02000"
                     /inference="similar to DNA sequence:INSDC:YLR090W"
                     /note="similar to Saccharomyces cerevisiae XDJ1 (YLR090W);
                     ancestral locus Anc_8.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668478.1"
                     /db_xref="GeneID:11497843"
                     /db_xref="GOA:G0W624"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0W624"
                     /translation="MADLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREEN
                     EIKFKEITSAYEILSDEEKRAHYDLYGDANENEYNNQNANDFFNFETDQPDYDSYAFD
                     NDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIEC
                     KKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSE
                     NKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTD
                     FVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQ
                     ASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTT
                     FDILEELPDTLNESNNRSAYDTGDQSDANYDREGPPQCSQQ"
     gene            <498932..>499777
                     /gene="NDAI0B02010"
                     /locus_tag="NDAI_0B02010"
                     /db_xref="GeneID:11497844"
     mRNA            <498932..>499777
                     /gene="NDAI0B02010"
                     /locus_tag="NDAI_0B02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668431.1"
                     /db_xref="GeneID:11497844"
     CDS             498932..499777
                     /gene="NDAI0B02010"
                     /locus_tag="NDAI_0B02010"
                     /inference="similar to DNA sequence:INSDC:YLR091W"
                     /note="similar to Saccharomyces cerevisiae YLR091W;
                     ancestral locus Anc_8.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668479.1"
                     /db_xref="GeneID:11497844"
                     /db_xref="UniProtKB/TrEMBL:G0W625"
                     /translation="MELLNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSF
                     KIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLT
                     FWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKI
                     YQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAI
                     TNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNEDDNNIEFQKSKKL
                     NWLNF"
     gene            <501062..>503779
                     /gene="NDAI0B02020"
                     /locus_tag="NDAI_0B02020"
                     /db_xref="GeneID:11497923"
     mRNA            <501062..>503779
                     /gene="NDAI0B02020"
                     /locus_tag="NDAI_0B02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668432.1"
                     /db_xref="GeneID:11497923"
     CDS             501062..503779
                     /gene="NDAI0B02020"
                     /locus_tag="NDAI_0B02020"
                     /inference="similar to DNA sequence:INSDC:YLR092W"
                     /note="similar to Saccharomyces cerevisiae SUL2 (YLR092W);
                     ancestral locus Anc_8.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668480.1"
                     /db_xref="GeneID:11497923"
                     /db_xref="GOA:G0W626"
                     /db_xref="InterPro:IPR001902"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:G0W626"
                     /translation="MNQTIPFQKNENNTNDIENQYELPSFPNSDTSSQNLADLELEYD
                     QYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPS
                     FEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFSSDLIAGITVG
                     CVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMSLETGKVIT
                     KVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTGFMTGSA
                     LNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYLWKWW
                     CGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKTKDER
                     PISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDYKV
                     VPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYC
                     LTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIE
                     NGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDYSSNSNLSLSA
                     DTINHNKKLKILHIPLLKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNPNV
                     IILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPG
                     EWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVD
                     ATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAG
                     HTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV"
     gene            complement(<504994..>505473)
                     /gene="NDAI0B02030"
                     /locus_tag="NDAI_0B02030"
                     /db_xref="GeneID:11497924"
     mRNA            complement(<504994..>505473)
                     /gene="NDAI0B02030"
                     /locus_tag="NDAI_0B02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668433.1"
                     /db_xref="GeneID:11497924"
     CDS             complement(504994..505473)
                     /gene="NDAI0B02030"
                     /locus_tag="NDAI_0B02030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668481.1"
                     /db_xref="GeneID:11497924"
                     /db_xref="UniProtKB/TrEMBL:G0W627"
                     /translation="MSEHTPTSTTINEREKAQLKGYLGGLFSDEPINDQLTLKRVTDH
                     FFIDLIVDHDFRLPVSANLDLNEGKPDEVIVERRQTFINHLIEQFEEQPEAKGILHGL
                     ITKYGEKFFTFYVVALFGIFREFFTTLDHKQLEKKPKRLDLEKSLSSFQDTYQANSK"
     gene            <505880..>506761
                     /gene="NDAI0B02040"
                     /locus_tag="NDAI_0B02040"
                     /db_xref="GeneID:11498570"
     mRNA            join(<505880..505895,506067..>506761)
                     /gene="NDAI0B02040"
                     /locus_tag="NDAI_0B02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668434.1"
                     /db_xref="GeneID:11498570"
     CDS             join(505880..505895,506067..506761)
                     /gene="NDAI0B02040"
                     /locus_tag="NDAI_0B02040"
                     /inference="similar to DNA sequence:INSDC:YLR093C"
                     /note="similar to Saccharomyces cerevisiae NYV1 (YLR093C);
                     ancestral locus Anc_8.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668482.1"
                     /db_xref="GeneID:11498570"
                     /db_xref="GOA:G0W628"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR019005"
                     /db_xref="UniProtKB/TrEMBL:G0W628"
                     /translation="MKRFNVSYVEVTKDGNTISSCYDSNDGNFGRNTYGSILNNSIPT
                     PDIFHKLIHDMVLPKVIPVIGNKVTKVSLDLIDGFDCYYTTDEDDKVLICFTQVDIPK
                     ILPIRLLSELKGEKKNNYSNNELGAHVGKILDEFHEELMSYKNDSGQEGDTTEDDIQD
                     IIKIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAARIKERMWWQRMKNTTLL
                     MFAIILTISALFIFFYVI"
     gene            complement(<508311..>510059)
                     /gene="NDAI0B02050"
                     /locus_tag="NDAI_0B02050"
                     /db_xref="GeneID:11498571"
     mRNA            complement(<508311..>510059)
                     /gene="NDAI0B02050"
                     /locus_tag="NDAI_0B02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668435.1"
                     /db_xref="GeneID:11498571"
     CDS             complement(508311..510059)
                     /gene="NDAI0B02050"
                     /locus_tag="NDAI_0B02050"
                     /inference="similar to DNA sequence:INSDC:YLR094C"
                     /note="similar to Saccharomyces cerevisiae GIS3 (YLR094C);
                     ancestral locus Anc_8.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668483.1"
                     /db_xref="GeneID:11498571"
                     /db_xref="UniProtKB/TrEMBL:G0W629"
                     /translation="MGLLFAPSNRFDTINNDETNEAWISSLFTPSSCGSYTVLKRPCS
                     TKKYQENISITSHTEKSRAPKKQPSLVYSGRRRRTGKSAFQNITKPINDSRTFERDQT
                     ISLNITPSMNSVLSQIKRHTSLYYLNDKSNAEDEYRKGTQDARKREDADDGVDNVPLP
                     CNSLKRYKDNISTLYLPSDEIDTHSDVSSITSSVLLREILQTDSNNWEVLRSESINQD
                     DDYNSSSNDHKGTSDQTQNLSLGYDGNSHPLCEPEILKEKENLHSTPRVKLLNMPDLD
                     FHDEWKIEDIIQTYKPVYEMGKEPTGKETDKYISTAIRIIKKDLRLNDRPALNKKEKN
                     IDLKMPYARQNNSLSSKFLRSTLKDNVIRDETQVELESWPTSIPLLKKEEEELREEVS
                     LLADKTHFLPNKRSRQQKMNPNFLKLYSIETSCRLKNILPEINIDDQVLKQLSYHDIK
                     TLPIKNQPKKTVNNHKEMGNESKYEDVSCHDIKMAIITKKKLWADMLHETREDLFGVS
                     SPWNLKFVAACNEQEDTKNTSTLVRVHSELKPWVNGNTTSTLLKPCGKLKIDRRFPSR
                     EIQYVVKGWCDSRFVI"
     gene            complement(<510602..>513349)
                     /gene="NDAI0B02060"
                     /locus_tag="NDAI_0B02060"
                     /db_xref="GeneID:11498572"
     mRNA            complement(<510602..>513349)
                     /gene="NDAI0B02060"
                     /locus_tag="NDAI_0B02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668436.1"
                     /db_xref="GeneID:11498572"
     CDS             complement(510602..513349)
                     /gene="NDAI0B02060"
                     /locus_tag="NDAI_0B02060"
                     /inference="similar to DNA sequence:INSDC:YLR095C"
                     /note="similar to Saccharomyces cerevisiae IOC2 (YLR095C);
                     ancestral locus Anc_8.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668484.1"
                     /db_xref="GeneID:11498572"
                     /db_xref="UniProtKB/TrEMBL:G0W630"
                     /translation="MKRTRTLRRNTGESTPTSSVTTFDKETSIKDDEEAPWKEYVDEH
                     TSALWSKIPRTALQSAQDFIVLNFPELFQSWHYHYVVAWLYNVCESYTTLSHQLEGSS
                     GPKFLWKNIKFDEFIFLHDLKKCASMTKDDDKSADFQDYASNRTQAVNKSTGNEDQES
                     DNLYLKIKHQLLRQLANNKNTELRNFNGIVELNLKNSVYKDQMSTLLSMDFDLLPLHD
                     KFTIFFYMIKIIEMKNMVFKNYMANNMHLFEFPRYIVDDTTSILALPNNGVLIQEKVT
                     KKKLVPKLDIPLKLKNCTIRNGASESVDLIHVDYSQEINAYLSSIDIEFKILTYNWDT
                     FLQYWGMHEKKKRGNKDIAHFVEDLIPVYVDHQVYSSKLIQQREKEKSMAELVTRRKR
                     SSRLVAREEESKKKEIEHDWYEKLDERDHFNKHRTRMVNTQKKKLQTIIWNQLWQLFE
                     EDLKLEKIKRRNTPDIQMHPISSIAYRTQSEYEGLNPVDIEVLEVGSRFNSRLIDIKP
                     RSSVTFTFEKDPNYIHELPDEYCIHERDLEQINSYGLETDISAPDNKDWIFQCSCEED
                     PVNPTVVSVVEDLVDPNLINKPLICCDVCFKWQHWDCQSKTTINFISLAAQNNNIVTT
                     GKKKDKKQQQTDMPLNVLSQRDFGIALLGEPEIYTGRNRRSTRQQHGDNVVTKEEQHT
                     TMRPTDKRKPFGSCSIFVCGWCLAKLETEMRDSFVPELKALRISKKNKHDDRERRKRA
                     KEEKRRQEELTTMHANPLDQKHPDIDAAASHVDQPVNLLANHSLTSNDGSNTEQPTNF
                     DNIKNNNTAVTSVPNAVKNQGPIRSLLKDGVLASGTQRVIAQLNEGYNFAAQDEGTSI
                     PPVSASLHTLPVVNGENNGKAPSIPSSSISSGAPAPVPGAPAASSVSQRDESSLSSPT
                     F"
     gene            <514024..>517800
                     /gene="NDAI0B02070"
                     /locus_tag="NDAI_0B02070"
                     /db_xref="GeneID:11498573"
     mRNA            <514024..>517800
                     /gene="NDAI0B02070"
                     /locus_tag="NDAI_0B02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668437.1"
                     /db_xref="GeneID:11498573"
     CDS             514024..517800
                     /gene="NDAI0B02070"
                     /locus_tag="NDAI_0B02070"
                     /inference="similar to DNA sequence:INSDC:YDR122W,YLR096W"
                     /note="similar to Saccharomyces cerevisiae KIN1 (YDR122W)
                     and KIN2 (YLR096W); ancestral locus Anc_8.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668485.1"
                     /db_xref="GeneID:11498573"
                     /db_xref="GOA:G0W631"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:G0W631"
                     /translation="MENPNLENPDYHINGQFKMTGPADLGPPIFKNNANPQPGTVAPA
                     TLRMMGRQHNNTTNHQYQPSPMEQKTHDPNLYQPHQGQNPLMPPFSVPSSNSRSQKGT
                     NIVNTSNTNYNNNKNNDENINATTALSGNIHDITTARNSNRNTAPIISNETKQFHRRS
                     LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEI
                     AERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL
                     DYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGL
                     SNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDEN
                     SSVLHEKIRQGKVEYPNHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGYDFPP
                     LSYLPRRIPLTPEAIDNNVLREMFRLEFIDDVEECQNSLIKIITEEPYLERSRGFWQL
                     VVKSPSNSSNINGSSVIGNQNVGFKNPFDDPTQAYHPLLSIYHLVHEMLTRKAAKLQR
                     KQAAIAAHQLQILQKQSQANNLEQAADIKSNWARQETIDPMPQTLRNNIPSIDNDIDP
                     SKVQKPKSYIPRNYSPSEKPLRVIVPPKLSVPEQAHTSPTSRKSSDYHNNFVATIATP
                     QSPSVQKDYQQRSNVTSCPSDQEDKNKSFGGLFRKLSQRRRDQVPQQQQQYLHPSEGE
                     YAQTNQNSIKSFDYQQKIPPHIEVPQIQIQNMNQQRSLKTHSRTVSEYMPSPPKMPLY
                     YNYNKQDTEKTATSTAPVRSMSQKKKATMPALPSNAETLVQEQRERQLSKGTDGTLND
                     QNTDKANQLADRQDAGRQNVDADENVPLPPLHVTKGRKFHPSARAKSVGHARRESLKF
                     TRPPVPQSVYPRDVEDNGFLEYSDDNRSDSRDGKTTEQREDSKKNITSNVETVKTIPE
                     CTTETSKDEMTDEEILAAASQAPVGSMPSIDFPRSLFLKGFFSVQTTSSKPLPIVRYK
                     IISVLNKMHIDFKEVKGGFVCIQRSGNSVEASSPKETQASPSRVSSKTTSIDEQLEQQ
                     PQRVTLNPDSQLSPRGTSISRHTSISRQGSISRYGQPNYAVTPLASNNHERTTSIGGT
                     SAFSGRHNRNGSINLRNNSDELSTTSLEYTQQQQEDDMLSTTKIQEMNKVDSDNALNT
                     NTPDKTKARVPLKFEIHIVKVRIVGLAGVHFKKVSGNTWLYKELASDILKELNL"
     gene            <520660..>521481
                     /gene="NDAI0B02080"
                     /locus_tag="NDAI_0B02080"
                     /db_xref="GeneID:11498116"
     mRNA            <520660..>521481
                     /gene="NDAI0B02080"
                     /locus_tag="NDAI_0B02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668438.1"
                     /db_xref="GeneID:11498116"
     CDS             520660..521481
                     /gene="NDAI0B02080"
                     /locus_tag="NDAI_0B02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668486.1"
                     /db_xref="GeneID:11498116"
                     /db_xref="GOA:G0W632"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W632"
                     /translation="MLSAEPMMQYSVSKTIPLLETSYVCLPHIMEVTQQRIQFKNATE
                     ASTQVRSGHIEQSSLVTKYNSHPSPIDVKLPPISALISNAYVNRYSCFGNDSRCDTFH
                     KDEAALLTPSYVDANQKSSGVSFQKKNIGLPFDVISNNVRDTIQDLYRDVLEKELPKV
                     AETKNQVLFSSAKPIMDLNGQSNTSPHRNSSKINSPGKAILKAKVRLRKQCSVCGKVC
                     SRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSHERRRNKKTCLAK"
     gene            <522219..>522584
                     /gene="NDAI0B02090"
                     /locus_tag="NDAI_0B02090"
                     /db_xref="GeneID:11498117"
     mRNA            join(<522219..522251,522393..>522584)
                     /gene="NDAI0B02090"
                     /locus_tag="NDAI_0B02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668439.1"
                     /db_xref="GeneID:11498117"
     CDS             join(522219..522251,522393..522584)
                     /gene="NDAI0B02090"
                     /locus_tag="NDAI_0B02090"
                     /inference="similar to DNA sequence:INSDC:YPR010C-A"
                     /note="similar to Saccharomyces cerevisiae YPR010C-A;
                     ancestral locus Anc_8.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668487.1"
                     /db_xref="GeneID:11498117"
                     /db_xref="UniProtKB/TrEMBL:G0W633"
                     /translation="MRPSQYLLNAAKKASGTKVPLELTPLFMAVGVALMSGTWFTYKK
                     LTYDDSLRIIHNPDQSSLEEVLAEADKEKK"
     gene            <523268..>524863
                     /gene="NDAI0B02100"
                     /locus_tag="NDAI_0B02100"
                     /db_xref="GeneID:11498118"
     mRNA            <523268..>524863
                     /gene="NDAI0B02100"
                     /locus_tag="NDAI_0B02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668440.1"
                     /db_xref="GeneID:11498118"
     CDS             523268..524863
                     /gene="NDAI0B02100"
                     /locus_tag="NDAI_0B02100"
                     /inference="similar to DNA sequence:INSDC:YPR002W"
                     /note="similar to Saccharomyces cerevisiae PDH1 (YPR002W);
                     ancestral locus Anc_8.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668488.1"
                     /db_xref="GeneID:11498118"
                     /db_xref="GOA:G0W634"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="InterPro:IPR012705"
                     /db_xref="UniProtKB/TrEMBL:G0W634"
                     /translation="MLRFSTKFQYSSTTCSYISKLVTFSSVRGNIKQYTTEASNTAPK
                     LTNNRPEPDKVLQDIAHYVHNISIDSQLAKDTAKLCLLDTLGCGLAALKYPHVQDIIK
                     PIVPGTVIPNGTKVFGTNYVTDPVRGAFVVGTLIRWLDFNDCWLAKEWGHPSDNLGGI
                     LPVADYMTRLYRASNGKEGKVFSVDDILECMIKAHEIQGIIALDNSLNEVGLDHVALV
                     KIATTAVVSKMLQLSEEQTIEAVSHAFVDGQPLRTYRHAPNTGSRKSWAAGDAVSRAV
                     NLAFMVKNAGIGTIHSVLTARKWGVYDVLFNGKPFIFDQKKEYGSYVMENVLFKISFP
                     AEFHAQTAVEAGMKAHRVLLDNGRTYKDIKSVRIRTQQPAIDIIDKVGPLYNYADRDH
                     CIQYMTTIPLIYGRLEADDYMDAVALLADIDVLRNKIYCIKDAEFTKDYYNPEKRSIA
                     NALLVELNDGTFLDEIVVEYPIGHKFRREEGIPLLLKKFRNHLSTYSHYSPGKADEIY
                     RLSMSPEFGEMAIDHYIDQYCIT"
     gene            <525331..>527871
                     /gene="NDAI0B02110"
                     /locus_tag="NDAI_0B02110"
                     /db_xref="GeneID:11498119"
     mRNA            <525331..>527871
                     /gene="NDAI0B02110"
                     /locus_tag="NDAI_0B02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668441.1"
                     /db_xref="GeneID:11498119"
     CDS             525331..527871
                     /gene="NDAI0B02110"
                     /locus_tag="NDAI_0B02110"
                     /inference="similar to DNA sequence:INSDC:YFR002W"
                     /note="similar to Saccharomyces cerevisiae NIC96
                     (YFR002W); ancestral locus Anc_8.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668489.1"
                     /db_xref="GeneID:11498119"
                     /db_xref="GOA:G0W635"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:G0W635"
                     /translation="MSNSIANGNTTLESSTKGSAKIFNDLVESSKNLPATSSQLGSIQ
                     LSVNEIKRRAIELRKKKNIDNTLTKAHYLLAGSGLAIEDVDSSLKNLQKNELSERKLT
                     SKYVGNEIDTYLRVKKGENILASIEQLLADASRDFDDYVNQSLELDWTKRKDEIRETF
                     GIFVPGKSENNSFVNKPLSPLDRVSPTWGNSGIGILNGGDSRLNVNSNLITREKFETY
                     AKIIHQFNNHRQENRQFPLNREVISILSHAGDTRNRQLLESWKIIESIKDPKNTIKAS
                     REYLEVQFLDYVDALSKNAISEGLPTNTNKVRSFIDTKLKNTDGSWKIANLTVINGLP
                     IWASIFYLLRAGLMQEALDLAMTNSSGFKKIEQSFLTYFQAYISSPENKLPTEFATKL
                     HTEFNQHIKNSLNGDPYRLAVYKIIGRCDLTRRNISLVTLSLEDWIWYHLKLIKEDVI
                     DDGPIYEKYHLEDFQNIILSYGPSRFTNYYIPVLILSGLYEVAIDYAYNLNEMDAVHL
                     AIGLANKKLLHITTNISDTLIAIEDGRRKVNFAKLLGNYTKSFKFSDPRIATEYLILI
                     AITDDPAEIKICHEALRELVLDTKEFGILLGKINRDGTRIPGVLEERQDLLYLNDEKE
                     FLRVITEQAAHKADEDGRTQDSLLLYQLAEEYDIVMSIVNGLLGSLLGGSDLTQPLFT
                     KDDNSETNPVLLASKLISIYNNNLEIAKKIHAKNKETCLLLLQIADIRKSYAENQWQY
                     ALGQIEKLDLLPFTDGQDARRKAQAFSGFDEPIVKCIPSLLIMTLTCVSKLVNVLNQS
                     DYKSVTKSQQIEFLKNISKNCIVYAGIIQFKMPRETYSTLIRLDVELC"
     gene            complement(<528111..>528587)
                     /gene="NDAI0B02120"
                     /locus_tag="NDAI_0B02120"
                     /db_xref="GeneID:11498120"
     mRNA            complement(<528111..>528587)
                     /gene="NDAI0B02120"
                     /locus_tag="NDAI_0B02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668442.1"
                     /db_xref="GeneID:11498120"
     CDS             complement(528111..528587)
                     /gene="NDAI0B02120"
                     /locus_tag="NDAI_0B02120"
                     /inference="similar to DNA sequence:INSDC:YFR003C"
                     /note="similar to Saccharomyces cerevisiae YPI1 (YFR003C);
                     ancestral locus Anc_8.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668490.1"
                     /db_xref="GeneID:11498120"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:G0W636"
                     /translation="MPQNLDGSQQEPRGAATVTLEEVPSVLQLHTSEPSINRRIERTS
                     HQSTRPSVRWEEGTVDNENLNRKKTKICCIFHPQEEIDEDGEGRYSDHEHPPPSPSSS
                     SSSSSSSSESDNDNRLNPEDRRQRRIERRRRKLNKERSVSPNAYEVQPDYSQHRQK"
     gene            <529263..>530183
                     /gene="NDAI0B02130"
                     /locus_tag="NDAI_0B02130"
                     /db_xref="GeneID:11497986"
     mRNA            <529263..>530183
                     /gene="NDAI0B02130"
                     /locus_tag="NDAI_0B02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668443.1"
                     /db_xref="GeneID:11497986"
     CDS             529263..530183
                     /gene="NDAI0B02130"
                     /locus_tag="NDAI_0B02130"
                     /inference="similar to DNA sequence:INSDC:YFR004W"
                     /note="similar to Saccharomyces cerevisiae RPN11
                     (YFR004W); ancestral locus Anc_8.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668491.1"
                     /db_xref="GeneID:11497986"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:G0W637"
                     /translation="MERLQRLMMEGKSNVADPEKDDTRETVYISSVALLKMLKHGRAG
                     VPMEVMGLMLGEFVDDYTIDVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRTE
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNPRAVAVVVDPIQSVKGKVVIDAFRLID
                     TGALLNNQEPRQTTSNSGLMNKANIQALIHGLNRHYYSLNVDYHRTSDETRMLMNLHK
                     EQWQSGLKACDYEEKETTNLEATQKMVKIAAQYSKRIEEEKDLTEAQQATRYVGKQDP
                     KKHLSAMAETTLEDNIVSVLTSSVNSVAIV"
     gene            complement(<530278..>531594)
                     /gene="NDAI0B02140"
                     /locus_tag="NDAI_0B02140"
                     /db_xref="GeneID:11497987"
     mRNA            complement(<530278..>531594)
                     /gene="NDAI0B02140"
                     /locus_tag="NDAI_0B02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668444.1"
                     /db_xref="GeneID:11497987"
     CDS             complement(530278..531594)
                     /gene="NDAI0B02140"
                     /locus_tag="NDAI_0B02140"
                     /inference="similar to DNA sequence:INSDC:YFR005C"
                     /note="similar to Saccharomyces cerevisiae SAD1 (YFR005C);
                     ancestral locus Anc_8.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668492.1"
                     /db_xref="GeneID:11497987"
                     /db_xref="GOA:G0W638"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0W638"
                     /translation="MQKLKRRSSRSNIREESSKKIKQNLSDESKRRLLQTVNLHKLDF
                     GLEKICSVTLSKLNVYCCLVCGKYFQGHNEKSPAFLHSINNNHNLFFNLYTSDFIKLP
                     DAILIEGDHEPLLESIKAAFFPKYSHEEIVAFPKKCKDLNKRLYVNGFVRVTNSSSLD
                     HLNVILLLLSHVTPLRDWLLLSDVSAESTFVQGLSNIVRKIWSPYLFKNHVSADEFAD
                     FLTVQNLINKLRNDPADLLIWMLNFMAFDSKALKRILHESCQGKINFNTRKTSQILPF
                     WKLSLDLPVNSILKEGQNANNLHHVDLHDLLRKFTSKGNSNSKNYSLEKLPHFLVLHY
                     NRFDFKSEYPVKNRNQILVQYPSVLKLKEVEYVLQANVVHYVKRNPNISKRQLAQDDV
                     SNWKIQLCNELTKKWIEIDANQTTNKDAELLFLNETYLQVWKRTNP"
     gene            <531982..>533565
                     /gene="NDAI0B02150"
                     /locus_tag="NDAI_0B02150"
                     /db_xref="GeneID:11497988"
     mRNA            <531982..>533565
                     /gene="NDAI0B02150"
                     /locus_tag="NDAI_0B02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668445.1"
                     /db_xref="GeneID:11497988"
     CDS             531982..533565
                     /gene="NDAI0B02150"
                     /locus_tag="NDAI_0B02150"
                     /inference="similar to DNA sequence:INSDC:YFR006W"
                     /note="similar to Saccharomyces cerevisiae YFR006W;
                     ancestral locus Anc_8.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668493.1"
                     /db_xref="GeneID:11497988"
                     /db_xref="GOA:G0W639"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G0W639"
                     /translation="MRTFLSLVFIATILLLFDYIRKYNRRKEPITKNYDLKMRMEDTS
                     EIQNLVSGENLPASLEGKKYPSKAHNEKVKKIFQSVNLDLPVNSAVFIAGNEVEPIKY
                     CDISHPFRQERYFYYLSGVDVPGSSILFNMKSNKLTLFLPLVDDDDVMWSGMPMGINE
                     ALNTFDVDEVLYADKINEVFEKELTGFKVFTTDLDNIHDNSIKEKLVSGDKRFFKALD
                     EARLTKDSYEIEVLRHAAKITDNCHLAVISALPIELNEYQVQAEFEYHAGRQNAHALG
                     YDPICCSGPACGTLHYVKNSEALHGKVSFLIDAGAEWKNYTTDVTRCFPISGKFTKEH
                     REIYDAVLDMQTQTMQNIRPGASWDELHLLSHKVLIKHLLKIGIFRKEFSAEEIFRRR
                     VTCVFYPHGLGHLMGLDVHDVAGNPNYEDPDPYFKYLRLRRTLEENMVLTDEPGCYFN
                     EFLIKELLEKYPERLEVVDRDILNKYMYIGGVRIEDDILVTKAGFENLTGITSDPDEI
                     ETIVQKSLSKRRSDFHVIV"
     gene            complement(<535325..>536758)
                     /gene="NDAI0B02160"
                     /locus_tag="NDAI_0B02160"
                     /db_xref="GeneID:11497989"
     mRNA            complement(<535325..>536758)
                     /gene="NDAI0B02160"
                     /locus_tag="NDAI_0B02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668446.1"
                     /db_xref="GeneID:11497989"
     CDS             complement(535325..536758)
                     /gene="NDAI0B02160"
                     /locus_tag="NDAI_0B02160"
                     /inference="similar to DNA sequence:INSDC:YPR001W"
                     /note="similar to Saccharomyces cerevisiae CIT3 (YPR001W);
                     ancestral locus Anc_8.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668494.1"
                     /db_xref="GeneID:11497989"
                     /db_xref="GOA:G0W640"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:G0W640"
                     /translation="MLRTSSFIRHFFSTRTACSVPRKSLKETLKELIPERKEKFLKLK
                     KNYHNVEIGRITIGSVTTGMRGNKSIFWEGSTVDPNKGITFHGKTIGECQQQLPGDEF
                     GYFHPEAILWYLMTKQIPTSQQVQHLTEELAERGSPKNFPELTSKIIDMLPPDTHPMT
                     QLAIGLASLSRNSKFASNYQRGLISKDHYWEDTLEDSLNLISFLPILTAKIYSKLVNG
                     GKPLGEFSVKNDWTLNICSLLGMSNGVHSSNHCNLNNEQSKDFLSLMRLYTGIHVDHE
                     GGNVSAHATHLVNSALSDPYLSYSSGIMGLAGPLHGLAAQEVVRFLVEMNSRISSPQN
                     TGEIEEYLWNILNSKKVIPGYGHAVLRIPDPRFTTMLKFAQSRTTEFENDENVILMQK
                     LSTVVPDILKEHGKCKNPFPNVDSASGILFHHFGIKDLLFFTVIFGCSRSIGPLTQLV
                     WDRIYGLPIERPKSISLTTMQNLCYQS"
     gap             537388..537407
                     /estimated_length=20
     gene            complement(<537936..>538655)
                     /gene="NDAI0B02170"
                     /locus_tag="NDAI_0B02170"
                     /db_xref="GeneID:11497990"
     mRNA            complement(<537936..>538655)
                     /gene="NDAI0B02170"
                     /locus_tag="NDAI_0B02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668447.1"
                     /db_xref="GeneID:11497990"
     CDS             complement(537936..538655)
                     /gene="NDAI0B02170"
                     /locus_tag="NDAI_0B02170"
                     /inference="similar to DNA sequence:INSDC:YFR001W"
                     /note="similar to Saccharomyces cerevisiae LOC1 (YFR001W);
                     ancestral locus Anc_8.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668495.1"
                     /db_xref="GeneID:11497990"
                     /db_xref="UniProtKB/TrEMBL:G0W641"
                     /translation="MALPFIIKHNRVSIQVIGYFLSLISYHKMVPKKYSKNNKQQSVR
                     REVAPEIFQDSQARNQLASQEKLTERSTRRKVSKLQVSKEQARARLYGTKNKKNQINE
                     KDLDIPTLNRAIIPGVKIKRGKKGKKFIADNDSVTLDRLIKTIGDKYDDLTESKLEKA
                     RRLEEIRDLKRKEIERKESAKQDKLEEKKGEIKKKASVARSLRRKNKRDSVKSSISDR
                     ANNAASDEDNKKKKRKSVSFA"
     gene            complement(<539822..>541036)
                     /gene="NDAI0B02180"
                     /locus_tag="NDAI_0B02180"
                     /db_xref="GeneID:11497991"
     mRNA            complement(<539822..>541036)
                     /gene="NDAI0B02180"
                     /locus_tag="NDAI_0B02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668448.1"
                     /db_xref="GeneID:11497991"
     CDS             complement(539822..541036)
                     /gene="NDAI0B02180"
                     /locus_tag="NDAI_0B02180"
                     /inference="similar to DNA sequence:INSDC:YPL001W"
                     /note="similar to Saccharomyces cerevisiae HAT1 (YPL001W);
                     ancestral locus Anc_8.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668496.1"
                     /db_xref="GeneID:11497991"
                     /db_xref="GOA:G0W642"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:G0W642"
                     /translation="MELTDFKPSTWISSSKDSLKISLVSKDGAVQFAPIFTYPIFGDA
                     EQIVGYQDLLVHLAFDSITFRPFLNVKYSTKLDTEDIDDVEGELLKVLPSDKDEVILK
                     DEAKWVDMFEFEQKNSFKLPEDKYKVNEYEIDKEHFVVYKMKLSDDEKFLKLHRRIQI
                     FSLFFIEAASYIDEEDFNWDIYWLFNKEKKQCMGYATAYMYWKYLGGKDFDESKEPKH
                     YRAKVSQFLILPPYQGKGHGSKLYQAIFKNWLSNDLVREFTVEDPSENFDDLRDRNDL
                     NFLYENGFFQELSSKIVNEKDFISNEWLLSKQRAYKIEKRQFGRLVEMIMYKENLVNA
                     FRHQVKRRLYLKNYDTLSEMTEAERKDALQKSYLTIKEDYERITCSSKFKKRHAEEIE
                     GLDSKKPKPEGA"
     gene            <541533..>542234
                     /gene="NDAI0B02190"
                     /locus_tag="NDAI_0B02190"
                     /db_xref="GeneID:11497963"
     mRNA            <541533..>542234
                     /gene="NDAI0B02190"
                     /locus_tag="NDAI_0B02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668449.1"
                     /db_xref="GeneID:11497963"
     CDS             541533..542234
                     /gene="NDAI0B02190"
                     /locus_tag="NDAI_0B02190"
                     /inference="similar to DNA sequence:INSDC:YPL002C"
                     /note="similar to Saccharomyces cerevisiae SNF8 (YPL002C);
                     ancestral locus Anc_8.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668497.1"
                     /db_xref="GeneID:11497963"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016689"
                     /db_xref="UniProtKB/TrEMBL:G0W643"
                     /translation="MRQFGLAQFDDKQREKYEDISSNILQKQTLELRDQLKIFQDRLT
                     IFANKHNEELRENPEFRLKFTRMCSSIGINPLSLFDKDKHLFTVNDFYYEICVKVIEI
                     CRQTKDMNGGVISFDELEKCFKHLRVGRPDLEKAINMLLALDGGFEVFEIRQKKFIRS
                     VPNELTDDQTKILEICSILGYATASLLKANLNWTNVRSKAVIDGMVANGLLWVDKQAG
                     SETYYWDPSWMARIN"
     gene            complement(<542402..>543721)
                     /gene="NDAI0B02200"
                     /locus_tag="NDAI_0B02200"
                     /db_xref="GeneID:11497964"
     mRNA            complement(<542402..>543721)
                     /gene="NDAI0B02200"
                     /locus_tag="NDAI_0B02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668450.1"
                     /db_xref="GeneID:11497964"
     CDS             complement(542402..543721)
                     /gene="NDAI0B02200"
                     /locus_tag="NDAI_0B02200"
                     /inference="similar to DNA sequence:INSDC:YFL001W"
                     /note="similar to Saccharomyces cerevisiae DEG1 (YFL001W);
                     ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668498.1"
                     /db_xref="GeneID:11497964"
                     /db_xref="GOA:G0W644"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G0W644"
                     /translation="MSFLFNLFKSGNRSVTNSNQAVALENTHYVKWTKEQLIKRVLEL
                     ESIQNEGLSIPHKKRKVDISTVTKKKKKEFDFSKHNSRFIALKFAYLGWNYNGLAMQK
                     EATPLPTVEGKIIEAMYTSKLVPSMVPQEYSFSRCGRTDKGVSAMSQVISLKVRSNLT
                     DEEQKRPENDPREIRYVHILNQLLPDDIRVSAVCLRPPEGFDARFSCDSRHYKYLFEA
                     DGLDISKMKEASSKYEGDHDFRNFCKLDGSKQITNHRRTIISAKILHVEGNIYCFDLV
                     GRAFLWHQVRCMMANLLLVGQGLEEVSLIEDMLDIEKTPQKPIYDMADDLPLLLYDCK
                     FPEMEWIESNLNNYDAVKYGKAVNALALHYQLKATIVNIFKNTLPTAETDFKTKTRIN
                     LGDGKGKVVTKYEKMKDREVMHSVETINSKYLKRKKAKAKIKKEELV"
     gene            complement(544124..544178)
                     /gene="NDAI0Btrna8F"
                     /locus_tag="NDAI_0Btrna8F"
                     /db_xref="GeneID:11497789"
     tRNA            complement(join(544124..544160,544124..544178))
                     /gene="NDAI0Btrna8F"
                     /locus_tag="NDAI_0Btrna8F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11497789"
     gene            complement(<546721..>548841)
                     /gene="NDAI0B02210"
                     /locus_tag="NDAI_0B02210"
                     /db_xref="GeneID:11498588"
     mRNA            complement(<546721..>548841)
                     /gene="NDAI0B02210"
                     /locus_tag="NDAI_0B02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668451.1"
                     /db_xref="GeneID:11498588"
     CDS             complement(546721..548841)
                     /gene="NDAI0B02210"
                     /locus_tag="NDAI_0B02210"
                     /inference="similar to DNA sequence:INSDC:YPR003C"
                     /note="similar to Saccharomyces cerevisiae YPR003C;
                     ancestral locus Anc_8.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668499.1"
                     /db_xref="GeneID:11498588"
                     /db_xref="GOA:G0W645"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="UniProtKB/TrEMBL:G0W645"
                     /translation="MQPSRRFCDTNGSSDSAEAISQHNEDGLVYNQEDVQDRIAINNR
                     SILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHV
                     EPLSGLYSLAITPFIYAIFGSVPQMIVGPESAISLVVGQAVEPMVNHDERISTISISI
                     VVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLAT
                     SPEHYHTPFEKILFLIKYGQHNYHAPTAILSLYSFIILMLMKVMKKRLMKRFKWVIFV
                     PEILIVIVGTIMFSFHFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLLDAG
                     IVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSK
                     INALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDL
                     KFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHSAQSRIQILAKRK
                     GDNRFSNADELGIFDGENNNNNTFFEPLLEDLDEDRLVVKIPEPLTFTNTEDLKERLS
                     RLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTYIDASAAQILLEIILAYNRRQVFV
                     FFVRVPMRREVRQRFERSGLNKIIVTKSPSATNTGQNLFPELSPYFEDITDALAYIES
                     MKSPVMTDDQESFYSNRLINSAIV"
     gene            complement(<551075..>552130)
                     /gene="NDAI0B02220"
                     /locus_tag="NDAI_0B02220"
                     /db_xref="GeneID:11497966"
     mRNA            complement(<551075..>552130)
                     /gene="NDAI0B02220"
                     /locus_tag="NDAI_0B02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668452.1"
                     /db_xref="GeneID:11497966"
     CDS             complement(551075..552130)
                     /gene="NDAI0B02220"
                     /locus_tag="NDAI_0B02220"
                     /inference="similar to DNA sequence:INSDC:YPR004C"
                     /note="similar to Saccharomyces cerevisiae YPR004C;
                     ancestral locus Anc_8.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668500.1"
                     /db_xref="GeneID:11497966"
                     /db_xref="GOA:G0W646"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G0W646"
                     /translation="MMLFLRTLPGIRGHTITLGKIRFSSTLAFIEATRDGKVSIPSMS
                     AIHAAQKLKNPITAIIIGSHAPGIAKQLQSSSTDLGLQEILVAEDATLNTYLPEVVTP
                     LLQNVLGTVDKYTHFVMANSSIGKNIIPRLAAVLNYQAICDVTEILDATTFKRPIYAG
                     NAIATIGSQQKLNMITVRPSSFSITKQVQKNMISPNIPIKQVQTSEVNDDIKWESDAL
                     LDNDKRPDLTSAKTVITGGVSLKDKEHFESLLDPLANTLNAAVGATRAAVDGGFCDNS
                     LQIGQTGKIVAPDLYVAIGVSGAIQHLAGMKGSKVVVAINKDADAPIFKVADYGLQGD
                     LFDIVPELTEKLQEMQS"
     gene            <553057..>555798
                     /gene="NDAI0B02230"
                     /locus_tag="NDAI_0B02230"
                     /db_xref="GeneID:11497967"
     mRNA            <553057..>555798
                     /gene="NDAI0B02230"
                     /locus_tag="NDAI_0B02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668453.1"
                     /db_xref="GeneID:11497967"
     CDS             553057..555798
                     /gene="NDAI0B02230"
                     /locus_tag="NDAI_0B02230"
                     /inference="similar to DNA sequence:INSDC:YER167W"
                     /note="similar to Saccharomyces cerevisiae BCK2 (YER167W);
                     ancestral locus Anc_8.232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668501.1"
                     /db_xref="GeneID:11497967"
                     /db_xref="UniProtKB/TrEMBL:G0W647"
                     /translation="MPRGDRDHTVNKVPTKSPDMESTNKWKIPHYYRRSHVHSPTQYS
                     NPNGSLNSFNGSPNINIMTSPKKLLIEEPQRVKTKSRKSKRKDGQVVFVNYTVLDTEK
                     KATMNTDIEKDIPLAEQHQILKRKSSKNSVLQIFKSSSKNLRNSSNRASLKLVKDKNL
                     HNNNTPAVNLSEVGTLINKSGGPSTASAKVKDTTKSLSAKRSYGSFLKHTKLVPNCNQ
                     VAKSYITETLDNQWEGDLEVVPKSLPNPSLAKPSNNNNRDKLTPLKVANIPLFTARHK
                     ATSKSKMPSKVEQMKSENNQVVNNHFFDDNTYTTEAVVHASYNTFPTDTDGYKLREEN
                     DASVAFSKLFTRKRANTSGAPSSFLNSTCNPNTNQGHNTITRGNTCNNQKQHTANRRI
                     NRSSSSSAIAQRTMSIASLSSLSNRYSPNRIISPGRPRSSTRSSSSYRMSRDLGSLYG
                     TASNIPELALENEGNQFLDNQYIANYSQVTNNDNNLNNSMFNHKKNQESISDIHQIYS
                     AGTVASTPSSSFVTPPYFGQALQSSTSAVSTPSCVESTNYHSGTLRPNNNPYGNNDSS
                     SNLPRTRSNHTNSNSVSTRKADQESDNFFSEFSSITTPTGSIYPTWEMQRIEAAIPKQ
                     NPKYYENLPKNGYMHRTTSQGYNSNSNNIDRKTNGIERFDGLHSQSKTYHDARKSTSS
                     AVDSLMTNSIGSTASSITPRMNSQDGEKYFLVNTGIASKEINLNHFNKPITENNETSV
                     QATNNNRNDTNNLDNNMDPLSQLYTEFDFENPNSFFHEQSCIMNSTTSNADTLMQNGE
                     NTKNDETISSLGLGTSSIISPNSTVQRPFNNLTTTTTNNDSSLPMNGNLGYNSQYNST
                     EGLDMVNLNDNNAIFDIQSMLLLSELGDNYMTGTKVSNSNDHINDDKIGLPFDNNNS"
     gene            complement(<556005..>557993)
                     /gene="NDAI0B02240"
                     /locus_tag="NDAI_0B02240"
                     /db_xref="GeneID:11497981"
     mRNA            complement(<556005..>557993)
                     /gene="NDAI0B02240"
                     /locus_tag="NDAI_0B02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668454.1"
                     /db_xref="GeneID:11497981"
     CDS             complement(556005..557993)
                     /gene="NDAI0B02240"
                     /locus_tag="NDAI_0B02240"
                     /inference="similar to DNA sequence:INSDC:YER168C"
                     /note="similar to Saccharomyces cerevisiae CCA1 (YER168C);
                     ancestral locus Anc_8.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668502.1"
                     /db_xref="GeneID:11497981"
                     /db_xref="GOA:G0W648"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:G0W648"
                     /translation="MFRRSLLSSSSILISSPALAVLYLQASSSSSSINSLKKYSKKYL
                     NRNQPTEIVSSKMSNNNGITIGNGNLMELSSSSSSSAPVETPIETPIPSTPLSNLTYE
                     NLHSSHNDNERFTLSPTINLTPIEKNICKLLNDYTLHYNELHKHTTVEPLTLRITGGW
                     VRDKLLGQSSHDLDIAINIMSGESFAMGLNDFLNKHYQRYGIKPHSIHKIDKNPAKSK
                     HLETATTKLFGVEVDFVNLRAEEYTELSRIPIMTKFGTPLEDALRRDATLNALFYNIQ
                     KNKIEDFTQMGLKDLKMGILRTPLPPRKTFLDDPLRVLRLIRFASRFNFKIDEKVQKE
                     MNDHEINVAFNSKISRERIGVEMEKILNGPNPLLGLDLIQKNHLDNVIFFWHNDENVI
                     KFNKENLDKNDLLQITKIYDQGILNNHLKNLIRNFQEFVSIPLIKSTINEFFTENSDS
                     SLKQNFILASSLTPFANLKIIALPKKKLNNTITVSESIIKEGLKLSKNDAKIVSQVID
                     LLKDYQGMIKKFVNASSSSTLKTKEQKLKRSEVGMFLKILNGHWQLIHFVSLLNEYLN
                     LLKENNQYKNQLLINSLFNKYESFYAFIFNENLQNSHEIKPLVDGKKLLTLLKMKPGP
                     WLGKINNASIIWQFDNPDGNETQLVEYIKGILQQQGQL"
     gene            <559530..>563000
                     /gene="NDAI0B02250"
                     /locus_tag="NDAI_0B02250"
                     /db_xref="GeneID:11497982"
     mRNA            <559530..>563000
                     /gene="NDAI0B02250"
                     /locus_tag="NDAI_0B02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668455.1"
                     /db_xref="GeneID:11497982"
     CDS             559530..563000
                     /gene="NDAI0B02250"
                     /locus_tag="NDAI_0B02250"
                     /inference="similar to DNA sequence:INSDC:YDR096W,YER169W"
                     /note="similar to Saccharomyces cerevisiae GIS1 (YDR096W)
                     and RPH1 (YER169W); ancestral locus Anc_8.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668503.1"
                     /db_xref="GeneID:11497982"
                     /db_xref="GOA:G0W649"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W649"
                     /translation="MLDTILPSYVPAEVEDGVPVFKPSFEEFKDFYKYVDSIKSYGMQ
                     SGIIKIIPPNEWLKGQINSSNPPDPSLLANIKIKSPIQQEISGNHGIFLAQNYEKKKT
                     YNMIQWKSLSKNYKLPDYPHHSHSYLSSISSASTFSSSSNVKKEDEEKKHKEKEKENR
                     EQVDTSTTPHAIANFKLDDFKKFIQNDNYNEDNLDQFNDKERLKFLENYYWKTLNFTP
                     TLYGADTLGSLFPENLNIWNVSKLPNLLDYLDKDIPGVNDSFLYAGLWKASFPWHLED
                     QDLYSINYIHFGAPKQWYSIPQEDNTKFYKFMKEQFPDESKSCSEFLRHKVFMASPKI
                     LTNNGIKVNKIVHYQHEFMITFPYGYHSGFNYGYNLAESVNFALEDWLEIGSHSKKCL
                     CVNDSVEIDVDKLASNWYSYKKSATPITINSTATNTNTDTHSSNTNQVYQSNDTRTRS
                     FTELLNHSSQELQNIQKQDINSIDMNINDPMNVITINNNNSVRNNNNIMQDSQHSSLR
                     STSPNLGQYYNPLRPGSSRISSPFLSKMMDLSNIVEPTLEDPALKFRKKVLRQQQQQQ
                     LLQKQQQTDTAPSSSSSSAFPPQSQPQYNQTLSSNNTINTQSTNLPPISLPPLNTPNT
                     NNLFDENEDNMIALSLANMANSRTSSPRLTLQTMDPANVSINNGNSISNNNNNNNTND
                     NNGSHNTNTLIASILSPIPSYSDTKNGNTNIGHSNILNTDNKNISPSSSLYSYHNSIF
                     PPPTFNNNTNTINSNNNTFSNLNGYNNYNTTHTFLSNNNNNNINNSNPIPLSFQSHMG
                     NSFQQRQQQQQMNGPPPMSPRANIAFMKRMKSPNIVTLNISRETSKSPLLPNPTLQAN
                     ANTDNDFKSPLNIDDDNSTNNNILSYLGKGQTSSLSEIEHKNNKHNKRAIPKGKAKPK
                     NGYNNGRSTSDLTSLNQPATKRQKSNNNTSRMTTLTSSQRKKGERESTISPSPSSQTE
                     EQTGQSQQPPKFTEDEIIMSENGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCP
                     KCGKKFKRRDHVLQHLNKKIPCVPDAYSNSTESQMRIQIQLQQQNSNPADNNNTNGDV
                     LGTDRAVASVSEAATAINSSTDNNSNKSNNNNNDDDDDDKNKAPSKTDVNNEGKDISS
                     SNIEPDIKRE"
     gene            <563789..>564514
                     /gene="NDAI0B02260"
                     /locus_tag="NDAI_0B02260"
                     /db_xref="GeneID:11497983"
     mRNA            <563789..>564514
                     /gene="NDAI0B02260"
                     /locus_tag="NDAI_0B02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668456.1"
                     /db_xref="GeneID:11497983"
     CDS             563789..564514
                     /gene="NDAI0B02260"
                     /locus_tag="NDAI_0B02260"
                     /inference="similar to DNA sequence:INSDC:YER170W"
                     /note="similar to Saccharomyces cerevisiae ADK2 (YER170W);
                     ancestral locus Anc_8.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668504.1"
                     /db_xref="GeneID:11497983"
                     /db_xref="GOA:G0W650"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028586"
                     /db_xref="UniProtKB/TrEMBL:G0W650"
                     /translation="MRDKVASIATPIRLVLLGPPGSGKGTQTKKLMNLIPQFDHISSG
                     ELLRQQINANTKLGQIASKYIHEGKLIPDDLITKLLTNRLFNPLSPNSNNSNSKWILD
                     GFPRTIIQAEHLDRTLLQNQTMLDLVVELNVPDSIILGRIEERYIHPSSGRVYNLKYN
                     PPKVPGRDDVTGERLVKRVDDTLAAFKERIKTYHETADPLKEYYDKQGVLSTLSGETS
                     DIIFPKLVSLLNSKFGLKLETSS"
     gene            <564974..>567289
                     /gene="NDAI0B02270"
                     /locus_tag="NDAI_0B02270"
                     /db_xref="GeneID:11497984"
     mRNA            <564974..>567289
                     /gene="NDAI0B02270"
                     /locus_tag="NDAI_0B02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668457.1"
                     /db_xref="GeneID:11497984"
     CDS             564974..567289
                     /gene="NDAI0B02270"
                     /locus_tag="NDAI_0B02270"
                     /inference="similar to DNA sequence:INSDC:YER171W"
                     /note="similar to Saccharomyces cerevisiae RAD3 (YER171W);
                     ancestral locus Anc_8.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668505.1"
                     /db_xref="GeneID:11497984"
                     /db_xref="GOA:G0W651"
                     /db_xref="InterPro:IPR001945"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W651"
                     /translation="MKFYIDDLPVLFPYPKIYPEQYHYMCDLKKTLDAGGNSILEMPS
                     GTGKTVSLLSLTISYQMHYPEHRKIIYCSRTMSEIEKALVELENLMAYRAKELGHVET
                     FRGLGLTSRKNLCLHPVVSKERKGSVVDEKCRRMTNGIAKRKLEQDPNADAELCEYHE
                     NLYKMEVDEYLPNGVFSFEKLIKYCEERTICPYFVVRRMISMCNIMIYSYHYLLDPKI
                     AERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTNDVLRRATKGAHALEEKIDDVRK
                     IDSQRLQDEYDKLVEGLHSSDIVPEQEEPFVETPVLSKDLLKEAIPGNIRRAEHFVSF
                     LKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIDRKPLRFCSERLSLLVRTLEVND
                     VEDFNSLKDIATFATLISTYEDGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVF
                     EKFSSVIITSGTISPLDMYPRMLNFETVLQKSYSMTLAKKSFLPMIVTKGSDQVAISS
                     RFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKH
                     KLILVETPDAQETSLALETYRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIG
                     IPFQYTESRILKARLEFLRENYQIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLA
                     DRRFSRKRTQLPKWIAQGLSDADLNLSTDMAISNAKQFLRTMAQPTDPKDQEGVSVWS
                     FEDLTKHQNEKKKKSQPIEVLGEEDEDIEME"
     gene            complement(<567453..>574025)
                     /gene="NDAI0B02280"
                     /locus_tag="NDAI_0B02280"
                     /db_xref="GeneID:11497985"
     mRNA            complement(<567453..>574025)
                     /gene="NDAI0B02280"
                     /locus_tag="NDAI_0B02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668458.1"
                     /db_xref="GeneID:11497985"
     CDS             complement(567453..574025)
                     /gene="NDAI0B02280"
                     /locus_tag="NDAI_0B02280"
                     /inference="similar to DNA sequence:INSDC:YER172C"
                     /note="similar to Saccharomyces cerevisiae BRR2 (YER172C);
                     ancestral locus Anc_8.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668506.1"
                     /db_xref="GeneID:11497985"
                     /db_xref="GOA:G0W652"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W652"
                     /translation="MGMENGRTTDDASDKQKIKEIYRYDEMSNKVLKADKRFQISTYD
                     PVKDAEKSHPKSLSGRISLKDMGTNLTHDLLDEEKEEAMKNVKRQQEKATIITQTKVN
                     NNNNLLLNRQRQNESTLLDLDSVSPLKYYPSTNENLAHYDDVIQWVIDLLGNDIPHDI
                     ISDTADVLICSLKENDDELDGFIDKKRIELQNDIGFDIEPSKFIELVKITKNITDFNK
                     DEEREEEIITENGVNDRDNIINVLANADDDSEGEEADEEDQKLLDQVISEEEGEEEAE
                     EEENGKKQPMNNKNLKNKSLLPTDNEDIVIMKGESSTFMNEDIQIYAVDESFLKRKLW
                     QVLDTQDISLISNTQSQIIDELMNTEYDTTPLNINLTKILGEDHASFINYIIRNRLPI
                     IWGYRLSQSSEENATKLFEEMTANGLEDLVQQYKSRKANVSKRRLEDNVKTGTKKTKK
                     SMEDNILDLATLKFDQGSKLMTVSKVLLPEGSFKRVKPHYDEIHIPAPSKPTIDYDLI
                     PISSLPQWARKSFPAGETDSLNPIQSKVFPAAFKNDYNILLCAPTGAGKTNVALLAIL
                     RNLSHHYNEQTGKLNLNHFKVVYIAPLKALVQEQVREFQRRLGYLGIKVSELTGDTRL
                     NRREISETHILVSTPEKWDIITRKVEDTSFVEEVRLIIIDEVHLLHDARGPVIESIVA
                     RTLWSQQLRERPRIVALSATLPNYKDVGKFLRVPADGLFYFDSSFRPCPLSQQFCGIK
                     EQNAVKRLSAMNQACYDKVLESVSEGHQVIVFVHSRKDTARTAKWLKNQFTESDNINK
                     IIKSDTSSVEILKRESETVQDLSLKSILTSGIGIHHAGLTRADRSLSEDLFADGLLQV
                     LVSTATLAWGVNLPAHTVIIKGTEVYSPEKGIWEQLSPQDILQMLGRAGRPRYDTHGE
                     GIIITNQQDVQYYLAVLNQQLPIESQFISRLIDNLNAEIVFGSVKNMNDALTWISYTY
                     LYVRMLVSPDLYKVQKADGDDDLKEFRRLLLNSALQTLNKQGLIIYDMGNDTMKSTEL
                     GRIASYFYIKHTSIDVYNNELSEHSSQFDIFRIFALSDEFKYISIRQEERRELKELFE
                     KVPIPIRETIDEPQAKTNILLQSYISRLRFDGFALRADMIFIQQNAGRLLRAMYELCL
                     RQGWSRSTKILLNLCKSVERRLWYTNSPLRQFPNCPQEVIKRTESSTLPWNDYLNLES
                     PAAVGRAIRSERNGKHVYDLIKRFPKVSAKCSIQPLTPSLLRIDLEIIPDWVWDKNLH
                     GNSEPFLVMVEDIDGNGILYYESVFITPDLISQEYVVDFSIQLTPAQQKRLPPNFFVN
                     VISEKWLHCHYQIAAILDDVRLPKKFPAPTELVNTELIPVSDLENEGFNEVFDFTNFN
                     RIQSSMFNGVYNSNDNILICTAEETNRIISVELAILNHWRQNKGRALFICPSQEKIDY
                     LLDKWQKKLSNIAGGKNINKLDVDLTLNLRIIARNHLILTTPEQFNLVSRRWRQRKNI
                     QKIELFICDGIDQIGNGIPGALYESAISRILFMSTQLEKEVRIIATSTPLANARDLAE
                     WIDVKKEGIFNYSPEVRVDPVEIHIQSFDGTSRQSYTPSMLKTVFDIALKTFSAHYTS
                     LVFVAGLEECKSVCSQLLTWSQLTEWDLLNTNVEQIDSYLSKVHDSWIKRSLMHGIGV
                     MYKGMQPKDRKVVQKLYDYGALSFLLVSKECHLCCPKSNQVFILGTSYFDGHAHRYIN
                     YTLYEILGMVSSVGKRALVDSGKAIILTDSNRKNYYRKFLVEPLPVESFIYYHLHDIL
                     LSEIGNNIIQDKQHCIDWMTYSYFYRRIHANPSFYGVKDISSFGISAYLTELIENVMK
                     DLVESSMIDISEDRNKLKASEDETDEVISPLNGCLISSHNDVYFVTMDTFIKKLSKTS
                     TLQDILETLSSATEFEQIRIRKNDYSNLVRLSKKLPLTFSLDATMNITSFKVFTLLQA
                     HFSRIPLEPEFKEDLRYILTKSLQLVNSIIDILSGEGCLNATTAMDISQMIVQAIWDV
                     DNPLRQIPFFDDNILAKCAEKKVETVYDIMSLEDDERMEIMMMENKKLVRVANFVNSY
                     PNVALLYSPLNNSKIAIEQLISITVKLTRDDEPESLEVITEQYPFKKLENWWLVIGEV
                     SKRELYAIKKVSLSKESQEYDLEFSLSSSGNHELTIWCVCDSYLDADKEVSFKLEVIE
                     "
     gene            <574340..>576586
                     /gene="NDAI0B02290"
                     /locus_tag="NDAI_0B02290"
                     /db_xref="GeneID:11497968"
     mRNA            <574340..>576586
                     /gene="NDAI0B02290"
                     /locus_tag="NDAI_0B02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668459.1"
                     /db_xref="GeneID:11497968"
     CDS             574340..576586
                     /gene="NDAI0B02290"
                     /locus_tag="NDAI_0B02290"
                     /inference="similar to DNA sequence:INSDC:YER173W"
                     /note="similar to Saccharomyces cerevisiae RAD24
                     (YER173W); ancestral locus Anc_8.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668507.1"
                     /db_xref="GeneID:11497968"
                     /db_xref="GOA:G0W653"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004582"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W653"
                     /translation="MGSQQLNNNNNTQPPPPLRHFSLSSLSSQINKWGSTSRSTSPVK
                     KRLLSPSPPSSSSMSKKRKKKQVELQCQDSTTVEKEEDEADDYIPWYKKYEPASLDEV
                     VVHKQKLKDVKDVFESMLHSHISNDDADGYPRILLLTGPSGSSKSTLIKQLAKELIPK
                     YRNTNGLNSSGTISLMGKTRKPMEDVETNDIIEYSNDLLLNGMKTMDAFREFLNQCKY
                     KCGNNLSVILIEDLPNVFHAETRYIFQKSLLEWLYSSDIKLPPLVICLTECEIERDNS
                     YSSFTTSSFNIDSTFTAETVLGREILSHPRLKRIKFNSINRTLMKSHLMKLCEVNKEL
                     LIKNDKWKDRIRFIKDLISSNSTTGTGGNGDIRSGIASLEMWARSKSKTDDTSLLIDS
                     TRESSISYFHGIGRIIYGSKDYKDDNEMINDLILNMKGMVGNDTFKLGLLENYGTFNK
                     NKFDIKLASEIINSLSEGDTMNDVELFEYTLRKIRFEFHKMKKNDDSSYHHGKANFPR
                     EWKIRRLMNEFKIESEDFINVSLYKYNEVHQMNDIIYQYGYYGPFIRRIRNYKKKVLM
                     HCLKNNGSSEMIKNMMDTLSVDDNIDLLRRIGGDIKVIDTEHYLISEDDTESQTRKSL
                     DYLLRQRDYKLQKLIHMKEHNELKASHDGVDTRDDDTDRIDEKEKEEEEELLLNDRIE
                     DSDSDETDIEVDFHRSNNAADDDADDDDDDESFYEMLSQKAPRTNHTSNIQHINDESL
                     SDSDIENL"
     gene            complement(<576792..>577691)
                     /gene="NDAI0B02300"
                     /locus_tag="NDAI_0B02300"
                     /db_xref="GeneID:11497969"
     mRNA            complement(<576792..>577691)
                     /gene="NDAI0B02300"
                     /locus_tag="NDAI_0B02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668460.1"
                     /db_xref="GeneID:11497969"
     CDS             complement(576792..577691)
                     /gene="NDAI0B02300"
                     /locus_tag="NDAI_0B02300"
                     /inference="similar to DNA sequence:INSDC:YDR098C,YER174C"
                     /note="similar to Saccharomyces cerevisiae GRX3 (YDR098C)
                     and GRX4 (YER174C); ancestral locus Anc_8.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668508.1"
                     /db_xref="GeneID:11497969"
                     /db_xref="GOA:G0W654"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G0W654"
                     /translation="MPALQITTNEQFTQLTEASSPPDNKLIVLYFYTKWAEPCHSTNE
                     LFDALNDEFRNENALFLAIDADINNDIISNLNVSIVPYFIFIQNGKLLEQLSGEDPKK
                     FVQILDQYLCISSTLSLSNLSLSNNNNNIYEYDSDNSADSNNSKYTIDSDYTSEDDIK
                     HTKHFHNHMHHVDTQHLMNEDEFNLKLSKLVQAAPVMLFLKGTPSEPKCGYSRQMVKI
                     LRANKIRFGFFNVLSDNNVRINMKKFSDWPTFPQLYINGEFQGGLDIIKETLLDDPDY
                     FFHTLQSSPTGGGTINPQIPSSL"
     gene            complement(<578747..>579727)
                     /gene="NDAI0B02310"
                     /locus_tag="NDAI_0B02310"
                     /db_xref="GeneID:11497970"
     mRNA            complement(<578747..>579727)
                     /gene="NDAI0B02310"
                     /locus_tag="NDAI_0B02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668461.1"
                     /db_xref="GeneID:11497970"
     CDS             complement(578747..579727)
                     /gene="NDAI0B02310"
                     /locus_tag="NDAI_0B02310"
                     /inference="similar to DNA sequence:INSDC:YER175C"
                     /note="similar to Saccharomyces cerevisiae TMT1 (YER175C);
                     ancestral locus Anc_8.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668509.1"
                     /db_xref="GeneID:11497970"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W655"
                     /translation="MSTFSSKDFNVGEYFKSRPQYPEEFYKFLQRYFHSDTVNDNDDD
                     DDDDDDDDDDDDDXXXXXXXXLDVGCGTGIATFQMFKQLPEYKRIIGSDLSSSMIKQA
                     NNLLKTNINDIKENDRELAFHVSSCYDFEFLQGVKCDMITAVECAHWFNFNKFQCLVY
                     DNLRNDKSVFAIWGYADPIFLDYPEFDKLMVELPYGEDQLGPYWEQPGRSILRDSLRG
                     LHLDVDLFQDIREEYFNAADLRKGNNIEDDNCNFPLTICKEMSIEEFSRYTKTFSAYH
                     SWKHDAKNAKKKDVCDQFIAELLKIHPEFTLGTKVKVVWNSFYKVGKKKL"
     gap             579535..579554
                     /estimated_length=20
     gene            <581329..>584886
                     /gene="NDAI0B02320"
                     /locus_tag="NDAI_0B02320"
                     /db_xref="GeneID:11497971"
     mRNA            <581329..>584886
                     /gene="NDAI0B02320"
                     /locus_tag="NDAI_0B02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668462.1"
                     /db_xref="GeneID:11497971"
     CDS             581329..584886
                     /gene="NDAI0B02320"
                     /locus_tag="NDAI_0B02320"
                     /inference="similar to DNA sequence:INSDC:YER176W"
                     /note="similar to Saccharomyces cerevisiae ECM32
                     (YER176W); ancestral locus Anc_8.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668510.1"
                     /db_xref="GeneID:11497971"
                     /db_xref="GOA:G0W656"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W656"
                     /translation="MTKFQCTTCQETLDAESMMKHLNSTRHKTVKSIEDDEELNCEEC
                     QDNNNIHQLQIIRIGGEDIILICNSCVEKKFNINEKPKTSYSLSNGAILKYWDNYTKV
                     RDCSCKRCGNESNLNVNLTNKQLILCDNCLKDDPKQDSSKFVSEKTGKFLYTFLGIKE
                     TSSSSSSKFKRKGGGRKIGRGKKRGRGGAKSASSSSAGKKKEKKPLTFLQKLDKEALK
                     TKKLNSTIESGSNLSLKSFKGFKATTKSDFAAQFLAPSNENVASVASTGNFLSLGNTN
                     SSKSSSPSPIIQHPAQRTNTRQKPNQKQTKSNPTSRAITPDISTKGSKHKGPKVTDKK
                     NAKQPTTITSMPTNPQNKNSNTTKSTGWAQGFEAPKKVKNMPKSILEPTVQNTKNAKK
                     KTSKAVEKTKQISKKHVNQKGHTESNPKPVVPIDEDFWSSGWDNALPEKEGVTASISS
                     PQPTRIKQNGNQKKELIPIPSNKEKGQNRKNQNTRSNKNNTKEKTPIPPIQHKKERNP
                     KGKSPTPSYTNEVLEEGVPIKKFVKYTPKLTYPDLRTYCDEFSYALFLEQKLENDFIQ
                     NFDITWSKDKNETVFVVSLDRHNNPEIEKLIPPALAQVVKVPFNERQPLMLSSHDESL
                     VWYSFIKEVGLQKNKIVLLLELFSWNKLSLPTRSGSDQFKLLPISAQANRILFAMTRI
                     KNPKFIDLLLGLKPIKQLIFNNKLKFNRSTLNDSQKLAVQHVLNNSITVIQGPPGTGK
                     TSTIEEIILQLIENFHSFPILCVAASNIAIDNIAEKIMESRPNIKILRILSDKKESQY
                     GPDHPLGKICLHNKIYERLSPEMKDIANKFRFGRRDEVSKNQDNKYYQEKTSITNKLV
                     AQTQIIFTTNITAGGRQLKVIKELPVVIMDESTQSSEASTLVPLSLPGIKKFVFVGDE
                     KQLSSFSNIPHLEMSLFERILANGTYEQPHMLDTQYRMHPQISKFPIHKFYYGELKDG
                     VTAEQKQLPNIKHPLFFYQSNNGYESTVENRQNGIKAFTYNNKYECQDILKILYKLIL
                     EKNVKHEEIGIITPYSAQRDLLSELLVADPVVNPYGRSMEQETDEAEFLNSKHTLGND
                     IQSHTVNIINGLHVATVDSFQGHEKNFIIFSCVRNNPENKIGFLRDRRRLNVALTRSK
                     NGLILVGNKEVLKKGDNLWRDFMVFLEKEKVIFDSLDDY"
     gene            <585975..>586781
                     /gene="NDAI0B02330"
                     /locus_tag="NDAI_0B02330"
                     /db_xref="GeneID:11497972"
     mRNA            <585975..>586781
                     /gene="NDAI0B02330"
                     /locus_tag="NDAI_0B02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668463.1"
                     /db_xref="GeneID:11497972"
     CDS             585975..586781
                     /gene="NDAI0B02330"
                     /locus_tag="NDAI_0B02330"
                     /inference="similar to DNA sequence:INSDC:YDR099W,YER177W"
                     /note="similar to Saccharomyces cerevisiae BMH2 (YDR099W)
                     and BMH1 (YER177W); ancestral locus Anc_8.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668511.1"
                     /db_xref="GeneID:11497972"
                     /db_xref="GOA:G0W657"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:G0W657"
                     /translation="MSASREDSVYLAKLAEQAERYEEMVENMKDVASSGQELSVEERN
                     LLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISADI
                     LSVLDSHLIPSASTGESKVFYYKMKGDYHRYLAEFSSGDVRENATTSSLEAYKKASEI
                     ATTDLPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKD
                     STLIMQLLRDNLTLWTSDMSEAGQEEEQQQQQQAQQQQQDAQANEDQPPK"
     gene            <587643..>589010
                     /gene="NDAI0B02340"
                     /locus_tag="NDAI_0B02340"
                     /db_xref="GeneID:11497973"
     mRNA            <587643..>589010
                     /gene="NDAI0B02340"
                     /locus_tag="NDAI_0B02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668464.1"
                     /db_xref="GeneID:11497973"
     CDS             587643..589010
                     /gene="NDAI0B02340"
                     /locus_tag="NDAI_0B02340"
                     /inference="similar to DNA sequence:INSDC:YER178W"
                     /note="similar to Saccharomyces cerevisiae PDA1 (YER178W);
                     ancestral locus Anc_8.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668512.1"
                     /db_xref="GeneID:11497973"
                     /db_xref="GOA:G0W658"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR017597"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0W658"
                     /translation="MRSWTSRIRPSLINKGRLFSASIPITQSSSSIMLKTTYNQYTRR
                     TMASTTNADESTATSEQQQQDQPEQEENESIEQDQEQQSSKDKVTINLSENSFEGYML
                     DIPNLSFETNKSTLLQMYKDMIIIRRMEMACDALYKAKKIRGFCHLSVGQEAIAVGIE
                     NAITKLDSVITSYRCHGFTFMRGASVKAVLAELMGRRAGVSFGKGGSMHLYAPGFYGG
                     NGIVGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLFNLPVVFC
                     CENNKYGMGTSASRSSAMTEYFKRGQYIPGIKVNGMDILAVYQASRFAKDWCLSGKGP
                     LLLEYETYRYGGHSMSDPGTTYRTRDEIQHMRSKNDPIAGLKMHLLELDIATDEEIKA
                     YDKSARKYVDEQVELADAAAAPEPKLSILFEDVYVKGTETPTLRGRIQEDTWDFKKQD
                     FAFRN"
     gene            <589423..>590508
                     /gene="NDAI0B02350"
                     /locus_tag="NDAI_0B02350"
                     /db_xref="GeneID:11496207"
     mRNA            <589423..>590508
                     /gene="NDAI0B02350"
                     /locus_tag="NDAI_0B02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668465.1"
                     /db_xref="GeneID:11496207"
     CDS             589423..590508
                     /gene="NDAI0B02350"
                     /locus_tag="NDAI_0B02350"
                     /inference="similar to DNA sequence:INSDC:YER179W"
                     /note="similar to Saccharomyces cerevisiae DMC1 (YER179W);
                     ancestral locus Anc_8.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668513.1"
                     /db_xref="GeneID:11496207"
                     /db_xref="GOA:G0W659"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011940"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W659"
                     /translation="MSATTEIEESDLDKTVISVDELQNHGINASDLQKLKTGGIFTVN
                     VCIPIIFFSSLVVFDIKLTRAIAITNRPYYLLQEDIYCKIKGLSEVKVEKIKEAANKI
                     IKVGFIPATVQLDIRQKVFALSTGSKQLDSILGGGIMSMSITEVFGEFRCGKTQMSHT
                     LCVTSQLPREMGGAEGKVAYIDTEGTFRPERIKQIAQNYDLDPDSCLENVSYARALNS
                     EHQMELVEQLGEALSSGEYRLVIMDSIMANFRVDYTGRGELNERQQKLNQHLFRLNRM
                     AEEFNVAVFMTNQVQSDPGASALFASADGRKPVGGHVLAHASATRILLRKGRGDERVA
                     KLQDSPDMPERECVYVIGEKGITDSNE"
     gene            complement(<590746..>591576)
                     /gene="NDAI0B02360"
                     /locus_tag="NDAI_0B02360"
                     /db_xref="GeneID:11496208"
     mRNA            complement(<590746..>591576)
                     /gene="NDAI0B02360"
                     /locus_tag="NDAI_0B02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668466.1"
                     /db_xref="GeneID:11496208"
     CDS             complement(590746..591576)
                     /gene="NDAI0B02360"
                     /locus_tag="NDAI_0B02360"
                     /inference="similar to DNA sequence:INSDC:YER180C"
                     /note="similar to Saccharomyces cerevisiae ISC10
                     (YER180C); ancestral locus Anc_8.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668514.1"
                     /db_xref="GeneID:11496208"
                     /db_xref="UniProtKB/TrEMBL:G0W660"
                     /translation="MNFLINQDGNELHDMNHYENENQRCSVVPTSKTSKIRSQVDSSF
                     KLITLKKNTERLFKYLEEENREPNVKPQPNQNLSLRRTRYNYTFPNYQQNSSIRKLSI
                     PKNDSGLTSIINVIAESKKTNNNLNSIHEVVHRTYDCAPFFHAYNYENRLGKDDYTGI
                     LKNIIDDEFKECYPVFPRELEFRRVEKKLRRIDYFLYYFLNIDRTKFFELEEERSLFY
                     NSSITAHTSSLAYMDTEEQQNEDDILDNDDTLSSISSMLNTENANNHGRNVSGNNLSV
                     "
     gene            complement(592349..592422)
                     /gene="NDAI0Btrna12I"
                     /locus_tag="NDAI_0Btrna12I"
                     /db_xref="GeneID:11496209"
     tRNA            complement(592349..592422)
                     /gene="NDAI0Btrna12I"
                     /locus_tag="NDAI_0Btrna12I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11496209"
     gene            complement(<593012..>595180)
                     /gene="NDAI0B02370"
                     /locus_tag="NDAI_0B02370"
                     /db_xref="GeneID:11497641"
     mRNA            complement(<593012..>595180)
                     /gene="NDAI0B02370"
                     /locus_tag="NDAI_0B02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668467.1"
                     /db_xref="GeneID:11497641"
     CDS             complement(593012..595180)
                     /gene="NDAI0B02370"
                     /locus_tag="NDAI_0B02370"
                     /inference="similar to DNA sequence:INSDC:YDR107C,YLR083C"
                     /note="similar to Saccharomyces cerevisiae YDR107C and
                     EMP70 (YLR083C); ancestral locus Anc_8.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668515.1"
                     /db_xref="GeneID:11497641"
                     /db_xref="GOA:G0W661"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:G0W661"
                     /translation="MLHQGQEERYMSLKTSIRTAHLFEVVPKIETNYSYCIDYHTSIL
                     YLPFKLRKTMIAPSLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYF
                     QHKNEDGKTMKSDKERFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQ
                     INMLQDKTCVSLCKTTIPGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFY
                     GTGFELGFVDVVQGTTTGDNANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANH
                     FDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSV
                     KFIPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARY
                     NELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFL
                     SPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGI
                     VALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQ
                     IARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFL
                     LTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTI
                     VLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE"
     gene            complement(<595444..>599103)
                     /gene="NDAI0B02380"
                     /locus_tag="NDAI_0B02380"
                     /db_xref="GeneID:11496210"
     mRNA            complement(<595444..>599103)
                     /gene="NDAI0B02380"
                     /locus_tag="NDAI_0B02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668468.1"
                     /db_xref="GeneID:11496210"
     CDS             complement(595444..599103)
                     /gene="NDAI0B02380"
                     /locus_tag="NDAI_0B02380"
                     /inference="similar to DNA sequence:INSDC:YLR084C"
                     /note="similar to Saccharomyces cerevisiae RAX2 (YLR084C);
                     ancestral locus Anc_8.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668516.1"
                     /db_xref="GeneID:11496210"
                     /db_xref="InterPro:IPR024982"
                     /db_xref="UniProtKB/TrEMBL:G0W662"
                     /translation="MLFSWVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASN
                     DDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIA
                     KITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVY
                     FGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFAGEF
                     YTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTTE
                     ESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDP
                     ISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQ
                     ISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNSIESSSSSSLSAND
                     WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIV
                     NVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATV
                     VADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTDVKITNTSL
                     NQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSNEASLTGNTAG
                     FSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTELLVI
                     DNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGNN
                     FTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYM
                     VYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHNSTLIV
                     GGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNI
                     SSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQSN
                     FNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPY
                     YIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPH
                     HQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNED
                     EMLETVPPEKLMKFL"
     gene            complement(<599601..>601472)
                     /gene="NDAI0B02390"
                     /locus_tag="NDAI_0B02390"
                     /db_xref="GeneID:11496211"
     mRNA            complement(<599601..>601472)
                     /gene="NDAI0B02390"
                     /locus_tag="NDAI_0B02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668469.1"
                     /db_xref="GeneID:11496211"
     CDS             complement(599601..601472)
                     /gene="NDAI0B02390"
                     /locus_tag="NDAI_0B02390"
                     /inference="similar to DNA sequence:INSDC:YGR013W"
                     /note="similar to Saccharomyces cerevisiae SNU71
                     (YGR013W); ancestral locus Anc_4.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668517.1"
                     /db_xref="GeneID:11496211"
                     /db_xref="GOA:G0W663"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="UniProtKB/TrEMBL:G0W663"
                     /translation="MSEIIYVSPQLYLISQKDWKSEASKKGFIPILKNDLASFQNNLN
                     SIKNGILLTTSTKNDRSNHNTNGITSNVIGGKETGQLSDNNSTPSLYQPLKQFLPISL
                     KQQLFTISLKGIPSTLLPKNIERFLKDLVLLAGGKEFVLECWSNVLFPGLDAQDLFIR
                     FNKEQEDNFVKVIQCWKGLLKASQDDTEERLDVQLHYDSNTSKFIKDHAVKLESDAEL
                     LKLCDKFKELLSWLKEKSISDKKILNENDLENYDSESALQYKIDMNTLGDLPRSSLDQ
                     LCKDIIEFRTKVVRNENEKRVKESLEESRRRKQQMLKTFAQIKRTKDKNPTSLENQSM
                     NEEDEAEDDVDLNTNEGDKTLDLTLENQRLQSLKEEADDRYRKLLNDLNSIIGPRLEI
                     LKSKIDSSKSYEEELLQQKSINLKTLIHNSEDSYYDHRRSFKEKEEYDDSINREKYGT
                     EVPVPVSVSKSIRVKHDISSSQPSAATGSISGEQEGKPEETVDEVNIKFSFKKAIDKH
                     VEASSEDESAHEVEKEAQQSLESNRLEEGVPAEQVLTFTDDELDERLAKLKESRAVDE
                     LVKEYLGVYEDDLVEYIFENIKEHKSKAMLVEDLKETFDEDSVAMVDVIWSRKELSS"
     gene            complement(<601802..>602242)
                     /gene="NDAI0B02400"
                     /locus_tag="NDAI_0B02400"
                     /db_xref="GeneID:11498104"
     mRNA            complement(<601802..>602242)
                     /gene="NDAI0B02400"
                     /locus_tag="NDAI_0B02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668470.1"
                     /db_xref="GeneID:11498104"
     CDS             complement(601802..602242)
                     /gene="NDAI0B02400"
                     /locus_tag="NDAI_0B02400"
                     /inference="similar to DNA sequence:INSDC:YPR017C"
                     /note="similar to Saccharomyces cerevisiae DSS4 (YPR017C);
                     ancestral locus Anc_8.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668518.1"
                     /db_xref="GeneID:11498104"
                     /db_xref="GOA:G0W664"
                     /db_xref="InterPro:IPR007515"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="UniProtKB/TrEMBL:G0W664"
                     /translation="MVKAICSFEDCRGTIATASKTRTISLPNTVFEKFQLLERREKSA
                     QSQEKHDFLIVEDVWDFDNIGVSRNIRPENDDDPRIEITDENLDEVVTFEHNGNTWTI
                     EKCTRYLICAECDKGPIGIVCQVKNDKGEEKVVYLLSLSSLQLV"
     gene            complement(<602541..>604256)
                     /gene="NDAI0B02410"
                     /locus_tag="NDAI_0B02410"
                     /db_xref="GeneID:11498105"
     mRNA            complement(<602541..>604256)
                     /gene="NDAI0B02410"
                     /locus_tag="NDAI_0B02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668471.1"
                     /db_xref="GeneID:11498105"
     CDS             complement(602541..604256)
                     /gene="NDAI0B02410"
                     /locus_tag="NDAI_0B02410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668519.1"
                     /db_xref="GeneID:11498105"
                     /db_xref="GOA:G0W665"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W665"
                     /translation="MDIFRVLTRGASVKKKDNSKKQSSVDYSLSKSNHTNLKTPGKND
                     KLANIQMDRELDFFRNKKIFHKVTDSKLGDSDQETLSKSEPAVDGNEEDETETFDVQP
                     KITNAKDALELRKSYKGNVTGQDIPLPIGSFEDLITRFSFDKRLLTNLIENHFTEPTP
                     IQCESIPLALNSRDIVACAPTGSGKTLAFLIPLLQQIINDKETLGLKGLIISPTKELA
                     NQIFIECIKLSNKIFLDKKRPLQIALLSKSLSAKLKNKVINEKKYDIIISTPLRLIDV
                     VKNEALDLSKVKHLIFDEADKLFDKTFVEQTDDILSSCTDNSLRKAMFSATIPSNVEE
                     IANSIMLDPIRVIIGHKEAANMNIEQKLVFCGNEEGKLIAIRQLVQEGEFKPPIIIFL
                     ESITRAKALYHELMYDRMNVDVIHAERTALQREKIIERFKSGDLWCLICTDVLARGID
                     FKGVNLVINYDVPRTAQAYVHRIGRTGRGGRSGKAITLYTKQDSLAIKPIINVMKQSG
                     CEVAEWMNNISKITKKEKEAIKRGKSHTERKQISTVPKIDILKKKRKQEMIQASKRRK
                     LEEHQ"
     gene            complement(<604848..>607550)
                     /gene="NDAI0B02420"
                     /locus_tag="NDAI_0B02420"
                     /db_xref="GeneID:11498106"
     mRNA            complement(<604848..>607550)
                     /gene="NDAI0B02420"
                     /locus_tag="NDAI_0B02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668472.1"
                     /db_xref="GeneID:11498106"
     CDS             complement(604848..607550)
                     /gene="NDAI0B02420"
                     /locus_tag="NDAI_0B02420"
                     /inference="similar to DNA sequence:INSDC:YPR021C"
                     /note="similar to Saccharomyces cerevisiae AGC1 (YPR021C);
                     ancestral locus Anc_8.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668520.1"
                     /db_xref="GeneID:11498106"
                     /db_xref="GOA:G0W666"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W666"
                     /translation="MEQINSNNSKRLKQIEIFNKYASFIDFQKEKESKDFRKVQHAHK
                     GTKNGQFVLFYDDFINLITNSKNDNTNAFNLNLIPKESFGCIFLAMDENNKSYLTLND
                     WFYFNNILQCNNYQFLILYEFLRKFDTNINTNIPSKSSRKNKFINYSNKFLSFDQLLL
                     NLKNLKFTINLLHETVVNDEFLKQKNLYLNWDHFKFLKFYQFFPYRNSNDATDDITKR
                     NQPYLTLNSLITILQNDLKQEKLFLGFEKLARFDSEKNALTINRYQLSYLLKLFYSHK
                     VSSYIFDSLDLSNTKLIKSNNNSITFNVFKDILYLFQNFDIINQLLIKYSKTIPQNKN
                     ATLEQKQQQIITKNDFITFLNSEHNKINNVIQFSPSQINLLFSIVENFKKIFIIINIL
                     INSFKLNQLIHKIKTIISYMKNLMNIIMINQIILFKILIFFNTTTANDTYPYYFLSNN
                     ELTIDDFMKIVNPNYLNDLIHQLELNNLIDQSLYINYYFYPIFDSIFNFSLGSIAGCI
                     GATIVYPIDFIKTRMQAQRSLTKYKNSVDCLIKIVSKNGIRSLYSGLTPQLIGVAPEK
                     AIKLTINDLMRNKLSGRNNRGNLKLSYEILSGATAGLCQTIVTNPLEIIKIRLQVKSS
                     NSEINAWKIIKHLKFNGLYKGITACLLRDVPFSAIYFPTYAHLKKDLFKFDPNDKFKK
                     KRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIEPKPGEVAYKGIFHAFKTIFEEE
                     SFKSFFKGGGARVLRSSPQFGFTLAAYEIFKNLFQGQSIDTGIDTGTGSGNLNDNPSL
                     QSAKSNNVSPITGPFNSYFKSLDNSSYTSKENKELHTNNDKLRRKANTSNNNRQYYSD
                     NYYPNYYYKSCQISKTFIDLDNNFAHFDYSVYKKFRDYLNSLNN"
     gene            <608926..>610590
                     /gene="NDAI0B02430"
                     /locus_tag="NDAI_0B02430"
                     /db_xref="GeneID:11498107"
     mRNA            <608926..>610590
                     /gene="NDAI0B02430"
                     /locus_tag="NDAI_0B02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668473.1"
                     /db_xref="GeneID:11498107"
     CDS             608926..610590
                     /gene="NDAI0B02430"
                     /locus_tag="NDAI_0B02430"
                     /inference="similar to DNA sequence:INSDC:YER123W"
                     /note="similar to Saccharomyces cerevisiae YCK3 (YER123W);
                     ancestral locus Anc_8.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668521.1"
                     /db_xref="GeneID:11498107"
                     /db_xref="GOA:G0W667"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W667"
                     /translation="MSQQQQHIVGIHYTVGPKIGEGSFGVIFEGENILNNKFKQKNDN
                     NDATTTGSNSNSDPVAIKFEPRHSDAPQLRDEFRSYKILNKVKGIPHVYYFGQEGMHN
                     ILIIDLLGPSLEDLFEWCNRKFSIKTTCMLAKQMIQRIKDIHNHDLIYRDIKPDNFLI
                     SQYQKKNSSQKGITRSANGDPNLIYLVDFGMAKQYRDPKTKQHIPYRERKSLSGTARY
                     MSINTHFGKEQSRRDDLESLGHVFFYFLRSSLPWQGLKAPNNKLKYEKIGLTKQKLNP
                     NDLLVNYNNIPRQFATFLKYARSLKFEQDPDYDYLISLMDDALLENGLKDDGHYDWMD
                     LNNGHGWDININKRINLHGYGNPNPNANANTTGTPNQNLNLKNTHKNNNNINNKAQAN
                     LDQSNINMKMSRIIHSTNSFMYSNDDQQQTTTNNNRSALLRSKDYSNSKDNLLKSSNQ
                     MEKNKYQSLKQPILQSRNNNNNNSYDSMSTRIKNNNNYYNDTRRQQQQQQQAQQNLFD
                     NTSASLQNNTCNNNENNRSTISRIFSYICCGYCCLSDSSPSSSSSY"
     gene            complement(<611035..>612675)
                     /gene="NDAI0B02440"
                     /locus_tag="NDAI_0B02440"
                     /db_xref="GeneID:11498108"
     mRNA            complement(<611035..>612675)
                     /gene="NDAI0B02440"
                     /locus_tag="NDAI_0B02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668474.1"
                     /db_xref="GeneID:11498108"
     CDS             complement(611035..612675)
                     /gene="NDAI0B02440"
                     /locus_tag="NDAI_0B02440"
                     /inference="similar to DNA sequence:INSDC:YER124C"
                     /note="similar to Saccharomyces cerevisiae DSE1 (YER124C);
                     ancestral locus Anc_8.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668522.1"
                     /db_xref="GeneID:11498108"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W668"
                     /translation="MNTEYYEPVTIFRQPAINIKKNFRNSTYQNGIGHNKFQYNKSWQ
                     TNTSKMGGSSNLRKVSGDFNDYYTTKKLKSSYWNINHNTNENFNKTIPNSLSINDSTI
                     ILSNGDSKDNLKLYNLNSMNNDVNENKIKLQTLQSITVPGTPITTSATISLPHNNESP
                     FILTGHQDGQVNLISTSLTEGNAKIIKRFNHSKYLTSISSRGSTSRCYKSQLDNILNK
                     FESKPIRNLKFKNSNEFISLINDSMFIYDINENKTPKFLQNFPMIESFAINPYHDDVL
                     ALCGSDFDNAGISLLDLRKDNDNHTSNNLFTPKVMEPVTRCAINSKSCEWMDETKLFQ
                     SHNGIIKVWDIRQTNGETICEIEPNSHFKTGIITSIKYDSIEKKLYSCDEFNNLISWN
                     LQHLEKVKKCVLSYGILPSYENIPYESEEVSECGNFILNSSMGKSEGRKNNSNMMMDY
                     CYDINGLITVDFEELGVHQICDVKCSIQDDKEGYELVEPQLEGEYNIQEIDEDEDVTD
                     SSNETLIFSESYDVSSMEAYEGLVDNNHDAMMVTKKMY"
     gene            <615375..>617249
                     /gene="NDAI0B02450"
                     /locus_tag="NDAI_0B02450"
                     /db_xref="GeneID:11498285"
     mRNA            <615375..>617249
                     /gene="NDAI0B02450"
                     /locus_tag="NDAI_0B02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668475.1"
                     /db_xref="GeneID:11498285"
     CDS             615375..617249
                     /gene="NDAI0B02450"
                     /locus_tag="NDAI_0B02450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668523.1"
                     /db_xref="GeneID:11498285"
                     /db_xref="GOA:G0W669"
                     /db_xref="InterPro:IPR007251"
                     /db_xref="UniProtKB/TrEMBL:G0W669"
                     /translation="MGRILAFFGNPGQRPTIHHRAPLPISHECGSDLDHVCTVEEGEE
                     EEVITIIDENGEKKETLKQDLRAISSNSDQSTAVELSDMNIESDGSIITSHGFTGLNK
                     GYTDKVLDILVDFAGGQIVFCCVWIILIIWIVIGIVYNGSYVWQVVMQDGQSIQCYIW
                     DTLLMRQQLTSTHEQVLVCCQLRSRMSTFKDFLTRTLNVHNHDKDDTNNNIPLSCSAS
                     SITSNNCNESNDKTTQDKSKINEDNEYCQEKNAETPENSLPESSDAIINPEMDMKTIA
                     GELPIENWYDRFSSISSNIIGSVPCMILFWLGIIVWIICGVIPKDAGNSPPYTGRTTG
                     SNPKLKKFSDAWQMYINTAVAVSLLICTTFLQNIRARHDKFIAKFLVNTFEIDDKIDI
                     RLRTYFKDFRLANPVITVPPGKRTWGEKCIDWYADIIGTGIGVMLAIAFFGVWIGIGS
                     PLHWDDNWWLIIGTYTGLVGFLDGYVIRQVYFRIIEHEEENYSKVAEQDLELFQVLGI
                     DCPEEFTGKPQGNVTKTLNYKISSFVNRICSDQLSVLASILIIIGLICVSSGLRWSTT
                     GQLIANTPTMIIEEFFLIVLLQAHNWADQQRRVEVSALLARRQILLAYVENHFPVIKY
                     "
     gene            <618295..>620805
                     /gene="NDAI0B02460"
                     /locus_tag="NDAI_0B02460"
                     /db_xref="GeneID:11498286"
     mRNA            <618295..>620805
                     /gene="NDAI0B02460"
                     /locus_tag="NDAI_0B02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668476.1"
                     /db_xref="GeneID:11498286"
     CDS             618295..620805
                     /gene="NDAI0B02460"
                     /locus_tag="NDAI_0B02460"
                     /inference="similar to DNA sequence:INSDC:YER125W"
                     /note="similar to Saccharomyces cerevisiae RSP5 (YER125W);
                     ancestral locus Anc_8.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668524.1"
                     /db_xref="GeneID:11498286"
                     /db_xref="GOA:G0W670"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR024928"
                     /db_xref="UniProtKB/TrEMBL:G0W670"
                     /translation="MPTTISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAK
                     KTLNPYWNETFKFNDINENSILTIQVFDQKKFKKKDQGFLGVVNIRLGDVLGHLDEDS
                     AASTSNSREETITRELKRSNDGMAVSGRLIVVLSSKSTPATGTATGANSARTATSTGT
                     AGSNRRSSAATGGSSSRIQDSHLNNANARTANTPGTHTPRPTAQAVESTLQSGPNAAA
                     AAAAAASTSAATGTGANTRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWK
                     RPTLDQTEQERGNQMSATTELERRQHRGRTLPGSSTNNNGSETNSSNSSVTVQVGNST
                     TTPAINGTAAAAFAATGATTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQ
                     QYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSS
                     LDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLK
                     KRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTIQINPNSGINP
                     EHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVILQDMEGVDADVYNSLNW
                     MLENSIDGVLDLTFSADDERFGEVVTVDLKENGRNIEVTDENKKEYVELFAQWKIVDR
                     VQEQFRAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDVEDWKKHTDYRGYQESDD
                     VIKWFWKCISSWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQL
                     PKSHTCFNRVDLPPYDDFDNMKQKLTLAVEETIGFGQE"
     gene            complement(<621332..>622117)
                     /gene="NDAI0B02470"
                     /locus_tag="NDAI_0B02470"
                     /db_xref="GeneID:11498287"
     mRNA            complement(<621332..>622117)
                     /gene="NDAI0B02470"
                     /locus_tag="NDAI_0B02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668477.1"
                     /db_xref="GeneID:11498287"
     CDS             complement(621332..622117)
                     /gene="NDAI0B02470"
                     /locus_tag="NDAI_0B02470"
                     /inference="similar to DNA sequence:INSDC:YER126C"
                     /note="similar to Saccharomyces cerevisiae NSA2 (YER126C);
                     ancestral locus Anc_8.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668525.1"
                     /db_xref="GeneID:11498287"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:G0W671"
                     /translation="MPQNEYIEQHIKQHGRRLDHDERKRKREAREVHKVSTKAQTLTG
                     WKGKQFAKKRYAEKVAMRKKIKAHEQSKIKTGSKPLDENGEALPTYLLDREQTNTAKA
                     ISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILSVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGMVTAGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     gene            <622504..>623646
                     /gene="NDAI0B02480"
                     /locus_tag="NDAI_0B02480"
                     /db_xref="GeneID:11498288"
     mRNA            <622504..>623646
                     /gene="NDAI0B02480"
                     /locus_tag="NDAI_0B02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668478.1"
                     /db_xref="GeneID:11498288"
     CDS             622504..623646
                     /gene="NDAI0B02480"
                     /locus_tag="NDAI_0B02480"
                     /inference="similar to DNA sequence:INSDC:YER127W"
                     /note="similar to Saccharomyces cerevisiae LCP5 (YER127W);
                     ancestral locus Anc_8.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668526.1"
                     /db_xref="GeneID:11498288"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:G0W672"
                     /translation="MSELNSILKEMNASLETVSESIEILHNNYLQDHEETEQEGGNNT
                     DDTLHSYLKLNKNEKVSLLSLKNDSMLSYINSLLLIVGNKLKTRKGNNDDDVAFYDLR
                     DKTIENRVVVERGIKPLEKKLSYQLDKLIRAYYKAEKEFKDAENRAIEKSALHDKKES
                     TNSDDDDDSGSEEDEDEEMAYRPNTTGLTKTSSKEKAASRAKEQEEGEGEGEGDGTEG
                     ADENESGIYRPPKINAMLPPTQQSSHFEDKFIVKEHKNRSNHSRMQAMEEYLKDQTDQ
                     PDWESSIGANIVNHGKGGIKSSRASEKERKVTSYEEDNFTRLNNLGTSKIEKKKQKQR
                     ERMAKVNIIGGEDFSIFNSKRKMEDSTSRRGNKKSRSAWDRAKRRL"
     gene            <624055..>624669
                     /gene="NDAI0B02490"
                     /locus_tag="NDAI_0B02490"
                     /db_xref="GeneID:11498289"
     mRNA            <624055..>624669
                     /gene="NDAI0B02490"
                     /locus_tag="NDAI_0B02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668479.1"
                     /db_xref="GeneID:11498289"
     CDS             624055..624669
                     /gene="NDAI0B02490"
                     /locus_tag="NDAI_0B02490"
                     /inference="similar to DNA sequence:INSDC:YER128W"
                     /note="similar to Saccharomyces cerevisiae YER128W;
                     ancestral locus Anc_8.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668527.1"
                     /db_xref="GeneID:11498289"
                     /db_xref="InterPro:IPR013640"
                     /db_xref="UniProtKB/TrEMBL:G0W673"
                     /translation="MINEYVSRKVSLKDINGCLICQKPTTTVLYNKSGPDWFYTCDIH
                     LQDNPEFVKPIYGKDYETKTNRLKSVQQELHRIQKNNDPSSWDGWVGKLFIKKNKNQS
                     PDKDKDKDKDENKDGDNNNNKVGNESTGNRSDMLQREYQTLLDELTHLKQNNRKYQLD
                     NSLYENRVQRRIRTQRIKETYTATNPEELAQRLATFPNVPTDKP"
     gene            <625206..>629036
                     /gene="NDAI0B02500"
                     /locus_tag="NDAI_0B02500"
                     /db_xref="GeneID:11498290"
     mRNA            <625206..>629036
                     /gene="NDAI0B02500"
                     /locus_tag="NDAI_0B02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668480.1"
                     /db_xref="GeneID:11498290"
     CDS             625206..629036
                     /gene="NDAI0B02500"
                     /locus_tag="NDAI_0B02500"
                     /inference="similar to DNA sequence:INSDC:YER129W,YGL179C"
                     /note="similar to Saccharomyces cerevisiae SAK1 (YER129W)
                     and TOS3 (YGL179C); ancestral locus Anc_8.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668528.1"
                     /db_xref="GeneID:11498290"
                     /db_xref="GOA:G0W674"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0W674"
                     /translation="MSTPNIHGHEELDIPPDLQLELSLSENNSDCSLKKMINTTTTND
                     NIHCINTDNNTNTTHSNNNKSATIIPRISSLHSNKNLEKNSIASSSAESLNILLERQR
                     VRQLNHPQHQSHIKAPASSLIYNNNNNGNNNTSNNDRGFSSFNSKFATLDNDLATVRP
                     QVKETNRISLTYDPISKRKVLNTYEIIRELGHGQHGKVKLARDLITNNLVAIKIVDRH
                     EKLSFSKRFKSSFSSSSSPSSHKKNKKDEKIKREIAIMKKLHHKHVVKLIEVLDDSNS
                     RKIYLVLEYCSNGEIKGCPKDVLETEARGPPLLSFQSTREIIRGVILGLEYLHYQGII
                     HRDIKPANLLVDQNGTVKISDFGVSLALRTTSTSTHSSGSSNGSTLPTSTNSSFVSNN
                     NNNTMNTNNNSSIPNSEDESIDEVELAKTAGTPAFFAPEICLGEDAFTKFNFQKNDLF
                     KGSSISFMIDIWALGITMYCLLFGMLPFISEYELDLFEKIINDPLKFPSFEELSSNNV
                     SFISCGQEYELAKDVLNRLLEKNPSKRITIPELKKHPFICWDFDHASESHDQSFITSK
                     IQEKDMFQSDQKNLFEKISISKHELKNAVSGVGKKIKESILKSIPLKKRDGTSTTSVT
                     TEPSSNDLEGYATNNNSDLSVIVSEGSVVTDINEMTKSKKLKSPPQAPPLLGSSNDDK
                     TCSTNNDTEFTNEFSTDYTDHNINASSNNSSHTLPYKQDIANTLQDYDTKHESNNVVN
                     LPINSSFASLDSFYIDNYAMSKIGMNSDFSPAGTPRIEDNNGPHSNYALASKHSTVSI
                     NTSSSNLDFYNLGIPSRRTEVLSQRPSSRNSPNLSRSQFSFSKRVSPSVLDSRNSARS
                     NSRTRSRSKSGSKPSLSPGSHMRLSQTFTPFSVSNKENSKSKSKSKSKSTSNSKLTQK
                     SNPSSLKSSPTPPKFQESPKRLYSLSPPILYSQYNSNDQVPNKLSVKKGNFNFHDGHE
                     MKSGCSERSNSISNSDNSYAGSSSTSSYSIDGSISETDSLPFEFGYDSENGSVLSLHD
                     LPNINEVHTYLKTHRASSLTSSSSSSGSSESNDNVNDSGTSEEEELYLNLGNNSTSRR
                     GQRPSESPVATATALNHNSANNNNYRYGNTSTYLHEGGGHSETTISFSRDTDRETLRD
                     NTSLKLDNSSNSLVDGRNLRLYQNSPKATLSLQTGRDHFDNSNATDNMTGNDNQRMAQ
                     SRNLLKAVLDSTKNERRRSSVACITQDCEGERENHEAYEPKQPLRIGRSPFIKQLNLE
                     DDKVRSHSVPLHKK"
     gene            complement(<629789..>630856)
                     /gene="NDAI0B02510"
                     /locus_tag="NDAI_0B02510"
                     /db_xref="GeneID:11498243"
     mRNA            complement(<629789..>630856)
                     /gene="NDAI0B02510"
                     /locus_tag="NDAI_0B02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668481.1"
                     /db_xref="GeneID:11498243"
     CDS             complement(629789..630856)
                     /gene="NDAI0B02510"
                     /locus_tag="NDAI_0B02510"
                     /inference="similar to DNA sequence:INSDC:YLR097C"
                     /note="similar to Saccharomyces cerevisiae HRT3 (YLR097C);
                     ancestral locus Anc_8.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668529.1"
                     /db_xref="GeneID:11498243"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W675"
                     /translation="MSSTADDSKYSVSSTTTDETRINDVSGAIEIWEQGVLKEKDGSM
                     SDAINYYRKALKIDENVEKIYRKKLHVEWELQKKLEALKLIDDNNDKSDAIDEDDEKQ
                     EREKNILPCWLLEMLPNDLLLKIIHHVVLMSGESWYNLSLTCSHLNKLCFHDLLPYQT
                     FANFIYSKQTYDNIAMELNGMSNLQEVEKDIWGDDVMMMLRKRPFVKFEGVYISVVNY
                     LRYGSNAEGSSSLLNPVHMITYYRYFRFYEDGTCLRLLTTDEPSQVVKHFYKERKPKD
                     SHLCSWTLGFDYNFGQLHVSRTTSKYHFVEEFRISSQGNKRHHKLKWIKSTVESNDGS
                     ISNCSLANEKSFSFSRVRKFA"
     gene            complement(<631209..>633341)
                     /gene="NDAI0B02520"
                     /locus_tag="NDAI_0B02520"
                     /db_xref="GeneID:11498244"
     mRNA            complement(<631209..>633341)
                     /gene="NDAI0B02520"
                     /locus_tag="NDAI_0B02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668482.1"
                     /db_xref="GeneID:11498244"
     CDS             complement(631209..633341)
                     /gene="NDAI0B02520"
                     /locus_tag="NDAI_0B02520"
                     /inference="similar to DNA sequence:INSDC:YLR098C"
                     /note="similar to Saccharomyces cerevisiae CHA4 (YLR098C);
                     ancestral locus Anc_8.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668530.1"
                     /db_xref="GeneID:11498244"
                     /db_xref="GOA:G0W676"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W676"
                     /translation="MTNINSAGDLLPKDVQINNGKVTKAKGKTNNDTKNATKSQRKIA
                     CQHCRKIRRKCDMINPCSNCIKFDTTCVYAEKDMRTTRYSNSYVKALECHIALLESSL
                     KKIKSSSDDQEKTKILDSLPLDNIIGESSVEYSMRRSSSVSLSSPDSSISNDDSEPTA
                     SKTSSIYPSNSLSISKAKSYNDHRSQLQLTLSNLSQDPLILRSFSLFFKWLYPGHFMF
                     IHRETFLSAFFGDNNTKDYYCSEELIYAIAALGSKISNSKTDSKLFSNSFSYYQHSKK
                     IVLEKIFHLQRNNNLDSSTSSSKLAIIQTLLCLSFYDIGNGENPMAWYLSGLAFRIAH
                     EIGLHLNPKAWTHVYEDELTMLDIKVRSRIYWGCYIADHLISILFGRSTTLRLSNSTI
                     PETDELPNIENGLEDYIYDQNAVSTTSNPLKKLIVLSRITEVFAGKIFVQSESFRQKS
                     EFLNRFNKEMKNWRKTLPLDLRWSLSNLKEMKQFNPSTTYIWLHYYIVLISYNKPFID
                     EIRESRELIEQYIEELHYILEIWLMNFKTLEKCNIYIVYLTLLSIQCMVNSKLIENKY
                     YTQFLNFLKDPTLNHDLAKKFIENLSVNDANTTSKSGSDGIISSSNNDSVGYERESST
                     LPLTQINHNAMNGHSATNVGMQYNMAFSNNHMSNEPIVEPIDLLGSLSYGTDFSLEYN
                     FDFTLLNEIDTLIGGPMDKDNSVSGNIA"
     gene            <633643..>633981
                     /gene="NDAI0B02530"
                     /locus_tag="NDAI_0B02530"
                     /db_xref="GeneID:11498245"
     mRNA            <633643..>633981
                     /gene="NDAI0B02530"
                     /locus_tag="NDAI_0B02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668483.1"
                     /db_xref="GeneID:11498245"
     CDS             633643..633981
                     /gene="NDAI0B02530"
                     /locus_tag="NDAI_0B02530"
                     /inference="similar to DNA sequence:INSDC:YLR099W-A"
                     /note="similar to Saccharomyces cerevisiae YLR099W-A;
                     ancestral locus Anc_8.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668531.1"
                     /db_xref="GeneID:11498245"
                     /db_xref="UniProtKB/TrEMBL:G0W677"
                     /translation="MDDTASIVTADNSTIYSTPIGTTSQINLDSLTQELEVEGEEEDY
                     ECAEEETESDIETIDYNAALVDAQRQWEQSLDQLNKVFNWILLPMIGKVIGRRSARVI
                     WQRVMNTIWN"
     gene            <634232..>638950
                     /gene="NDAI0B02540"
                     /locus_tag="NDAI_0B02540"
                     /db_xref="GeneID:11498246"
     mRNA            <634232..>638950
                     /gene="NDAI0B02540"
                     /locus_tag="NDAI_0B02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668484.1"
                     /db_xref="GeneID:11498246"
     CDS             634232..638950
                     /gene="NDAI0B02540"
                     /locus_tag="NDAI_0B02540"
                     /inference="similar to DNA sequence:INSDC:YDR127W"
                     /note="similar to Saccharomyces cerevisiae ARO1 (YDR127W);
                     ancestral locus Anc_8.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668532.1"
                     /db_xref="GeneID:11498246"
                     /db_xref="GOA:G0W678"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR008289"
                     /db_xref="InterPro:IPR010110"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018508"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W678"
                     /translation="MVAPLVKVPILGKETIHVGYKIHSHIVETIYKHCSSSTYVIIND
                     TNLSKVSYYKSLLNEFQSSLPQESRILTYEVSPGEANKSRETKASIEDYLLKQGCTRD
                     TVIIAIGGGVIGDMIGFVAATFMRGVRFIQIPTSLLAMVDSSIGGKTAVDTPLGKNFI
                     GAFWQPEFVLVDIMWLSSLPRREFINGMAEVIKTAAIWNAEEFTRLEDNAIKFLEVVN
                     NGDSDESTAIETILNHVYKLVLESIKVKAEVVSSDERESGLRNLLNFGHSIGHAYEAI
                     LTPQALHGECVSIGMIKEAELSRYLGILSPTQVARLSKILSAYGLPIAPEEKWFKDLT
                     LNKETPLNVLLDKMSIDKKNAGSKKKVVLLEAIGKCYGTSAHFVTDEDLRFILTDETL
                     VYPFTVNETNTNEKFITPPGSKSISNRALILAALGKGQCKIRNLLHSDDTKYMLSAIQ
                     DLNAATITSEDNGETIVIEGHGGEALSACPNELYLGNAGTASRFLTSVAALVNSTPTK
                     DHVILTGNARMQQRPIGPLVDSLRINGIKIDYVKSEGCLPIKVDTSSVFQGGRIELAA
                     TVSSQYVSSILMCAPYAQEPVTLSLVGGKPISILYVDMTIKMMEKFGVNVIKSKTEPY
                     TYHISKGTYVNPKEYVIESDASSATYPLAFAAMTGTTVTVSNIGYESLQGDAKFAPLV
                     LGPMGCTVKQTATSTTVTGPKVGSLKPLKHVDMEPMTDAFLTACVVAAIAHDDGDSKS
                     ENITTIEGIANQRVKECNRILAMATELEKFGVRTKELPDGIQVYGLNSLKDLQCPAAQ
                     GIHSYDDHRVAMSFSLLAGMVSTAPNGVRIQERHCTAKTWPGWWDVLHTKLGAKLDGC
                     EPTKGSTITNNSNNVRKSVVIIGMRAAGKTTISKWCATTLGYKWVDLDDLFEEQYADG
                     SIKDFVAKFGWEKFRSEETRIFKEVIEQYGDKGYVFSTGGGIVENAESRVHLKKFVSQ
                     GGIVMHLHRDIEETIVFLKSDPTRPAFVEEIREVWERREKWYKDCSNYTFFAPHCSTE
                     VEFQNLRRAFGKFILFISGLKQTVIPTKRSAFVCLTFEDLAEHDTKLTPITYGCDAVE
                     VRVDHLANYDPDYVNRQLSILRTSTDSLPIIFTIRTKKQGGNFPDEEYEAIEELYKTA
                     LKSGVEYIDLELTLPTSIQYNVLNNKRFTKIIGSHHDFAAAYPWGDAEWENRYIQALA
                     LDVDIIKFVGTATKFEDNLVLEKFRDAHKEKPLIAINMTECGKISRVLNTVLTPITSH
                     LLPSASAPGQLTLKQINEIYTSMGGLSSKEFFVVGTPIGHSRSPILHNTGYELLGLPY
                     NFDKYETDSAEVISKELLEGKPNLGGLAVTIPLKLDIIKYMSELTDAAKAIGAVNTVI
                     PLGNKTFRGDNTDWLGIKNSLVSNGVPESVKGTAGLIIGAGGTSRAAVFALHKMGCSK
                     IFMINRTTPKLEELKESFPTEFNIVVVNSIEQAEQAKEPVGIAVSCVPADKPLDPTLL
                     SKLERFLTKGLNAGFPPTLLDAAYKPAVTPIMRLAKDKYEWQVVPGAQMLVHQGVAQF
                     EKWTGFKAPYKAIFQAVTTD"
     gene            <639385..>640449
                     /gene="NDAI0B02550"
                     /locus_tag="NDAI_0B02550"
                     /db_xref="GeneID:11498247"
     mRNA            <639385..>640449
                     /gene="NDAI0B02550"
                     /locus_tag="NDAI_0B02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668485.1"
                     /db_xref="GeneID:11498247"
     CDS             639385..640449
                     /gene="NDAI0B02550"
                     /locus_tag="NDAI_0B02550"
                     /inference="similar to DNA sequence:INSDC:YLR100W"
                     /note="similar to Saccharomyces cerevisiae ERG27
                     (YLR100W); ancestral locus Anc_8.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668533.1"
                     /db_xref="GeneID:11498247"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W679"
                     /translation="MHNGKVVDDRKVIVITGTNSNLGLNIAYRFIDTSDKETRLTFVV
                     TSRTLPRVKEAINLIKAYTHKSKRTGIVDYDYFLVDFTNMVSVLNAYYELTKTYDAIH
                     YFFVNAAQGVYDGIDWVGAMKEVIANPLEAVTNPTYKMQKVGVKSKDNMGLVFQANVF
                     GPYYLLHKLLPLLSAGNGTIIWISSIMSGPKYLSLQDIELLRTDSSYEGSKRLVDLLH
                     LATYKELKSMGIHQYIVQPGIFTSHSFFKYLNVFTFYGMLLLFYIARIFLGSKWHNIS
                     GYKAANAPIYVALEMDKSNYEGEELKYGSATTRSGKEYIKAQEIIPIGSSDVYDYIKL
                     KEKEWDEKLKGQITNTRIPM"
     gene            complement(<640723..>642660)
                     /gene="NDAI0B02560"
                     /locus_tag="NDAI_0B02560"
                     /db_xref="GeneID:11497806"
     mRNA            complement(<640723..>642660)
                     /gene="NDAI0B02560"
                     /locus_tag="NDAI_0B02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668486.1"
                     /db_xref="GeneID:11497806"
     CDS             complement(640723..642660)
                     /gene="NDAI0B02560"
                     /locus_tag="NDAI_0B02560"
                     /inference="similar to DNA sequence:INSDC:YDR129C"
                     /note="similar to Saccharomyces cerevisiae SAC6 (YDR129C);
                     ancestral locus Anc_8.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668534.1"
                     /db_xref="GeneID:11497806"
                     /db_xref="GOA:G0W680"
                     /db_xref="InterPro:IPR001589"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G0W680"
                     /translation="MNIVKLQRKFPILSQEDLFNTIERFRSIDLDDKGWVEKQQALEA
                     VQKTGEASYDEARETLKRVNVDASGHVELDDYVELIAKLKESKSEPVPQTSFSVDNST
                     ANAIPVQPTPMGLKHEGEGARARIIVGGSTTGTTHTINEEERREFTKHINQVLAGDED
                     IGYMLPFPEDTFQLFDECKDGLVLSKLINDSVPDTIDTRVLNMPKNNKRLNNFQASEN
                     ANIVINSAKAIGCVVVNVHSEDIIEGKEHLILGLIWQIIRRGLLSKIDIKLHPELYRL
                     LEDDETLEQFLRLPPEQILLRWFNYHLKQANWGRRVTNFSKDVSDGENYTILLNQLAP
                     TLCSKDPLQTTDLLQRAEQILVNAEKLECRKYLTPRALVAGNPKLNLAFVAHLFNTHP
                     GLEPIEEEEQPEIEEFDAEGEREARVFTLWLNSLDVDPPVVSLFEDLKDGLILMQAYN
                     KVMPNTVDFKHVNKKPTSGVELSRFKALENTNYAVELGKHNGFSLVGIEGSDILDGNK
                     LLTLGLVWQLMRRNITNTMKHLSSTGRDMSDSQILKWAQDQVAKGGRSSTIRSFKDPS
                     LSNAHFLLDVLNGIAPGYVNYDLVAPGNNEEERYANARLAISIARKLGALIWLVPEDI
                     NEVRARLILTFVASLMSIQKN"
     gene            complement(<643063..>644019)
                     /gene="NDAI0B02570"
                     /locus_tag="NDAI_0B02570"
                     /db_xref="GeneID:11497807"
     mRNA            complement(<643063..>644019)
                     /gene="NDAI0B02570"
                     /locus_tag="NDAI_0B02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668487.1"
                     /db_xref="GeneID:11497807"
     CDS             complement(643063..644019)
                     /gene="NDAI0B02570"
                     /locus_tag="NDAI_0B02570"
                     /inference="similar to DNA sequence:INSDC:YLR102C"
                     /note="similar to Saccharomyces cerevisiae APC9 (YLR102C);
                     ancestral locus Anc_8.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668535.1"
                     /db_xref="GeneID:11497807"
                     /db_xref="InterPro:IPR024274"
                     /db_xref="UniProtKB/TrEMBL:G0W681"
                     /translation="MIEDEANNNNNNNVNNNGAFQSLSNNPSSLWGTPQRQGAIHFHN
                     HKNDNNATDVFNTPLRRPTRSTANHLSSSEHHLVSHSDCNDGNGTRNDDIDYVMDDKD
                     HLNSSHREEEEGYKYDYRPFIDKDLVQEHKINNLLRSEKAIHCLIFHKNGHSNESTSF
                     FMEDSYKPDLQLHCGDEDGDEIHDQAQYPAGSLITRIPNCNANHLYGLFNCIPLLPSK
                     RGNSSMETALRDFWDDNDDTGLLSAIDSAHRVKLGEIFKRECELFQELQLQSQSQSQS
                     QEDGTEVDIGDAFNQEITVDEIKRQCHEIYEEDEETTIPTLM"
     gene            complement(<644532..>646544)
                     /gene="NDAI0B02580"
                     /locus_tag="NDAI_0B02580"
                     /db_xref="GeneID:11497808"
     mRNA            complement(<644532..>646544)
                     /gene="NDAI0B02580"
                     /locus_tag="NDAI_0B02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668488.1"
                     /db_xref="GeneID:11497808"
     CDS             complement(644532..646544)
                     /gene="NDAI0B02580"
                     /locus_tag="NDAI_0B02580"
                     /inference="similar to DNA sequence:INSDC:YLR103C"
                     /note="similar to Saccharomyces cerevisiae CDC45
                     (YLR103C); ancestral locus Anc_8.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668536.1"
                     /db_xref="GeneID:11497808"
                     /db_xref="GOA:G0W682"
                     /db_xref="InterPro:IPR003874"
                     /db_xref="UniProtKB/TrEMBL:G0W682"
                     /translation="MYYKVDQLKQAYYNILKSSSSHSSCQLVIFVSCLNIDSMCATKM
                     LSNLFKKELVQLQIVPVFGYSELKKLYSQLDININSVILVGFGAVVDLEAFLNLDNNN
                     TTDNNNTPDNNNNNNNNNNSERLIYVLDAHRPWNLDNLFGSDIIHCFDDGTVENNLQH
                     EKEAYFKLVKLEEERENDSEDDGLSDDDEDDDDDDDDDEEQDQTDEDEDEESNIDSKK
                     RKKSSSNNNNPRKKLIIQRRKDINTYERFLEEYYSNGSTIVNSISTQIYSLLSSIGET
                     NIQNLWLTILGATSLDTAYSQVYNRLFPLLQDEVKRLSPSNNSMISTKTPDTLSLEVQ
                     PDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGRKRLHKMFARMGIPLTTAQESWLY
                     MDHSIKRELGIIFDKNLDRYGLQDIVRDGFVRTFGYRGSISASEFVEALTALLEMGGS
                     ILKDGRVVSSSNNANYDVPLDEEDIQDNDGNVSQLLNLTRRQWVSNFWLSWDALDDRK
                     FELLNRGIQHAQMLQKSVFNTSVIILEKKLIKHLRIYRLCVLQDGPDLELYRNPLTLL
                     RLGNWLIECCAESEDKQLLPMVLASLDESTDTYLVAGLSPRYPRGLDTINTRKPILNN
                     FSMAFQQITAETGAKVKIDNFESSIIEIRKDDLSPFLEKLTLSGLL"
     gene            complement(<647421..>647915)
                     /gene="NDAI0B02590"
                     /locus_tag="NDAI_0B02590"
                     /db_xref="GeneID:11497809"
     mRNA            complement(<647421..>647915)
                     /gene="NDAI0B02590"
                     /locus_tag="NDAI_0B02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668489.1"
                     /db_xref="GeneID:11497809"
     CDS             complement(647421..647915)
                     /gene="NDAI0B02590"
                     /locus_tag="NDAI_0B02590"
                     /inference="similar to DNA sequence:INSDC:YOL071W"
                     /note="similar to Saccharomyces cerevisiae EMI5 (YOL071W);
                     ancestral locus Anc_3.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668537.1"
                     /db_xref="GeneID:11497809"
                     /db_xref="GOA:G0W683"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:G0W683"
                     /translation="MLTRNLLRCASTATVIFSRTRVLNGVLSYSFYSTNNNNNNKPNK
                     DEDDVVSRIKIPPIDRSNEPLERTRSRLIYQSRKRGILETDLLLSAFAAKYLKDMDVV
                     ELKEYDELLNELDWDIYYWATKNFDYSPLPKKWNDSKVLKKLQEFSQNKKKEILKMPD
                     LDKY"
     gene            complement(<648258..>649721)
                     /gene="NDAI0B02600"
                     /locus_tag="NDAI_0B02600"
                     /db_xref="GeneID:11497810"
     mRNA            complement(<648258..>649721)
                     /gene="NDAI0B02600"
                     /locus_tag="NDAI_0B02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668490.1"
                     /db_xref="GeneID:11497810"
     CDS             complement(648258..649721)
                     /gene="NDAI0B02600"
                     /locus_tag="NDAI_0B02600"
                     /inference="similar to DNA sequence:INSDC:YOL072W"
                     /note="similar to Saccharomyces cerevisiae THP1 (YOL072W);
                     ancestral locus Anc_3.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668538.1"
                     /db_xref="GeneID:11497810"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:G0W684"
                     /translation="MVGNYNLNQFFRDIQNGNYTILSLDLQFNGFQVASLQNELISKS
                     YTKKQLEELVEFNSGNKRWTRFNIMITSFLNYCENVDPWSIWSSCDLIFEFYSNLTNC
                     LLNDTYPIDPLVPIFRKQTEIVIPLAIKLDNNYMILGTRKYQFLSHTSSIISKLFNSI
                     KTYRNDNSGGNGSNDSERYDATLPEKQKILLYLVNKLNNLYFRIDSPQLCSNIFNNFK
                     PKSMLEHFKDYNIRERIEYRYLLGRYYLLNARMSNAYAQLQKAYVMAMSINNSLQGND
                     DDNGNRLVWKRNINRILRYLIPAGIVIGKCPNFNDIKDYPQIDIYKKLCHNITTGNMS
                     GLHGWLKLHEKLLRRQYVHLILLEKLPILTYRFLIKNVISKFVISEGSNKLLYELVHR
                     AIWVSLNLSDDNGSIDNSMGKKITIYDGIHTGTLADTENILVTLINLGFLRGNCFPLL
                     KLCVFQKNVPITDVMPSVDKRIALQFPLHSDDSWLDS"
     gene            <650056..>651381
                     /gene="NDAI0B02610"
                     /locus_tag="NDAI_0B02610"
                     /db_xref="GeneID:11497811"
     mRNA            <650056..>651381
                     /gene="NDAI0B02610"
                     /locus_tag="NDAI_0B02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668491.1"
                     /db_xref="GeneID:11497811"
     CDS             650056..651381
                     /gene="NDAI0B02610"
                     /locus_tag="NDAI_0B02610"
                     /inference="similar to DNA sequence:INSDC:YGR072W"
                     /note="similar to Saccharomyces cerevisiae UPF3 (YGR072W);
                     ancestral locus Anc_3.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668539.1"
                     /db_xref="GeneID:11497811"
                     /db_xref="GOA:G0W685"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W685"
                     /translation="MSESPNAQSKKVQQPSPRQQQPTGTTVAAGNTSTDGTAINPRNR
                     RRRPKSRNKQTIDTVPDKEANSTAKSENATHLKGSNKPAKKRATQQQQKQQKRQKQRQ
                     KQDRNESNLFKLVLRHLPPNLNSENFIKNVSLSKNIHDLYLEWYYIQGHYSSKLFKQP
                     HYSRAYFIFDSIVKLNKFASIVKNMKFIDDHENVMIPLLTLSSYIKSIEENVPERSRN
                     NPKKHQRTKAPKKDILEGTIENDDLFKMFLGRSKENDKVIDYGNFSLLRPVRKEVSRQ
                     KEADIAAAKKSELALTKLAGGSASSTKDVTSQAKNANKDKNKDKISKENKKEKQKGAK
                     ATTGTTEGKKKSRRSKKKKKNVPATNTNMGSGNLTFESSTDNATNKKPTQNVVILEAA
                     GKKELQKRKKQISKTSNVMPSLLSQTNNNHIDSPTKNIQSSIKILKREK"
     gene            <651971..>652432
                     /gene="NDAI0B02620"
                     /locus_tag="NDAI_0B02620"
                     /db_xref="GeneID:11497992"
     mRNA            <651971..>652432
                     /gene="NDAI0B02620"
                     /locus_tag="NDAI_0B02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668492.1"
                     /db_xref="GeneID:11497992"
     CDS             651971..652432
                     /gene="NDAI0B02620"
                     /locus_tag="NDAI_0B02620"
                     /inference="similar to DNA sequence:INSDC:YGR074W"
                     /note="similar to Saccharomyces cerevisiae SMD1 (YGR074W);
                     ancestral locus Anc_3.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668540.1"
                     /db_xref="GeneID:11497992"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:G0W686"
                     /translation="MKLVNFLKKLRNEQVTIELKNGTTVWGTLQTVSPQMNTTLTDVK
                     LSLPRNASQGISAGSVAIASVYLTNGTSGTSNNNPTGIESSTTSLQYINIRGNTIRQI
                     ILPDSLNLDSLLVDEKELNKLRKLGKVSDDSNRKRKRGFSENTTKRVRRAL"
     gene            complement(<652520..>654364)
                     /gene="NDAI0B02630"
                     /locus_tag="NDAI_0B02630"
                     /db_xref="GeneID:11497993"
     mRNA            complement(<652520..>654364)
                     /gene="NDAI0B02630"
                     /locus_tag="NDAI_0B02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668493.1"
                     /db_xref="GeneID:11497993"
     CDS             complement(652520..654364)
                     /gene="NDAI0B02630"
                     /locus_tag="NDAI_0B02630"
                     /inference="similar to DNA sequence:INSDC:YGR077C"
                     /note="similar to Saccharomyces cerevisiae PEX8 (YGR077C);
                     ancestral locus Anc_3.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668541.1"
                     /db_xref="GeneID:11497993"
                     /db_xref="UniProtKB/TrEMBL:G0W687"
                     /translation="MNNNNRIDPISHLITLLRSHSGTIPIETLPAILNNAIYYIPRAR
                     SKENLQYLVSSFFQSELWHQLKDPMELQRATQSIFQWKLEISEPIINLNDFFYVWNHS
                     IINCNKWDIIKLSILSGIISTNETFLQLQKQYFLDDSGRVQEMYTTWKQKYFLPIWCQ
                     SIHQWNYKPNDKSKSPELDDLVLIYSASQLDDSNMEFLMKNNIPWNFIVESCMKLSIQ
                     YITKGNLRDKRNQNDKMLQLNLNQVAKTLMTGIPRCDIRTVSKVLNNYTSVCFDVCTK
                     EVNHGNSEIKYADEYYSNIFIFILLTLKSCLQRSNKYGMIPELWYNQIILCLFYLNFI
                     ALDFGTVGFQLYDYVYDVTVTGIKMTSNIQFKNNGMSYYEDIINNLKGNIWLNDNGFA
                     NKINKSKMTFFLIFLQKTLPGLDGITGTFYNETITPLEYLCFEENNKDETIRDLLHGV
                     ILSVFDNIRFVSGTGLLIWQADHLLRYINLCYDQYHNKNNLSEKQLLIIIQTLGPKSV
                     FLRTFNRDLTGELLHLTYLRVINCSPNEVEQQKTFIKCIIFLLSFTDDRYMCDWLDNI
                     RELILKTKLDKKQYNELLHLLWNVISDIKSGTAIKWWYMHKESLRSKL"
     gene            <654702..>655703
                     /gene="NDAI0B02640"
                     /locus_tag="NDAI_0B02640"
                     /db_xref="GeneID:11497994"
     mRNA            <654702..>655703
                     /gene="NDAI0B02640"
                     /locus_tag="NDAI_0B02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668494.1"
                     /db_xref="GeneID:11497994"
     CDS             654702..655703
                     /gene="NDAI0B02640"
                     /locus_tag="NDAI_0B02640"
                     /inference="similar to DNA sequence:INSDC:YOL073C"
                     /note="similar to Saccharomyces cerevisiae YOL073C;
                     ancestral locus Anc_3.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668542.1"
                     /db_xref="GeneID:11497994"
                     /db_xref="UniProtKB/TrEMBL:G0W688"
                     /translation="MSLEGPTGLFQYPVTKLAMICTGAIPLLAAIGGYKYLFITRYDP
                     FISEYHQYYRLLTFQLASINESNVVLSILIWYQFRHLERLMGSYKYFSVITLLFLYTT
                     LIISCSNLIFNAFLPWNIWNRFPSGSLPLLLSLFHFYKQYTPQIYQFEILLTKPIFSK
                     SKDHNKQMKWELNDHFFLNTLIFILILNQDFVGIICGFVSWLCGVFVDKHLLPGLNKW
                     RLPYIWRYFNEYKSVQYTSGTNNVDPTVGIIMSSNTYNNGQQFSSTTSVNTLLHNGNS
                     HANNNNNNNNGSSNNGIGINISNPLQTQGTTQTTEEENAADEPVRPLGVQFLDTFRR"
     gene            complement(656174..656245)
                     /gene="NDAI0Btrna14E"
                     /locus_tag="NDAI_0Btrna14E"
                     /db_xref="GeneID:11497995"
     tRNA            complement(656174..656245)
                     /gene="NDAI0Btrna14E"
                     /locus_tag="NDAI_0Btrna14E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11497995"
     gene            <657989..>660778
                     /gene="NDAI0B02650"
                     /locus_tag="NDAI_0B02650"
                     /db_xref="GeneID:11497648"
     mRNA            <657989..>660778
                     /gene="NDAI0B02650"
                     /locus_tag="NDAI_0B02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668495.1"
                     /db_xref="GeneID:11497648"
     CDS             657989..660778
                     /gene="NDAI0B02650"
                     /locus_tag="NDAI_0B02650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668543.1"
                     /db_xref="GeneID:11497648"
                     /db_xref="GOA:G0W689"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G0W689"
                     /translation="MSVNDGTVEKEDIPLQQKPNHPVSQTTQVKKEIKNEKPPVNSDE
                     EEEEEEDIDALIDELQSDNEGQYDEEAEENERVAAGEARPIPEAMLQTNPEIGLTSDE
                     VLKRRKKYGLNQMSEESENLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGL
                     LLLNASVGFIQEFQAGSIVAELKKTLANTATVIRDGNLVEIPANEVVPGDILQLDDGT
                     IIPADGRIVTEDTFVQIDQSAITGESLAVDKHYGDQTFSSSTVKRGNAFMIVVATGDN
                     TFVGRAASLVNKASGGQGHFTEVLNGIGIILLVLVIITLLVVWTASFYRTDGIVTILR
                     FTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT
                     LTKNKLSLHEPYTVEGVSASDLMLTACLAASRKKKGLDAIDKAFLKSLADYPEAKNAL
                     SKYKVLEFYPFDPVSKKVTAVVETEEGETIVCVKGAPLFVLKTVEQDHPIPEEIHENY
                     ENKVAELASRGFRALGVARKRGEGHWEIMGVMPCMDPPRNDTAQTVAEARTLGLRVKM
                     LTGDAVGIAKETCRQLGLGTNIYNAEKLGLGDGGDMPGSELADFVENADGFAEVFPQH
                     KYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLS
                     AIIDALKTSRQIFHRMYAYVVYRIALSIHLEIFFGLWIAILNRFLTIELIVFIAIFAD
                     VATLAIAYDNAPFSQSPVKWNLPRLWGMSVVLGIILAIGSWISLTTMFLPRGGIIQNF
                     GSIDGVMFLEISLTENWLIFITRAVGPFWSSIPSWQLAGAVFAVDIIATMFALFGWWS
                     QNWNDIVTIVRVWVWSLGVFCVLGGAYYLMSTSVMFDRLMNRKPLHEVPKSKRSIEDF
                     LSAMQRVSTQHEKEV"
     gene            <661296..>663068
                     /gene="NDAI0B02660"
                     /locus_tag="NDAI_0B02660"
                     /db_xref="GeneID:11497996"
     mRNA            <661296..>663068
                     /gene="NDAI0B02660"
                     /locus_tag="NDAI_0B02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668496.1"
                     /db_xref="GeneID:11497996"
     CDS             661296..663068
                     /gene="NDAI0B02660"
                     /locus_tag="NDAI_0B02660"
                     /inference="similar to DNA sequence:INSDC:YGL186C"
                     /note="similar to Saccharomyces cerevisiae TPN1 (YGL186C);
                     ancestral locus Anc_8.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668544.1"
                     /db_xref="GeneID:11497996"
                     /db_xref="GOA:G0W690"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="UniProtKB/TrEMBL:G0W690"
                     /translation="MIEKQLEITKEIRFSGIDQPCDSFEEEDDNNSSNNRNDNSYLEH
                     AFNKVKLLSDKIDGLGVETTGIDRISPYERGTKTKQFLHVAGYWLSATGSLSSMSSFL
                     LGPLLFELTFKQTMCSGMISMVIGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFV
                     ALVAIIGVMGWSVVNSVVGGEMLASISNDKVPSWVGIVIVTACSFLVAVFGIKQVLRV
                     ETFLSIPVLTCFTLLYISSSDKYHMLSDFQNATLNKDTLKGNWLSFFSLCYSITATWG
                     SITADYYILFPEDTLKFQVFVLTFFGTAVPTLFVGTLGVCLATVAATYEPWDDSYKKY
                     GMGGLLHSGFKRWNGFGKFCVVVLILSLVSNNIINTYSAAFSVQLSSVRAAKVPRWFW
                     SICCTVVYLVCALVGRDHFSTILGNFLPMIGYWISMYFILLLEENEIFRRYFLHLYTK
                     EFPDYKKTDSSSVTDIEDSEDPHVSQSSGIMVNNSSQVIEKREVITNIHALKRKHIST
                     KNRYNWDKWDDAEVLTHGYAATLSFIVGIAGVVIGMAQAYWIGPVAAKFGEFGGDIAM
                     WLSMGFSGVVYPPLRYWELRRYGR"
     gene            <665985..>666494
                     /gene="NDAI0B02670"
                     /locus_tag="NDAI_0B02670"
                     /db_xref="GeneID:11498314"
     mRNA            <665985..>666494
                     /gene="NDAI0B02670"
                     /locus_tag="NDAI_0B02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668497.1"
                     /db_xref="GeneID:11498314"
     CDS             665985..666494
                     /gene="NDAI0B02670"
                     /locus_tag="NDAI_0B02670"
                     /inference="similar to DNA sequence:INSDC:YGL187C"
                     /note="similar to Saccharomyces cerevisiae COX4 (YGL187C);
                     ancestral locus Anc_8.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668545.1"
                     /db_xref="GeneID:11498314"
                     /db_xref="GOA:G0W691"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="InterPro:IPR020893"
                     /db_xref="UniProtKB/TrEMBL:G0W691"
                     /translation="MFALRQSSRRIIRPATRSLSLSRVIFQQAPKTTTTTKTDSQITT
                     GKTASSLAEVNGPETLIGVGAKEGTVPSDVEQATGLERLELLGKLEGIEFFDTKPLDA
                     SRKGTMKDPIIINSYDDYRYVGCTGSPAGSHTIMWLKPTVEKVARCWECGSVYKLNPV
                     GVPDPDHSH"
     gene            <668741..>670354
                     /gene="NDAI0B02680"
                     /locus_tag="NDAI_0B02680"
                     /db_xref="GeneID:11498315"
     mRNA            <668741..>670354
                     /gene="NDAI0B02680"
                     /locus_tag="NDAI_0B02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668498.1"
                     /db_xref="GeneID:11498315"
     CDS             668741..670354
                     /gene="NDAI0B02680"
                     /locus_tag="NDAI_0B02680"
                     /inference="similar to DNA sequence:INSDC:YGL190C"
                     /note="similar to Saccharomyces cerevisiae CDC55
                     (YGL190C); ancestral locus Anc_8.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668546.1"
                     /db_xref="GeneID:11498315"
                     /db_xref="GOA:G0W692"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W692"
                     /translation="MHMNQSLKNFDFKFSQCFGDKTDIITADADIITSVEFDYSGDYL
                     ATGDKGGRVVLFERNHDSKNAKRTCEYKFFTEFQSHDAEFDYLKSVEIEEKINQIKWL
                     NSTTQRSKFLISTNDKTIKLWKITEKNVTMVNENNLEGVATNISPLNSINQLKLPSLT
                     YHDKIISATPKRVFGNAHTYHINSISPNSDQETFISADDLRINLWNYDHPDQSFNIID
                     IKPMNMEELTEVITCAEFHPQDCNLFMYSLSKGLIKLCDMRQNSLCHDNKAKIFEEYI
                     DPINHNFFTEITSSISDIKFSPNGRYIASRDYLTVKIWDINMDNEPIKTINVQEQLKE
                     RLSDTYENDAIFDRFEVVFSGDSSSVMTGSYNNNFMIYPNAIKTNDLDTDMIVQPFNS
                     SKNNSNSNNNNNNQKIKTKKDGTILMTDTGATIPRTSLRNKRNNNNNNNDNNNNVDGD
                     DAMMMDDGFEGDLNDDDEEELDEIVLQANKLAFRNKGFGSLAQRSARNKEWGDNVDFK
                     KSIMHFSWHPRENTIAVGATNNLFMFSSI"
     gene            complement(<670683..>671072)
                     /gene="NDAI0B02690"
                     /locus_tag="NDAI_0B02690"
                     /db_xref="GeneID:11498394"
     mRNA            complement(<670683..>671072)
                     /gene="NDAI0B02690"
                     /locus_tag="NDAI_0B02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668499.1"
                     /db_xref="GeneID:11498394"
     CDS             complement(670683..671072)
                     /gene="NDAI0B02690"
                     /locus_tag="NDAI_0B02690"
                     /inference="similar to DNA sequence:INSDC:YGL191W"
                     /note="similar to Saccharomyces cerevisiae COX13
                     (YGL191W); ancestral locus Anc_8.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668547.1"
                     /db_xref="GeneID:11498394"
                     /db_xref="GOA:G0W693"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="UniProtKB/TrEMBL:G0W693"
                     /translation="MLRTNLIRRYATLPPNALKPAFGPPNTAMANAFKKTLQTEEGHA
                     SHTKNLWFKISVWVAAPAILLTALNTYFVEKEHAEHRKHLSHVPDSEWPRDYEFLNMR
                     QKPFFWGDGDKTLFWNPVVNRHIDHDD"
     gene            complement(<672049..>673941)
                     /gene="NDAI0B02700"
                     /locus_tag="NDAI_0B02700"
                     /db_xref="GeneID:11498395"
     mRNA            complement(<672049..>673941)
                     /gene="NDAI0B02700"
                     /locus_tag="NDAI_0B02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668500.1"
                     /db_xref="GeneID:11498395"
     CDS             complement(672049..673941)
                     /gene="NDAI0B02700"
                     /locus_tag="NDAI_0B02700"
                     /inference="similar to DNA sequence:INSDC:YGL192W"
                     /note="similar to Saccharomyces cerevisiae IME4 (YGL192W);
                     ancestral locus Anc_8.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668548.1"
                     /db_xref="GeneID:11498395"
                     /db_xref="GOA:G0W694"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W694"
                     /translation="MNLDLIHFLIENHVELCKVPVSGNIRDIFSLYLMSRDRVVDMDS
                     DALVQVMTYNDFINELKDVEIIVPGSIIFKNENAPSPHEFDTITFIDVVPLKILYYMH
                     FERKDKNSDSFDSRKSSELKTQPPLPTPISSPQPFDKFMDLLDMEKMDDMKTIRNNPL
                     NKVLLTKLNNILETEPQSYQLGRERAKESTPITNYIPSCMNHEHSSILSSTVYIVNNK
                     IISMQWSKLSKYEIENPEFVECLQNNIHYVPNLKPQTDLSLGDCSYLDTCHKLNSCRY
                     LHYLQYIPESLLTKISNETKKKNDEIEQNGYKIPFYSHGNCSSVAVKEQLPPQWIKCD
                     VRKFDFNIIGKFSVVIADPAWNIHMNLPYGTCNDIELLQLPLNHLQNDGVLFLWVTGR
                     AIELGKESLMNWGYKVINEISWIKTNQLGRTIVTGRTGHWLNHSKEHLLVGIKGDPRW
                     VNKHIDIDLVVSTTRETSRKPDELYGMIERLVGPHARKLEIFGRDHNIRPGWLTIGNQ
                     LTGTCIHEMDVKTKYDKFIANNNKNKENRYRLPNQQQKQNNNQNQSLNKIQRQPDFNR
                     NNHKRFNMSSQPLLSQNNNGINIMTNRNQINIAGSIPYSIQERTETSTPIQNTYFASS
                     TASSSS"
     gene            <674610..>675971
                     /gene="NDAI0B02710"
                     /locus_tag="NDAI_0B02710"
                     /db_xref="GeneID:11498396"
     mRNA            <674610..>675971
                     /gene="NDAI0B02710"
                     /locus_tag="NDAI_0B02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668501.1"
                     /db_xref="GeneID:11498396"
     CDS             674610..675971
                     /gene="NDAI0B02710"
                     /locus_tag="NDAI_0B02710"
                     /inference="similar to DNA sequence:INSDC:YGL194C"
                     /note="similar to Saccharomyces cerevisiae HOS2 (YGL194C);
                     ancestral locus Anc_8.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668549.1"
                     /db_xref="GeneID:11498396"
                     /db_xref="GOA:G0W695"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G0W695"
                     /translation="MSATFAYDTLTAAKQPLFEESFDNSSSYTPRVSYHFNPKVSNYH
                     YGVKHPMKPFRLMLTDHLVSSYGLHKIMDLYETRPATNEEMVQFHSEDYLDFLSKVTP
                     ENLSKMPRGTLEKFNIGDDCPIFQNLYDYSTLYTGASLDATRKLINDQSDIAINWSGG
                     LHHAKKNNPSGFCYINDIVLSIVNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTI
                     SFHKFNGEFFPGTGDYDETGCAKGKHFAMNVPLEDGIDDDSYINLFKSIMDPLITSYK
                     PTVIVQQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIPMLVVGGGGYTPRNVSRL
                     WTYETGILNNVLLPNELPEGIPFRDSFGPDYSLYPVLDDLYENKNSKKFLEDIRIRCL
                     ENIKYLQGAPSVRMDAEVIPTQDITGLTEDEEDLINELNEDDLSWRLKQIEKENSQLN
                     ELM"
     gene            complement(<676766..>684793)
                     /gene="NDAI0B02720"
                     /locus_tag="NDAI_0B02720"
                     /db_xref="GeneID:11498397"
     mRNA            complement(<676766..>684793)
                     /gene="NDAI0B02720"
                     /locus_tag="NDAI_0B02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668502.1"
                     /db_xref="GeneID:11498397"
     CDS             complement(676766..684793)
                     /gene="NDAI0B02720"
                     /locus_tag="NDAI_0B02720"
                     /inference="similar to DNA sequence:INSDC:YGL195W"
                     /note="similar to Saccharomyces cerevisiae GCN1 (YGL195W);
                     ancestral locus Anc_8.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668550.1"
                     /db_xref="GeneID:11498397"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022716"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:G0W696"
                     /translation="MSSTVSWEELSPLLDRRCNDSLVSRRIPFLESLKKVIDSETLEL
                     PQLTQISVILLKTFMTYQDTQSKELVTRIFQSILKIEPRLLEKYSTFILAQVSKNPGT
                     KAVSDYLNILDWVHAFLKDISSDPTLVSEYASRLLEAHTYTTFGIENVLDNQEGIKKA
                     QNKRNQHRRRIRESVLQSTTKTFTQCFKSTENGVPFLEIVLQNILESNTKQKLPITGI
                     VIAMGALTQSSMQLFSAQPALYNLLKEKYVEKYCTFLGKDILLAKVPPSAFTLEISLK
                     PFVKEFVTEALFNEHFVPNMEKANLRAPELGFAIANELYSGVDAKKINLLKVFTSSKL
                     MSQSFSSFKSSKEIVRELSSNSVITLLKSLNDETTEEPNLLKFIDEIFKNIKSNLNAD
                     YKYLVSKILVVVPTSSETVSTKIVQGLSTYITKEGKENALCLMLSAFFTHYFNLPTAV
                     DDMNKIIRNGFKDKTLNIRKCWFTIFLEYSKKASPSLLGEFETDCLEFVTSTLGHLHK
                     HDHKSLLGCLEYISASYTSGNKGLQDKVQNMIESLPESSALGDAFVTVALSTALPSTD
                     RLHSIELLHDSFIRHPKLLGLSIATAVEKCLNETTDDLSARMISFKYIAPIFNSISQP
                     IEDASVLTSVLIAQLIISQFTGFKLKNGWAGLVLQAKQDPATIVAAHAKQIIERIISI
                     TNDAKYIDTPFSECAFKAAAYTSFINPTAIAPLLSDLIKSDLAVGELPRLTAEDFEIW
                     EGNENVMVVNILDKKMVNKLSDKNTKDYETLKWEQSIRKEQAKKNARKYTKEEQALVN
                     EQLAKESEIRKRINSIKVRLHRAVKLIKQLSKESTLVDNGNQVWYPVAVNNLLRLAQE
                     PSSSKLVNTSINDTFLALSDNFSDRLETMGFFIGLAILRVHKVTNIPENYLEEPLEDL
                     LSRVLFRVKFVCNQKALDSISLTYLLPLLINVLEEGKRVSIKNADKPLARTEFVEEDK
                     EEEHLLLAMEIISVHADVFEDRSIPRIPIISVLLSLLKLPSKAKIAKDCFNALCQSIS
                     VSPNQDDLDIILSNLLSPNQFVRSTILETLDNEFELEPFMEFSPEIFICRFESDESNK
                     EIADFIWDFNKFKINDELITKLLTLFNQDDSGLRLFTAKAYAYASMYLAKDSASVLQE
                     HLNVLLRFYEEKSKPLEAILDEFGLVVVSAAERKDPWQDRSTVAITLKEMAAGLSEED
                     DSIVNTIKFLVESGALGDREPLVRQEMKEAGIEVITIHGANKSEELIPIFEHSLVSDI
                     PASIKENVIILYGTLARHLKKDDPRIHIIIDRLLATLDTPSSDVQEAVSECIAPLVFQ
                     FRSNVEGYIRDLMNKLLDPTCPARVRKGAAWGISGLVKGYGISALSEFDIIRNLMEAA
                     EDKKESKRRESVALAFECLSKSLKKFFEPYVIEVLPNILKNLGDSVPEVRNATAEATK
                     AIMGHTTSYGVKKLIPVAVSNLDEISWRTKRGSVELLGNMAYLDPTQLSSSLSTIVPE
                     IVGVLNDSHKEVRKAADESLKRFGEVIRNPEIQNLVPVLLQAIGDPTKYTEDALDALI
                     QTQFVHYIDGPSLALIIHVIHRGMHDRSANTKRKACKIVGNMAILVDTKDLIPYLQQL
                     IDEVKIAMVDPVPNTRATAARALGALVERLGEEQFPDLIPRLLDTLSDEMKSGDRLGS
                     AQALAEVISGLGLSKLDELLPTILAGVTNFRAYVREGFMPLLLFIPICFGAQFAPYIN
                     QIIQPILSGLADNDENIRDTSLKAGKLIVKNYATKAIDLLLPELERGMFDENDRIRLS
                     SVQLTGELLFQVTGISARNEFTEEQEDYNTETSTKLVDVLGQDRRDRVLAALFVCRND
                     TSGIVRATTVDIWKALVPNTPRAVKEILPTLTSIIVTHLASSSNVLRNIAAQTLGDLV
                     RRVGGNALSQLLPTLEESLEESSNSDSRQGVCIALHELIESSSGESLATFQDIIVNII
                     RKTLIDVDESVRSSAASAFDAYQNVVGNLAVDEIIPYLLHMLKSEDDSEYALLGLQDI
                     MSTKSEVIFPILIPTLLASPIDAFRASALGSLAEVAGSALYKRLSTIVNAVVNALVSD
                     HPDEETKHSLETTLDKIFLSVDEDEGLHPLLQQIMSLLKSDDKAKRSVISKRLPNFFE
                     HTTLNLDIYVPDFVSYAILSLDDNDPEVVEGNFNALTALLKTQDKSMLEKLVKPAKQA
                     LALTGTQGEDLAAFKLPRGPNCVLPIFLHGLMYGSSDEREASALAIADVVSKTPSANL
                     KPFVSVITGPLIRVVGERFSSDIKAAILFALNILFVKIPQFLRPFIPQLQRTFVKSLS
                     DPSNETLRLRAAKALGTLIEYQPRVDPLVVELVTGAKQATDEGVKTAMLKALLEVIVK
                     AGNKLNETSKNNVVNLVEEEMLSSNDKLAIAYAKLIGSLSEILSPSEAHKILEEKVLS
                     VDLNEESGKFAILTLNSFLKDAPGHIFNPELIDSFVKYIINAISSTNPYFGENGIIAA
                     GKLLLLENEKKSPFSKNESSSPFALGEENIKNLIDVLATASLQPTCNSADCRRVALVV
                     IRTMARFKFDECVKPYITVLGLSVFGSLRDPIIPVKLAAEKAYLALFKLVEEPDMKTF
                     NEWFSLTSSGETSTTTIVGTSIQFRSIGDFTKRVGKRLATVERDRIAAGGDAETMFSD
                     RFEDEREIWAVGGVELNNNDI"
     gene            complement(<685132..>686418)
                     /gene="NDAI0B02730"
                     /locus_tag="NDAI_0B02730"
                     /db_xref="GeneID:11497670"
     mRNA            complement(<685132..>686418)
                     /gene="NDAI0B02730"
                     /locus_tag="NDAI_0B02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668503.1"
                     /db_xref="GeneID:11497670"
     CDS             complement(685132..686418)
                     /gene="NDAI0B02730"
                     /locus_tag="NDAI_0B02730"
                     /inference="similar to DNA sequence:INSDC:YGL196W"
                     /note="similar to Saccharomyces cerevisiae YGL196W;
                     ancestral locus Anc_8.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668551.1"
                     /db_xref="GeneID:11497670"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR026956"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:G0W697"
                     /translation="MTDLLSKYKGTTIDNLPTPCFVINEKKFKSNCRNMLNSIHKLED
                     NVGKHISFRAHVKTHKTAQGTFKQLGHGVASSKGSNSILVSTIKEAKGILDYQEVMNL
                     DYVKDIAFSLPACVPSYIRELSHLSKRVNYLRVFVDNIEHLENLRRFGPPSSNSKWSI
                     FVKIDMGTHRAGIPTDNKDFLNLLKRLFSPDIQKIANCYGFYAHCGHSYSARSVKEAA
                     NFLKEEIVAVNTAAKIALSIEPGLEPSGLVLSVGATPTSNSLQILEDGALIEYIKEEL
                     ISALEIHCGNYCLYDLQQVSTKCVELDDIAGTVLGTVVSSYESRMEILTDTGVMSLTR
                     ETSAYKGFGLCRDLSSIMQDTRPNIEWYVDRVSQEHGILKKYDAKGEQQELLPLGSKV
                     AILPQHACIVMGQFDFYFILDEQNQVVDVWTPFQKW"
     gene            complement(<687699..>692252)
                     /gene="NDAI0B02740"
                     /locus_tag="NDAI_0B02740"
                     /db_xref="GeneID:11497671"
     mRNA            complement(<687699..>692252)
                     /gene="NDAI0B02740"
                     /locus_tag="NDAI_0B02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668504.1"
                     /db_xref="GeneID:11497671"
     CDS             complement(687699..692252)
                     /gene="NDAI0B02740"
                     /locus_tag="NDAI_0B02740"
                     /inference="similar to DNA sequence:INSDC:YER132C,YGL197W"
                     /note="similar to Saccharomyces cerevisiae PMD1 (YER132C)
                     and MDS3 (YGL197W); ancestral locus Anc_8.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668552.1"
                     /db_xref="GeneID:11497671"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G0W698"
                     /translation="MPLLQPSTCTCYPLQLPTLTSNQKLLDEPTKKRISLECRTGAAT
                     ILARSNIFVHGGLTIPLNLEGQINSLQLQKELILYFSKEKNNGISFENLNQWISSETF
                     FLDLISRTWYRVETTLQKVDDNESNNNNNDDSNDNGNNIQKNIKSDNDNNDNNNDTND
                     VDDDDNDGNETYSEVGSTHIIIESQLKERLFHSICYSKSCLYIFGGLIVSPQNGYELI
                     ATNELWKLDLRTKTWILLSKDPRIARRFNHTMHVKNENNDKRDTKLVIVGGLNNLDQP
                     IHKIDIFNITQNCWQSDSIPKDPLDVRSNIDGVDVSLNDDVNFTVLVDNNEAKIPALA
                     YYSPNFQNVTSDTEDNLEGQGTIDSSGTENFSSPIVILPLITEAKGIRMDYNEAQTGS
                     LLKRPFNLQYPTGDYFGYSIIIGGFYSGTNALDFYCFVYDIPSGKWTRLGIYCPDCDE
                     YTHRFWKIFVWKSHHQAIMLGTKNDDSCSPTVQRFDYLSTFGLPIINVYNKALQPGLR
                     NLLATPLPSSTKENETTEFNDDDQPFRKLSFTFSATSQFESYIHYIAPPLDKNIIKSV
                     FPPYAMVLGKDALEIFGKPLSDFEFITSEGDSIGIPLYLLRRRWGRYFDMLLSRSYAQ
                     VCADYETTGNQSTLIKISSRNSKSGSKDFQTESRLSSSGSLENYFNRSSVQWPYTRKS
                     SILGPTTNNLGTAGTKNTGTSEPSHISKGETPSKGTSTTETTAEEPRNYYRKEEDDDP
                     ISSYALTKNPTTESRYSQATTGSTTSSSGGMVFRVPFQEKNGTSSAQLRTQGYSSNDY
                     EANPQKRRSSLLGIPDRDMLKVLSSDAHRRSSHPTLSYIERRNSSTVPQQSPLRVPTS
                     TRSSISYVSSSSDRMGNPMNQSRAGSFTESPVLGVLNINLPPQASIPIDPLPPIPGHE
                     SKLPNGRRNNSIGDYFRNSNFPTRRNSLRRASTPDLVRPSDSLDASIDRQLLDEENED
                     ERDSSSQRKSSFFPPRFGSGSKSIDTSRNSITDERGRLSVTSCTDSLNSRSSNVTLEV
                     EPLLTPRSLYMPWPTATVRAFAEFFYTGQVNNKWMLAPVVLDLLVMAKIYEFPLLYNL
                     VAEVLYSIVGRKEENLAVTCKALKETFENKVLIYCEGNSEKTKLFLRKNENFKELLRL
                     KRCLENLDNGYFDIDLVRNASRTHSTSTFESNAADYLDKIMNRDSGISSSINYVPTAF
                     AGGPRDSHNSVGSLGFPPSLNIQPGRQSVSGYAQRPKNKSSLSKEIDPTSFPEFNTNI
                     GPLSGGFRKESAVDPKSNIPDYLNITDDISLSTTSSSSSSSSDYDDATEQESSTENKG
                     PKIDSTKDSEMNSGEKETISRESNQLKDNFPKETRSDSDDYDSGLAMLSLNKMRRKVK
                     KGEDHDDSIDPLFKTNNNTNIQSPKKNYGTFARYGSSLGSKAFRGEEPENDFSMLTLE
                     NLASRNSLPPVDYIIKSIYKTVVLVNDIRLMVRCLDCVEISKGLKVLKKKFSQEIQAI
                     DKDIAAKNVTATTVAKENKEVPT"
     gene            complement(<692830..>693570)
                     /gene="NDAI0B02750"
                     /locus_tag="NDAI_0B02750"
                     /db_xref="GeneID:11497672"
     mRNA            complement(<692830..>693570)
                     /gene="NDAI0B02750"
                     /locus_tag="NDAI_0B02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668505.1"
                     /db_xref="GeneID:11497672"
     CDS             complement(692830..693570)
                     /gene="NDAI0B02750"
                     /locus_tag="NDAI_0B02750"
                     /inference="similar to DNA sequence:INSDC:YGL198W"
                     /note="similar to Saccharomyces cerevisiae YIP4 (YGL198W);
                     ancestral locus Anc_8.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668553.1"
                     /db_xref="GeneID:11497672"
                     /db_xref="GOA:G0W699"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:G0W699"
                     /translation="MAAEDSIIEPDVIEPDTTTNHGSTGPSPSSIANANGTANPFASP
                     SDPIKRGTLDESVLTTLKRDVSEINSRLKQVVYPHFPTRTLLPTSEPGNSIESNVDIS
                     GHSDLWAPLTFIILYSLCVSHAKSLFSSIFVSCWFILLVMALHLRLTKPYDNISLISY
                     ISLSGYCLFPQVINAFLSQVILPLFLKANYNTWIIRVLTILKLLFLAVCLKWSVTAIT
                     LVTKCKDAVQIFPLGLCFLGFGWLSTML"
     gene            complement(<694100..>697327)
                     /gene="NDAI0B02760"
                     /locus_tag="NDAI_0B02760"
                     /db_xref="GeneID:11497673"
     mRNA            complement(<694100..>697327)
                     /gene="NDAI0B02760"
                     /locus_tag="NDAI_0B02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668506.1"
                     /db_xref="GeneID:11497673"
     CDS             complement(694100..697327)
                     /gene="NDAI0B02760"
                     /locus_tag="NDAI_0B02760"
                     /inference="similar to DNA sequence:INSDC:YOL087C"
                     /note="similar to Saccharomyces cerevisiae YOL087C;
                     ancestral locus Anc_3.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668554.1"
                     /db_xref="GeneID:11497673"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="UniProtKB/TrEMBL:G0W6A0"
                     /translation="MKQLTVSYGLISPQTDTEHKNSHILPISKIYTCPDLNLFLTGGR
                     DGSIIINANDKEQGKTKKRLQVHSDWVTDLVRIPGTTKFISVSHDFSIVLFEIFYNGD
                     PDSWNMKIVGSHDDYIKCIVPLLSMSNDDSEFWFATAGLDKKIKIWKLFGFEFSEISL
                     IHVFDNANTQDDTGSIYTMVSVQNDTSNLPFDLVVGDADGNIVLYSCQDKIEVKRLKH
                     VHSTNIKVIKLLENSTKLLTTASDGIINLWDLVPSVRNVNAENVYKPTRIGSWKWDCS
                     IWCIEGSSLYDIVIGDSMGRISKLDFDLIQNDDILNVYHKEVKFTSYFNPGQYKRSDT
                     NGKTITKNIESNGEQSSTDQKKKKKVHGGVLDMKFIDQDTLLFSFCDDSNLNSLNLRV
                     NKLTINKGGFALTRSSLLTNRRHVITENTKGEVQRWDIVSCELLNTFPSNEGSFDDIV
                     IRFTSKEILSHWCTVSVKVGVLFVKINEKFLSTEIYGSALEKYEIINDIEINAEQRYN
                     LGKIVINSLFNEFLNYEAQKDEIVRKRILTKKKSIHHHQKDTAKNSKNSIGKHRNNVF
                     SKLNSSASNLADSYDSSFASVPGTPLVRNLENKGMDISISNTDQFLLKPPGSAPPLTT
                     NPLESVDPLDIVQPSPMDRSASSSHYNMLSRRFKSFRENNSKQNLIGVNTPEENMSDI
                     DGGFVTSENSKDVSTEPLLWNQESSTENGVDKNVSNFALGPINTNLEKLRNEESSRMN
                     SISSINSPMMSSIAVTNAGKKEDFMSDLLDEIHNAYIQEYNNSNSSSLKILSKKSLES
                     KIEKDLTCPLIQVKSGSLILVHCWNDGSCGGRVLFSTYLPPSRSPHKHKIGEGNSSTN
                     YDDDRANDSKDHSSDLGDSALVDSSRVFKDDVLLEEDEFEHDEYGTGIRKRQIFEQFE
                     RNLPYWFAKTLFKNVKIVEIEQPKVNFIIAPWVGNREEALNGTSTDSKGNSNDTQFHY
                     RLKFGKSKEQTLASTDLPKVSDANAKLIAPGMIKVKKIKLYVIDRFDGKTPEMKAKQD
                     PSIWLELLCRDQVLDNDMTLSTVRTLYWKSQGEIIINFRRKPNTI"
     gene            <697765..>698070
                     /gene="NDAI0B02770"
                     /locus_tag="NDAI_0B02770"
                     /db_xref="GeneID:11497674"
     mRNA            <697765..>698070
                     /gene="NDAI0B02770"
                     /locus_tag="NDAI_0B02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668507.1"
                     /db_xref="GeneID:11497674"
     CDS             697765..698070
                     /gene="NDAI0B02770"
                     /locus_tag="NDAI_0B02770"
                     /inference="similar to DNA sequence:INSDC:YOL086W-A"
                     /note="similar to Saccharomyces cerevisiae YOL086W-A;
                     ancestral locus Anc_3.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668555.1"
                     /db_xref="GeneID:11497674"
                     /db_xref="GOA:G0W6A1"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR029003"
                     /db_xref="UniProtKB/TrEMBL:G0W6A1"
                     /translation="MDQQKQTERLKAELWCAVDKQVKELVPSLNVKGNITYSPKFINA
                     LMSLTYLQLTDIGTDLELFANHAGRGTITRDDLMLLLRKTPLLQEMVSNLNMNSLEQ"
     gene            complement(<698294..>699433)
                     /gene="NDAI0B02780"
                     /locus_tag="NDAI_0B02780"
                     /db_xref="GeneID:11496229"
     mRNA            complement(<698294..>699433)
                     /gene="NDAI0B02780"
                     /locus_tag="NDAI_0B02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668508.1"
                     /db_xref="GeneID:11496229"
     CDS             complement(698294..699433)
                     /gene="NDAI0B02780"
                     /locus_tag="NDAI_0B02780"
                     /inference="similar to DNA sequence:INSDC:YBR145W,YOL086C"
                     /note="similar to Saccharomyces cerevisiae ADH5 (YBR145W)
                     and ADH1 (YOL086C); ancestral locus Anc_3.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668556.1"
                     /db_xref="GeneID:11496229"
                     /db_xref="UniProtKB/TrEMBL:G0W6A2"
                     /translation="MILYLISVILLVILLLITNLKNFIIRKLKFKNLKQMTKSSELLP
                     RYNDIQNSSGSQNISTLSLNEIDTYPETHYQLKIKIIYINNRYTIARIISKRIGVHPI
                     WEINDLIILSINNLKLKLDENFNFTNTTNVLFRIPFNSISLSHNHDYLVKLLTVLNVN
                     AIGWNHALNQPRSQLRPGKWVLIPALTDNVDNITSALVGVRLAALRGLRVALVLFHDV
                     LSNHVANTDDLKEKFLEAGGELFLTGEEDWVFQTMDATDGEGVHSIVVDCNEFQTGKD
                     AIESMIIDCLVVSRKNGTLILTGQESQDLKPHDLKCISDVFTQVTKSVSIIGSNEGTR
                     FDVRQVSGFVGRKLFQLPITVIQAGTTEAVNPTALKVNEIIHINE"
     gene            <700989..>703955
                     /gene="NDAI0B02790"
                     /locus_tag="NDAI_0B02790"
                     /db_xref="GeneID:11496230"
     mRNA            <700989..>703955
                     /gene="NDAI0B02790"
                     /locus_tag="NDAI_0B02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668509.1"
                     /db_xref="GeneID:11496230"
     CDS             700989..703955
                     /gene="NDAI0B02790"
                     /locus_tag="NDAI_0B02790"
                     /inference="similar to DNA sequence:INSDC:YOL084W"
                     /note="similar to Saccharomyces cerevisiae PHM7 (YOL084W);
                     ancestral locus Anc_3.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668557.1"
                     /db_xref="GeneID:11496230"
                     /db_xref="GOA:G0W6A3"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:G0W6A3"
                     /translation="MATEDTSSSTSAFVTSLIIYGIIALIFIWLFLTLRPRNRRTYEP
                     RTLTDIQTIKEEERTDEVPSGYFQWVPFLLGKPHSFLIQHTSLDGYLFLRYIGIFATT
                     SLLLCFILFPILLPVNATNGNNLKGFELLSFANVTNKNRFFAHVFLSWIVFGLITYII
                     YKELYYYIILRQAVQTSPLYDGLLSSRTVMITELDPSIAQEGELEKRFSKAVNINFAH
                     DLSHLEKHINERRKVSMKLESSLNKVIDKAVKRYYKYNEKKPEKLFGPDNNKPQANLE
                     TYVPYYSRPSHRINTRFPFFPFGEKVDTIHHCTEELAQLNDKVHTQQRKWDKNEKLPA
                     AFIQFDTQLEAQECFQSIEGLLGPKSFGRKLINSVPEDINWSNMKLSSAERKSKRILA
                     NSLMVALIIFWAIPVAVVGCISNINFLTEKVPFLKFINNLPNFLMGLITGILPTLMLA
                     VLMSLLPPFIKMAGTLSGCLTKLETDQYCQKWYYAFQVIQVFIVTTLASSASATVEAI
                     IRDPSSAMTLLANNLPKASNFYIAYFLLQGLTVPSGSLLQALNLVLQNTMGRILDSTP
                     RQKWKRYNTLSKPDMGVIYPTMEILVCIYISYSIIAPLLLVFSTIALFLMYIAYLYNL
                     NFVLGFSPDFRGRNYPRALFQVFVGIYLSEVCLVGLFIMAKTWGPLVLECFWIVVTAL
                     AHIYMKRKFLPLIDAVPLSVIHYARGEPNYHYPSEDLGLKEVQDIGKVAKEKVDAGEF
                     TGVIRPATHADLKRANLLRDDDQEESSSTKSSTSSDPNATMKNYNPSEYTSGSSSKKM
                     SVGGNDTLKLQNTSTFVEDEEGKFRKYHYDDVKGLKDLNRGNNDRSAPDGVLAVADYG
                     NMYGDVGAVKNAPEAFPPNITEDVSFFGRIRNFFNPKNSYPFEKVRTRLPHVYNTTVE
                     YDQEYLTSAYTDPIVNEKDPIIWICKDPMGVSKQQIEEAEDSGAKISHDFAEYNEKGK
                     STFTFNPPDYEPPVKK"
     gene            <704381..>707194
                     /gene="NDAI0B02800"
                     /locus_tag="NDAI_0B02800"
                     /db_xref="GeneID:11496231"
     mRNA            <704381..>707194
                     /gene="NDAI0B02800"
                     /locus_tag="NDAI_0B02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668510.1"
                     /db_xref="GeneID:11496231"
     CDS             704381..707194
                     /gene="NDAI0B02800"
                     /locus_tag="NDAI_0B02800"
                     /inference="similar to DNA sequence:INSDC:YOL082W"
                     /note="similar to Saccharomyces cerevisiae ATG19
                     (YOL082W); ancestral locus Anc_3.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668558.1"
                     /db_xref="GeneID:11496231"
                     /db_xref="InterPro:IPR024543"
                     /db_xref="UniProtKB/TrEMBL:G0W6A4"
                     /translation="MCEQTPMEEKLPEVSWPTGKQYYIDNGFGLVAVNPKALTPYFLL
                     KAFPKARIISNTRDYIFPREIGLEFDELRRVLAGNIAISFKVSDRYLKYQSQKFDSNN
                     AEPVTINDAQVGGQKIYAFYDKGKYNEFNLASVTPKDILDGEPIVMSILNCKVVDSSK
                     IAPHRVLSNPDFATLKNELESPAPTLIKLTKKYLEAQVKIPEVNNIGESSYPNALTPN
                     HLLKTFSTGRIISNTRETGSVPKEIDQFVKLTIPDGKSIAAFPLEDVSIEKILDVIPK
                     TIMLRNYPNVTMRSQNVYSDPLPGFQEVRMLLADKAPKEIVLSANYLKQEEKTFNASL
                     RTPDIIIYLGEPAPLKDIKLNTLSPTKCLELFPTTFHLRTNNDTSFRTSAELTPNPGY
                     DFQDVKKLFAKQGEHVVALTKCYLEQQSALNEVEKHGSSLNSSNSGFYFIQGKAPAMF
                     CSSDKLDPSYLMSLSEELIEISNCTGSTQANSLFRYNVTQDFETVLQELLSKNSVTFV
                     LSKSYLLKQATRLDKNWNDMQYIQTENTHIYISMKDERLGAYPARKATPALLLGFFTE
                     IFITNSYPDKDKEFTKYLADDFNDFSVVKNILLEDRFISFQISRQFLKNCCKKSISSE
                     VKGTKDCTAVSSVNSSSNYNEGIQVTDNSIAKRQILLSEAAIVQLNATIQKTINYISK
                     GDEKERERSSSKKVSLFNTELETDDETHDFISTLKTSEDLKKVVNGYPKFKEWRYIGG
                     KDESEIDERFSSKDNMIAQVSINHELENIKKPEEFLNSTALEVTMERRYKDIKFTLTN
                     RGKSDLPGNSKFVVQYSIEHHGVAHVADVTLDMGPHKLLIGSKKHLLWSPPCPIHNGI
                     VVDVVELSTEDGFVFYSGKVHDNNFELSTPALSYEHLEVNEQYYNSLEKRKQVNLLVR
                     AMYQRNLFPLILQQDKLGRNMIC"
     gene            <708172..>709233
                     /gene="NDAI0B02810"
                     /locus_tag="NDAI_0B02810"
                     /db_xref="GeneID:11496232"
     mRNA            <708172..>709233
                     /gene="NDAI0B02810"
                     /locus_tag="NDAI_0B02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668511.1"
                     /db_xref="GeneID:11496232"
     CDS             708172..709233
                     /gene="NDAI0B02810"
                     /locus_tag="NDAI_0B02810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668559.1"
                     /db_xref="GeneID:11496232"
                     /db_xref="UniProtKB/TrEMBL:G0W6A5"
                     /translation="MYSLNKLTTLTYKNVTVNASITTEDFTEQEFNHVLLKCFGLVDA
                     VQSKDIQWLSDHAECGKIATAHDLEKLRVAFDHGFITISVYDKPVEGTSSLEPEEYVS
                     VDKYPQEEKNLELEQQDDVVGILDDKGVKEMVIVPDNSNCQIESNETKEMEHDLLEDI
                     ISKMNVLTKVIKGKQTSKDSELTEETSSITLPLTSDIDKGMYDFFKTKCSREALKDIY
                     QIYERYKPLEALELPSMLKVSVKHFPEKREIRFLITNCGTTPLKEDCRLRYWNDEALG
                     AGDSLRVSLRKIEPGCPVVSVGRYSKKRRYFDNPGKIYMAIRLSGSDLIWRADGSENE
                     VVFYNFTKKAGTVPSHGIF"
     gene            <711163..>720060
                     /gene="NDAI0B02820"
                     /locus_tag="NDAI_0B02820"
                     /db_xref="GeneID:11496233"
     mRNA            <711163..>720060
                     /gene="NDAI0B02820"
                     /locus_tag="NDAI_0B02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668512.1"
                     /db_xref="GeneID:11496233"
     CDS             711163..720060
                     /gene="NDAI0B02820"
                     /locus_tag="NDAI_0B02820"
                     /inference="similar to DNA sequence:INSDC:YBR140C,YOL081W"
                     /note="similar to Saccharomyces cerevisiae IRA1 (YBR140C)
                     and IRA2 (YOL081W); ancestral locus Anc_3.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668560.1"
                     /db_xref="GeneID:11496233"
                     /db_xref="GOA:G0W6A6"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:G0W6A6"
                     /translation="MNRQPSYMVDTLVKHFFNERIFPILPIESGFPSYLEVESEPSYI
                     SCRSVIMNIAISKDLNPIAEQTMNLIETILKNESIISQNTTESAIQSILALLRLLSDT
                     MEYFWDYIESHNTEKSKKSKDEHYEKKKNLFSGSIMGYSVGRSGFHQKPPNLLNSELA
                     LRLINLCSKLKFNTRTLDVLRDMASNLYGVDSLLSATALVKYQTFLKQKNNPEYARMV
                     DITLSHILRFVAASNPNEFFKYIRANIQDPLTTASKSEFQVVQHFEMLGCAYITIDTL
                     PKFLNIVKLLFRGIKRIIFTCMLLFFSSKSLTFWYMARPNEYVQLFDLLKNDPMKTNV
                     YTKTLTTTVSTLFDQIYSDFDVANILSSLQHHTVLQNSQTTNTVGTATQSDTSSTNSN
                     SNSSILTNDPSLPQVTIPATSLLSNVDSDFLRTADDSTHQPRTDLPAGKKSGLGNTKD
                     TLHLENILELYTYFDDTEILPHTAILRFLITLVVLDTDTFVELNSQHFEYLSDPEKNL
                     KNVLVPEGKDSDINSNIKHITSGLKKLTTLQLSKKKSVKFMTLLIKNLNGAQAVAKIL
                     LPDSLRAAISLVSIMASVHLINKEIPSAVFAKRLISLLGSNLELGSPWSVPPNKTLVN
                     CLDRNSVSRNHIRLKFFAAALQFDPDAFLAKLGITDVTLPTLNLEEQIFYTEAFRVFF
                     HLPSTGDLRKEIAYKTSAFFKSLFCSVADILLEAFPYFNDKISDIVSSILDGTILDEF
                     GTRKLFRGSTTSLAASLNSASSYQPSERSVLSPSSYDGDAAQALFFSPSMLSKASISR
                     SSPTSASQDDDTSTSTSSLSSTNHGSSNTPSAIDLPFSHLITPRTRPVGSSAVKNRFP
                     PVTSLLNSEKSVTTDLSPTSNLSASLMTLTNSTPTPTLQPYKLTSKSGRLRRYSEEST
                     HSVSMLETLNLESPVFLTSVESMNARKIMINIFSIFKRMTNYFILPHSRNANQLWISS
                     DFKNIIKPIFVAIVDSDRNLQSTARAFMDVLVNYIKEFSADTSTITVSGYFLICSYTI
                     SLFSMGLFDLNLESHKRGVLLDIVQNFLKLRSYLGTVAENTHHMDNVVEAERTTFPLI
                     VGTVGRALFVSLHTDDPVIQKKLRIAFAEFLTVIKFHQKYIGPIDKNWIFNLPFLEAM
                     SKEIPRTAGAVAAQRHIRTNILKHILQPDSILLDSMNALLKKWYHLAHCNTRTPEETA
                     NFRSIAGIIASVSGPFLVIQKQQGEQYPYLLEFATELRKEMNYFIGKQCEWLNSPDLL
                     TRENSREILGDELHPLSFKLLFDNLKCHIRALSDIDLTKPEEEYNFILLQQLIAVLRS
                     ILKRSDDQKIMVIFSIDVIDVISQLMRIIKGISKSSRKYYRAIIYMTKVIKALEYSEN
                     SLALKHHYHLKNKWLKLIISWFKSTISKELDLENLSKPHREVNLRRRDLDLLYIDTAI
                     ESSIAIAYLTENLPLEIPVTASEEEGRRSESVIYGNYFNILLKGLEKSMESDKFPPSL
                     AHKMSVLNENIILALSNLSNANIEASLQFSVPMGYSKNRNIKNAFLKVFTNSLSQYPL
                     DKGRFKKSKLFGIDKLLLYTVKFPQLVVAAGKVCPAHELDAYAAVLINGFETRNASHL
                     CVSELIKDEIEHVSRPMDILRRNSCATRALSLLSRTKGNEFLIKALRPVLQKVLENKD
                     FFEVEKLDPNDPEAALQVALFEKYMTDLLASITEALPYFPPEFFYICQTIYTATKKKF
                     PDYAYIAAGSFVFLRLICPALVSPESENIIEISNSDEKRPFISLAKVIQNIANGSDNL
                     IKWPSLANKSEFLKKCSDHIFQFLVETCRTDREINIVVRTDPEPIPFDFDFLHRFLYM
                     KGFEIRKVLLDGLRSLDDCVFFRSTFLLVDKLLGDAGPPEMKYSNEIPPFIREHIDEY
                     PQLYEFMSRHAFKKRPTNDDFLFVHESMSNDGIPIITLMLKKFKTNGIGVEDVAFKFI
                     QIYSRIWITKHCLVLDCTEFSEYELDIKKLNSLLFNILPSFSVQNCIKIFLFNATEVF
                     LRAWLTYCEQGSPYLTMKTPHCFINSNTDGELVKSLGLTGQGLSILQDIRISLKDVTL
                     YNSDTKKPVPIVMKIGNKYLQVLQVTPKLINSKTLGSSFDVKFNQVFRISEISSVHVS
                     STTGASNEFTVNFVDGASLIFYSQKYLEIVKMFYYAQMRLSNEYGENLYEPIGEIKST
                     EEDKQIRDNYELIGHLILVILVGLYDDDDIVKNNAYNLMATSRNAFNLNFGANFRGAT
                     EIYVPNDTTTFVTMVSKSLAECHPELTPYICKYILNGLETGIILHEHVPQTICAWSYW
                     IPNLYEHIYLLDDEEGPDVISRILRTLIRLTVSEPDFATVYHRQVWSLLGADGRLTAP
                     LVEEIINHALERDSEDRDWKKTLSLLTGLPTVEVACTIVQRLMKLIKSFLPSLRLEAL
                     TQSWSELMILVKASSHLFFEAPFLAEMFLPELLFIVSLLIDVGPPEIRSSLHELLMNV
                     CHSLTINEILPEENRRNLDETLTVFSRQKMKFIFGFSQDKGRLLQNFSASSFSSKFTV
                     LDYFTTNIMLVMDYASTTESAQWKTKFKKYLTDAVFQDESFLASRAMMMLGIIGQTYT
                     SEMFCRSLLQETLKTIAQPVVTDELIFLIIAQLFTYSKVVQGLDPSLDLMTEMFWLTT
                     VFIESPHAAIFQGGLIFMTSCLDRLYMNYFNTNNSGKSLISLLINTRGFASPLLKELE
                     TMNGIIWNEENFVHILTAYIKRGLTIPFTRNTAISTLHMLFKNTYLEHRICATSNGHL
                     NYLYLLFQVLNAEEFSQVLEEVEYEDEMIDLNDVNKVPKSLLDWLSSGCSSSSIALYQ
                     SALLFNGNILDESSKLRTILVIRYLLHRNPRCIFNFYVIISDEIRKAASMEHFSDCGP
                     VAFDIISLLVLQPEFNDLAKYNTRTVNYLKEKGLYKINITEIAEHNFNDLMMGLREDP
                     ELLLERKRLTVMILSRMACHV"
     gene            complement(<720207..>721022)
                     /gene="NDAI0B02830"
                     /locus_tag="NDAI_0B02830"
                     /db_xref="GeneID:11496234"
     mRNA            complement(<720207..>721022)
                     /gene="NDAI0B02830"
                     /locus_tag="NDAI_0B02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668513.1"
                     /db_xref="GeneID:11496234"
     CDS             complement(720207..721022)
                     /gene="NDAI0B02830"
                     /locus_tag="NDAI_0B02830"
                     /inference="similar to DNA sequence:INSDC:YOL080C"
                     /note="similar to Saccharomyces cerevisiae REX4 (YOL080C);
                     ancestral locus Anc_3.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668561.1"
                     /db_xref="GeneID:11496234"
                     /db_xref="GOA:G0W6A7"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G0W6A7"
                     /translation="MALSSNWQKLQTTKKVVTKTKKVTNANKVYKPKAARKGSKIMNM
                     VYNINNEIAKQKLNKEEGKVFEFKTAPDTIISETSEAITLQGNITSNKAKEIGKFIAM
                     DCEFVGVGPEGKESALARISIVNFFGHVIMDEYVKPREKVTDWRTWVSGIKSEHMKNA
                     ISFKEAQKKTADILKGRILVGHAVKHDLEALLLSHPKIMIRDTSRHLPYRQKYAKGKS
                     PSLKKLTKEVLKLEIQTGEHSSVQDAQATMLLYKVSKKEFEHHHKTMFGFESR"
     gene            <721322..>724858
                     /gene="NDAI0B02840"
                     /locus_tag="NDAI_0B02840"
                     /db_xref="GeneID:11497974"
     mRNA            <721322..>724858
                     /gene="NDAI0B02840"
                     /locus_tag="NDAI_0B02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668514.1"
                     /db_xref="GeneID:11497974"
     CDS             721322..724858
                     /gene="NDAI0B02840"
                     /locus_tag="NDAI_0B02840"
                     /inference="similar to DNA sequence:INSDC:YOL078W"
                     /note="similar to Saccharomyces cerevisiae AVO1 (YOL078W);
                     ancestral locus Anc_3.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668562.1"
                     /db_xref="GeneID:11497974"
                     /db_xref="InterPro:IPR008828"
                     /db_xref="UniProtKB/TrEMBL:G0W6A8"
                     /translation="MVRCSSRGKLYCFCFTLERLLFNISIGLSISRRNFDDLALMDVV
                     TSINKLRAQFMQIGLERDQMKRVFKPYNPNSAMDDTEIRRLYQDSDGVDLISEMESPP
                     ISKNFMDASYMTINQARLKKMKTSKQNVSNPYNVSGYEETENTFKEEETSVNGEPSTL
                     EMAATEVSKADTLKRNDLHSLIHVEDPQKSMKINDNTIFSAESDSDTIDSTKKVTRQS
                     TLPFARIFKSKKESSDSLKKKSIKSAGPINQQSKNTSKQYKKNINSSTKYDVNFDFDH
                     TLEEEEDEDEDDEDDDEEGLDLQSAFFQLDGSARVGSENGNNSNNREDKAETNNLGNV
                     SRLKSHLPQGMIARNSILESSKNNGSAKSESLNGSSEVQPNDTKSSSLATKNQQTTND
                     TDDINEDISDLESYIDERDLDGISLNAAPSNMENASTYRHTSDTELQADTDFHDNDRS
                     IAHSDSSLIDDADGLSTVSSFGKSLLESDFSTDDFIKNGYPPLSRDVSVDSTIDRNNI
                     LSHSIPLSESGYGIYHGADDSTLNNVFDKAILNIKHVKNQKQREKRSSSLSLREATHP
                     RGSSSKRSPYNIPVISKQRRHSRASSVTIGGASKSMKKNESTSIRSKRAPSMNQGRSI
                     SEIAKSDHSSRRNSKEVLQIEKLNEIPRRKPLNSQLSSLFNRKKERSGISTDVLSYFT
                     FVAGTKVPPYEAMDLDVYIQGSVKYKKHPFKTKVRKSAKIFEVIGFILYLYCNAYKPA
                     DFGKDGFTIEELINPNNFLLSIVDEDGEPFEDNFGKLDRKRLMQSVSDNEVVLCRAAE
                     TEKQNNQDVTPLPYDINGDIISSPRSEAIPSFATGDDKKDPTLNQLSFYKPIIKSADD
                     LGNNNAANKTIETRVFLYPNLNPKFNYTDINVSLTSNINDILVKYCRMKNLDPNEYSL
                     KIPDKNYVLNLNDTVLRLDGNYKVEIISKRDARQLHLEKIKPDMVKPNLPTIQSTDLT
                     PLTLEPAISYLKAGDLEKKITTVPNGMIPTKTKRSSSKYKLGLSKQQSHSSNSSLVAG
                     PSGGNNGFFKSKNSSKISLHKPEIVPNGNAYQDLFSGAYHRYKVWRRQQMSFISKHER
                     TLAIDGDYIYIVPPEGRMHWHENVKTKSLHISQVILVKKSKRMPDQFKIFVKRGQDDI
                     KRYYFEAVSVEECTEIVTRLQNLLNAYRMNHK"
     gene            <725158..>725358
                     /gene="NDAI0B02850"
                     /locus_tag="NDAI_0B02850"
                     /db_xref="GeneID:11497975"
     mRNA            <725158..>725358
                     /gene="NDAI0B02850"
                     /locus_tag="NDAI_0B02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668515.1"
                     /db_xref="GeneID:11497975"
     CDS             725158..725358
                     /gene="NDAI0B02850"
                     /locus_tag="NDAI_0B02850"
                     /inference="similar to DNA sequence:INSDC:YOL077W-A"
                     /note="similar to Saccharomyces cerevisiae ATP19
                     (YOL077W-A); ancestral locus Anc_3.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668563.1"
                     /db_xref="GeneID:11497975"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:G0W6A9"
                     /translation="MGSAYQIMGRSVPSHYLAMGTIGLVSLCILPSLVGGKKEKVASI
                     NAISDDEDAFVRKYLQEHKTKV"
     gene            complement(<725577..>726455)
                     /gene="NDAI0B02860"
                     /locus_tag="NDAI_0B02860"
                     /db_xref="GeneID:11497976"
     mRNA            complement(<725577..>726455)
                     /gene="NDAI0B02860"
                     /locus_tag="NDAI_0B02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668516.1"
                     /db_xref="GeneID:11497976"
     CDS             complement(725577..726455)
                     /gene="NDAI0B02860"
                     /locus_tag="NDAI_0B02860"
                     /inference="similar to DNA sequence:INSDC:YOL077C"
                     /note="similar to Saccharomyces cerevisiae BRX1 (YOL077C);
                     ancestral locus Anc_3.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668564.1"
                     /db_xref="GeneID:11497976"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="InterPro:IPR026532"
                     /db_xref="UniProtKB/TrEMBL:G0W6B0"
                     /translation="MSSIYKALAGKKNESNAQKKQNGGKNFMNKQRTLLISSRGVNFR
                     HRHLIQDLSSLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNILFFEARKHQDLYLWLS
                     KPPNGPTIKFYIQNLHTMDELNFTGNCLKGSRPILSFDHRFDSSPHYQLIKELLIHNF
                     GVPPTARKVKPFIDHVMSFSIVDDKIWARTYEISHTARNKDEYEEGQEEDLSLVEIGP
                     RFVMTTILILEGSFGGPKIYENKQYVSPNVVRAQMKQQAANEAKARSDAAVERKIKKR
                     ENILAADPLSNEVLFK"
     gene            complement(<726822..>730625)
                     /gene="NDAI0B02870"
                     /locus_tag="NDAI_0B02870"
                     /db_xref="GeneID:11497977"
     mRNA            complement(<726822..>730625)
                     /gene="NDAI0B02870"
                     /locus_tag="NDAI_0B02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668517.1"
                     /db_xref="GeneID:11497977"
     CDS             complement(726822..730625)
                     /gene="NDAI0B02870"
                     /locus_tag="NDAI_0B02870"
                     /inference="similar to DNA sequence:INSDC:YOL075C"
                     /note="similar to Saccharomyces cerevisiae YOL075C;
                     ancestral locus Anc_3.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668565.1"
                     /db_xref="GeneID:11497977"
                     /db_xref="GOA:G0W6B1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6B1"
                     /translation="MSTTLVENELSLSMVPRVGLHVRDLSIIASNTNTVLVDSFSLDL
                     PSGSVMAVMGGSGSGKTTLLNVLASKISGGLKTEGTINYVLEGEVTENQHVKMAYLPQ
                     QDVLSARLTCRETLKYAADLKLDKTEEEKAIIVDQLIRELGLKDCADTEVGDSTHKGL
                     SGGEQRRLSAGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLAIEDGRTFIMSIH
                     QPRSDILFLLDNVCILSKGKVVYCDAMKNTIPYFSSLGYDVPPMVNPADYFIDISSVD
                     GRSDEAEEETRIRLNQLVESWKQYEANTLCYEPVDTSKEIQVENMSNRLSYWKQVRVL
                     TRRNFQLNRSDYVTLIATFGEPAVMGTLVGWIYYKPDKTTVGGLRTTAGCLYASVVVQ
                     CYLYLLFDTYRLCEQDIALYDRERAEGSVTPLAFMTARKLSLFLSDDILMILIFTTIT
                     YFMFGLEADGAKFFYQFSITFLSQMCCAGLAMVSVAVSRDFSKASLVGNLTFTVLSMS
                     CGFFVNAKVMPVYVRWTKYIGFTWYGFGALLSSTFTDTSCPTDDLASCYGNQLLDSYG
                     FPRNWITVPAIVIFCWCIGYYFVAFVILYLHKVDITLQSEVKSKKKKLDEKENKEIMI
                     DPFASISKENSEKEIDIESRSTSNSEITITLQDIDLQVRYKRFFKNIRGGLSHEEVKE
                     ILQSVNAVFKPGMINAIMGPSGSGKSTLLNLISGRIKQSVFSKFNTSGKIMFNDVQIS
                     EDMFKGVCSYVSQDDNHLLAKLTVRETFKFAADLRLHHLTSEQRAIKTDELIRALGLK
                     HCENNIIGNEFIKGISGGEKRRVSMGIQLLNDPPILLLDEPTSGLDSFTSATILEILK
                     KLATEYSKTVIITIHQPRSELFKEFGNVLLLAKSGRTAFNGSPDKMIEYFSSLGYDCP
                     EFTNVADFFLDLISINTQNEQNEYTSKARAEHILTSWKQRNNTLSVKSPVSEKNEMSE
                     ENFLLEYGHCVRKPCTPLLAYLVNVKRQSITTRRNFDSLMARIAQIPGLGAIFALFFA
                     PLKHNYNSINNRLGLAQESTALYFVGMLANLACYPAERDYFYKEHEDNVYGIGPFFLA
                     YMTLELPLSLLASIIYAIFTVLACGLPRTAGNFFANVYCSFIVSGCGEALGIMTNTFF
                     ERPGFVVNCISVLLSIGTQMSGLMSLHMPKVLKGFNYLNPVGYTSLIIINFAFPDSMK
                     LTCEDGGRNPDGTCELPNGRAVLESYGLVANTREYLGIVICVAIIYRLIAYCILKAKL
                     EWLKW"
     gene            complement(731139..731199)
                     /gene="NDAI0Btrna17K"
                     /locus_tag="NDAI_0Btrna17K"
                     /db_xref="GeneID:11497965"
     tRNA            complement(join(731139..731175,731139..731199))
                     /gene="NDAI0Btrna17K"
                     /locus_tag="NDAI_0Btrna17K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11497965"
     gene            <733429..>733902
                     /gene="NDAI0B02880"
                     /locus_tag="NDAI_0B02880"
                     /db_xref="GeneID:11497654"
     mRNA            <733429..>733902
                     /gene="NDAI0B02880"
                     /locus_tag="NDAI_0B02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668518.1"
                     /db_xref="GeneID:11497654"
     CDS             733429..733902
                     /gene="NDAI0B02880"
                     /locus_tag="NDAI_0B02880"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668566.1"
                     /db_xref="GeneID:11497654"
                     /db_xref="UniProtKB/TrEMBL:G0W6B2"
                     /translation="MSLTQEEESDTFILSQIHNLSYDGKKMHSSSAITFVISLEELSK
                     FHSHSRCCYCETLLQGLKGPYKTMQLKDTLDERSKIVSSILEDIQRLYHLYGNSTLNA
                     SNKTVPTQHLRLHSINNLFKNDPKGLNDTSKPLSVKILLYLIYKSFFIFNLFRYL"
     gene            734233..734306
                     /gene="NDAI0Btrna13I"
                     /locus_tag="NDAI_0Btrna13I"
                     /db_xref="GeneID:11497979"
     tRNA            734233..734306
                     /gene="NDAI0Btrna13I"
                     /locus_tag="NDAI_0Btrna13I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11497979"
     gene            complement(<734776..>736356)
                     /gene="NDAI0B02890"
                     /locus_tag="NDAI_0B02890"
                     /db_xref="GeneID:11497646"
     mRNA            complement(<734776..>736356)
                     /gene="NDAI0B02890"
                     /locus_tag="NDAI_0B02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668519.1"
                     /db_xref="GeneID:11497646"
     CDS             complement(734776..736356)
                     /gene="NDAI0B02890"
                     /locus_tag="NDAI_0B02890"
                     /inference="similar to DNA sequence:INSDC:YBL015W"
                     /note="similar to Saccharomyces cerevisiae ACH1 (YBL015W);
                     ancestral locus Anc_8.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668567.1"
                     /db_xref="GeneID:11497646"
                     /db_xref="GOA:G0W6B3"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /db_xref="UniProtKB/TrEMBL:G0W6B3"
                     /translation="MTVSQLLKQRVRYLPYLEKVKQPKDLIPLFKNGQYLGWSGFTGV
                     GTPKAVPDALIEHVEQNNLQGKLKFNLFVGASAGPEENLWAQHDMILKRAPHQVGKPI
                     AKAINTGKIKFFDKHLSMFPQDLTYGFYTRERTDNKILDYMIIEATAIKEDGSIVPGP
                     SVGASPEFISVSDKIIIEVNTATPSFEGIHDIDMPINPPFRVPYPYVKVDDRCGRDSI
                     PVDPEKVIAIVESKTMDQVPPNTPSDLISQNIAQHLVDFFRNEVKHGRLPENLLPLQS
                     GIGNIANAVIEGLTDAQFKHLNVWTEVLQDSFLDLFANGSLDFATATSIRLTEDGFKR
                     AFADWENLKHKICLRSQVVSNNPEMIRRLGVIAMNTPVEVDIYAHANSTNVNGSRMLN
                     GLGGSADFLRNAKLSIMHAPSARPTKVDPTGISSIVPMASHVDQTEHDLDILVTEQGL
                     ADLRGLCPRDRAREIIKQCAHPDYKSLLTDYLERSEHYAAKHGSLHEPHMLKNAFKFH
                     TNLQEKGTMKVENWDPVD"
     gene            complement(<737651..>738709)
                     /gene="NDAI0B02900"
                     /locus_tag="NDAI_0B02900"
                     /db_xref="GeneID:11497980"
     mRNA            complement(<737651..>738709)
                     /gene="NDAI0B02900"
                     /locus_tag="NDAI_0B02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668520.1"
                     /db_xref="GeneID:11497980"
     CDS             complement(737651..738709)
                     /gene="NDAI0B02900"
                     /locus_tag="NDAI_0B02900"
                     /inference="similar to DNA sequence:INSDC:YBL016W"
                     /note="similar to Saccharomyces cerevisiae FUS3 (YBL016W);
                     ancestral locus Anc_8.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668568.1"
                     /db_xref="GeneID:11497980"
                     /db_xref="GOA:G0W6B4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008349"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W6B4"
                     /translation="MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKI
                     EPFDKPLFALRTLREIKLLKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHR
                     VISTQNLTDDHIQYFIYQTLRAVKTLHGSNVIHRDLKPSNLLINSNCDLKICDFGLAR
                     IIEEDREDDDQMTQLQNGMTEYVATRWYRAPEVMLTAAKYSKAMDIWSCGCILAELFM
                     KRPIFPGKDYRHQLLLIFGLIGTPFEEDLNCIESRRAREYIMTLPRYEPVPLSKVLPQ
                     VNPLGIDLLQRMLIFDPKKRITAEEALSHPYLKTYHDPNDEPQGAPIPSSFFEFDHYK
                     DVLTTKDLKKLLWNEIFC"
     gap             739521..739552
                     /estimated_length=32
     gene            <740092..>744852
                     /gene="NDAI0B02910"
                     /locus_tag="NDAI_0B02910"
                     /db_xref="GeneID:11498415"
     mRNA            <740092..>744852
                     /gene="NDAI0B02910"
                     /locus_tag="NDAI_0B02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668521.1"
                     /db_xref="GeneID:11498415"
     CDS             740092..744852
                     /gene="NDAI0B02910"
                     /locus_tag="NDAI_0B02910"
                     /inference="similar to DNA sequence:INSDC:YBL017C"
                     /note="similar to Saccharomyces cerevisiae PEP1 (YBL017C);
                     ancestral locus Anc_8.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668569.1"
                     /db_xref="GeneID:11498415"
                     /db_xref="GOA:G0W6B5"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:G0W6B5"
                     /translation="MRLLSWAPIWLVVVTLLNFPLANADNNEFIPKVTKTSSKSSFNI
                     EPFDDSTTILKLEDSNLFRSENNGESWNPIKEIKDKVYWVHVDEFNSHDRAFAYSESD
                     KTNIIYITEDQGKTWKSSKVPMDSKKTSIHGCHVLTHPTNKNYLIARCTACDASASSK
                     TLKGKYTSNTRCETITFLSQNLGKSYNKVEPPSIKKIESTISTETICRFMRNTKNSQL
                     GDSDATVVCSYDIIEQPKNSPIIKTTSSFFTTIDGGKTIKQYDIFKDKAISSYAIKKS
                     NIVVLTQEDKYNRHSAKKLWVSKDGISFKEAYLPTQLRYTVAGMIKEDDFGKIILPIR
                     RQQSATTDDDTSTVAEMLVSDSTGLKFTPFDWVPQDTQGWANLYMPKELKGTMIGTFA
                     SMMRRFGRKHKGSSNSTDERGVTKITVDNGKTWSNLKVVDPANKDSYPCNIDDVEHCS
                     LQILSPFQTDAEPSPGILIRIGYVSDGNSLEILDNKTFISTDGGLTWRMIFDYPVIYA
                     IGDSANIIVAVPFDPNEDNDPESEFYYSLDQGETWNEYQLEEPIIPLEIVSTTPDGSG
                     LNFIINGFLVTANPFDENGTGNFIYAIDFSELYDKKLCTKDDFEQWYLGNGNCINGAK
                     YSYPRRKQNSKCIARKLFEDLELTEQVCDECTNADYECSFEFIKDNEGKCVPDYNLLT
                     MSGACSATKKDTLKIAPMQLITGDKCKKPLDISPVDVSCEDVPNRGGSPNKGKGELIR
                     VTENTFGSRVTFYQYFDTYSDESLIIGDAHHNYFISHDSGQTVTKIESMDQKIIEVVF
                     NTYFNSSAYLFGDGGNLFVTNDGGHTITSTKLPEGVQLGFPLDFHSKDPNTFIYYGGK
                     NCDSILSKECHAVAYITRDGGKTFTELLDNTIHCEFAGSQYEHPSDENLIICQVKEKG
                     FTKRSLVSSTDYFKNNKEIIFDDILGYMSSGKFSIVAVTHGENELRAYVTLDGKEFAE
                     AKLPKDLEKFEQEAFTVLNGDPSSILLHFSTNHAFDKGFGRLLKSNSNGTSFVTLEPG
                     VNRVNSGLVDFEKIQGLEGVMVINVVDNMDDVRTKNADKKLKTKITFNDGSDWTFLKP
                     PARDSEGKKYNCKSNSLSSCSLNLHGYTDRTDIRDTYSSGSAIGYMFAVGNVGESLLP
                     YDECSTFLTIDGGATWKEVRKGPYQWEYGDHGGILVLVPDKKASDTISFSIDSGKTWV
                     DYKFTDAKVTISDIVTVPQDSAMRFLLIGASPSVKGSSAKTFTIDFTGIFPRQCIFDF
                     NNQDSDDFSYFKVNPSRAECLFGHQKEYLKKIHNNCFIGNVPLADYSRITKNCSCIRA
                     DFECDYNFYKAKDGTCKLVEGLDPIDPSDVCKINQDLIEFSEPTGYRKIPLSTCQGGL
                     RLDASSDLYPCPGKEKQFNQKYGVGALHFILIFGIPFLTFVGIAWFIYINGIRRNGGF
                     SRFGEIRLGDDELIENNNTDKVVNYILKGGMFVFSGLFSRFQKVKHSFNEILTRFRER
                     SGRGGPSYSSLLHDQFLDEADDLLAGHDEDANDLSSFADHDSNFDIDDEGSFTPGLEP
                     EHAPYADEPASTTNTGDAQSPGPVVPSSNDEESL"
     gene            <745399..>745686
                     /gene="NDAI0B02920"
                     /locus_tag="NDAI_0B02920"
                     /db_xref="GeneID:11498416"
     mRNA            <745399..>745686
                     /gene="NDAI0B02920"
                     /locus_tag="NDAI_0B02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668522.1"
                     /db_xref="GeneID:11498416"
     CDS             745399..745686
                     /gene="NDAI0B02920"
                     /locus_tag="NDAI_0B02920"
                     /inference="similar to DNA sequence:INSDC:YBL018C"
                     /note="similar to Saccharomyces cerevisiae POP8 (YBL018C);
                     ancestral locus Anc_8.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668570.1"
                     /db_xref="GeneID:11498416"
                     /db_xref="InterPro:IPR020347"
                     /db_xref="UniProtKB/TrEMBL:G0W6B6"
                     /translation="MNALKRSYGIFGEGLEYSLIHQDDKIAYVRVSHHDKDVFSSSIA
                     TYISTDELIGSPLIVQILQETSNLESLDISSDDQLWLKKVIEENEEDTACN"
     gene            complement(<745841..>747511)
                     /gene="NDAI0B02930"
                     /locus_tag="NDAI_0B02930"
                     /db_xref="GeneID:11498417"
     mRNA            complement(<745841..>747511)
                     /gene="NDAI0B02930"
                     /locus_tag="NDAI_0B02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668523.1"
                     /db_xref="GeneID:11498417"
     CDS             complement(745841..747511)
                     /gene="NDAI0B02930"
                     /locus_tag="NDAI_0B02930"
                     /inference="similar to DNA sequence:INSDC:YBL019W"
                     /note="similar to Saccharomyces cerevisiae APN2 (YBL019W);
                     ancestral locus Anc_8.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668571.1"
                     /db_xref="GeneID:11498417"
                     /db_xref="GOA:G0W6B7"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="UniProtKB/TrEMBL:G0W6B7"
                     /translation="MSIPKSSKETSLRFLTFNVNAIRTFFHYDPFSSMNENLSKVFSY
                     LDADIITFQELKTETSSIIKWGKLCDFYSFISIPTTKKGYAGVGCWVRKVEPTHPLYK
                     VLHVTKAEEGITGYLTIKKQGRNGEKIRYRDLPSNDTIGGFENITFDDESEALSLDSE
                     GRCVMVELACNIVVISVYCPANSSRTLEGELFRMKFLRVLFKRIENLHHLGKEVVLMG
                     DVNVCRDLIDHAEALEVGGISIKNETTGIEIEAEYQESCRNFILNPDVPYRRLLNQML
                     TDSIVPELAQTGFLVDTTRMKQSRNRLKMYTVWNTLKNYRPVNYGSRVDYILMTSNLG
                     KAVIEADILPSVNGSDHCPVFTDIDCTFLQVPDDIDYTLIPRFEARFKFDLLNHNILD
                     MFAKRNNNPKRKPSVTLESTPSQKKIKPLKKSTPRSKTIESFFTSSIPQKKPYSDDAS
                     ISSRTASSPVPSMHRSSESDVSSEADLLTSGNNKSQPSLCSSHKVSGRSSSIKDLFGK
                     PPLCKHGEESILRTSKTSSNPGKRFWICKKPRGDLNNPDASCGFFQWL"
     gene            complement(<747864..>749657)
                     /gene="NDAI0B02940"
                     /locus_tag="NDAI_0B02940"
                     /db_xref="GeneID:11498418"
     mRNA            complement(<747864..>749657)
                     /gene="NDAI0B02940"
                     /locus_tag="NDAI_0B02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668524.1"
                     /db_xref="GeneID:11498418"
     CDS             complement(747864..749657)
                     /gene="NDAI0B02940"
                     /locus_tag="NDAI_0B02940"
                     /inference="similar to DNA sequence:INSDC:YBL020W"
                     /note="similar to Saccharomyces cerevisiae RFT1 (YBL020W);
                     ancestral locus Anc_8.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668572.1"
                     /db_xref="GeneID:11498418"
                     /db_xref="GOA:G0W6B8"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:G0W6B8"
                     /translation="MDEKDSTTTINLPTSSDQILEKSTKGATFLMLGQLFTKLITFFL
                     NSLLVRFLSPRIFGITAFLEFIVNTVLFFSREAIRLSTLRITEDHTTSSVEKTKNSQI
                     LQTAVNFAYIPFVIGVPLSIVLTTWQYKNINGYFINLPFFQVSILLIWISIIVELLSE
                     PFFIINQFMLNYSSRSRIESLAITMGCITNFIIVVSFEKNWWNPILKSMIHHNNELMD
                     QEEFMEVSREGIAILAFAVGKLVHSLILLLCYYWDYLMNFHETKTFSLKLTKIYNENK
                     STMTKNYYYFQNDILEHFKKVYFQLCFKHLLTEGDKLIINSLCTVEEQGIYSLLSNYG
                     SLVTRLLFAPIEESLRLFLARLLSNRTAKNLKLSMQVLINLTKFYFYLSLLIVIFGPV
                     NSSFLLQFLIGSKWSTTSVLDTIRVYCFYIPFLSLNGIFEAFFQSTATGDQILKHSYF
                     MMVFSGVFLLNCWILIEFLNLSINGLIYGNIFNMILRITYCSWFIINFYKKLYNSEEN
                     ISTSSMKDSTLVKDKGSIFVNFRNFRVVIIVGLCISTFNWIMIGHVKNFHQLFINIVL
                     ALILFITILLQERTILKGLLRRRKVDESKEV"
     gene            <750069..>750518
                     /gene="NDAI0B02950"
                     /locus_tag="NDAI_0B02950"
                     /db_xref="GeneID:11498419"
     mRNA            <750069..>750518
                     /gene="NDAI0B02950"
                     /locus_tag="NDAI_0B02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668525.1"
                     /db_xref="GeneID:11498419"
     CDS             750069..750518
                     /gene="NDAI0B02950"
                     /locus_tag="NDAI_0B02950"
                     /inference="similar to DNA sequence:INSDC:YBL021C"
                     /note="similar to Saccharomyces cerevisiae HAP3 (YBL021C);
                     ancestral locus Anc_8.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668573.1"
                     /db_xref="GeneID:11498419"
                     /db_xref="GOA:G0W6B9"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0W6B9"
                     /translation="MPSNNNGENINADVNPNISDHTLAHGHDFHEFREQDRWLPINNV
                     ARLMKNTLPGSAKVSKDAKECMQECVSEFISFVTSEASDRCANDKRKTINGEDILISL
                     HALGFENYAEVLKIYLAKYRQQQALKQQQQDDDDAEQEQQPSTAFTS"
     gene            <751389..>754868
                     /gene="NDAI0B02960"
                     /locus_tag="NDAI_0B02960"
                     /db_xref="GeneID:11498420"
     mRNA            <751389..>754868
                     /gene="NDAI0B02960"
                     /locus_tag="NDAI_0B02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668526.1"
                     /db_xref="GeneID:11498420"
     CDS             751389..754868
                     /gene="NDAI0B02960"
                     /locus_tag="NDAI_0B02960"
                     /inference="similar to DNA sequence:INSDC:YBL022C"
                     /note="similar to Saccharomyces cerevisiae PIM1 (YBL022C);
                     ancestral locus Anc_8.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668574.1"
                     /db_xref="GeneID:11498420"
                     /db_xref="GOA:G0W6C0"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="UniProtKB/TrEMBL:G0W6C0"
                     /translation="MLRNKGSAQITLRRLFKGTKCYTHGSNHALVSPLLSNVSTINRP
                     RWASTVSSESHRFPLNEFYNHLSTNYKGNSAFLLDQTSKFTSILAKDDSSKDISKIPS
                     DKNDKKPENRIEQPENEKDQEEDNIPSKKQDNGDAKDSIDSSESITRNSKSGSASSPP
                     GNNNNTPDDPPPPPHSSSSSDSYSTAPGIPDVYPEMLALPISRRPLFPGFYKAVVISD
                     PNVMKAIKEMLERQQPYLGAFMLKDSESDIDIIENRDQVHPVGVLAQITSAFPSKDEK
                     TGKETMTALLYPHKRIKLDDLVIPEKHPSPSVPITPKLEDIVVEKIVDNEIAEQPKIT
                     GDVVDNADGSQIEKQNKEKQESVVQKEEGEEEFESDDISEEELQKLQEEDLNPTEFLK
                     AYNVSLVNVSNLEDEPFDRKSPVINALTSEILKVFKEISQLNTMFREQIATFSASIQS
                     ATTNIFEEPARLADFAAAVSAGEEDELQDILSSLNIEQRLEKSLLVLKKELMNAELQN
                     KISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGRDKLIETYKKRVEKLQLPDNVQK
                     IFDEEVTKLATLETSMSEFGVIRNYLDWITSLPWGITSKEQYSIPRARKILDEDHYGM
                     KDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSIARALNRQFFRFSVGGM
                     TDVAEIKGHRRTYIGALPGRVIQAMKKCQTQNPLILIDEIDKIGHGGVHGDPSAALLE
                     VLDPEQNNSFLDNYLDIPMDLSKVLFVCTANSLDTIPRPLLDRMEVIELTGYVAEEKV
                     KIAEQYLSPSAKKTAGLQNANVTLSENAVVALMKYYCRESGVRNLKKYIEKIYRKAAL
                     NIVKQISVDEKESSDTTGDKKETVVSQDQKIEVEKTKEDTESMQVSDDIKIDITPDNL
                     KDYVGPPIYTTDRLYETTPPGVVMGLAWTSMGGCSLYVESVLEQPLHNCKHPTLERTG
                     QLGDVMKESSRLAYSFAKMFLAKRYPENRFFEQASIHLHCPEGATPKDGPSAGVTMAT
                     SFLSLALNRSVEPTVAMTGELTLTGKVLRIGGLREKAVAAKRSGAKTIIFPKDNMSDW
                     EELPENVKEGLEPLAADWYDDIFQKLFVSVSTKKGNKVWDSEFAILDAKKKLRKRMNR
                     NLITSKSICKYST"
     gene            <755160..>757793
                     /gene="NDAI0B02970"
                     /locus_tag="NDAI_0B02970"
                     /db_xref="GeneID:11498421"
     mRNA            <755160..>757793
                     /gene="NDAI0B02970"
                     /locus_tag="NDAI_0B02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668527.1"
                     /db_xref="GeneID:11498421"
     CDS             755160..757793
                     /gene="NDAI0B02970"
                     /locus_tag="NDAI_0B02970"
                     /inference="similar to DNA sequence:INSDC:YBL023C"
                     /note="similar to Saccharomyces cerevisiae MCM2 (YBL023C);
                     ancestral locus Anc_8.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668575.1"
                     /db_xref="GeneID:11498421"
                     /db_xref="GOA:G0W6C1"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G0W6C1"
                     /translation="MSLNRRRRREDNEDSDGENELPPSSPQQQPERAAFDPVSSPIGS
                     PMVDDPELDDDDDMVNPEGRDNEIDEDPDLEEMEEQMNQVDLVGEDMYEDYRHDASKD
                     RYDLNDVDDTAQRELSASERRRIDAQLNERDRLLRNVAYMDNDDEEPGNTALDEMGLP
                     VQRRRRRRQYETLEHSDDDLLDDMDIDPLREELTLESLSNIKANSYSEWITQPNVGRT
                     IARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCP
                     EEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIHSLRELRESNLTSLVRVTG
                     VVTRRTGVFPQLKYVKFNCLKCGTILGPFFQDSNEEIRISFCTNCKSKGPFNVNGEKT
                     VYRNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNL
                     NAKNGFPVFATIIEANSVRRREGNMSNEGEEGLDVFGWTEEEEREFRKISRDRGIIDK
                     IISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILK
                     YVEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGALVLADKGVCLIDEFDKM
                     NDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLT
                     EPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENKDGDDLETTQAGEDDEEA
                     QELSARQRRLKVQRKKEEEISPIPQELLMKYIHYARTKVHPKLHQMDMDKVSRVYADL
                     RRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKI
                     SVRRQLHRSFAIYTLGQHQRR"
     gene            complement(<757926..>759965)
                     /gene="NDAI0B02980"
                     /locus_tag="NDAI_0B02980"
                     /db_xref="GeneID:11497626"
     mRNA            complement(<757926..>759965)
                     /gene="NDAI0B02980"
                     /locus_tag="NDAI_0B02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668528.1"
                     /db_xref="GeneID:11497626"
     CDS             complement(757926..759965)
                     /gene="NDAI0B02980"
                     /locus_tag="NDAI_0B02980"
                     /inference="similar to DNA sequence:INSDC:YBL024W"
                     /note="similar to Saccharomyces cerevisiae NCL1 (YBL024W);
                     ancestral locus Anc_8.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668576.1"
                     /db_xref="GeneID:11497626"
                     /db_xref="GOA:G0W6C2"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W6C2"
                     /translation="MGRSKNFKRGGRNNNRSNRNWSELVKENTKWENYYKSLNLFSLE
                     QWDQFKLACQTPLPVTFRVTGSRKHANEVLELFKERHLPNLTNVTFEGEPIKPPMVLP
                     WYPNHLAWQLDVPKIVIRKNAQFAKTQRFLVVENAVGNISRQEAVSMIPPIVLDVKPH
                     HTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSDSKRSHMLVHQLKRLNSANLM
                     VVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSGDGTIRKNVNIWKDWNTQNS
                     LGLHNVQLNILNRGIQLLKSGGRLVYSTCSLSPIENEAVISATLRKWGNKIKLVDCKE
                     MLPGLISSPGISKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQ
                     QNTGGFFIAVLEKIEETVEDEKSFVSSPAAVVNVTTETTTENVNGTTAVNEQDTVPET
                     KPKKKTKLPIDAIDEPFVFIDPYHKAFASCWDYYGIDDSFNKNTCLVRSSTGEPSKVI
                     YTVCPSLRDIIELNDQKLKLVFSGVKLFVYQRDDIDCPWRIHSEALPIMRNHMESERI
                     ITTTLKMLKYLLIEPFPTLENITNLHMDQAFVNKVEKLSTGCAFIEVSRDEEKESILL
                     PIWIGIKSVSIMVCKEDVNEYLYRIFNDETLLTTGDKSKINESEGAHDKTRNVVV"
     gene            complement(<760343..>760849)
                     /gene="NDAI0B02990"
                     /locus_tag="NDAI_0B02990"
                     /db_xref="GeneID:11497627"
     mRNA            complement(<760343..>760849)
                     /gene="NDAI0B02990"
                     /locus_tag="NDAI_0B02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668529.1"
                     /db_xref="GeneID:11497627"
     CDS             complement(760343..760849)
                     /gene="NDAI0B02990"
                     /locus_tag="NDAI_0B02990"
                     /inference="similar to DNA sequence:INSDC:YBL025W"
                     /note="similar to Saccharomyces cerevisiae RRN10
                     (YBL025W); ancestral locus Anc_8.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668577.1"
                     /db_xref="GeneID:11497627"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:G0W6C3"
                     /translation="MDRNVFEACSDLVTEFHTHKVSADEILAEKIGNIVPIPFKTRDE
                     LQDVSLRDEEDGLFKGDLIPNIDLKVVHYFATQLCLRRYPHLINSFDESSLITLGLLI
                     EKWVQDYLVANNKNSMSTDDEEEEEVETEGYTDGGTEGEDQEFTIGKGPSQMISKITN
                     YMSHPGNI"
     gene            complement(<762367..>763734)
                     /gene="NDAI0B03000"
                     /locus_tag="NDAI_0B03000"
                     /db_xref="GeneID:11497628"
     mRNA            complement(<762367..>763734)
                     /gene="NDAI0B03000"
                     /locus_tag="NDAI_0B03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668530.1"
                     /db_xref="GeneID:11497628"
     CDS             complement(762367..763734)
                     /gene="NDAI0B03000"
                     /locus_tag="NDAI_0B03000"
                     /inference="similar to DNA sequence:INSDC:YER136W"
                     /note="similar to Saccharomyces cerevisiae GDI1 (YER136W);
                     ancestral locus Anc_8.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668578.1"
                     /db_xref="GeneID:11497628"
                     /db_xref="GOA:G0W6C4"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:G0W6C4"
                     /translation="MDQETIDTEYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHY
                     GGESASVTLSQLYDKFKKSPISKEDREAKFGKDRDWNVDLIPKFLMVNGELTNILVHT
                     DVTRYVDFKQVTGSYVFKQGKIYKVPANEYEAISSPLMGIFEKRRMKKFLEWISSYKE
                     DELNTHQGLDLDKNTMEEVYAKFGLGNSTKEFIGHAMALWTNDEYLQQIARPSFERIL
                     LYCQSVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIEEVLYDGEAESKK
                     FKGVKTKLGTFTAPLVIADPTYFPDKCKSTGQKVIRAICVLNHPIPGAGDSDSLQIII
                     PQSQVNRKNDIYIAVVSAAHNVCSKGHYLAIISTIVETSQPHVELESAFKLLGPIEEK
                     FMGIAEIFEPKEDGSKDNIFLSRSYDASSHFESMTDDVKDIYFRVTGHPLVLKQREDS
                     LQATT"
     gene            <765653..>765895
                     /gene="NDAI0B03010"
                     /locus_tag="NDAI_0B03010"
                     /db_xref="GeneID:11497629"
     mRNA            <765653..>765895
                     /gene="NDAI0B03010"
                     /locus_tag="NDAI_0B03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668531.1"
                     /db_xref="GeneID:11497629"
     CDS             765653..765895
                     /gene="NDAI0B03010"
                     /locus_tag="NDAI_0B03010"
                     /inference="similar to DNA sequence:INSDC:YDR064W"
                     /note="similar to Saccharomyces cerevisiae RPS13
                     (YDR064W); ancestral locus Anc_8.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668579.1"
                     /db_xref="GeneID:11497629"
                     /db_xref="GOA:G0W6C5"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:G0W6C5"
                     /translation="MRILKSNGLAPDIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRL
                     ILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
     gene            complement(<768060..>768797)
                     /gene="NDAI0B03020"
                     /locus_tag="NDAI_0B03020"
                     /db_xref="GeneID:11497630"
     mRNA            complement(<768060..>768797)
                     /gene="NDAI0B03020"
                     /locus_tag="NDAI_0B03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668532.1"
                     /db_xref="GeneID:11497630"
     CDS             complement(768060..768797)
                     /gene="NDAI0B03020"
                     /locus_tag="NDAI_0B03020"
                     /inference="similar to DNA sequence:INSDC:YDR066C,YER139C"
                     /note="similar to Saccharomyces cerevisiae YDR066C and
                     YER139C; ancestral locus Anc_8.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668580.1"
                     /db_xref="GeneID:11497630"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:G0W6C6"
                     /translation="MTTIETIQKVALGPYQRHRQLSMNEAEMLSLEVISLLCDSYCAD
                     ETTLKYTAKLITPDIYMNLIDERNLNKRCGYPLCNKSPERLRDPFSIDEVTKKFLWEN
                     NPYAYLSRFCSKFHFRCSQFYQLQLSNEALFSRTGIHLINNHIYDKDGEDIITSFNSP
                     INERYNVVLFEEFLREKATEEDIKSLVAGLKKLGLQGETNETKTDDHHEDLQWEQDLS
                     KWLSEIKIVEIEKPNLLGDFQKEEEED"
     gene            <769172..>770767
                     /gene="NDAI0B03030"
                     /locus_tag="NDAI_0B03030"
                     /db_xref="GeneID:11497631"
     mRNA            <769172..>770767
                     /gene="NDAI0B03030"
                     /locus_tag="NDAI_0B03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668533.1"
                     /db_xref="GeneID:11497631"
     CDS             769172..770767
                     /gene="NDAI0B03030"
                     /locus_tag="NDAI_0B03030"
                     /inference="similar to DNA sequence:INSDC:YER140W"
                     /note="similar to Saccharomyces cerevisiae YER140W;
                     ancestral locus Anc_8.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668581.1"
                     /db_xref="GeneID:11497631"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:G0W6C7"
                     /translation="MVKKTRNRSASFKRKRQYDVGNRWRQLKGLGNRFIQAMDHQGLR
                     SDKEIEMEGDSVDEVEIEQLLNMITMPIYLEKYMFFTLLACFDCFLYHFTGLPIKIIQ
                     NLSLTRKNKTITFPTGLNKHKQRKNWLTKTYKERCLVFLIGVSSMFLSKLNTSIIYHR
                     IKRQSAMKLYMLFSVLEMADILLASMGQSLSAVVLSRIGYGRKIYQKGLLISLSVIYI
                     LLHGYVLVYQAVALNVAVNSYSNSLLTLLLSMQFAEIKSAVLKKFDKEGLFQITIADA
                     VERFKLFLLLMIIILRNISANPIGLPTSWSFKKSSTVLMNFLSGPFISVIGSEIIVDW
                     VKHAYINKFNRIRPEIYDKFFYITYNDHTTSLRKFQDRMGLPIPAFVVLFIVMVRPTL
                     FQIFQQSNFPLITQSIIILIFSFWILVMMKFILHTILEKWGVQIQKSWEKVPVDTTVK
                     ESQYVPGMLSDGQGKVDELSRMVIHLDDKIDFKKSNHPTYLPERSTELPPSLNDKRIE
                     RNLKKPNGLEEVARYKMVSKNIW"
     gene            <771116..>772618
                     /gene="NDAI0B03040"
                     /locus_tag="NDAI_0B03040"
                     /db_xref="GeneID:11497632"
     mRNA            <771116..>772618
                     /gene="NDAI0B03040"
                     /locus_tag="NDAI_0B03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668534.1"
                     /db_xref="GeneID:11497632"
     CDS             771116..772618
                     /gene="NDAI0B03040"
                     /locus_tag="NDAI_0B03040"
                     /inference="similar to DNA sequence:INSDC:YER141W"
                     /note="similar to Saccharomyces cerevisiae COX15
                     (YER141W); ancestral locus Anc_8.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668582.1"
                     /db_xref="GeneID:11497632"
                     /db_xref="GOA:G0W6C8"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:G0W6C8"
                     /translation="MLFRNLLLGSRTKVLAKSASPVNVYKQLTKRTICSTNVKSLRFD
                     LNQKSMLMKTSPFTKTIPRSFSLSSKFSNPTTIAANATATTTPVVSEESLKTAKSVAY
                     WLIGTSGLVFGIVILGGLTRLTESGLSITEWKPVAGTLPPLNQKQWEEEFEKYKESPE
                     FKQLNSHINLDEFKFIFFMEWVHRLWGRAIGAVFILPAAYFAVSGKTSRHVNKRLLGL
                     TGLLALQGFLGWWMVKSGLDQEQLTERNSKPTVSQYRLTTHLGAAFFLYMGMLWTGFE
                     ILRERKWIKDPAEALKLFKKLDNGSMGPLRKISLGLLFVSFVTAMSGGMVAGLDAGWI
                     YNTWPKMGEQWLPPSRELMDDNFARREDKKDLWWRNLLENPTTVQLVHRTFAYTSFAA
                     VLAAHMYCIKLKHIIPKNANTTMHALMGVVTFQVGLGIFTLLWLVPIPLASLHQGGAL
                     ALVTTSLIFAVQLRKPRMPIRNLINSLYIQKLQPSSKILNEAAKFSNKAL"
     gene            complement(<773115..>774191)
                     /gene="NDAI0B03050"
                     /locus_tag="NDAI_0B03050"
                     /db_xref="GeneID:11497633"
     mRNA            complement(<773115..>774191)
                     /gene="NDAI0B03050"
                     /locus_tag="NDAI_0B03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668535.1"
                     /db_xref="GeneID:11497633"
     CDS             complement(773115..774191)
                     /gene="NDAI0B03050"
                     /locus_tag="NDAI_0B03050"
                     /inference="similar to DNA sequence:INSDC:YER142C"
                     /note="similar to Saccharomyces cerevisiae MAG1 (YER142C);
                     ancestral locus Anc_8.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668583.1"
                     /db_xref="GeneID:11497633"
                     /db_xref="GOA:G0W6C9"
                     /db_xref="InterPro:IPR000035"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G0W6C9"
                     /translation="MSHQGKVGIIYIYISICKCYVTKKKFISSTTFALEVRLKIIWHI
                     FQTKYPRIMTKRTIAEVELEDSTIKNEDTQAETKVLKVDAKIDLPSEIPKEFALKHIE
                     EFNKACQYIIKVDPTLLEPLLIHEAPLYLLTSEADNTLQSYFARLASVIVAQQLSGHA
                     AKSIKKKFIEHFDNKFPTYKDLYHDLKDDDERKQILACGLSQRKMTYLDSLTTYFYEN
                     EENIRKLFDGKDNDQEIIDELVKNIKGIGPWSAKMFLITGLRRFDVFAAEDLGIARGF
                     SKYLSDKPELVKSLISTRGVIKKSKIKHKKVNWKIYDDDIMEKCAERFAPYRSVFMFI
                     LWRMSNTHLDAVIKNENDFARGHQ"
     gene            complement(<775021..>776817)
                     /gene="NDAI0B03060"
                     /locus_tag="NDAI_0B03060"
                     /db_xref="GeneID:11497634"
     mRNA            complement(<775021..>776817)
                     /gene="NDAI0B03060"
                     /locus_tag="NDAI_0B03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668536.1"
                     /db_xref="GeneID:11497634"
     CDS             complement(775021..776817)
                     /gene="NDAI0B03060"
                     /locus_tag="NDAI_0B03060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668584.1"
                     /db_xref="GeneID:11497634"
                     /db_xref="GOA:G0W6D0"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W6D0"
                     /translation="MKGFLHFKTNRKDKDGTNNSENNSKKKKKNANSMSDPNNKYTDP
                     LTMPLTDTYDFNKDMELDMMMDDYLYDDEDRDRIPRINQLPRKPLKEYVVANLLCLCV
                     AFGGFMTGWDTGTISGFVVQTDFIRRFGHLDTAVNTYVLSRVRLGLLVSIVNIGCAIG
                     GIVLSKAGDVYGRRKGLTIVTMVYMVGIIIQISAVNKWYQYFIGRIIAGFGIGGIAVF
                     CPILISEISPKYYRGTCVSFYQLMITAGIFVGYCTNFGTKKYTNSVQWRVPLGLSFAW
                     SLFYMILVLTVVPESPRYLCENNQVQKAKESIARSNRVSPDDPAVQTEMDFIMVSVES
                     EKLAGNAAWGELFSKRSTVFQRVIMGIMIQMLQQLTGNNYFFYYGTIIFKSVGLEDSF
                     QTSIIIGVVNFASTFVALYTVDRIGRRSMLLWGCLTMISCMVIYSSVGVTRLYPNSAT
                     SPSKGAGACMICFTCFYIFCYAISWAPIAWVIVSESFPLRVRSKCMALACASNWIWGF
                     LISFFTPFITGAINFYYGYVFTGCIVFSFFYVFFFIPETKGLSLEEIQELWEERVLPW
                     KSTAWIPPSKRTVDYDIEALAIHDGPWYKAFF"
     gene            complement(<778366..>781047)
                     /gene="NDAI0B03070"
                     /locus_tag="NDAI_0B03070"
                     /db_xref="GeneID:11497635"
     mRNA            complement(<778366..>781047)
                     /gene="NDAI0B03070"
                     /locus_tag="NDAI_0B03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668537.1"
                     /db_xref="GeneID:11497635"
     CDS             complement(778366..781047)
                     /gene="NDAI0B03070"
                     /locus_tag="NDAI_0B03070"
                     /inference="similar to DNA sequence:INSDC:YGL166W,YPR008W"
                     /note="similar to Saccharomyces cerevisiae CUP2 (YGL166W)
                     and HAA1 (YPR008W); ancestral locus Anc_8.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668585.1"
                     /db_xref="GeneID:11497635"
                     /db_xref="GOA:G0W6D1"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:G0W6D1"
                     /translation="MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCA
                     YCKELRKNKNGNIPGSCTCGRQEKKRLAQKAKEEARAKAKEQLLSGKCTCNTKPNEVC
                     TYHHTLNATGNKYTRQQKKLMSSSSIDIRTLDTNTPTMEIHQMKNNHSKANRSHARSN
                     RPKFERAPSSASLDANFVLAHGHHYKKNHNGNNNTNNNTGGPLSDNASVISSSYLDSE
                     IGSGKISKDYHHVPSLASLSSLHSQQSLEHNFSLPQSPPLSNLNFNFITGNSTNNSNH
                     HSRHTTTANNWDNASINSANSSNLIQRVANINTANNIQKFQSTNNNSNSRIINSIDEN
                     GNNNNNSNTNNDNATQGRMRAGEVVVPLEEYVPSDINGVGKITDKNLLLEDWDPYSIQ
                     CSNLNLNLNRNQYDNVTATTTKTNLNELDTSTLNGLDLNNGNMDTNSSQHGLLDMFPD
                     SSTISTLSRANLLLQERNDGLLSINNSTDPSSNNRDIRKQTRNNINMSREFSNSNYTN
                     NNVLHGNINDNGNGNGIHHSSGTSRSRSWRTQQKNVSPQQAKSNLNMNMNMNTNNNSS
                     ALRNVEVLSITPSFMDIPESGGPISPTPSISQMNMANTNNDENIRHILSSTSLSSSKQ
                     RSFSIDRNHRYTSPSALMGGKSTTSPTTINPSIVSTIDDQISLNSIQSFPNSTVNDMV
                     DVSTNTDYSNTFQSQPSQPQQQSSQQGQYPLQIPLSGFQFDTIPKTDIISPGSNFIQF
                     NESPNNKNNNNNNPNFQNVNNTNLDESGNINFEDTFVFKKDSETAKRTNSNSPLKNSN
                     NNSNNNSDLNTNLNLNPDATNMLRNNEMMILNDINGGIREADLNINNNVDKNLVETNV
                     NGGSNSSPISSIQTASPPSQLLTEHGFQELDNFMSTL"
     gene            complement(<785326..>786708)
                     /gene="NDAI0B03080"
                     /locus_tag="NDAI_0B03080"
                     /db_xref="GeneID:11498431"
     mRNA            complement(<785326..>786708)
                     /gene="NDAI0B03080"
                     /locus_tag="NDAI_0B03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668538.1"
                     /db_xref="GeneID:11498431"
     CDS             complement(785326..786708)
                     /gene="NDAI0B03080"
                     /locus_tag="NDAI_0B03080"
                     /inference="similar to DNA sequence:INSDC:YPR013C"
                     /note="similar to Saccharomyces cerevisiae YPR013C;
                     ancestral locus Anc_8.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668586.1"
                     /db_xref="GeneID:11498431"
                     /db_xref="GOA:G0W6D2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W6D2"
                     /translation="MNDNNIFHVAPETREYNQLGNLSHIGIGSYNTHILRSSPQSIRG
                     RLSSVGEFTLNLDESLVSTIFMPSNIRNNPIGHIATSETNKGVANHALSAQTAKLDIT
                     NRNPYHHNGLSAAHSRDSKSEINQTFSNTSIDAEMKVHTKDTLYGTNSSSHTQPGLLT
                     VPEINKNTLTNETSNEKESLLKEPFKLPTLGSNNTKKMKTESSSRKLPVLLPSMNPRG
                     SPQENPSNRVKKLEFGISDHIHHRSAVQRSSIQQVWPRNMDPSQPQIMPNVPMPFLSQ
                     DTQLSTLIQSALNSFQYAPYGENQQNLGPSPLINEMASIFNLPVNDNQFWQRSNSLPQ
                     LHVPPTGSSNSIISHHMSVDGTQSMEDTTEPLSNDVLETERLKLMLDLSTIRRRQCPI
                     CGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRHYKIHLKKNWGNKKT
                     RKELKRNDDV"
     gene            788355..788427
                     /gene="NDAI0Btrna18K"
                     /locus_tag="NDAI_0Btrna18K"
                     /db_xref="GeneID:11498432"
     tRNA            788355..788427
                     /gene="NDAI0Btrna18K"
                     /locus_tag="NDAI_0Btrna18K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11498432"
     gene            <789017..>789580
                     /gene="NDAI0B03090"
                     /locus_tag="NDAI_0B03090"
                     /db_xref="GeneID:11497657"
     mRNA            <789017..>789580
                     /gene="NDAI0B03090"
                     /locus_tag="NDAI_0B03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668539.1"
                     /db_xref="GeneID:11497657"
     CDS             789017..789580
                     /gene="NDAI0B03090"
                     /locus_tag="NDAI_0B03090"
                     /inference="similar to DNA sequence:INSDC:YPL034W"
                     /note="similar to Saccharomyces cerevisiae YPL034W;
                     ancestral locus Anc_2.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668587.1"
                     /db_xref="GeneID:11497657"
                     /db_xref="UniProtKB/TrEMBL:G0W6D3"
                     /translation="MKKTHREQKSWNSPDTILVKIGMTTKKNVALRLQEWEKTCQHPV
                     INLSPERVRNLLSGREEFMNNDKSDVKTLTKWMKKLSLHKKDSKKVKISAEGPIKRQP
                     EILQTYKYGGFFHDGTGHTSLQEIENSIHRLLWKQYGKGLVYCYGCDPTGQRRHTEWF
                     NIPIQKLPYVLHTIDSFCLSQNEMVNR"
     gene            complement(<789678..>790466)
                     /gene="NDAI0B03100"
                     /locus_tag="NDAI_0B03100"
                     /db_xref="GeneID:11498433"
     mRNA            complement(<789678..>790466)
                     /gene="NDAI0B03100"
                     /locus_tag="NDAI_0B03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668540.1"
                     /db_xref="GeneID:11498433"
     CDS             complement(789678..790466)
                     /gene="NDAI0B03100"
                     /locus_tag="NDAI_0B03100"
                     /inference="similar to DNA sequence:INSDC:YPL033C"
                     /note="similar to Saccharomyces cerevisiae YPL033C;
                     ancestral locus Anc_2.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668588.1"
                     /db_xref="GeneID:11498433"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W6D4"
                     /translation="MFQKIMLGLLNTLYHSCWNKGPKIDIVIILGGCETKFGSKLIWS
                     FLSLGLPVIHIDLFRNENFDLLPEYQFYPLCSFENARQEAFIFQKLYTIRGKSVTLIN
                     NFQYGISQLFCSKTNQKLITLQQCTLVNLILVMKITKFFLKKIVSVKNNFSIVNISHQ
                     LTLELPSLANNYMFSKAALNQYVDSLFSELHSLKRGDMDVKCSILYLPIILDFQLWEE
                     WSDHINDEIIKYVIQGRTGVIKLEPIKYDYWKLRNIQNIMHQNI"
     gene            <790820..>791587
                     /gene="NDAI0B03110"
                     /locus_tag="NDAI_0B03110"
                     /db_xref="GeneID:11498434"
     mRNA            <790820..>791587
                     /gene="NDAI0B03110"
                     /locus_tag="NDAI_0B03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668541.1"
                     /db_xref="GeneID:11498434"
     CDS             790820..791587
                     /gene="NDAI0B03110"
                     /locus_tag="NDAI_0B03110"
                     /inference="similar to DNA sequence:INSDC:YDL087C"
                     /note="similar to Saccharomyces cerevisiae LUC7 (YDL087C);
                     ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668589.1"
                     /db_xref="GeneID:11498434"
                     /db_xref="GOA:G0W6D5"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:G0W6D5"
                     /translation="MSKILSTPAAEQRRLLEQLMGRDSSSSRHRGGSRFHSHSNRAND
                     MGLYDPKICKSYLVGDCPYDLFQGTKQSLGRCPQIHLAKHKLKYEDEKGKGVKFEAFE
                     REYFMVLSKFINDCNAQINIALKNLEHTSEEKETIRKATEELDFLDTRIGLMVQEIQL
                     LVDVNEVMKALIQSTKLQDVQEKRKLVGKKVKAITENVGQSAQQKLQVCEVCGAYLSR
                     LDTDRRLADHFLGKIHLGYVKMREHYEYYKKKRYQKT"
     gene            complement(<791837..>793120)
                     /gene="NDAI0B03120"
                     /locus_tag="NDAI_0B03120"
                     /db_xref="GeneID:11498435"
     mRNA            complement(<791837..>793120)
                     /gene="NDAI0B03120"
                     /locus_tag="NDAI_0B03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668542.1"
                     /db_xref="GeneID:11498435"
     CDS             complement(791837..793120)
                     /gene="NDAI0B03120"
                     /locus_tag="NDAI_0B03120"
                     /inference="similar to DNA sequence:INSDC:YDL089W"
                     /note="similar to Saccharomyces cerevisiae YDL089W;
                     ancestral locus Anc_2.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668590.1"
                     /db_xref="GeneID:11498435"
                     /db_xref="InterPro:IPR018819"
                     /db_xref="UniProtKB/TrEMBL:G0W6D6"
                     /translation="MSFRTSRTRLAPINTLSNGVNIKTNKSSEEFLTDLYDDELEDPA
                     YDKGNFIRRALFFFTTSPSDLLISLNETLEAIDWDAKSRTIAQPFGNGLTFLFFIMRF
                     LQDNVIYPNYHKIHKKSDAFDLSKSKKLKSYSFLKQYALDESKRKISISSFWYMSILK
                     TADYIITMISSILILLNIYLTYKFFSNHYKSYSIFNCDPELLQQSKHLTRHPLNELTQ
                     NQYYFENASKGSIWTMLKCFLFDRRKENNITSDAQEYYFKLKKWHPSKFMVNLFISFS
                     PIGICFLFFSEVSFLMLIPIAFQQLLLHHLIIEHYELLIVDNLIIASATMNEYNSKIV
                     RPKTSKRIQEVMVDSTPKGHGYVRFFPSTGVAKQSLFETHTLSGELIKEKYNKKKGRF
                     EVLDIDNSEREMPHNIIVQAPYHRPKYRRYGQRND"
     gene            <793439..>794716
                     /gene="NDAI0B03130"
                     /locus_tag="NDAI_0B03130"
                     /db_xref="GeneID:11498436"
     mRNA            <793439..>794716
                     /gene="NDAI0B03130"
                     /locus_tag="NDAI_0B03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668543.1"
                     /db_xref="GeneID:11498436"
     CDS             793439..794716
                     /gene="NDAI0B03130"
                     /locus_tag="NDAI_0B03130"
                     /inference="similar to DNA sequence:INSDC:YDL090C"
                     /note="similar to Saccharomyces cerevisiae RAM1 (YDL090C);
                     ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668591.1"
                     /db_xref="GeneID:11498436"
                     /db_xref="GOA:G0W6D7"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:G0W6D7"
                     /translation="MSNPLSRAKFIDTKLLGRKRTVVEKIVSEEEIEPLMKELETDTT
                     ISRDEVKHTCQELFEKVINKEEVVLDRKFHRRYLDLAFGSTLPPQLTALDASQPWMLY
                     WIANSLKVLDPTWLTDDIKNAIQEKIFKLSEVPHQGGPFGGGVGQLAHMAGTYASVNA
                     LAVCDNISGCWDKIDRQALYDWLLALKQPDGGFKTCLEVGEADTRGVYCALTLASLLN
                     ILTDELREGTVEYLVKCQNYEGGFGGSPQEDEAHGGYTFCAVASLAILNSLDKINLEK
                     LMEWCSLRQTNEEGGLAGRSNKLVDGCYSFWVGATSAILESRGWDSSIDKKVLRDYIL
                     ICCQSSHEPGLRDKPGKHSDFYHTMYILFGLVITENTFKDQGGHLCHNIEAKLIDSYK
                     FIPSDLQGINPVYGLPIDDTKLFMNHFRNIDKK"
     gene            798129..798202
                     /gene="NDAI0Btrna17V"
                     /locus_tag="NDAI_0Btrna17V"
                     /db_xref="GeneID:11498437"
     tRNA            798129..798202
                     /gene="NDAI0Btrna17V"
                     /locus_tag="NDAI_0Btrna17V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11498437"
     gene            <798553..>799872
                     /gene="NDAI0B03140"
                     /locus_tag="NDAI_0B03140"
                     /db_xref="GeneID:11497656"
     mRNA            <798553..>799872
                     /gene="NDAI0B03140"
                     /locus_tag="NDAI_0B03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668544.1"
                     /db_xref="GeneID:11497656"
     CDS             798553..799872
                     /gene="NDAI0B03140"
                     /locus_tag="NDAI_0B03140"
                     /inference="similar to DNA sequence:INSDC:YDL091C"
                     /note="similar to Saccharomyces cerevisiae UBX3 (YDL091C);
                     ancestral locus Anc_2.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668592.1"
                     /db_xref="GeneID:11497656"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0W6D8"
                     /translation="MNFINHALGSSNASGPDFVRSIPGAFPNQSRNGNSNTESGTNHN
                     NGSTDGATAPSRSLAFFKVIYRIPLLLLFYFMKVSLVLFTTTKSFLKYEEFYKKAKLE
                     HKVELNDIIDTISNQAIPLDDNSSYTFASLYSVENGRFNKGYMRDSYTDLLAGTSDQA
                     TFGMIYLHDPLLDDPMQYVNDILCTEPFITLIQKFQMLLWIGDVTKSEGLQVANSLKV
                     RKFPFLGFITLKNESKVELVKSYQGSLIECDYSSQSLENILTKAYPKLVNIRQQRQNQ
                     AMESLIREQQDARYQTSLNRDQERERRRVQAREREQMERHREIQERQWLLWRKARLHP
                     EPVGNEINSSRIALRVDGNRVVRKFDSSLPIEEIYAYAELYSKGLLEADAEYDSHDEY
                     PSGYDHEYTFKLVCLAPRKELDPSTIISEEPLIYPSGNVVIEDIGEI"
     gene            complement(<800038..>800472)
                     /gene="NDAI0B03150"
                     /locus_tag="NDAI_0B03150"
                     /db_xref="GeneID:11498438"
     mRNA            complement(<800038..>800472)
                     /gene="NDAI0B03150"
                     /locus_tag="NDAI_0B03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668545.1"
                     /db_xref="GeneID:11498438"
     CDS             complement(800038..800472)
                     /gene="NDAI0B03150"
                     /locus_tag="NDAI_0B03150"
                     /inference="similar to DNA sequence:INSDC:YDL092W"
                     /note="similar to Saccharomyces cerevisiae SRP14
                     (YDL092W); ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668593.1"
                     /db_xref="GeneID:11498438"
                     /db_xref="GOA:G0W6D9"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:G0W6D9"
                     /translation="MSTNEGCLSSETFLVKVSEFFKIANEKKITVHLTLKRLIDRDPV
                     EENPELDSTKQPFFDVSQKATGVVPAGKEISTKEYPLLIRISYGSHAKKTKCSTIINS
                     DQLDKFWQDYTSVVKSSMNGLIKKKKKKGKSAGTKDKKKGKK"
     gene            complement(<800942..>804085)
                     /gene="NDAI0B03160"
                     /locus_tag="NDAI_0B03160"
                     /db_xref="GeneID:11498439"
     mRNA            complement(<800942..>804085)
                     /gene="NDAI0B03160"
                     /locus_tag="NDAI_0B03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668546.1"
                     /db_xref="GeneID:11498439"
     CDS             complement(800942..804085)
                     /gene="NDAI0B03160"
                     /locus_tag="NDAI_0B03160"
                     /inference="similar to DNA sequence:INSDC:YDL095W"
                     /note="similar to Saccharomyces cerevisiae PMT1 (YDL095W);
                     ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668594.1"
                     /db_xref="GeneID:11498439"
                     /db_xref="GOA:G0W6E0"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G0W6E0"
                     /translation="MAVSKGTKEKNPDAVEEPIVQIPEVKSGPLRPYLNIEPSNHLVK
                     SRTIQTFNEKVLVATLWIFTSIIRLHDLSWPNSVVFDEVVYGGFASKYLKGTFFLDVN
                     PPLVKLLYAAIGYLSGFKGSFDFGRIGAAFSAATPYVLMRSLSALLGSFTVVVLYLTL
                     RVSGVRIWVALATAICLAVENSYVTVSRFIMLDSPLVFFIALAVYFVQKSELYQAGSI
                     KSYFLVFLSSISLGFAISSKWVAVGAFAWVGLMCLFRLWFMVGDLNRSVCSSFKIAAI
                     KIATLLVVPFCMYVFVFYLHFQLANVDSSISQYFTQEFRTALINNTIPQDIPAEVGVG
                     SRITLRHTGTNGGYLHSHSHYYETGSNQQQISLYPYEDGNNEWLVELYDKPLANVTEW
                     KNLTSGMKIKLLHNTFCRVHTHDHKPPVSENSDWQKEVSCYGFENFEGDGNDDWIIEI
                     DEDESVPGEAQQHIRALETKFRLKHAIMGCYLFSHETKLDKKGFNQQEVTCGYSGKDY
                     LTTWYVESNENPLLPDETDRVSYQKPTFLDKFIETHKKILHVSGKIDNTHPYESSPFS
                     WPLMPRGIDFWNEGHQDIYLLGNAVVWWSVTAFIALFLGNSALQLLRWQLGYELSQDP
                     VVINFHLQVIQYLLGFILNFAPSLLFKGQLFLNNYLPAYYFGILALGHGLEMIVSYFF
                     ERRKSSGYVLIVVFVFMAVRFFSGHSSLVYGTRWTTDLCEQSKLLSDWDYDCSSFYST
                     YREYDAHPDGTYEGNPLISPSKTLAAPAPPTPIPGAPLTEIEKFDEVVDDGVVKKFID
                     QNGNEIPEEEARRLIAEQGGSFERVVNGQVKGEGEGQENIEENIQENAQKNIQENVQE
                     HQQEHQQETLQGDVQENEEPVKEEEAQSVSFEPSFDNEESFPVNGGDKGSQDGVAGTV
                     HNDDGGIQEQPETPPIENVHAAEQELEQDSDQNNDEAFEQILHEPIPKKFVDENGNEL
                     DPEVARKMVQEGGSFERLQEDEEEPFPTNTVDIESLIHDGKPKKFIDEFGNELSPEDA
                     KRLVEEQGGIVEEFVLH"
     gene            complement(<804534..>807128)
                     /gene="NDAI0B03170"
                     /locus_tag="NDAI_0B03170"
                     /db_xref="GeneID:11498440"
     mRNA            complement(<804534..>807128)
                     /gene="NDAI0B03170"
                     /locus_tag="NDAI_0B03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668547.1"
                     /db_xref="GeneID:11498440"
     CDS             complement(804534..807128)
                     /gene="NDAI0B03170"
                     /locus_tag="NDAI_0B03170"
                     /inference="similar to DNA sequence:INSDC:YDL093W"
                     /note="similar to Saccharomyces cerevisiae PMT5 (YDL093W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668595.1"
                     /db_xref="GeneID:11498440"
                     /db_xref="GOA:G0W6E1"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G0W6E1"
                     /translation="MAHKKKTTSSKSGSVKPSSEQQTTETTPDLFIEKGPVRPYIVTE
                     PPKELTASRTITTMKEKLMLLALIVFTASIRLPRLSQPNSVVFDEVHFGKFASYYIKG
                     EFFMDVHPPLAKMLYAGVAALAGFKGDFLFPEIGALYPKDVPYVVMRTFSAALGSCTV
                     ILLYLTLRASGVRSWIAFVCGLCFAIENSYVTISRYILLDSPLIFFIAASAYAFKKYE
                     TYHSFSIGSLKTLIATGLCLGMAASSKWVGLFTIAWIGLLCIWRLWFMVGDLSKSVKS
                     VFMIAIMKLVCLLGIPTILYLLFFQVHFQSLRFEGDGSSFLSSEFRSALIGNTIPQNM
                     VYDVGVGSMVTLRHTGTMGGYLHSHQHNYPVGSEQQQITLYPHLDFNNEWIIESNNAP
                     GVTFKSFHNLSDGTVIKLLHPGTQCRLHSHDHKAPVSENSDWQKEVSCYGYPGFTGDG
                     NDDWIIEIDKSKSVPGEAQERIIAINTKFRLKHALSGCYLFSHETKLPEWGFQQQEVT
                     CAHSGKAYLTLWYIEGSENPLLPEDTKRISYKAPSFLQKFIESHQKMWHINSNLVEPH
                     YFESLPTSWPLLSRGISYWGDDTHHKTVYLLGNAIVWWSVSAFIVVFAIVVLYELISW
                     QVGKSILQDSNVVNFHVQVIHYLLGFAIHFAPSFLMKRQMFLHHYLPAYYFGVLALGH
                     ALDITCTHVLKRKKTFAYIFLGVFFCASYYFFNNHTAIIYGDEWTKEACKSSRWVSTW
                     DYNCDIFLDKYEDYATLELETEETPLRTMPYPTLSSESSPVIEINKNVVELEAEKVER
                     QKPSDAPPVPGKETYDDIMKQPGAKIFKDQYGNSIDPDVAKQWLQQEGGSILRVEKKT
                     VKTKLPKN"
     gene            <812336..>815659
                     /gene="NDAI0B03180"
                     /locus_tag="NDAI_0B03180"
                     /db_xref="GeneID:11498441"
     mRNA            <812336..>815659
                     /gene="NDAI0B03180"
                     /locus_tag="NDAI_0B03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668548.1"
                     /db_xref="GeneID:11498441"
     CDS             812336..815659
                     /gene="NDAI0B03180"
                     /locus_tag="NDAI_0B03180"
                     /inference="similar to DNA sequence:INSDC:YDL102W"
                     /note="similar to Saccharomyces cerevisiae POL3 (YDL102W);
                     ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668596.1"
                     /db_xref="GeneID:11498441"
                     /db_xref="GOA:G0W6E2"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:G0W6E2"
                     /translation="MSNALKRPDEEDELQDELSVDNPNTNTTKKLKLQSLDHSVGSEP
                     VSTIEIIPTDGFKKFKQLGFKPKDQDLHGTQLESVFEQELEQMEHDFALSQEKDTSIY
                     KRTPIPKDFSPSTHDISFQQIDAEQSTLNNGTKVNNTSTVVRFFGVTSEGCSVLCNVT
                     GFKHYLYVPAPNGIESIDPNELKNFINYLNELFGTTNQNGVDSIEVVQKQSIWGYSGD
                     GNLPFWKIYVTYPSLINKLRTGFEKGHYTYNSWFTNGTTTYDNIAYPLRLMVDCGIVG
                     MSWITLPKGKYTMIPDASKLSTCQLEVCINYKDLVAHPAENDWSHMAPLRILSFDIEC
                     AGRVGVFPEPEVDPVIQIANVVSVTGAKKPFIRNVFTLNSCSPITGSQVFSHDTEEEM
                     LSHWRQFILEADPDLIIGYNTTNFDLPYLINRAKALKVQDFPYFGRLKNVKQEIKDAI
                     FSSKAYGTRESKNINIDGRLQLDLLQFAQREYKLRSYTLNAVSAHFLGEQKEDVHYSI
                     ITDLQNGDSETRRRLAVYCLKDAYLPLRLLEKLMALVNYTEMARVTGVPFSYLLARGQ
                     QIKVVSQLFRKCIQIDTVIPNMSSQASDEQYEGATVIEPIRGYYDVPIATLDFNSLYP
                     SIMMAHNLCYTTLCNKATVERLKLKKDEEYIISPNGDYFVTDKVRRGILPIILDELIQ
                     ARKRAKKDLKNETDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTAF
                     GRDMIMTTKNAVEEKYTKNKGYADDAIVVYGDTDSVMVKFGTTDLKEAMRLGTEAAAF
                     VSTLFKHPINLEFEKCYFPYLLINKKRYAGLYWTNPDKFDRLDQKGLASVRRDSCSLV
                     SIVMNKVLKKILIERNVPSALDFVKATINDILHNNVDISKLIISKTLAPNYTNPQPHA
                     VLAARLKKRDGMGPNVGDRVDYVITGGNDKLYNRAEDPLYVLEHNLQIDSKYYLNNQL
                     QNPIISIIAPIIGEKDANSMFVVKSIKINTGNTKGGLMGFVKKVEVCKGCKGPLKKGE
                     GPLCSNCQERSGELYIKALYEVRDLEEKFARLWTECQRCAGSLHNEVLCSNKNCDIFY
                     MRVKVKKELQEKMEQLSKW"
     gene            complement(<815759..>817309)
                     /gene="NDAI0B03190"
                     /locus_tag="NDAI_0B03190"
                     /db_xref="GeneID:11498442"
     mRNA            complement(<815759..>817309)
                     /gene="NDAI0B03190"
                     /locus_tag="NDAI_0B03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668549.1"
                     /db_xref="GeneID:11498442"
     CDS             complement(815759..817309)
                     /gene="NDAI0B03190"
                     /locus_tag="NDAI_0B03190"
                     /inference="similar to DNA sequence:INSDC:YDL101C"
                     /note="similar to Saccharomyces cerevisiae DUN1 (YDL101C);
                     ancestral locus Anc_2.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668597.1"
                     /db_xref="GeneID:11498442"
                     /db_xref="GOA:G0W6E3"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W6E3"
                     /translation="MTATTATAKRGLSGEVPASVKRQQTIVGEMPTNTIATLVSLIPG
                     KEQIINIDAKSVTTIGRSRSCDIVLTETDISTVHCELYLIEMNMGNNSRSLINIVDKS
                     RNGTFINGNRLVKKDCILKNGDRVVLGKACSFLFKYTITDANTDFPEDNSVEASSETS
                     PQMKDPEKYDGVFKKVPANASRLNEGGVRKIAKPKTISFFDKYLLGKDLGSGHYATVK
                     QGINKINGQTVAVKIFHPQQNDDQKKNKQFKEETSILMRIHHKNIVNLLDSFIEPISK
                     SQIQKYLVLEMIYDGELFERVVKKTTLRQDETKAIFSQILTGLKYLHQQNIIHRDIKP
                     ENILLNITKRTNPEQKQLGPWDENEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVA
                     PEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYTPYWD
                     NIDDSILHLISNLLVLDANKRYSVDDAINHPWFNDTRQENTVSLEMKRLQITDNKVPK
                     TYSELSCL"
     gene            complement(<817852..>818910)
                     /gene="NDAI0B03200"
                     /locus_tag="NDAI_0B03200"
                     /db_xref="GeneID:11498443"
     mRNA            complement(<817852..>818910)
                     /gene="NDAI0B03200"
                     /locus_tag="NDAI_0B03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668550.1"
                     /db_xref="GeneID:11498443"
     CDS             complement(817852..818910)
                     /gene="NDAI0B03200"
                     /locus_tag="NDAI_0B03200"
                     /inference="similar to DNA sequence:INSDC:YDL100C"
                     /note="similar to Saccharomyces cerevisiae GET3 (YDL100C);
                     ancestral locus Anc_2.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668598.1"
                     /db_xref="GeneID:11498443"
                     /db_xref="GOA:G0W6E4"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /db_xref="UniProtKB/TrEMBL:G0W6E4"
                     /translation="MDLSVDPNLHSLINSTTHKWIFVGGKGGVGKTTSSCSIAIQMAL
                     AQPTKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPNAALKDMNDMAV
                     SRANADGTNDDDPLGGLLQGGALAELTGSIPGIDEALSFMEVMKHIKRQENGESETFD
                     TVIFDTAPTGHTLRFLQLPNTLSKLLEKFGELTGKLGPMLNMMGAGNVDIASKLNELK
                     SNVESIKQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAE
                     DDQEHNCKRCQARWKMQKKYLDQIDELYEDFHLVKMPLCAGEIRGLNNLTKFSQFLNK
                     EYDPAADGKIIYELEEKE"
     gene            <819236..>820156
                     /gene="NDAI0B03210"
                     /locus_tag="NDAI_0B03210"
                     /db_xref="GeneID:11498444"
     mRNA            <819236..>820156
                     /gene="NDAI0B03210"
                     /locus_tag="NDAI_0B03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668551.1"
                     /db_xref="GeneID:11498444"
     CDS             819236..820156
                     /gene="NDAI0B03210"
                     /locus_tag="NDAI_0B03210"
                     /inference="similar to DNA sequence:INSDC:YDL099W"
                     /note="similar to Saccharomyces cerevisiae BUG1 (YDL099W);
                     ancestral locus Anc_2.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668599.1"
                     /db_xref="GeneID:11498444"
                     /db_xref="UniProtKB/TrEMBL:G0W6E5"
                     /translation="MSEQEAEDKRAQQLEEARKRVEELKKKKKNKKNKNKKNKAKEKE
                     DENETVDVDTNEDLTPAPEVSINQDVPEAEAEDDAVATKEQENEDTSLKPEEEEVTAV
                     QETEADETESAVKSEKITGEEKIDETVSNVENISTGQKEEENLFDSNNTEPSDFLKTI
                     QQEKKKDKINQLNQKLEELTIENKRLKFTNIEQDTDIEELEAEIAKLKQSLQAKDAEL
                     ERTKDELKEALEERKSRPEANPFQFASFNDGSSGMNSHDGFIDTTRGAGRSTQIQTPK
                     VDRVLLNKWRNWNVDMTSWRSIGSGPIVEF"
     gene            complement(<820805..>821386)
                     /gene="NDAI0B03220"
                     /locus_tag="NDAI_0B03220"
                     /db_xref="GeneID:11498445"
     mRNA            complement(<820805..>821386)
                     /gene="NDAI0B03220"
                     /locus_tag="NDAI_0B03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668552.1"
                     /db_xref="GeneID:11498445"
     CDS             complement(820805..821386)
                     /gene="NDAI0B03220"
                     /locus_tag="NDAI_0B03220"
                     /inference="similar to DNA sequence:INSDC:YDL098C"
                     /note="similar to Saccharomyces cerevisiae SNU23
                     (YDL098C); ancestral locus Anc_2.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668600.1"
                     /db_xref="GeneID:11498445"
                     /db_xref="GOA:G0W6E6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W6E6"
                     /translation="MSNFGRRTWNREEYAHPITTTYEASLEGSLSATELSALKQKYTN
                     YDQLMRDSNKGINKKLLTTGLSEFKKGKQFGFYCTICDLTFKDTLQFINHLNHKTHEI
                     KFENLFKEPLILDQRDNDDIPDAEFKLAFQNAVQDFVRASGIKKKREDNGDSDRKKNK
                     SVKCNIAKSNASSSNNNEIAKMMGFQSFGSSKK"
     gene            complement(<823243..>824520)
                     /gene="NDAI0B03230"
                     /locus_tag="NDAI_0B03230"
                     /db_xref="GeneID:11497812"
     mRNA            complement(<823243..>824520)
                     /gene="NDAI0B03230"
                     /locus_tag="NDAI_0B03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668553.1"
                     /db_xref="GeneID:11497812"
     CDS             complement(823243..824520)
                     /gene="NDAI0B03230"
                     /locus_tag="NDAI_0B03230"
                     /inference="similar to DNA sequence:INSDC:YDL097C"
                     /note="similar to Saccharomyces cerevisiae RPN6 (YDL097C);
                     ancestral locus Anc_2.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668601.1"
                     /db_xref="GeneID:11497812"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:G0W6E7"
                     /translation="MSTAAMDTARKLVEDKQYEKAEQEYLQLINKDLSSNSDKVRNEM
                     ESCILELGQLYVSTNAKDKLREFIPRSTDYMMQFAKSKTAKVLKTLIEKFENIPDSLD
                     DQIFVCQKSIEFAKNEKRIFLKHSLEIKLATLHYQKKQYQDSLKLIDELLKEFKKLDD
                     KPSLVDVHLLESKVYHKLRNLAKSKAALTAARTAANSIYCPTVTMAELDLMSGILHCE
                     DKDYKTAFSYFYESFESFHNLNTSTSYGKACQVLRYMLLCKIMLNLIDDVKNILNAKY
                     TKETYQSRGIDAMKAVAEAYNNRSLLEFNTALKQYQDELMKSDDLTRSHFSALYDTLL
                     ESNLCKIIEPFECVEISHISKMIGLEPQHVEGKLSQMILDKVFYGVLDQGNGWLYIYD
                     TPHQDAAYDSALELVGELNTIIDHLYEKASVLY"
     gap             827427..827446
                     /estimated_length=20
     gap             829052..829569
                     /estimated_length=518
     gene            <831985..>833436
                     /gene="NDAI0B03240"
                     /locus_tag="NDAI_0B03240"
                     /db_xref="GeneID:11497813"
     mRNA            <831985..>833436
                     /gene="NDAI0B03240"
                     /locus_tag="NDAI_0B03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668554.1"
                     /db_xref="GeneID:11497813"
     CDS             831985..833436
                     /gene="NDAI0B03240"
                     /locus_tag="NDAI_0B03240"
                     /inference="similar to DNA sequence:INSDC:YDL103C"
                     /note="similar to Saccharomyces cerevisiae QRI1 (YDL103C);
                     ancestral locus Anc_2.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668602.1"
                     /db_xref="GeneID:11497813"
                     /db_xref="GOA:G0W6E8"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W6E8"
                     /translation="MTQDIKQLYIDAGQGHLFNHWDSLTSTEQSEFLSSLQTVANRIH
                     PRDLITNCQKAIKLADTISHASPESIRPLPTASYESIINAKNDPIESHALATYRQLGH
                     HAIEKGEVAVILMAGGQGTRLGSNEPKGCYDVGLPSHKSLFQMQAEKIHTLQRITNSK
                     RPIPWFIMTSEPTRMMTERFFDKHGYFGLTREQVQFFNQGTLPALDSNGEKLLLKDKV
                     HLVQSPDGNGGLYQGLKENGIIDKLIQLNVKHVYVYCVDNILSKIADPVFIGFAIKHG
                     FQLATKAVRKRDPHESVGLIATRDDKPCVIEYSEISKELAEDIDSNGLLRLRAGNIVN
                     HYYSVDLLRKSLNSWCDMLPYHIAKKKIPYFDNDSMELMKPGDKSNGIKLEQFIFDVF
                     PNVPLEKFGCLEVERSIEFAPLKNGPGSSNDNPETSKLAFLQLGTNWLRENNAIIKND
                     VLVEVSNKLSYDGENLEKFNGHVFEKQDVILDE"
     gene            complement(<833718..>836237)
                     /gene="NDAI0B03260"
                     /locus_tag="NDAI_0B03260"
                     /db_xref="GeneID:11497814"
     mRNA            complement(<833718..>836237)
                     /gene="NDAI0B03260"
                     /locus_tag="NDAI_0B03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668555.1"
                     /db_xref="GeneID:11497814"
     CDS             complement(833718..836237)
                     /gene="NDAI0B03260"
                     /locus_tag="NDAI_0B03260"
                     /inference="similar to DNA sequence:INSDC:YMR164C"
                     /note="similar to Saccharomyces cerevisiae MSS11
                     (YMR164C); ancestral locus Anc_2.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668603.1"
                     /db_xref="GeneID:11497814"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:G0W6E9"
                     /translation="MSNYTNEQHQQQQRRPSSPSAASTAQRSASVSVPSTKSQANKKP
                     HKMRKTSSNTNNNNTSVTATNNNTNNIDGNGNGTTRSSNNNGNSSASSTGTNLTSDPE
                     LLFDTNAFVSDAKASNSKQLLYAHIYNYLLEMRYYEAASQFLKEAEIPMALANPNGDL
                     NKKKFTTSKLISTKQPAKLFKADMLINSPQTFLLEWWESFYAMNEFIENTPAELLVKD
                     ESDYGNIYPILPEKYRQNQMATSQLLQQQQQQQQRNQNQMPPPQQTQSQPQTYQQNGP
                     KSMRVNNSTSNNNTNNNNTNIPLNVNMNMPPNMNMNVGMNMNMPPNAPSNIHPNMNMA
                     MNMNINNSRGPRNSTAAPITAQYLPNSSNNVNDTYSNYQKMNNINNQQTRIPHSATEL
                     NSSTIQPITTATTTQRLSNPQEQNLPASAPPSATFPMSNNSNTNTNTNNNSNNIYYVP
                     VNDSRENSYPNIHPINKNPSSYGIPQSNMNNYPQSQSHAQAQAQAQQQQQQQQQRSDM
                     NVNNQNIPNSMIAMQNGYPEQQQQQQLQRQNGNIGSLQPQQRQPQPQSQPQPQQQPSQ
                     QQKQFNGRPTPYPPQPQPQQHFPSDSANAPNNNNFSSMYIDPQQQQQSQMIRGPHPDQ
                     SFPHPHPNGMIEQGQIPTQLSSSSTTKVGTPISTGTTVRSNQQQQQQQQQQQQQQMLL
                     HRIQLQQQHHHQQQQPMQYQSHMNGPPQQQQQQSEETRESSTASNNATTSNIEFSTIQ
                     QHHQLQYMDMMNNMNTTAVDNNNNNNPNMASAAELFNFGMIDSNNNNNQNGFTNSNTN
                     NNNTNNNNNELPNKNNNNMNSGTNESAAKNKDVVGDNDTGL"
     gene            <837486..>838736
                     /gene="NDAI0B03270"
                     /locus_tag="NDAI_0B03270"
                     /db_xref="GeneID:11497815"
     mRNA            <837486..>838736
                     /gene="NDAI0B03270"
                     /locus_tag="NDAI_0B03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668556.1"
                     /db_xref="GeneID:11497815"
     CDS             837486..838736
                     /gene="NDAI0B03270"
                     /locus_tag="NDAI_0B03270"
                     /inference="similar to DNA sequence:INSDC:YDL104C"
                     /note="similar to Saccharomyces cerevisiae QRI7 (YDL104C);
                     ancestral locus Anc_2.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668604.1"
                     /db_xref="GeneID:11497815"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:G0W6F0"
                     /translation="MFTYHPQSSRFLLRLCLKSMKYRVTIHIRSLTAQYPQLRHYNVL
                     AIETSCDDTCLAIINRSSSTSLPENNSTIRCNLKSTLNSKSDGGIIPTKAQEHHQSSI
                     SDLISESLTYLPANEKIDLICTTRGPGMMGSLSTGLTMGKGLSLAWNIRWLVFIIFWV
                     HLLIPRMFADEDDELDFPFISLIVSGGHTCLIYSESVLKHEILVDTLDIALGDSLDKC
                     GREIGINGNMIGKEMEKLTKSYTIDKKKNDQRMILPNPLKRTNEFAFSFAPFLTAVKT
                     HLSSNNIDPKDVAIDVQKEMAYEIQEAIFDHLLLRIKKYMIINHKRFKHVKNFICSGG
                     VSANSRLRIKLNNGLNEFFKNFHYPPLEYCTDNALMIGWAGIELYENKTYPNLRSNRN
                     VLPIRKWPLNDLLNVPGWQWDGIK"
     gene            complement(<838825..>840159)
                     /gene="NDAI0B03280"
                     /locus_tag="NDAI_0B03280"
                     /db_xref="GeneID:11497816"
     mRNA            complement(<838825..>840159)
                     /gene="NDAI0B03280"
                     /locus_tag="NDAI_0B03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668557.1"
                     /db_xref="GeneID:11497816"
     CDS             complement(838825..840159)
                     /gene="NDAI0B03280"
                     /locus_tag="NDAI_0B03280"
                     /inference="similar to DNA sequence:INSDC:YDL105W"
                     /note="similar to Saccharomyces cerevisiae NSE4 (YDL105W);
                     ancestral locus Anc_2.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668605.1"
                     /db_xref="GeneID:11497816"
                     /db_xref="GOA:G0W6F1"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:G0W6F1"
                     /translation="MSSYVMLCYVVLCCVNSSHVSLYLSQSIKQYFPSHKKTYSRSYM
                     STTKRSQDHSSNEHHRVKRTKLLDNDTNDDDDAEATTGMGRLEFEALQQYREFEDKLI
                     TDRAEAIRTGDINIVINSLDNVNGLFSKVNGSKNNGLFAHDAKAIVNISELAQISVRN
                     LKFGDTRSLINIDDITNYFKRYMLKEYFKLNRIKEEESSADNLLSSMELTNDENEDND
                     GANTRNNNKLRQNVMKKNYLKQFNRYDQFNEFNWFRMGALFENFSSMPITVDHLSGPF
                     ALEKKIRAPIVRKRRVEPVGKLTKAEVVTQENLKTKEPTTPEQVKRIFKILQKKIGQS
                     NNNNNSINLFEFIIDPNSFCRTVENLFYTSFLIKEGRLELIENESDGFPSIRIKENVR
                     SNDSANNEIEKQKRLNKHQNHIIFQIDMPTWKKLIEKFSITESFIPSFSDNN"
     gene            <841165..>842952
                     /gene="NDAI0B03290"
                     /locus_tag="NDAI_0B03290"
                     /db_xref="GeneID:11497817"
     mRNA            <841165..>842952
                     /gene="NDAI0B03290"
                     /locus_tag="NDAI_0B03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668558.1"
                     /db_xref="GeneID:11497817"
     CDS             841165..842952
                     /gene="NDAI0B03290"
                     /locus_tag="NDAI_0B03290"
                     /inference="similar to DNA sequence:INSDC:YDL106C"
                     /note="similar to Saccharomyces cerevisiae PHO2 (YDL106C);
                     ancestral locus Anc_2.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668606.1"
                     /db_xref="GeneID:11497817"
                     /db_xref="GOA:G0W6F2"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G0W6F2"
                     /translation="MSAPFSTNENINNNTSHENGSNDDIRLTMLNEFMVNNNNNLDNF
                     DFTINTNTNTNTNTSVTTTTNTNDNIIDDSASNITTNTNTTPNTNTNTNATKTKRKRA
                     KGETLNILKQYFDQNPIPSLQERKNISKLTNMPEKNVRIWFQNRRAKLKKNGTILNIK
                     KQQQQHSNSQKNKNNNNNNNNNENSSYSDDSNDNNSESNSNSDGSADAEDDINDAFFD
                     RIPIDSNKNYYFIDSCSITVGSWNRMKNGSLLEKDYPIVNTLSNLSPISIDKIMANTT
                     DLLILVSRKNDEINYFFSALADETKILFRIFFPLSSVQNCSLVLQTDNDILPTDLESI
                     QQEEEKFGELKLTLTKSPTFAVYFVENTDDQLSLNQWSICEDFSEGKQVTDAFIGGSN
                     LPHILKGLQNSLKFLNSYILDYKSTKEILPPSINTQSHLPSQSQAQSQQLQLHSHSQQ
                     HYQDNNNNNHNNHIPHDTNDSNNISNSFMPLSMVPSPSTSNSLISNVLSPPNIPQNAL
                     FSLLLDDQGTTSGAGAVTTDTHNNNNNTTNQETNSNDNENKNDNSNNNNNNNNNNAGM
                     EPSILPTDLDNDSHSLFFDTYSHDTGKWL"
     gene            complement(<843279..>844427)
                     /gene="NDAI0B03300"
                     /locus_tag="NDAI_0B03300"
                     /db_xref="GeneID:11497818"
     mRNA            complement(<843279..>844427)
                     /gene="NDAI0B03300"
                     /locus_tag="NDAI_0B03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668559.1"
                     /db_xref="GeneID:11497818"
     CDS             complement(843279..844427)
                     /gene="NDAI0B03300"
                     /locus_tag="NDAI_0B03300"
                     /inference="similar to DNA sequence:INSDC:YDL107W"
                     /note="similar to Saccharomyces cerevisiae MSS2 (YDL107W);
                     ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668607.1"
                     /db_xref="GeneID:11497818"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="UniProtKB/TrEMBL:G0W6F3"
                     /translation="MVATPRWNYNRDIPPNLYREDKKLDTERRDETRQKSMNKWSIIL
                     RRNLTTTPTKQLRPFNELFPSKRFINKILFEIDSDKTYHELLPKFTKLYQNTSYSLRP
                     LYDFQDSHELMLMNKILRQISKRQRMTNESFIKMENLLLERAAELGDNDAISMLCFNI
                     LKDNASGENDGDVKNAKKLVKELLEIEHPLTLKNVGDLCVVRHDNNEAKRYYNKFLQT
                     VLHGNDDNNSNVLLIGQVYEKLGEIEYQEGNFLKAEEYWLKCIKICKLEDCNKSYFYL
                     GKIYLNSEPLKSKVLFENCATQGFKEAFKELGFLEMNYFKNYDKAIEWFKLGMELFDI
                     QCFFGFFQSCYHLKKWGACSNCLKSLKRFESVNKSYKDLIDQFLIQTK"
     gene            complement(<844616..>845557)
                     /gene="NDAI0B03310"
                     /locus_tag="NDAI_0B03310"
                     /db_xref="GeneID:11497819"
     mRNA            complement(<844616..>845557)
                     /gene="NDAI0B03310"
                     /locus_tag="NDAI_0B03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668560.1"
                     /db_xref="GeneID:11497819"
     CDS             complement(844616..845557)
                     /gene="NDAI0B03310"
                     /locus_tag="NDAI_0B03310"
                     /inference="similar to DNA sequence:INSDC:YDL108W"
                     /note="similar to Saccharomyces cerevisiae KIN28
                     (YDL108W); ancestral locus Anc_2.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668608.1"
                     /db_xref="GeneID:11497819"
                     /db_xref="GOA:G0W6F4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W6F4"
                     /translation="MSTANNTPIAKVEYTKEKKVGEGTYAVVYLGTKQSTGRQIAVKE
                     IKTSEFKDGLDMSAIREVKYLQEMQHDNVIELIDIFMAYDNLNLVLEFLPTDLEVIIK
                     DKSILFTPADIKSWMLMTLRGVHHCHRNFILHRDLKPNNLLVSPDGIIKVADFGLARA
                     IPAPHENLTSNVVTRWYRAPELLFGARHYTSAIDIWSVGVIFAELMLRIPYLPGQNDV
                     DQMEVTFRALGTPTDKDWPEVSSFNSYNKLQIYPPPSTFELRKRFIAASENALKFMSG
                     MLTMNPVKRWSAIECLESEYFQEMPPPTNPSEIPLPK"
     gene            <845809..>847758
                     /gene="NDAI0B03320"
                     /locus_tag="NDAI_0B03320"
                     /db_xref="GeneID:11497820"
     mRNA            <845809..>847758
                     /gene="NDAI0B03320"
                     /locus_tag="NDAI_0B03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668561.1"
                     /db_xref="GeneID:11497820"
     CDS             845809..847758
                     /gene="NDAI0B03320"
                     /locus_tag="NDAI_0B03320"
                     /inference="similar to DNA sequence:INSDC:YDL109C,YGL144C"
                     /note="similar to Saccharomyces cerevisiae YDL109C and
                     ROG1 (YGL144C); ancestral locus Anc_2.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668609.1"
                     /db_xref="GeneID:11497820"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W6F5"
                     /translation="MGIRPEPLYQDESQLKIGEIERYIITYDLYQGDDLPPALNLNPL
                     QLTLKNLSISSSRATYLMGPFTLYCHLITDSYNHKKRIISSLDKPQYVSNLQPQCKFE
                     STLSLNQIKRQYVWILDVVSQLIFTTTLCVPFILTINYSGSFQSSCSLNGKNVGPSSL
                     HVRKLDVHDLWDPYVQMPLVSREQQGEAKREEYIHLVILTHGMHSNNTADMFYMMEQL
                     RGINDRSPEDNHEKIVIDGFNGNVCETELGIKYLGEKLAKHIVNDLYNDRIVKISFIG
                     HSLGGLIQSFAIAYITIVYPWFFKSVVPINFIALATPFLGVVTDNPKYVKVILSSGAV
                     GKTGHELALLKDSQNENILHLLSGEPLITILSKFKNRTIYANYMNDGIVPLHTSSLLF
                     LDYNEIMQELRKRGVQSKRLSSVSSRWRLRKSKKEEYTLPKASVLQSMKTILVPPDPD
                     DEFVCNPDARETVIIHDKVYTNEDVERILLDYEKLQSSSPNTEGEQEDRDPRGKDIRV
                     LEKFIQKGLNGKSKHAALVIDIARRWHFPELPWRKVIVNIKPEAHNSIIVRRRFSNAY
                     GWEVIDHLIEAHFPEDTKEIGDTSETINALQAVTSTDHNGKQELEPNKLFSWLTKVET
                     TRTHHGGLLSRSTKFFDSRNKDRIA"
     gene            <848506..>851265
                     /gene="NDAI0B03330"
                     /locus_tag="NDAI_0B03330"
                     /db_xref="GeneID:11497821"
     mRNA            <848506..>851265
                     /gene="NDAI0B03330"
                     /locus_tag="NDAI_0B03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668562.1"
                     /db_xref="GeneID:11497821"
     CDS             848506..851265
                     /gene="NDAI0B03330"
                     /locus_tag="NDAI_0B03330"
                     /inference="similar to DNA sequence:INSDC:YDL117W"
                     /note="similar to Saccharomyces cerevisiae CYK3 (YDL117W);
                     ancestral locus Anc_2.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668610.1"
                     /db_xref="GeneID:11497821"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="UniProtKB/TrEMBL:G0W6F6"
                     /translation="MTSNISSSLKPPFKVRAKYGWSGQAKGDLGFLEGDIMEVTRVAG
                     DWFYGKLLRNRKCAGYFPNNFVTLLEERLNEAPGNSQDSSRRTTTTTTKKEQQMKTSV
                     PAIPSRESARSHRDNSASTLPSFPHSRQPLRVSNSSPSFPEYSRNMKVSTTTTPSYYP
                     NEKQRRQNRETYHEPKQYVYQQQRSSYSTRNDKFNESLNNPLPPLPPLPAISMKDSSR
                     DRLPTKSYSSNDINSSLSKDYNYYKENQNFYDGFYPTKKSILSNDDNHTSNSNPSSSS
                     SSSNLFSNSKYLDNSLTSSENSFALMSDFSATSAGSFARHKYAQSFTNSLEKSQSISN
                     KKNTDTINSNDNSFTTSGNRMSGFFKKMMTKSATHTNNDKEENDSYPKLPALEDLNIS
                     NSHGDARDWLTIKSHINRSRTLTKYDKHPRYMRALEEHRDIVLHPQDSIYDDLSTNET
                     KGSTNSKPGLVDIELSDLKVEYIDKMTWKRCTNNKKLNQMKIDSWANLTFSARYATTM
                     EKLRGIYIFCTEMFALIDDNGSSDFSKEPPNLDQLLYQNHCTPYQLTWLFQRLANSLG
                     ITCEIVIGFLKTPGSQTTEFKYNHCWLRVLVNREWRLIDVILGNLTNPIHEFVNNEKK
                     KKAENYYFLAQPLDFIYTHIPPRDFEQHIVPSIDQLSALYLPLVFPSFFKNSLKLYKF
                     CTALSFLEDSEIYECQLEIPSDIELFTSVVISDDNDNATPIPSEKLSIYNSMDLTLTQ
                     MKRHKMDSSRRIAIIKAVLPPGAEKGSLYIHSGLRGTQTTLVNVHPLSVMIPLTHKGN
                     ESEFEFVTRLPSENVQRIETYIMEPQNKILFVDNEYNFEIIQQPFDGVIYNKDISRYD
                     NELRSMAIKSPSGKIYSMVKNDPHFPYGTWKKNINIKEVGTWTGLIMDDSGIGWCPFA
                     EWVCT"
     gene            <851668..>853962
                     /gene="NDAI0B03340"
                     /locus_tag="NDAI_0B03340"
                     /db_xref="GeneID:11497822"
     mRNA            <851668..>853962
                     /gene="NDAI0B03340"
                     /locus_tag="NDAI_0B03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668563.1"
                     /db_xref="GeneID:11497822"
     CDS             851668..853962
                     /gene="NDAI0B03340"
                     /locus_tag="NDAI_0B03340"
                     /inference="similar to DNA sequence:INSDC:YDL116W"
                     /note="similar to Saccharomyces cerevisiae NUP84
                     (YDL116W); ancestral locus Anc_2.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668611.1"
                     /db_xref="GeneID:11497822"
                     /db_xref="GOA:G0W6F7"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:G0W6F7"
                     /translation="MDMDFPLRNDISTPLSGQIDQKKQHFVKFSDALMDFQEAEQTEE
                     DIETSASPFDMIKQFRSIAGELALSSIDKAKEAGGETTNNDYNDWELEARFWHLLDLL
                     ISYRVSDHDMNDENENENHANVVYPYNSSAIFEKDLLSKDHQLYQIWIIIVWLQENRT
                     VGERPTSLPTSKWVNTLISGGGLKSSDLDARLRDPAVVKLHEKDIQDDQMFFKYIYDL
                     LLSGNYDELFDECRLSENLTFSMILCGMQEYVNPKIDTQVDNEFDSQQGVKKHALWRR
                     AVFALSKSSNIGYYERAIYQYLAGVILEDNNAGKDQAILMDWETEFLLYLNQIFQIEV
                     ENYLLQNNKFDSEELVLQLPSKSISLPDILNLLASKYPTESESPIRVLIGAIILDKLP
                     SLVHSSVEMLQDLVAGEENNNDLLDEPYLLRVMTHLVIFLDFVTPGIISKLDKKRLIT
                     AYISILKLHGLYESIPIYINFLEPEDALEAYSFILSTMEDPIVREKQLKLMIFLKLPK
                     SDILKRTTQRVFTETESEYEPKNEISVIFEVNDIDKHLIYNVEWLLEGKYYMDAMEAV
                     IALARRFLINGKVKALDFFFKRNSVDDLVKNYDLTKLAAQRMSTDDDSIILDCKTQEL
                     RQYERLIDGLNNYEQWNKTVKLLNSESNIPSLIEKFREYTDGTYDIIKTFLVDLTENH
                     DHPEQEILHEIRSLYTPFLIIELHKGLVEASKLLKIPKFINEALNYTSLVANETDKIY
                     LLFKSSNKLKEYLQLVANTATLVE"
     gene            complement(<854060..>855326)
                     /gene="NDAI0B03350"
                     /locus_tag="NDAI_0B03350"
                     /db_xref="GeneID:11497823"
     mRNA            complement(join(<854060..855099,855233..>855326))
                     /gene="NDAI0B03350"
                     /locus_tag="NDAI_0B03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668564.1"
                     /db_xref="GeneID:11497823"
     CDS             complement(join(854060..855099,855233..855326))
                     /gene="NDAI0B03350"
                     /locus_tag="NDAI_0B03350"
                     /inference="similar to DNA sequence:INSDC:YDL115C"
                     /note="similar to Saccharomyces cerevisiae IWR1 (YDL115C);
                     ancestral locus Anc_2.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668612.1"
                     /db_xref="GeneID:11497823"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:G0W6F8"
                     /translation="MTLNNSTIPSSDAPEFIRVKRRRDEDSVQALLIDEGKKNKRTKF
                     MFRLTKTVNPNSYQSEHESTTPLLKLSATDNRHFVLEQKKRRHSSTYDGDEKPLPYTD
                     QDRATTTNDDNELPPEIHEMVDKYLTLNKGKPTTTRKKPSKKHFTGESAKIITMPSLD
                     YVYDIYHLENLPDEEEISKYKRDNKIGFVKIINTDMDLVPDEDEDEDVLARSDDEDSN
                     EENYYQNDYPEDEDDDRSVLFGSEGEDIAADGEGPMTQNEPWNYQKILRADGTENVED
                     EYADLFDKLGGNNNILSSINPGSNFVDLDRGADIEETHDSDEAEEDIDVDYNELDHDN
                     SLMTDYGKGNFPRNRFFPTDDEDPLAEHRDKIFGNLQNMINKK"
     gene            <855790..>856674
                     /gene="NDAI0B03360"
                     /locus_tag="NDAI_0B03360"
                     /db_xref="GeneID:11497824"
     mRNA            <855790..>856674
                     /gene="NDAI0B03360"
                     /locus_tag="NDAI_0B03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668565.1"
                     /db_xref="GeneID:11497824"
     CDS             855790..856674
                     /gene="NDAI0B03360"
                     /locus_tag="NDAI_0B03360"
                     /inference="similar to DNA sequence:INSDC:YDL114W"
                     /note="similar to Saccharomyces cerevisiae YDL114W;
                     ancestral locus Anc_2.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668613.1"
                     /db_xref="GeneID:11497824"
                     /db_xref="GOA:G0W6F9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G0W6F9"
                     /translation="MVLLVRNVLLNILISFQKRFTFPFLEKKTPEDTILKKGSVAIIT
                     GGSGGLGLEIVKRLTSRNVTCIILDVIPPNVRFKKEEKVIFYRCDISSIHQVKKVHRD
                     IRKRNERISLLINNAGITCVKPLIEMTNQEIKKIIEVNFIGAYGMIETFLPDLMRDND
                     KCYIVNIASVLGLISPANLTGYGASKAGMIAVHKSLASSLKNCKEGHKIRTLLVCTGK
                     IKTTMFETVPTPSSILAPDIDPSELAKLIIHSIDNNLEHTLKEPYYVNLVPFFKMLDR
                     PYIALLKRFSGMNQATSN"
     gene            complement(<856887..>859010)
                     /gene="NDAI0B03370"
                     /locus_tag="NDAI_0B03370"
                     /db_xref="GeneID:11497825"
     mRNA            complement(<856887..>859010)
                     /gene="NDAI0B03370"
                     /locus_tag="NDAI_0B03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668566.1"
                     /db_xref="GeneID:11497825"
     CDS             complement(856887..859010)
                     /gene="NDAI0B03370"
                     /locus_tag="NDAI_0B03370"
                     /inference="similar to DNA sequence:INSDC:YDL113C"
                     /note="similar to Saccharomyces cerevisiae ATG20
                     (YDL113C); ancestral locus Anc_2.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668614.1"
                     /db_xref="GeneID:11497825"
                     /db_xref="GOA:G0W6G0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:G0W6G0"
                     /translation="MVSKMDNSNVSKNTTNNKSNDTPKLMEGSAESIDDKATESEIFQ
                     DFKDAQMLSDDITEENKQVVSPHSDASNEDNSNNPIKETKNDANISSSSKLEPIMVHT
                     ALLEKDNPFMESSPNNHPNEDGVVGKVDQIDEDKTNSEQDIEKDVSKETNASKTELTT
                     SLTKKSKDLINPNEAYRNNKDDTGLLRLDHSASPNTKDKGTINSLNEHEKSTPKIYSK
                     DIENQSSHSTENQPVCKILDATKISEGQGRSYIAYTIKYNDSSVKRRYSDFESLRNIL
                     VRLFPMVLIPPIPEKQSIKNYGKVITGATSNYQLPTNAQTSVDLSLSIINGTINNSDE
                     KLIRHRVRMLTQFLKKLLKNDEIMKTSIMQDFLSSNNANWKDFLNSSPTFSTLPKNVL
                     QCNPLDPTTTTRIHASLPIPNSSTQLVLPRDNTDSIPEDPKDPFSFIEQDYKQYETLL
                     NNGIYKHNRRITKTLHDIGNDMKEISELFLNLSNLEPENHELFGELLYVSGSYGSSAS
                     TLDELVNKLYFNINEPLNESIYMMGAARELIKYRKMKYLQLNMIKKSLDSKSHQFEKL
                     RQQNVANEHLDKFIDSETAKSHVINLARPPQEPRTYSGKFLNSFNKFATIVKDSVVNK
                     DMDPRMTCKSLSKDIELLKESVSVTEDDMEIISKVIKDEELPKFSKERGEEMSTILKQ
                     YSQYMRAYAEKNLAIWKEQRGRLDK"
     gene            <859629..>863969
                     /gene="NDAI0B03380"
                     /locus_tag="NDAI_0B03380"
                     /db_xref="GeneID:11497826"
     mRNA            <859629..>863969
                     /gene="NDAI0B03380"
                     /locus_tag="NDAI_0B03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668567.1"
                     /db_xref="GeneID:11497826"
     CDS             859629..863969
                     /gene="NDAI0B03380"
                     /locus_tag="NDAI_0B03380"
                     /inference="similar to DNA sequence:INSDC:YDL112W"
                     /note="similar to Saccharomyces cerevisiae TRM3 (YDL112W);
                     ancestral locus Anc_2.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668615.1"
                     /db_xref="GeneID:11497826"
                     /db_xref="GOA:G0W6G1"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:G0W6G1"
                     /translation="MSSSGLITKILGPDDQLKLVTELIEHDQLEQLLEICNISELDLS
                     RDPQTIDNLFHKIQQRFDLNFHDLRERTDSNLNQLNEYLENKDAQILAQLIAQTNELW
                     KKFDAWVTNKILQYILSNHKKLFDAEFYNEIMARFLNNDKMSYDIEAIENIEEFEIVY
                     DLHLLESVYLFEDPTRKPLVSNTSDRLLLPLLSCNIETIATGASKLMRWRIIAIHETC
                     NIDQEFDKLTWSLLKDLYVAGKEASWKQKNYLSFLLRILSDKKMSPELIKFVQTEQYW
                     VHLQDSLNHTVHELRKLGLSILKLTIQCLSEGIDAFTTTSFHWDPSKVEEITETWKRF
                     TTLYEIVALDTALNQLHAANADIIGLFDDATIYPSWGLILFSTGLMASMESVRKYTMS
                     LVFEVRDAAVFSTNTSILLETILPSMMQAHYYNTDKLLCPYGDRVALFVCDILSQPVD
                     EVHHSNLLLDLFKLLIKEGTSFDPARIYVSIGVLKFLEVNHANILSYDHLNLIKKLYE
                     FESEDEVFQTTIQTIYLKFLLYVHPTIEPSHWIQTMVSHLYWNKGSYRYLSPLLDSFR
                     DVAVSRFNPNNTTEQLQFTIGNEPTFDALTLILFDDQEVEITNEIIFEIIKSKEHVKV
                     LSSEKVVNVLITLLSGTENDDVYLDSYTLADYEGFTASTWNSLNISPLWVSIRDKFSP
                     EKFKFFVSIFKKMVSDSIQNFHINADEVLSLYGKITEYLQEFPKHKENFRVKDVIYGT
                     YFDFLLVFLKINFLDEEKDELRKILNMVDSNIHQDNGNYLGNLGVTKICQFLLDTYVV
                     INPKTEPEVDEKNSSIIHFIFDNMISIWDVISTDRLVLKERELYLSLLKTIFHPSILY
                     MASLPIAAHGMVSRFEQYGKDIISHGFSRRGLLPLLGLQICKFMEKYGKTLNNDAIDY
                     WWLIKIISLCFIQPQMSVNIFKLKPVIAHLFDKKLSLYFIKGSGLYEEVYGSEEISSR
                     VLIINSMLLSSDYFKIQFISELVKRNNLLISKKRIDGPEETERLLLWELLLMCRHQSA
                     STLDISKDIKDMILSNITMEEGSPLVRTYKEWFIAYNFAKKFNEKKATEIEDFIFELL
                     VDHSKPIQVVSAEKICFLVLKALTIEGKFDVTRLLERFISNIVPNATSNKPLVRHFSN
                     SLMLSFWPIFETSIKNATLKSILKNLFLNAQKTQLFGKYRAGDANIWDLYDDLTLVSI
                     FGGVIRKITDHAAPYISEMTFKKYLINKDLFPMGKDENTLWLNKRSSLEATISGSEDL
                     TEKGFQLQTKSGAWETVLDIDTKKSNEMVKRSDLIVVASLVDKPPNLGGICRLCDVLG
                     VGLLTVQDIKVKNHPQFKNVAVTADRWMPMEEVPVDGIVEFMKLKKREGYSLIGLEQT
                     DKSVKLDNDYRFPRKCLILLGTEAHGIPGPLLNELDLCLEIKQFGVIRSMNIQTATAV
                     IVQSYTVQHM"
     gene            complement(<864157..>864588)
                     /gene="NDAI0B03390"
                     /locus_tag="NDAI_0B03390"
                     /db_xref="GeneID:11497827"
     mRNA            complement(<864157..>864588)
                     /gene="NDAI0B03390"
                     /locus_tag="NDAI_0B03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668568.1"
                     /db_xref="GeneID:11497827"
     CDS             complement(864157..864588)
                     /gene="NDAI0B03390"
                     /locus_tag="NDAI_0B03390"
                     /inference="similar to DNA sequence:INSDC:YDL110C"
                     /note="similar to Saccharomyces cerevisiae TMA17
                     (YDL110C); ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668616.1"
                     /db_xref="GeneID:11497827"
                     /db_xref="UniProtKB/TrEMBL:G0W6G2"
                     /translation="MSTSSSLKRPIKIDAFKVAIRDMSSDELFNIQREIENSVHHLER
                     SNDKLAKYIAKLEGNHHHEEEDEDTSEVETIDESDLQLFKDSMNENNIVLKNYSQRLE
                     ALTQEHIFRTSGKATNENIKSKNIDSDNNTQQNATPNQIYL"
     gene            <865804..>866736
                     /gene="NDAI0B03400"
                     /locus_tag="NDAI_0B03400"
                     /db_xref="GeneID:11497941"
     mRNA            <865804..>866736
                     /gene="NDAI0B03400"
                     /locus_tag="NDAI_0B03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668569.1"
                     /db_xref="GeneID:11497941"
     CDS             865804..866736
                     /gene="NDAI0B03400"
                     /locus_tag="NDAI_0B03400"
                     /inference="similar to DNA sequence:INSDC:YDL119C"
                     /note="similar to Saccharomyces cerevisiae YDL119C;
                     ancestral locus Anc_2.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668617.1"
                     /db_xref="GeneID:11497941"
                     /db_xref="GOA:G0W6G3"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W6G3"
                     /translation="MTESSSSKTTVHLVGGFLGGLSSAVTLQPLDLLKTRIQQHKGST
                     LLTALKEIKNPLQFWRGTLPSALRTSIGSGLYLSCLNIMRTTLVKERSTLLPSSTSTS
                     PSSIGSFGKSSKLPQLTMSENLITGALARGLVGCITMPITVLKVRYESTFYHYKSLNE
                     AIINIYTTEGTKGFFRGVGATCLRDAPYAGLYVLLYEKSKQIVPKFLPTALIHYDKNG
                     KYNMSTSTLVNSTSAFISASLATTATAPLDTIKTRMQLDPKVFNGFFKTVYIIVRKES
                     VLNLFSGLSMRLTRKALSAGIAWGIYEDLIKRFM"
     gene            complement(<866982..>867545)
                     /gene="NDAI0B03410"
                     /locus_tag="NDAI_0B03410"
                     /db_xref="GeneID:11497942"
     mRNA            complement(<866982..>867545)
                     /gene="NDAI0B03410"
                     /locus_tag="NDAI_0B03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668570.1"
                     /db_xref="GeneID:11497942"
     CDS             complement(866982..867545)
                     /gene="NDAI0B03410"
                     /locus_tag="NDAI_0B03410"
                     /inference="similar to DNA sequence:INSDC:YDL120W"
                     /note="similar to Saccharomyces cerevisiae YFH1 (YDL120W);
                     ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668618.1"
                     /db_xref="GeneID:11497942"
                     /db_xref="GOA:G0W6G4"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:G0W6G4"
                     /translation="MSLSRGSVVRISRLRLFPTLINPIFTRHLQYHCLNRQYLAAKKT
                     HYGANIVSNMLLKREYASSTDGRDIPEEILNLPLQTYHVEADSFLNNLLEKLEMVSDE
                     YPNDITEVDLSHGVMTLEVPAIGAYVINKQPPNKQIWFASPISGPDRFDFYKKQWISL
                     RNGNKLLDVLQKELNDAIPGTEVNLKK"
     gene            <867864..>868328
                     /gene="NDAI0B03420"
                     /locus_tag="NDAI_0B03420"
                     /db_xref="GeneID:11497943"
     mRNA            <867864..>868328
                     /gene="NDAI0B03420"
                     /locus_tag="NDAI_0B03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668571.1"
                     /db_xref="GeneID:11497943"
     CDS             867864..868328
                     /gene="NDAI0B03420"
                     /locus_tag="NDAI_0B03420"
                     /inference="similar to DNA sequence:INSDC:YDL121C"
                     /note="similar to Saccharomyces cerevisiae YDL121C;
                     ancestral locus Anc_2.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668619.1"
                     /db_xref="GeneID:11497943"
                     /db_xref="UniProtKB/TrEMBL:G0W6G5"
                     /translation="MDIFAYFVLFCVVILFIIILPLLSNVGNFKIGRPSSRPSDQDVP
                     TSNRQRLKNAINDPNLLKFKLKKEPEDNYDDNTSGKSSANTRDGKFEIDNKTGLKKRI
                     IGRKVVDASNPNEFDYDLEELINEDRIEEERAEAKRMSKFKGKEQETYEELV"
     gene            complement(<868578..>871148)
                     /gene="NDAI0B03430"
                     /locus_tag="NDAI_0B03430"
                     /db_xref="GeneID:11497944"
     mRNA            complement(<868578..>871148)
                     /gene="NDAI0B03430"
                     /locus_tag="NDAI_0B03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668572.1"
                     /db_xref="GeneID:11497944"
     CDS             complement(868578..871148)
                     /gene="NDAI0B03430"
                     /locus_tag="NDAI_0B03430"
                     /inference="similar to DNA sequence:INSDC:YDL122W"
                     /note="similar to Saccharomyces cerevisiae UBP1 (YDL122W);
                     ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668620.1"
                     /db_xref="GeneID:11497944"
                     /db_xref="GOA:G0W6G6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0W6G6"
                     /translation="MDQKIYENYLQNSSSYHSSSLPITISTAAAATTTTTTTTTTTTT
                     GSFPLNIIDKYNNTNTLVTTLLLAVLIPIMVYYRSNISSALHNNSNYGPSSSSGNGGG
                     GGIMRRWMPRSSQMDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTI
                     KQEQEQEQEQEQVGDEKKEDVDIGFTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKN
                     APNKNMLLGYDQEDAQEFFQNILSELEKNLKSISSQNNKEEEEEKKEQEKNSNECVKI
                     LKKDLPKDAIIGQEQLGKVGTVYIPTEQIEPNTSTALPSSNPQEKLYTPFKLITPLDG
                     ISAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGMTLKLSNLLNEWIKPEIIDGVEC
                     NRCALEAIKSHLLDQLEQYHNNSTEIPQKLIDAVKDRVECLQKILSKPVIDEEDYKKL
                     HTENMVRKCSKSKQILISRPPPLLSIHINRSVFDVRTYQIRKNNSRVLFKSKLNLEPW
                     TCDIDEINLDARLPMSKKESSLGQDEFSEDDEATTNGEYYNRLHQKYQQEFEDSSDED
                     DDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIEDSSSVYSSADEKDTHDSIEETDSLG
                     NTIRKRVIKQETFERAEDSIEKENEGAEANHDDDNDDNNDEQEHKGNNDDELPSSSPL
                     AASEEEEDGEVQETSLSPSGAIPQTIRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYI
                     AFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLFYEYDYDEITGKLKDDLGLGDEDI
                     DIEMETPENNDMDVVVENESEDENEEELMEEKEQRQQQEEEEEEVAAEKEDEVLEPID
                     "
     gene            complement(<872200..>873699)
                     /gene="NDAI0B03440"
                     /locus_tag="NDAI_0B03440"
                     /db_xref="GeneID:11497945"
     mRNA            complement(<872200..>873699)
                     /gene="NDAI0B03440"
                     /locus_tag="NDAI_0B03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668573.1"
                     /db_xref="GeneID:11497945"
     CDS             complement(872200..873699)
                     /gene="NDAI0B03440"
                     /locus_tag="NDAI_0B03440"
                     /inference="similar to DNA sequence:INSDC:YNL016W"
                     /note="similar to Saccharomyces cerevisiae PUB1 (YNL016W);
                     ancestral locus Anc_2.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668621.1"
                     /db_xref="GeneID:11497945"
                     /db_xref="GOA:G0W6G7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W6G7"
                     /translation="MAEETAPILSQEQEGSASPITESSTASAAIEHVQEEQATTETNQ
                     QDGEESNQTEIATEEKGNGEEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINEDL
                     LKQYFQVGGQITDVKIMVDKKNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKIN
                     WAFQSQQNLNSNDTFNLFVGDLNIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGY
                     GFVSFADRDQAQNAMDTMQGKEINGRPIRINWATKRENNNNNHGGNNNGQQRRGGYRN
                     NNNNNNSRNTMGGMPMGMGGMPQNVMGLGSMDGIPIQMQQQQQQQQQQQVAAAAAAAA
                     AAAAAQQGPLVPGPVNPQAVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFI
                     LDFSHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTTFIPNQQQQQ
                     QQAQVQGQQQQQLPPQHGQIPMQEQGQQPGMIPIMMNDQQQQQQQQQDM"
     gene            <874743..>875858
                     /gene="NDAI0B03450"
                     /locus_tag="NDAI_0B03450"
                     /db_xref="GeneID:11497946"
     mRNA            <874743..>875858
                     /gene="NDAI0B03450"
                     /locus_tag="NDAI_0B03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668574.1"
                     /db_xref="GeneID:11497946"
     CDS             874743..875858
                     /gene="NDAI0B03450"
                     /locus_tag="NDAI_0B03450"
                     /inference="similar to DNA sequence:INSDC:YIL083C"
                     /note="similar to Saccharomyces cerevisiae YIL083C;
                     ancestral locus Anc_2.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668622.1"
                     /db_xref="GeneID:11497946"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:G0W6G8"
                     /translation="MTTSQKETVPVRIHTSITEISHAIDRTITDEAFPVAYTTEEEHY
                     FQTNPKPSYIDELIKQSQDFIDLQHSLGRTKIVLITSGGTTVPLENNTVRFIDNFSAG
                     TRGASSAEQFLLNGYSVIFLHREFSLTPFNRNFTHGTSISFLDYFDERGQINSKYHDK
                     IMEMKTLYDRFHSHERKLLLLPFTTVNQYLWSLKSIARLMNSTGSLFYLAAAVSDFFI
                     PFSRLPEHKIQSRDYKTDGVETSTGAVTSKEMKKELAMTTPEGQLIINLDPVPKFLRR
                     LVESWATQAMLVSFKLETDQSILIEKSTFALDRYNHQLVIGNLLQTRHKEVVFVSPDN
                     RRGQWIHLDGDHKELEELMIPEVIKRHDQWIQSQFKA"
     gene            <876271..>877365
                     /gene="NDAI0B03460"
                     /locus_tag="NDAI_0B03460"
                     /db_xref="GeneID:11497947"
     mRNA            <876271..>877365
                     /gene="NDAI0B03460"
                     /locus_tag="NDAI_0B03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668575.1"
                     /db_xref="GeneID:11497947"
     CDS             876271..877365
                     /gene="NDAI0B03460"
                     /locus_tag="NDAI_0B03460"
                     /inference="similar to DNA sequence:INSDC:YIL084C"
                     /note="similar to Saccharomyces cerevisiae SDS3 (YIL084C);
                     ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668623.1"
                     /db_xref="GeneID:11497947"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:G0W6G9"
                     /translation="MTTQKSHLRELSRKDKKRYNMETKVSKIHHNFINDRDVHYKDRL
                     TSLQLNLTTLHDGTNPLLLRGIRDLEEERDLDLVRLRFFEEYRVSRSSIEFQEDIERA
                     KMDHEKLIKLCKEKLYSIIDNKIKNLKEERLLMDVANVHSYSMDYSRPYYHKNTRSHT
                     TTGAASVQQQSGWESSSNDMANESATDTGLERRSLRRRLGTTRGGDDDGDTFIGGRGR
                     KGKQQQQHFTTGNTGDNNNNTDESDFQTGYSTGTWTGTIAKQKTNSNNNTNGYKTGIS
                     SDSDFLQGISDHAELQALLFGGKSANGAAAKSTAENKRKYRSQRYSTKSAPPLGSLTT
                     DEITEDINLLRSLSGKPPSPFKTANSSSAD"
     gene            <877597..>879156
                     /gene="NDAI0B03470"
                     /locus_tag="NDAI_0B03470"
                     /db_xref="GeneID:11497948"
     mRNA            <877597..>879156
                     /gene="NDAI0B03470"
                     /locus_tag="NDAI_0B03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668576.1"
                     /db_xref="GeneID:11497948"
     CDS             877597..879156
                     /gene="NDAI0B03470"
                     /locus_tag="NDAI_0B03470"
                     /inference="similar to DNA sequence:INSDC:YIL085C,YNL029C"
                     /note="similar to Saccharomyces cerevisiae KTR7 (YIL085C)
                     and KTR5 (YNL029C); ancestral locus Anc_2.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668624.1"
                     /db_xref="GeneID:11497948"
                     /db_xref="GOA:G0W6H0"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W6H0"
                     /translation="MIRFRRKRLITLLLLLLLVISLPSFTLHRKWKNKHDPTNIPYSQ
                     QDIFSERDEPFHRGCNDINSYLEDPSYKKMNSTFVMLTRNEELQDVIKTMKSIESHFN
                     QWFQYPYVFLNDIPFTNEFQLEIENLTQSKVYFGTIDELDWEFPKEVRESFEFKNALE
                     DQADRGVMYGSMESYHKMCRFYSGIFYKHPLMKQFEWYWRIEPDVDFFCDITYDPFWE
                     MHQRGKKYGFTIFISELYWTVPNLFRVTKSFINDFGWKVGTLWQLFVWNYNILDVKDY
                     RDNTYDKDELQRWSNDVNDINEHLSENVAIDYLLNDNIDNEEGMKYLISKAQSKIPIF
                     EDKFDEEEFNLCHFWSNFEIARLDVFDNDVYNSYFQYLESYGGFWSERWGDAPIHSLG
                     LGLTLNLEDVHYFRDIGYRHSILQHCPKNYEKEKDENDIPYYEFDSQYKRDKNKMKYD
                     KSSDIGIGCRCQCPKGKEDVEDTSYPCMDIWLELLYDENPERVFKDGSFVQPFNAKEF
                     ENGIREDFLQS"
     gene            complement(<879581..>879892)
                     /gene="NDAI0B03480"
                     /locus_tag="NDAI_0B03480"
                     /db_xref="GeneID:11497949"
     mRNA            complement(<879581..>879892)
                     /gene="NDAI0B03480"
                     /locus_tag="NDAI_0B03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668577.1"
                     /db_xref="GeneID:11497949"
     CDS             complement(879581..879892)
                     /gene="NDAI0B03480"
                     /locus_tag="NDAI_0B03480"
                     /inference="similar to DNA sequence:INSDC:YNL030W"
                     /note="similar to Saccharomyces cerevisiae HHF2 (YNL030W);
                     ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668625.1"
                     /db_xref="GeneID:11497949"
                     /db_xref="GOA:G0WDJ0"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ0"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <880594..>881004
                     /gene="NDAI0B03490"
                     /locus_tag="NDAI_0B03490"
                     /db_xref="GeneID:11497950"
     mRNA            <880594..>881004
                     /gene="NDAI0B03490"
                     /locus_tag="NDAI_0B03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668578.1"
                     /db_xref="GeneID:11497950"
     CDS             880594..881004
                     /gene="NDAI0B03490"
                     /locus_tag="NDAI_0B03490"
                     /inference="similar to DNA sequence:INSDC:YNL031C"
                     /note="similar to Saccharomyces cerevisiae HHT2 (YNL031C);
                     ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668626.1"
                     /db_xref="GeneID:11497950"
                     /db_xref="GOA:G0WDJ1"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0WDJ1"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <881570..>882055
                     /gene="NDAI0B03500"
                     /locus_tag="NDAI_0B03500"
                     /db_xref="GeneID:11497951"
     mRNA            <881570..>882055
                     /gene="NDAI0B03500"
                     /locus_tag="NDAI_0B03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668579.1"
                     /db_xref="GeneID:11497951"
     CDS             881570..882055
                     /gene="NDAI0B03500"
                     /locus_tag="NDAI_0B03500"
                     /inference="similar to DNA sequence:INSDC:YIL087C"
                     /note="similar to Saccharomyces cerevisiae YIL087C;
                     ancestral locus Anc_2.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668627.1"
                     /db_xref="GeneID:11497951"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:G0W6H3"
                     /translation="MTDKSIEELDQVLTSETKSLWKQAYEYTNTPLPAIINAGLIFAT
                     PVLSPQFKTAISTTTSGAVPFLSKGRTSSTNKYIGLSNKNILLFGAAQALGAKMLSDG
                     DIENGSGFVTAWSILFLIVNGKRSLNSLKVTKIWPMVLCVGSLGNSILYGKRFISGGF
                     K"
     gene            <882507..>883997
                     /gene="NDAI0B03510"
                     /locus_tag="NDAI_0B03510"
                     /db_xref="GeneID:11497952"
     mRNA            <882507..>883997
                     /gene="NDAI0B03510"
                     /locus_tag="NDAI_0B03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668580.1"
                     /db_xref="GeneID:11497952"
     CDS             882507..883997
                     /gene="NDAI0B03510"
                     /locus_tag="NDAI_0B03510"
                     /inference="similar to DNA sequence:INSDC:YIL088C"
                     /note="similar to Saccharomyces cerevisiae AVT7 (YIL088C);
                     ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668628.1"
                     /db_xref="GeneID:11497952"
                     /db_xref="GOA:G0W6H4"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G0W6H4"
                     /translation="MPATATVSSSIINLVKTIVGAGLLAIPYAFRSDGILVGTLLTLL
                     AAINSGFGLFILAKCSKTLINPRNSSFFSICMLTYPSLSPLFDLAMIIQCFGVGLSYL
                     VLIGDIFPGLFGGHRDYWIISSAFIIVPLSCLKKLDSLKYSSIVGLFALAYLSMFIFV
                     MFLHNTVFKLPNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELED
                     ISMQNIKNVINGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCL
                     GTMLILSFPLLFHPLRIAVNNLVVWMKMTVDGDLGNNGKNCNVNPSLLNNNNNNNNNG
                     VTMPITLNVSDDIADEVEDESILQNITTTTPTPRGSIEQLPDNVSVKTVLEEQEEEEA
                     AFPDTRFYGITAFLLIVMYIIALNVKSFALVLALIGATGSTSISFILPGLFGYKLIGT
                     DSLAIGQMVPLRDRLYKRLSLLLVFFGLAVMILSLYVTLSEVSETM"
     gene            complement(<885459..>886964)
                     /gene="NDAI0B03520"
                     /locus_tag="NDAI_0B03520"
                     /db_xref="GeneID:11497953"
     mRNA            complement(<885459..>886964)
                     /gene="NDAI0B03520"
                     /locus_tag="NDAI_0B03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668581.1"
                     /db_xref="GeneID:11497953"
     CDS             complement(885459..886964)
                     /gene="NDAI0B03520"
                     /locus_tag="NDAI_0B03520"
                     /inference="similar to DNA sequence:INSDC:YIL090W"
                     /note="similar to Saccharomyces cerevisiae ICE2 (YIL090W);
                     ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668629.1"
                     /db_xref="GeneID:11497953"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:G0W6H5"
                     /translation="MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTAT
                     LFTIYFLSTTLSLLARKYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPL
                     SDDTQKVDIISDVVRRNLSSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFT
                     ILAIQAVGETNKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTA
                     SLLGFTLSLVGGLGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIF
                     KEVWQRHQGNLPTTDNLLFYYNNFVLRHIDMLWELLVSKINQNDPNNTLPSSFNINFL
                     TTFLSKDLLLRICKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRV
                     LIFYSATRIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDL
                     CLWGCNLKWLIPNQPELIVDSWGFWNWCNIFFTIIIYASELFGTTATANKQ"
     gene            <887479..>889698
                     /gene="NDAI0B03530"
                     /locus_tag="NDAI_0B03530"
                     /db_xref="GeneID:11497954"
     mRNA            <887479..>889698
                     /gene="NDAI0B03530"
                     /locus_tag="NDAI_0B03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668582.1"
                     /db_xref="GeneID:11497954"
     CDS             887479..889698
                     /gene="NDAI0B03530"
                     /locus_tag="NDAI_0B03530"
                     /inference="similar to DNA sequence:INSDC:YIL091C"
                     /note="similar to Saccharomyces cerevisiae YIL091C;
                     ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668630.1"
                     /db_xref="GeneID:11497954"
                     /db_xref="GOA:G0W6H6"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6H6"
                     /translation="MAAKDSTERNQKKSYKSNNSNDHHRKRGRQELRTIRRSAAKKSR
                     YDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDEDERKGKVYGALLTILETEHP
                     EPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDETEQIENGLLDRDDEQSDDD
                     QLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVIS
                     SKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPM
                     FQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQG
                     FTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQ
                     IFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLS
                     SIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQT
                     MVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGG
                     SIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGD
                     INEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYN
                     EVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK"
     gene            <890148..>890933
                     /gene="NDAI0B03540"
                     /locus_tag="NDAI_0B03540"
                     /db_xref="GeneID:11497955"
     mRNA            <890148..>890933
                     /gene="NDAI0B03540"
                     /locus_tag="NDAI_0B03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668583.1"
                     /db_xref="GeneID:11497955"
     CDS             890148..890933
                     /gene="NDAI0B03540"
                     /locus_tag="NDAI_0B03540"
                     /inference="similar to DNA sequence:INSDC:YIL093C"
                     /note="similar to Saccharomyces cerevisiae RSM25
                     (YIL093C); ancestral locus Anc_2.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668631.1"
                     /db_xref="GeneID:11497955"
                     /db_xref="GOA:G0W6H7"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="InterPro:IPR019520"
                     /db_xref="UniProtKB/TrEMBL:G0W6H7"
                     /translation="MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTR
                     EPKITNPTTGRNKTFFKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRL
                     RSLFFEQHPWELSRPKILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGI
                     NMLQAYNKARFEFYRLRIQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWK
                     KKAIQETQLMEVRSSNPSDSWAAPEEQDLEEDFTEGEPEILDI"
     gene            <891508..>892626
                     /gene="NDAI0B03550"
                     /locus_tag="NDAI_0B03550"
                     /db_xref="GeneID:11497494"
     mRNA            <891508..>892626
                     /gene="NDAI0B03550"
                     /locus_tag="NDAI_0B03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668584.1"
                     /db_xref="GeneID:11497494"
     CDS             891508..892626
                     /gene="NDAI0B03550"
                     /locus_tag="NDAI_0B03550"
                     /inference="similar to DNA sequence:INSDC:YIL094C"
                     /note="similar to Saccharomyces cerevisiae LYS12
                     (YIL094C); ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668632.1"
                     /db_xref="GeneID:11497494"
                     /db_xref="GOA:G0W6H8"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G0W6H8"
                     /translation="MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQ
                     VLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTK
                     VEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYID
                     RATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLF
                     REICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAA
                     LVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAA
                     QDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL"
     gene            complement(<892839..>895109)
                     /gene="NDAI0B03560"
                     /locus_tag="NDAI_0B03560"
                     /db_xref="GeneID:11497495"
     mRNA            complement(<892839..>895109)
                     /gene="NDAI0B03560"
                     /locus_tag="NDAI_0B03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668585.1"
                     /db_xref="GeneID:11497495"
     CDS             complement(892839..895109)
                     /gene="NDAI0B03560"
                     /locus_tag="NDAI_0B03560"
                     /inference="similar to DNA sequence:INSDC:YIL095W,YNL020C"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668633.1"
                     /db_xref="GeneID:11497495"
                     /db_xref="GOA:G0W6H9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W6H9"
                     /translation="MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPV
                     DTYSKSNVACLKRVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGS
                     YEVLLLMEYCEGGGLIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDI
                     KIENVLRSGNGEFKLCDFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLY
                     RGLPIDEKSDIWALGVFLYKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIR
                     VMLSENPTKRPNICELLEEISSIQGVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIAT
                     AQPIQQLNARTQTMPIINTKANTSLVTPITVPVLSENTRLPALELDIKVPQFSPSLDK
                     DMYMKLHPFQKSGTLLTPSKTASVSPIRRYISRSPSRDNTNYDIQRRRTSQYDHDQNQ
                     SNYMGRSLSRTSSIKSTSALSFEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIR
                     SRQDTGGSVRSAFGAIRGAFTGSMRAPSLDNNTNNSMHNNSNNNTSRNSSYGRHNIIT
                     NPIKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPFVTK
                     TTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMIPRNLNSREKDSLRYSSVVI
                     NPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYLSKMFSKERISSTATEQLVTLDVDT
                     LERDFRKRFPSTLENR"
     gene            896548..896621
                     /gene="NDAI0Btrna14I"
                     /locus_tag="NDAI_0Btrna14I"
                     /db_xref="GeneID:11497496"
     tRNA            896548..896621
                     /gene="NDAI0Btrna14I"
                     /locus_tag="NDAI_0Btrna14I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11497496"
     gene            <897811..>898812
                     /gene="NDAI0B03570"
                     /locus_tag="NDAI_0B03570"
                     /db_xref="GeneID:11497649"
     mRNA            <897811..>898812
                     /gene="NDAI0B03570"
                     /locus_tag="NDAI_0B03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668586.1"
                     /db_xref="GeneID:11497649"
     CDS             897811..898812
                     /gene="NDAI0B03570"
                     /locus_tag="NDAI_0B03570"
                     /inference="similar to DNA sequence:INSDC:YIL096C"
                     /note="similar to Saccharomyces cerevisiae YIL096C;
                     ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668634.1"
                     /db_xref="GeneID:11497649"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:G0W6I0"
                     /translation="MARKLKGKVNSKGLKAALLRQQSQEKLRLKQKKKEQAEIKKKSQ
                     PPKKIVQNQEAQKADLPTFIPFERNETLLLIGEGDFSFAKSIIEQDYILPGNLIATSF
                     DASPTELRLKYPNTFEENYKFLINEGVKILFKVDGTKLIKSLKLSKKTPWSKIVGPAW
                     KSKYLNNIMFNFPHTGKGIKDQDRNIKDHQELVFGYFDSSKQLFSLINKPLKSATSGY
                     TLGYSTEKNQDSEGISSEGYGKIILSVFDGEPYDSWQIKMLAKKNALHVERSNKFQWE
                     NFPGYHHRRTNSEQTTTKPAEERNARIFIFKKFEKAKHSKSKRNRNIDDDDSDEDER"
     gene            complement(<899036..>900559)
                     /gene="NDAI0B03580"
                     /locus_tag="NDAI_0B03580"
                     /db_xref="GeneID:11497497"
     mRNA            complement(<899036..>900559)
                     /gene="NDAI0B03580"
                     /locus_tag="NDAI_0B03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668587.1"
                     /db_xref="GeneID:11497497"
     CDS             complement(899036..900559)
                     /gene="NDAI0B03580"
                     /locus_tag="NDAI_0B03580"
                     /inference="similar to DNA sequence:INSDC:YIL097W"
                     /note="similar to Saccharomyces cerevisiae FYV10
                     (YIL097W); ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668635.1"
                     /db_xref="GeneID:11497497"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:G0W6I1"
                     /translation="MSSLIEEPNTDFHLKLNQQSFYIPYELLQKNIRQVYKLVEKETK
                     AIQRSYDLLNRHFERNSIDDDKIALGEISDLIKRIDKFEKQLSIRIDHDLELLDRIKA
                     RLDFFQDLDDIKASSNKNRLLLWYQKYTNLLIGDYLLRNSRINTTELESKVLLGENRK
                     IGNGKGNINKTEMNSGDIFLKQQHLEQLLDHDILITANKISNALTQSHDLTPLLKWIN
                     ENKIYLKKRNSILEFETRFQEYIELLKQGWYQRSISCYQTYLLPFMKNNFNDLKLAAG
                     LILFIQYSNNGREDTATLYEIDDNSKMNKPSQNLIHSIYENIFNKRILTTNVNTDLIK
                     NNSMHFCYGTCDTDRYQKLLSVSRWDTLKKIFLDEYYTMYGISKNDPLLIYLSLGIST
                     LKTKGCLHESIAPDLENGELRTYLSEKVITNHCPVCSESFAKISKNLPYAHHTKSRLF
                     ENPVMLPNGNVYDAQRLKDLAKTLKKKELCILEKEQIIDPIDGKRYSETDFVKMYPT"
     gene            complement(<901108..>902187)
                     /gene="NDAI0B03590"
                     /locus_tag="NDAI_0B03590"
                     /db_xref="GeneID:11497498"
     mRNA            complement(<901108..>902187)
                     /gene="NDAI0B03590"
                     /locus_tag="NDAI_0B03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668588.1"
                     /db_xref="GeneID:11497498"
     CDS             complement(901108..902187)
                     /gene="NDAI0B03590"
                     /locus_tag="NDAI_0B03590"
                     /inference="similar to DNA sequence:INSDC:YNL037C"
                     /note="similar to Saccharomyces cerevisiae IDH1 (YNL037C);
                     ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668636.1"
                     /db_xref="GeneID:11497498"
                     /db_xref="GOA:G0W6I2"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G0W6I2"
                     /translation="MFKHSVTKRSLVTLAKETIIPKKYGGRFTVTLLPGDGVGKEITD
                     SVVSIFKSENVPIDWETVDISGLDHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGS
                     LNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVES
                     LKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPE
                     IQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRDY
                     AVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEGKA
                     TTQDIGGSASTTEFTQAVINKLARL"
     gene            <903929..>904480
                     /gene="NDAI0B03600"
                     /locus_tag="NDAI_0B03600"
                     /db_xref="GeneID:11497499"
     mRNA            <903929..>904480
                     /gene="NDAI0B03600"
                     /locus_tag="NDAI_0B03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668589.1"
                     /db_xref="GeneID:11497499"
     CDS             903929..904480
                     /gene="NDAI0B03600"
                     /locus_tag="NDAI_0B03600"
                     /inference="similar to DNA sequence:INSDC:YIL098C"
                     /note="similar to Saccharomyces cerevisiae FMC1 (YIL098C);
                     ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668637.1"
                     /db_xref="GeneID:11497499"
                     /db_xref="UniProtKB/TrEMBL:G0W6I3"
                     /translation="MAHNQAMVGSVNRHIFGIYKSLIKELVRNERSARIKQTLEDNKR
                     HVSLLLYKKSQILRNLEFQSKQNSFVDRKNDLTVKAYHDLNKIENRIKSLKSENPRTD
                     KSLLFLNDSEPIKSIFKNVLSMEHKRGNNTRDLQHFKDTIDFLKNQREYQQLVELYFA
                     DSNLTQAEKIKRTANRVGLDTPR"
     gene            <906622..>908517
                     /gene="NDAI0B03610"
                     /locus_tag="NDAI_0B03610"
                     /db_xref="GeneID:11497500"
     mRNA            <906622..>908517
                     /gene="NDAI0B03610"
                     /locus_tag="NDAI_0B03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668590.1"
                     /db_xref="GeneID:11497500"
     CDS             906622..908517
                     /gene="NDAI0B03610"
                     /locus_tag="NDAI_0B03610"
                     /inference="similar to DNA sequence:INSDC:YIL101C"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668638.1"
                     /db_xref="GeneID:11497500"
                     /db_xref="GOA:G0W6I4"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G0W6I4"
                     /translation="MKRKKHKMSNLNGNQQIPEIQYPVNQINIASIRFTDNPLDEFQK
                     LYFNQIWNGNQSLDLDVKEQLYKSSNTGLTVKPNVIPKSKRKTSTDKKIEILKCFEYE
                     VPKLKSCNDESTPSTPIFNGPTERKTYKPSNVSNDRDLNRNSAQCILWEYRSGYVFFT
                     GIWKTYQDVIAGKMGFPQYNDNQVNRLIHDTFKLELEYVTSNSTIEYGKHKTHIGEGM
                     LSGVKRRKVAISPQNSRSVTNTNYNYDDSGFIKTLDYSKYKDFQWNKVPLDLRNSILQ
                     SFKNHLVSELGNKWEDVKDVTLDDFTKRVRGGYIKIQGTWLPMQIARMLCNWFCFPIR
                     YLLVPIFGPKFPEDCENCYNEYHRPINLTTNRIQSPVTFVNRPVASSINNHTGHQRNM
                     HNTDNKLFCIDNSLISFNSSNNNSQMKFIDNNSQMKFIDINSRQMFSTEAFQPIQQYV
                     EINNSTSQRQRGINDTDFSNRLPPLKYVLNSKKESVSHNMYPVQNYERRSISNIMVPF
                     PVNHQALPSFINNMEVPIVSNRLPYGCLIDTEIVPSSTNVRRAVSANGFQNYSQNPNN
                     GENIQQSIIPQMHAPVYIQGNLAYPVVYMPASQIPTPNIRNNERPRSRGEAALPVKFN
                     GNANNPP"
     gene            complement(<908982..>910280)
                     /gene="NDAI0B03620"
                     /locus_tag="NDAI_0B03620"
                     /db_xref="GeneID:11497501"
     mRNA            complement(<908982..>910280)
                     /gene="NDAI0B03620"
                     /locus_tag="NDAI_0B03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668591.1"
                     /db_xref="GeneID:11497501"
     CDS             complement(908982..910280)
                     /gene="NDAI0B03620"
                     /locus_tag="NDAI_0B03620"
                     /inference="similar to DNA sequence:INSDC:YIL103W"
                     /note="similar to Saccharomyces cerevisiae DPH1 (YIL103W);
                     ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668639.1"
                     /db_xref="GeneID:11497501"
                     /db_xref="GOA:G0W6I5"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:G0W6I5"
                     /translation="MSEQSQEQAQPAKVPRRRFVGSKKSDGKGVTTKKQDGTEVVHKP
                     RTSRINIGKSITHIPDDILDDKELNEAIKLLPENYNFEIHKTIWNIRKHKAKRVALQM
                     PEGLLIFSLIISDILEQFCDGVETVVMGDVSYGACCIDDFTARALDCDFIVHYAHSCL
                     VPIDITTIKVLYVFVTINIDETHVIKTLQKNFPKGSRLATFGTIQFNPCVHSIKDKLL
                     NDDNHMLYIIPPQIKPLSRGEVLGCTSERLNKDQIDAMVFIGDGRFHLESAMIHNPEI
                     PAYRYDPYNRKFTLEGYDQKQLVSVRSDAIETARRGKTFGLILGALGRQGNRGTVERM
                     ERNLKAAGKTVIKIILSEIFPQKLAMFDEIDAFVQVACPRLSIDWGYAFNKPLLTPYE
                     ASVLLEKDVMFSETYYPMDYYETNGYGRGQIPEHAYGFTD"
     gene            <910631..>912163
                     /gene="NDAI0B03630"
                     /locus_tag="NDAI_0B03630"
                     /db_xref="GeneID:11497502"
     mRNA            <910631..>912163
                     /gene="NDAI0B03630"
                     /locus_tag="NDAI_0B03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668592.1"
                     /db_xref="GeneID:11497502"
     CDS             910631..912163
                     /gene="NDAI0B03630"
                     /locus_tag="NDAI_0B03630"
                     /inference="similar to DNA sequence:INSDC:YIL104C"
                     /note="similar to Saccharomyces cerevisiae SHQ1 (YIL104C);
                     ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668640.1"
                     /db_xref="GeneID:11497502"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G0W6I6"
                     /translation="MLTPKFEVTQDDEFLYITIHISNIRFNASGLELIIDENLFIFHL
                     SPYYLRLRFPEKLVDDERSNAEFKSKEESIFVKAPKLEKGTFFEDLDFPTKLLARQGD
                     LIEADDQEKVIQKKPLIQEVGGSDKKTSILRESISDINAQGEQFNWEIEQKVTDPTSD
                     GLLGVKYGFNNMYDSMISVSISNGNDINELDDPEHTNANDRVKERLLKEDSKFDPEYY
                     VSDYMINKYGSGEDLVMNGIKALLEYTPPLVKLYLKWYKHTDNKDGIMPVEFTTEEQE
                     QMQNNIPQREYLIDGSETKRAYITLLNVLFGYVFEQLENEGQHNTESAWTMGKLIPQI
                     SFLDQQLILEEDASKDATQIKGAVVTGIRRAMCYPLHRHYELSLKVWKQVYYLLRAGK
                     RTVIRALLDINEVFRFHDVYYVYSKILLADLTSWFISQSTEPVLRSLAIEMHRQLELL
                     QNKPGIDNVGSGDLCFQFLDPYSDEPEEEQDVLKENTVGRKTLREWELMAEEHYKESE
                     SG"
     gene            <912673..>914706
                     /gene="NDAI0B03640"
                     /locus_tag="NDAI_0B03640"
                     /db_xref="GeneID:11497503"
     mRNA            <912673..>914706
                     /gene="NDAI0B03640"
                     /locus_tag="NDAI_0B03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668593.1"
                     /db_xref="GeneID:11497503"
     CDS             912673..914706
                     /gene="NDAI0B03640"
                     /locus_tag="NDAI_0B03640"
                     /inference="similar to DNA sequence:INSDC:YIL105C,YNL047C"
                     /note="similar to Saccharomyces cerevisiae SLM1 (YIL105C)
                     and SLM2 (YNL047C); ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668641.1"
                     /db_xref="GeneID:11497503"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0W6I7"
                     /translation="MSKHNTMTSTVSDMLSQQQMNLHHLHSLQKHTRSLTSSDYPTSY
                     LQHSGPSSLQQQSYLQQSYIQQQQQQQQQQQQAQVQAQPQVQQNPNVSAAEMLSSTST
                     DQNTLTNNNFGKRGSVASADINNVAQANNNNNNIPELMVNNESIYPPNSNKPILNNVN
                     INTASNFDVTGNSPNPNQTAGTGSLPNIDSMVGSSSVNRANSTLRQIPERNSLTSTSM
                     QSRMRNSTQRSRANQQQDPRSPLVILIPTSAQPTDILAARFSAWRNIIRSIIVYLTET
                     ASIEDEIVRQQLRLSHAVQFPFFAIENQHQPTTNDEKATQKFFLPLGNGSIQDLPTIL
                     NQYHESMASSASKASRDLSNEIIPRLEDLRRDLLIKIKEIKSLQSDFKNSCAKELQQT
                     KQDMRHFWDSLKDVRYNNVPRQDPYLTKIILDKQIKKQITEENFLHEAFNNLETSGAE
                     LEKVVVMEIQNALTNYARLLGQQSQLVFDILISKLDIGLFNMDPQFEWDNFISRDPNF
                     LLPNLPMRSFKEIVYRSQFDPLTYQIRSGFLERRSKFLKSYSRGYYVLTPSFLHEFKT
                     ADRKKDLVPVMSLALNECSVTEHSNKKVQQEAKFILHAKQNGLIHKGHNWVFKTDSYD
                     TMMQWFEDIRLLTSTSNLQEKLKFVKNRLNLDDDGKPMSATKDEVPLNNENAA"
     gene            complement(<915023..>916093)
                     /gene="NDAI0B03650"
                     /locus_tag="NDAI_0B03650"
                     /db_xref="GeneID:11497504"
     mRNA            complement(join(<915023..915923,916074..>916093))
                     /gene="NDAI0B03650"
                     /locus_tag="NDAI_0B03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668594.1"
                     /db_xref="GeneID:11497504"
     CDS             complement(join(915023..915923,916074..916093))
                     /gene="NDAI0B03650"
                     /locus_tag="NDAI_0B03650"
                     /inference="similar to DNA sequence:INSDC:YIL106W"
                     /note="similar to Saccharomyces cerevisiae MOB1 (YIL106W);
                     ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668642.1"
                     /db_xref="GeneID:11497504"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G0W6I8"
                     /translation="MAFLQNFHLSPGQTIRSTRGFKWNSGPNQQQQQQQQQSQEELPP
                     SSSPLRAKENNARPFNDTSNNNTVYGGDPLLTTPIRSEPQLQQQQNVTDFNYTPSHQK
                     PYIQPQSGTTVTTHQDIKHIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQI
                     NMLYGTITEFCSPQSCPRMIATNEYEYLWSKGKGIPPVSVSAPKYVEYLMRWCQDQFD
                     DEAIFPAKKDGVFPERFIDKIIIPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFR
                     HFCLFAEEFKLLRPADFGPLLELVTELRDR"
     gene            <916722..>919112
                     /gene="NDAI0B03660"
                     /locus_tag="NDAI_0B03660"
                     /db_xref="GeneID:11497505"
     mRNA            <916722..>919112
                     /gene="NDAI0B03660"
                     /locus_tag="NDAI_0B03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668595.1"
                     /db_xref="GeneID:11497505"
     CDS             916722..919112
                     /gene="NDAI0B03660"
                     /locus_tag="NDAI_0B03660"
                     /inference="similar to DNA sequence:INSDC:YIL107C"
                     /note="similar to Saccharomyces cerevisiae PFK26
                     (YIL107C); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668643.1"
                     /db_xref="GeneID:11497505"
                     /db_xref="GOA:G0W6I9"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0W6I9"
                     /translation="MFKRVDYSQNSSKANSLEPEHLEPTETPPELIPTPEYDSCGPLR
                     SNSGNNMKKIASGSSSGGALSSLPSFHRRPLTDTPITSEFASPGDSHEATPEVSPKES
                     QTELKNLLDKHNQHDNKNSKDGNETINNNSIRSFAAASTAVTSDSTSTSTATLMTDST
                     IVNAMTSKISYPKRRPTTIDVPGLTKSKTSPDGIISSTDYGSKLVIVMVGLPATGKSF
                     ITNKLSRYLNYSMYYCKVFNVGNTRRQFTEQKGLSEQDSKFFDPKNPESTKLREKWAM
                     DTLDELLNYLSEGPGCVGIFDATNTTKERRKHLLEKIRKRNKYLKVLFLESICSNKDL
                     VEKNVKLKLFGPDYKGKNPDQSLKDFRDRLKNYMQAYEPIEDSEGIQYIKMIDVGKKV
                     IAYNIEGFLASQTVYYLLNFNLTERQIWITRNGESVDNARGRIGGNSHLTSRGDKYAK
                     CLAKFMDKQRIAFYTRKIENESKSKEDGKLSKRKASTVQLNDFFVWTSMLTRSIETAK
                     YFNEDDYPIKQMKMLDELGAGDFEGMTYPEIQGKFPEEFEERQKDKLRYRYPGMGGES
                     YMDVINRLRPVITELERIEDNVLIITHRVVARALLGYYMNLDVDIIANLDIPLHCVYC
                     LEPKPYGITWSLWEYDEEDDDFYEVPASELNTTRVKEIGLVHKERRYSVVPTAPSSSV
                     SSTSDFLSKRPLSKSTSLNENGLVDTQSRMNKLDMLDGGGTSISTFHSRQVPNRKFEH
                     PNPKNKLLNRQNFEIDRLNEKLSLLKTKYESTEKNNENKSSPRGTPPMTRSQSHNL"
     gene            complement(<919259..>921331)
                     /gene="NDAI0B03670"
                     /locus_tag="NDAI_0B03670"
                     /db_xref="GeneID:11497506"
     mRNA            complement(<919259..>921331)
                     /gene="NDAI0B03670"
                     /locus_tag="NDAI_0B03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668596.1"
                     /db_xref="GeneID:11497506"
     CDS             complement(919259..921331)
                     /gene="NDAI0B03670"
                     /locus_tag="NDAI_0B03670"
                     /inference="similar to DNA sequence:INSDC:YIL108W"
                     /note="similar to Saccharomyces cerevisiae YIL108W;
                     ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668644.1"
                     /db_xref="GeneID:11497506"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:G0W6J0"
                     /translation="MEFFNLNHNEQVVSPCLTIHGKLTKKTSGAQSIQVQHPQLPPLT
                     FPINEDFFKATVILTPGENKFTFITDKNVSQQITCYYTPLLQDQPIHLCLILAKDSPM
                     KFDSPKDQIAKENGNDLYLAIKKLRMAGRLLQAFTNEQMLRNGFGHRTVQFVEEYTLD
                     TEFQDNPMKKLKMRNNIKIHLVRSEKSIKEIRSHDIAQQNSKAKDAGALYGIAMDALK
                     KYGGPFINCEKPVQAACIYMDTHWDGKLITGHAALGGGDDHIKLAIFGSHGIYSWPRS
                     MEDVVPYFLNDTKASTTEVANDCGQCGSYWECLAITMGAFWHEMGHLLGSPHQEHGVM
                     LRDYTVLNRSFLTKEAYCLRTKSYGAAAPIFPKEECTWHRLDLLRYLYHPSFTKPEDY
                     NDPSFFRPSKIGGFQFSEPNFYPLGNDICRFSSQTGITVIEIICGDLALGYIEYLPVS
                     LGGPGPQKEVVVSLSELRARIPANKLEEFKDKFTLNLIAVNSPSATYENFPSLATVTP
                     IPMGKYGYPESIRGFKSPAHGQIGRGKETGILGINVKNVVAVRVYHGAALDGMRFFFN
                     APTKKNEPPAIPSRTYVDKLTKSFKANVSISNDHPSVLFGVETPNYSDVILEPGEYIT
                     GFTVKSGWWIDAVQVSTNYGRKTDMLGNKEGGGQRELFPPEGQYVLGIYGSVGNWVDS
                     LGIVYGSL"
     gene            complement(<922452..>923492)
                     /gene="NDAI0B03680"
                     /locus_tag="NDAI_0B03680"
                     /db_xref="GeneID:11497507"
     mRNA            complement(<922452..>923492)
                     /gene="NDAI0B03680"
                     /locus_tag="NDAI_0B03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668597.1"
                     /db_xref="GeneID:11497507"
     CDS             complement(922452..923492)
                     /gene="NDAI0B03680"
                     /locus_tag="NDAI_0B03680"
                     /inference="similar to DNA sequence:INSDC:YIL110W"
                     /note="similar to Saccharomyces cerevisiae YIL110W;
                     ancestral locus Anc_2.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668645.1"
                     /db_xref="GeneID:11497507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W6J1"
                     /translation="MSFSFGFTSNDLNDDELTDDETIAPTGSTQTTNEFVNPLDFPRL
                     LTQDVVQPQIIDLSLMLKSLNNVRLSFEQFSSPITSYPLYRRELFDVKHQLMLESDDP
                     NVSNTNNELTDILIGDTSEDLRKNVYEGGLKSWECSIDLVDALNDTSYKELNQFNTFV
                     ELGCGTSLPTEFIFSKLLLESTNQDITKTVILSDYNESVLRLVSLPNLLITWANCVLT
                     AEQRVSLQRAQDENVPICEDELLLTEKLLDSFYQDMQKRNINIHFISGSWGRTFTKLL
                     HTIIPADQNILVLTSETIYQPENLPVIAETLLDLKLSYSSIAVKEFVAAKDIYFGVGG
                     SIVEFENYLKRK"
     gene            complement(<924098..>924439)
                     /gene="NDAI0B03690"
                     /locus_tag="NDAI_0B03690"
                     /db_xref="GeneID:11497508"
     mRNA            complement(<924098..>924439)
                     /gene="NDAI0B03690"
                     /locus_tag="NDAI_0B03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668598.1"
                     /db_xref="GeneID:11497508"
     CDS             complement(924098..924439)
                     /gene="NDAI0B03690"
                     /locus_tag="NDAI_0B03690"
                     /inference="similar to DNA sequence:INSDC:YNL052W,YIL111W"
                     /note="similar to Saccharomyces cerevisiae COX5A (YNL052W)
                     and COX5B (YIL111W); ancestral locus Anc_2.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668646.1"
                     /db_xref="GeneID:11497508"
                     /db_xref="GOA:G0W6J2"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:G0W6J2"
                     /translation="MANTEQEELATKLAERQKLPWNQLTPNEKQAAWFISYGEWGPRR
                     PIHGKGDVTYITKGVFIGLAVSLGLFAFIRQFAGEPPKTMTKEWQLKSDEYLKSKNAN
                     PWGGYSQVQSK"
     gene            complement(<925092..>928517)
                     /gene="NDAI0B03700"
                     /locus_tag="NDAI_0B03700"
                     /db_xref="GeneID:11497509"
     mRNA            complement(<925092..>928517)
                     /gene="NDAI0B03700"
                     /locus_tag="NDAI_0B03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668599.1"
                     /db_xref="GeneID:11497509"
     CDS             complement(925092..928517)
                     /gene="NDAI0B03700"
                     /locus_tag="NDAI_0B03700"
                     /inference="similar to DNA sequence:INSDC:YIL112W"
                     /note="similar to Saccharomyces cerevisiae HOS4 (YIL112W);
                     ancestral locus Anc_2.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668647.1"
                     /db_xref="GeneID:11497509"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W6J3"
                     /translation="MSSPSKQAVKKRSLSNYLSNVNSRKEELERIAKEEKEKQQKLSE
                     LQKQQQQQQQQQQREQKVGSKEEALPSIDKDDILIIKKAVATPKKSQDDAREPPCSVT
                     SPILKNIASHTDEKEEDIESKKSDNLKVTEIDPNNTQEVSGNISARGPDSESKGQSSI
                     LRSELQSILKEPELSNDLIKTEPSITTDDEHEQPHPHDNENNHVTEQEPKSEKINTKE
                     QETLSDTETAENTPLKPKRGKLIRADKLRREHSKRRLQFGHDSDSDLSDIDEDENFTI
                     NSSVLHSDISPLKKTNNNNNNNDQTKNTNDHETSLASSPQAAAKHEPIKKIKSSKPSH
                     VAVTKPATSKQRRGIYRDSGGRTKLAIACDKGKFETAKRLIEEEGYDVNDQDNAGNSA
                     LHEAALNGHLDIVKLLVEHDANVNIQSYEMFQDTPLFDASANGYLDVVEYLLEHGANP
                     TLTNAKGRTACESIEEDADLDEEDRQIVKDIKHRLIVAARDWKLKNGHTTLDQNGKSD
                     PSMSYYNNNNNINGKNNNNSMRSSSPGNTIEGETNRAQTIIEEEFLYSDVGSKEGKDK
                     LFRAARDGNSTYVGKYLQHRGQPDFKSLMEAVKFGHEDIVSLFLAFGAQINKRGKDGM
                     TLLMLAVGRGHLETVKLLIKNNADVTAMDSNGNTALYYAENSIIGVINPEEIALLKND
                     LDKSANNLIKKEVGSPKHDIGNVKAATNESLIEEIEKKREDKAMDNALNTTTEISVND
                     KDFTRKDTVAKSMESDSSEQEEDDEDILYINTNKRKRIPSSSTVSNSAMVNSTNIDEA
                     DKDMSAIFDNDDNNNDNDNEAAMHLKKKQKVNDVIAPKVREETPEEKEIRLKATEEYI
                     QKRLENKKRKEQEYIDRMNLEEERRIEEKEKQRIAEEKRLAEEEKRKKLEEMRLRMEQ
                     DLQNRRSIRALYPIGLRLIDLNDKKNYMSFMPLYYIVKNQIRYVLDLQLYVLTKDESI
                     LKYEPSEKVEPEHKEQLWSLLKFIFLNGGRTDVGEDKEEDEDDKKVQYRVNFKRYDID
                     TRLRIETQEYDKFANLPMKWIPIDKIEIEDKDLEASIKSNMNQVALFDKKDYNNNRSN
                     NKSSKQDICNSTKRPIMLPTKLQYRKGITDLLSKTININSSWATTKSKETQMI"
     gene            <929158..>930006
                     /gene="NDAI0B03710"
                     /locus_tag="NDAI_0B03710"
                     /db_xref="GeneID:11498270"
     mRNA            <929158..>930006
                     /gene="NDAI0B03710"
                     /locus_tag="NDAI_0B03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668600.1"
                     /db_xref="GeneID:11498270"
     CDS             929158..930006
                     /gene="NDAI0B03710"
                     /locus_tag="NDAI_0B03710"
                     /inference="similar to DNA sequence:INSDC:YIL114C,YNL055C"
                     /note="similar to Saccharomyces cerevisiae POR2 (YIL114C)
                     and POR1 (YNL055C); ancestral locus Anc_2.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668648.1"
                     /db_xref="GeneID:11498270"
                     /db_xref="GOA:G0W6J4"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:G0W6J4"
                     /translation="MAPPFFPDISKNINNLLNNDFYHSTPAAIKVNTTTNNGVKFTVN
                     AKQPVKEGALQADVESKFFEKTTGVTLTQGWSNQNRLNTKIELASLAPGLKSELITSY
                     TPSVGAKNAKVNMSFVQPFFAAKGTFDIFKSPLFIGNLTLAHEGVVGGAEFGYDITGG
                     TISRYALCLGYSARDYNLALSINDARITSASFYQSVSKILQVGAKATLNPQRGSNVGI
                     EFATKYNPDPTSQIKAKINDGGLLTLSYKQDLRPGITLGVGTSLDALKLDEPIHKLGW
                     SLTFSA"
     gene            <930486..>934910
                     /gene="NDAI0B03720"
                     /locus_tag="NDAI_0B03720"
                     /db_xref="GeneID:11498271"
     mRNA            <930486..>934910
                     /gene="NDAI0B03720"
                     /locus_tag="NDAI_0B03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668601.1"
                     /db_xref="GeneID:11498271"
     CDS             930486..934910
                     /gene="NDAI0B03720"
                     /locus_tag="NDAI_0B03720"
                     /inference="similar to DNA sequence:INSDC:YIL115C"
                     /note="similar to Saccharomyces cerevisiae NUP159
                     (YIL115C); ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668649.1"
                     /db_xref="GeneID:11498271"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G0W6J5"
                     /translation="MSTLKDEEVITTISEDFGFKGLGIKAVLPSYNEKLPFASLHNFD
                     ISNEQSLFAASCGGKTIVGNLQDLRDLVTTQSKKNAEDGNDDDDNDAHLEDKTEAKTK
                     LLSNIWESVEILNVIFVKIFENKNVLIITRDGDIMNLNLSSNSKDIEAVFSTSENDTF
                     VDVQATSNNSILFLNDKGQLYHFNLTSREATILLEETVGTFNIVGTTLSAILKNGQIK
                     LYKCQGTTLTEKAGFTIPTEVKESFNEEPYIPNGIQELSDNELLVVLGIEVSEATEDV
                     MYDQKMYIVKHSGNNAEFQESFDITPAFGSVLRYPTFYDIQLPNLIESTQTINILGSA
                     SASDLTIWDSKEVIQPSQDSERAVLPINKETNNDTNPIGMAMDISSTGTILEPCPGVD
                     SLERLPLIYILNNEGNIQIEALYHTSAIKANKFEIPTLTYETSKSQENVPSFTSLNLN
                     DNKSDEEKKTIFGATVTTTTDTASQPFGSSISSNNTQTTIGKPTFSFGSETKPISTPP
                     AFGTPSFTSASKSENKPASLFGNTTIENPFTSADKTQSPFGQTNKDTETKQPFAFGTN
                     TATTPSFGTSAFAASTEQNKQPFSTVQTTNSTSTAAPAFGTPSFGQPTFGAPSFGTPS
                     FGKPAFGTPVFGAAATNANPQAAPAFGKPAFGTSTFGSIASPDNKEASSLFGKSSFGA
                     PSTSTSSPFGQFASNANGSTESSSFSKFATDPKTQGTSSPFGKLDSKVETTTKSPFGQ
                     LSSGNNIFSKPLFGVTDNKESPFAKFGTKIETSSEEKENDVESSDLSDTTVEQTPFKL
                     KEDTTGKEIEKVETEVKTEEPKADRSSVEESKRDIKEEAPRNEEVSEVEAKEDIPEGE
                     EQEKVAEEGKEASESQEISISELSEGEASEEGTTLEPSKEEEIRDEVSIAEEENKEEE
                     STPAKSPKEEKEEKLITQDTDKETISSLTNRIKQSATKGSLDFSTPTFKFGSAPTPET
                     MGESPFSTFAGKLDQKTGSSFSFDDLPSKKLNDENDEPYSEDVSDEEEDNVSRASEIE
                     EAPNSPNESDANQQKKKETGLESMHAEQKESSELEVETIETSESNIQSVTEKESKEAS
                     SVENVSESSKEQEETESYDDLRDITTDELDRARSEPPDFQQPKSKLVSHAVDATIQTI
                     PDLSESSTQTIPPVVIDEGTQGEPPVVLSAVCQTDPIPPIDFQVQVFENDENYLAELL
                     KPKPLKKYFTNASVSSIPHMSNNPVIISMESTYHLVTAELSVLFDNIENLNKFFIDQS
                     TPQLNKRTKKSIANIYTWRIFEANTLYDILKEETGNINDNIMNVDQLNSTILSFLEKK
                     FKELLNKSVEIKEEYTQLQCLFDNDSADKLKRLRLHQGQLQSKLRKKMSKTHESLTEI
                     DGALNALKMYTIKNKRLDENPLVTKLAHESTSSIKLLKEIRDLRDEIEALQKSLNLSN
                     SEELSLEKRDIQSAEIIEAGLVMNTKKQVGQFFKNTRV"
     gene            complement(<935131..>936291)
                     /gene="NDAI0B03730"
                     /locus_tag="NDAI_0B03730"
                     /db_xref="GeneID:11498272"
     mRNA            complement(<935131..>936291)
                     /gene="NDAI0B03730"
                     /locus_tag="NDAI_0B03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668602.1"
                     /db_xref="GeneID:11498272"
     CDS             complement(935131..936291)
                     /gene="NDAI0B03730"
                     /locus_tag="NDAI_0B03730"
                     /inference="similar to DNA sequence:INSDC:YIL116W"
                     /note="similar to Saccharomyces cerevisiae HIS5 (YIL116W);
                     ancestral locus Anc_2.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668650.1"
                     /db_xref="GeneID:11498272"
                     /db_xref="GOA:G0W6J6"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W6J6"
                     /translation="MTFDLQKIVRPKIFNLEPYHCARDDFQDGVLLDANENAHGPTQQ
                     GLDASNSELHRYPDPHQLEFKTAMASYRNKTSTYKAENLTPLTSENLCLGVGSDESID
                     AIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNSFQMDTESVLTVL
                     QNDPLIKLLFITSPGNPTGARIETERIETVLQNWTDGLVVVDEAYIDFCGGSTAPLVT
                     KYPNLVTLQTLSKSFGLAGIRLGMTYASKDLAKILNAMKAPYNISRLASDFALKAVQH
                     DNLQLMESNAKKINDEKHRLLRELTSLDYVDDQYVGGLDANFIMIRVNKGDNTLAKKL
                     YLALATESGVVVRFRGTELGCSGCLRITVGTPPENDKLIKEFKKLLAELVNE"
     gene            <938769..>939977
                     /gene="NDAI0B03740"
                     /locus_tag="NDAI_0B03740"
                     /db_xref="GeneID:11498273"
     mRNA            <938769..>939977
                     /gene="NDAI0B03740"
                     /locus_tag="NDAI_0B03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668603.1"
                     /db_xref="GeneID:11498273"
     CDS             938769..939977
                     /gene="NDAI0B03740"
                     /locus_tag="NDAI_0B03740"
                     /inference="similar to DNA sequence:INSDC:YIL117C,YNL058C"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668651.1"
                     /db_xref="GeneID:11498273"
                     /db_xref="UniProtKB/TrEMBL:G0W6J7"
                     /translation="MVSIPLSKTFKVLEPRALPKLVTTTSSSTSTSTSPSTSQESTST
                     HSGSNSAITTTSPSPSITSSSPSSSTTTVIPTITPPSINDNPYITNDDKYVQSTVFIA
                     VGVIVGFIFFLYLALWAITSYLNYRTAKKSTSYDSLLASSNGYNTPLMIHKIESNDSD
                     YYSDKTNERKNSFNEERNSISPKTNQGLFNNVNSNLSSLNMPGANPVTDNYCNSTTEV
                     NNNLNHISNSAITVANSTTITNTTPGSNTTTGTNTPPTNFRHSLFISPTARVIEQQQK
                     HNRLSEFYQDTSNTMNTSEASIITESVITDLNKPDLINITPDRRKRNSLLSTFSSPSL
                     SGQYLQSPPHLYSERSRLSVSSMAPLNIQRLKGRNSTNTGSRKLTPSMVLDNLLGEED
                     NDTDSHKESN"
     gene            complement(<940372..>941094)
                     /gene="NDAI0B03750"
                     /locus_tag="NDAI_0B03750"
                     /db_xref="GeneID:11498274"
     mRNA            complement(<940372..>941094)
                     /gene="NDAI0B03750"
                     /locus_tag="NDAI_0B03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668604.1"
                     /db_xref="GeneID:11498274"
     CDS             complement(940372..941094)
                     /gene="NDAI0B03750"
                     /locus_tag="NDAI_0B03750"
                     /inference="similar to DNA sequence:INSDC:YIL118W"
                     /note="similar to Saccharomyces cerevisiae RHO3 (YIL118W);
                     ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668652.1"
                     /db_xref="GeneID:11498274"
                     /db_xref="GOA:G0W6J8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6J8"
                     /translation="MGFLCGSSTTSKKPIERKIVILGDGSCGKTSLLNVFTRGYFPEV
                     YEPTVFENYIHDIFVDNKHITLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDS
                     LANVEHKWVGEIADHCENVNLVLVALKCDLRNNENESNVINPGMIQQQQSNNNSNNNI
                     PQLQQQQQEQNQQFKKKDLITYDEGVAMAKKIKALRYLECSAKLNKGVNEAFTEAARV
                     ALLAGPQVPESNDDDDSGCVIM"
     gap             943347..943663
                     /estimated_length=317
     gene            <945962..>947287
                     /gene="NDAI0B03760"
                     /locus_tag="NDAI_0B03760"
                     /db_xref="GeneID:11498275"
     mRNA            <945962..>947287
                     /gene="NDAI0B03760"
                     /locus_tag="NDAI_0B03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668605.1"
                     /db_xref="GeneID:11498275"
     CDS             945962..947287
                     /gene="NDAI0B03760"
                     /locus_tag="NDAI_0B03760"
                     /inference="similar to DNA sequence:INSDC:YIL119C"
                     /note="similar to Saccharomyces cerevisiae RPI1 (YIL119C);
                     ancestral locus Anc_2.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668653.1"
                     /db_xref="GeneID:11498275"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:G0W6J9"
                     /translation="MEANRNTFSLPHENEQNRIDHLTNPITTSQPNFPNSLNNDSTYS
                     NQILKNKDGNMNTQNNINPNLTGSDLDNNGNSDSTNNENNVNSTNNANNNDNDNDNDN
                     DNDDDEESPSYSIGTQDQPSGSNNINMSSQHVKHTRKKWREPEDISFLKVILNNAQLL
                     TYVEYFKPMKNFWIKLSQILRQEYGYDRNSRQCHDRFKVLYLKAIKLRDLQAETIPNY
                     NPQTNNNLKANTELEFRLLQLLNTFNYHNGTIILNSPVTLAAETDNKSQIPFVNQNSN
                     TNPLRPNGFDHPNGSNPNALNFSNSNDQLTKLSSATPVNQFATQASRPPLIGSQRNNQ
                     FIQPTQSPDPQYRDPQIRIIEDLKEQITALRNDINVLNTRYQEQANYIQTIWSIIQPQ
                     NQHQPPQLTPAPTLSYATTTSSTQYPQYDPNTGSAQDKFPSLRGFQREH"
     gene            complement(<947945..>949660)
                     /gene="NDAI0B03770"
                     /locus_tag="NDAI_0B03770"
                     /db_xref="GeneID:11498276"
     mRNA            complement(<947945..>949660)
                     /gene="NDAI0B03770"
                     /locus_tag="NDAI_0B03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668606.1"
                     /db_xref="GeneID:11498276"
     CDS             complement(947945..949660)
                     /gene="NDAI0B03770"
                     /locus_tag="NDAI_0B03770"
                     /inference="similar to DNA sequence:INSDC:YNL065W,YIL120W"
                     /note="similar to Saccharomyces cerevisiae AQR1 (YNL065W)
                     and QDR1 (YIL120W); ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668654.1"
                     /db_xref="GeneID:11498276"
                     /db_xref="GOA:G0W6K0"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W6K0"
                     /translation="MSEQIDKLNEQEKVDITPRSSDGYTHKVRSYHNDDDDESVINIS
                     DINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVL
                     SVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSSVLVYCCACIG
                     LACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYVSGFQVIGSAF
                     GALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPETKRTVVGNGSIMPPNRISRA
                     PSLYFPPLRRKLHLDNPDLETKEPHINVNIFASFKILTIPEVTILLFVAGLQFSTNTV
                     HQTALSTVLSKRYGLTVAKIGLCYLPSGICTLISVVTSGRYLNWIYRRRMAAHNKWIK
                     EQEAVLLEQNNHDIDAVREIIATDSKYTFNIFKARLEPALVTLLLSASGYVSFGWCIS
                     VKAPLAAVLVTSGFGSLFSNCILTFSSTLIVDLFPSKSSTATACLNLFRCLMSAILIA
                     CLSKMSIAMTYGGVFTFLGALAASSSLLLLFPIRHGKALALKRRKEEEALLISKNVDS
                     IKSPV"
     gene            complement(<950913..>952139)
                     /gene="NDAI0B03780"
                     /locus_tag="NDAI_0B03780"
                     /db_xref="GeneID:11498277"
     mRNA            complement(<950913..>952139)
                     /gene="NDAI0B03780"
                     /locus_tag="NDAI_0B03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668607.1"
                     /db_xref="GeneID:11498277"
     CDS             complement(950913..952139)
                     /gene="NDAI0B03780"
                     /locus_tag="NDAI_0B03780"
                     /inference="similar to DNA sequence:INSDC:YIL122W"
                     /note="similar to Saccharomyces cerevisiae POG1 (YIL122W);
                     ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668655.1"
                     /db_xref="GeneID:11498277"
                     /db_xref="UniProtKB/TrEMBL:G0W6K1"
                     /translation="MTLPKSQTNQTNSNTIPSRELQQNSNQETSTLETSSNRSTSYTP
                     NPTTTALSSTTEDTSNTVDTFRNLILEELGIKDISKFGQIESQVFDKYVEIRLTREQK
                     KVEELRKANLDKLEQILGNFQENANLTVDTIKTIFHPGSANTSDPVLTKKRRIETSRS
                     PSPRGHRRYRSEITPISENQENLHIISQQQDPHAPQGRCIGQQPGYYQPYYTAPMIPL
                     LPNGQPLSIQPPNLQYLPGQWSKQQYPPAPNLYQQPMSNNRHNPSPSSDANKLRTITE
                     TYANSSFTGKSSAVSQYTDSRPHHIAIPPPGTVFRSDTHFNPPHLIAFENQLPPPQLQ
                     VLSQNNSPGHIYADRQQIYPQGTHPPNHFSHRRSHSATVLMPNPGNKSPQKGPVALPG
                     RPVDFLIHTQKHPPPT"
     gene            complement(<953217..>954554)
                     /gene="NDAI0B03790"
                     /locus_tag="NDAI_0B03790"
                     /db_xref="GeneID:11498278"
     mRNA            complement(<953217..>954554)
                     /gene="NDAI0B03790"
                     /locus_tag="NDAI_0B03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668608.1"
                     /db_xref="GeneID:11498278"
     CDS             complement(953217..954554)
                     /gene="NDAI0B03790"
                     /locus_tag="NDAI_0B03790"
                     /inference="similar to DNA sequence:INSDC:YIL123W,YNL066W"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668656.1"
                     /db_xref="GeneID:11498278"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G0W6K2"
                     /translation="MKINASLVAAISLIGTSTTVTALPFFAFDKLSKDCTTTVTTSGH
                     QHKRAIAVEYVYETVLVDNKGNTVTQANQQTAITTTVPTSTLQPVNAIEDVSFKASTI
                     ANTPTTIPTAAGEPTTVQEQIQNQEQTTSTTQQIQTTSTEQAVQIPTTTSTAQASTAD
                     ASSSASSSSNSGSYYGDLSSFSGPTSEFQDGTIRCSQFPSGQGVISVDWLNEGGWSGV
                     ENTDTSTGGSCAEGSYCSYACQPGMSKTQWPSDQPSDGRSVGGLLCQNGYLYRSNTDS
                     NYLCEWGVDAAIVVSELSQDVAICRTDYPGTENMVIPTFVTAGNSLPLTVVDQDTYYS
                     WQGMKTSAQYYVNNAGVSVQDGCIWGDSGSGVGNWAPLNFGAGSTGGISYLSLIPNPN
                     NGSPLNFNVKIVAADDQSTVNGECYYENGSFSGGSDGCTVAVTSGRAKFVLYN"
     gene            complement(<955897..>956805)
                     /gene="NDAI0B03800"
                     /locus_tag="NDAI_0B03800"
                     /db_xref="GeneID:11498279"
     mRNA            complement(<955897..>956805)
                     /gene="NDAI0B03800"
                     /locus_tag="NDAI_0B03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668609.1"
                     /db_xref="GeneID:11498279"
     CDS             complement(955897..956805)
                     /gene="NDAI0B03800"
                     /locus_tag="NDAI_0B03800"
                     /inference="similar to DNA sequence:INSDC:YIL124W"
                     /note="similar to Saccharomyces cerevisiae AYR1 (YIL124W);
                     ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668657.1"
                     /db_xref="GeneID:11498279"
                     /db_xref="GOA:G0W6K3"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G0W6K3"
                     /translation="MSSIQQQKLKKIAVVTGASSGIGYEITNELAKNNYIIYACARRV
                     DPIQQLVDEFSNAVIKPHKLDISNPEEITQFKQFLSENLPNEKLDLLYNNAGQSCTFP
                     ALDVSNDVMEQCFKVNVFGHVNMCRELSQFLINAKGTIVFTGSLAGITPFPFGSIYSA
                     TKAAIHQYARVLHLELKPFGVRVINAVTGAVKSNIADTRPLPETSVFNFAEGQEAFKN
                     RQLMAKKSHPMPADVYAKKLVKDIMSGSDPVDIYRGKLATVMSFIMLLVPYRILEFGL
                     KKYFKLDKVFEALDSTDEERLKRKSA"
     gene            complement(<957317..>960361)
                     /gene="NDAI0B03810"
                     /locus_tag="NDAI_0B03810"
                     /db_xref="GeneID:11498280"
     mRNA            complement(<957317..>960361)
                     /gene="NDAI0B03810"
                     /locus_tag="NDAI_0B03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668610.1"
                     /db_xref="GeneID:11498280"
     CDS             complement(957317..960361)
                     /gene="NDAI0B03810"
                     /locus_tag="NDAI_0B03810"
                     /inference="similar to DNA sequence:INSDC:YIL125W"
                     /note="similar to Saccharomyces cerevisiae KGD1 (YIL125W);
                     ancestral locus Anc_2.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668658.1"
                     /db_xref="GeneID:11498280"
                     /db_xref="GOA:G0W6K4"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0W6K4"
                     /translation="MLRAITNPVYRKGSRSLVNIALLKQCSNKLTHSSQRYITTGTDT
                     FLSTSNSSYIDEMYLAWQKDPTSVHVSWDAYFKNMGNLKTPASNAFQAPPIIIGTPQS
                     SPQSPLGSVASNVDANVSLHLKVQLLCRAYQVRGHLKAHIDPLGLSFGDSSSKHIPKE
                     LTLEYYGFNENDLKTEINLGPGILPRFARKDGQPTKMPLGEIIEHLEKLYCSSYGIQY
                     THIPSKEKCEWLRERIEIPNPYKYSVDQKRQILDRLTWATSFETFLSTKFPNEKRFGL
                     EGLEAVVPGIKTLIDRSVEMGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFTGTST
                     RDDIEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLEAQDPVVLGRTRALLHAKG
                     DLENKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEYSTGGTIHIITNNQIGFTTDPR
                     FARSTPYPSDLAKAIDAPIFHCNANDIEAVTFIFNLAAEWRNTFHTDAIIDVVGWRKH
                     GHNETDQPSFTQPLMYKRIAKQKSVIDVYTAKLLNEGSFTQKDIDEHKKWVWSLFEEA
                     FEKSKDYVPSQREWLTAAWEDFKSPKELATEILPHNPTKVPAETLQNIGKVISTWPEK
                     FEVHKNLKRILTNRGKSISEGEGIDWSTGEALAFATLTLEGHNVRVSGEDVERGTFSQ
                     RHAVLHDQNSEDTYIPLKHLSEKQADFSICNSSLSEYGVMGFEYGYSLTSPEYLVMWE
                     AQFGDFANTAQVIIDQFIAGGEQKWKQRSGLILSLPHGYDGQGPEHSSGRLERFLQLA
                     NEDPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHIIRRQQHRQFRKPLALFFSKQLL
                     RHPLARSNLEEFTEGGFQWIIEDVEHGKAIGTKEETKRLVLLSGQVYTALHKKRETLG
                     DKTTALMKIEELHPFPFAQLRDAINSYPNLEEIVWCQEEPLNMGSWSFVSPRLKTTLN
                     ETTYKDFTVRYCGRNPSGAVAAGSKALHAAEEEAFLKDVFQQ"
     gene            complement(<961507..>963138)
                     /gene="NDAI0B03820"
                     /locus_tag="NDAI_0B03820"
                     /db_xref="GeneID:11498281"
     mRNA            complement(<961507..>963138)
                     /gene="NDAI0B03820"
                     /locus_tag="NDAI_0B03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668611.1"
                     /db_xref="GeneID:11498281"
     CDS             complement(961507..963138)
                     /gene="NDAI0B03820"
                     /locus_tag="NDAI_0B03820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668659.1"
                     /db_xref="GeneID:11498281"
                     /db_xref="GOA:G0W6K5"
                     /db_xref="InterPro:IPR001207"
                     /db_xref="UniProtKB/TrEMBL:G0W6K5"
                     /translation="MAKLCNKGKKYTVLEINDTLAKIKQINELFGSDSRQLNVVFYVE
                     KFRRLRINRVMEALVTTSRPLSQIFIRSTNTRGIEENIKGLVSKLISEFFNISENFDR
                     IEQKRVELAEILGKNILSKNEMVDKHNRFLSNAIKTALQNSGLGAGNRTLEYSSYTMV
                     ASISSLLVLYGDLISIGMFSTVDEEKRVFGNIDYPNVEGMIIRVEEEDKDIDEERQDG
                     EVVDEGLSEELEDVLKDNNREHLMTGNGSFNVMKQCFSRQGLFPAVKMTTVSVTPDVN
                     SVAMDKYIRDSLKYIFNNIEPDSLFIATKLLNPNLRNEFAGIFLIDGTFLRGHFRTLI
                     NIVGMTTDYRSIPLAHLFTTSHETTKACRITIQSLKRNVDLDWSAANFMCDQGKGLES
                     AIREEYGKEELTCVTHLSKNLIRNAKGRVIEAFQAATHTLDPQVYEESINELIKKFPE
                     SKRNSGNSTFKKLTENPRSFSRLKRDCPHWEIFTTNPVEQFHSIIKVLKRGNLVNMIV
                     NLTSFQISCQNKLFLNPHFQAPPIYLPLLIRPHLS"
     gene            complement(<964643..>965218)
                     /gene="NDAI0B03830"
                     /locus_tag="NDAI_0B03830"
                     /db_xref="GeneID:11498282"
     mRNA            complement(<964643..>965218)
                     /gene="NDAI0B03830"
                     /locus_tag="NDAI_0B03830"
                     /product="ribosomal protein L9"
                     /transcript_id="XM_003668612.1"
                     /db_xref="GeneID:11498282"
     CDS             complement(964643..965218)
                     /gene="NDAI0B03830"
                     /locus_tag="NDAI_0B03830"
                     /inference="similar to DNA sequence:INSDC:YNL067W"
                     /note="similar to Saccharomyces cerevisiae RPL9B
                     (YNL067W); ancestral locus Anc_2.236"
                     /codon_start=1
                     /product="ribosomal protein L9"
                     /protein_id="XP_003668660.1"
                     /db_xref="GeneID:11498282"
                     /db_xref="GOA:G0W6K6"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G0W6K6"
                     /translation="MKYIQTEQSIAIPEGVTVNIKSRIVKVTGPRGVLTKNLKHIDVT
                     FNKISKDLIKVTVHNGDRKHVAALRTVKSLVDNMIIGVTKGFKYKMRYVYAHFPINVN
                     TIEKDGAKFIEIRNFLGDKKVRTVPVREGVDIEYSTNVKDEIVLSGNSVENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSHKGCIVEDM"
     gene            complement(<965694..>969785)
                     /gene="NDAI0B03840"
                     /locus_tag="NDAI_0B03840"
                     /db_xref="GeneID:11498283"
     mRNA            complement(<965694..>969785)
                     /gene="NDAI0B03840"
                     /locus_tag="NDAI_0B03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668613.1"
                     /db_xref="GeneID:11498283"
     CDS             complement(965694..969785)
                     /gene="NDAI0B03840"
                     /locus_tag="NDAI_0B03840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668661.1"
                     /db_xref="GeneID:11498283"
                     /db_xref="GOA:G0W6K7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:G0W6K7"
                     /translation="MLEASQVATEPVLLPSHKEIQNVNNIHIPKPQTKDQLEQLIYRY
                     RAIQQHPVENKLEINLLEEVFIDISNDQDEYNKIVEQLRSDLLSTTDEPKENYDTDLL
                     KKQILALQLLERDLDIPDGLLSSDETTNTNKTSAQFGNGSVSPIKLTLDFYKNAEAFG
                     LADKLSKKPTAQLGHVDTETAITKDIAKRIKELENLPANIGSYSLDDSLEFLTTDALP
                     SNVDILKIKALIELKSLKALTKQKSLRQKLITNVTTSAHQTIPSLRDSPYTMAATRSV
                     YVRPKVIVPQTVRLAEELERQQLLEKRKKQRNLHLKKIYNIIDFVKETQENKNPRRDR
                     CSVFGKFCTTAHNQIEKDEQRRIERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLL
                     KQTNSFLDSLAQAVQVQQNEAKLLNGEEIKPLTDEDREKIDYYEVAHRIKEKISKQPS
                     ILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFESKKEPGP
                     FLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRRSLQHEIRNGNFDVLLTTYEYI
                     IKDKALLSKHDWAHMIIDEGHRMKNAQSKLSYTISHYYRTRNRLILTGTPLQNNLPEL
                     WALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLL
                     RRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYEQMLKHNALFVGAGTEGATKTGIKGLN
                     NKIMQLRKICNHPFVFDEVEGVVNPSRGNSDVLYRVAGKFELLDRVLPKFKASGHRVL
                     MFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLKEFNAPNSEYFCFLLSTRA
                     GGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILE
                     RAMQKLDIDGKVIQAGKFDNKSTAEEQEEFLRKLLENEMRDDEDNDAELDDDELNEIL
                     ARSPEEKIMFDKMDKERITNEKKIAKANGLKTVPPRLIQVSELPAIFRENIEEHFKDE
                     PVAIGRIREKKRVYYDDGLTEEQFLEAVEDENNTLEDAIQKRREARDRRRQKKEAQKV
                     GIETLENSPDTTVETEPTAAEVTLPDGVGENIANEENIPIKEPTPVQTPRRRTRKRKA
                     SQEPEPEPEPQPQPTVNEVTEENHVTAPPVIDGKVDQEPEIAEPVKKRPKLKIKLTLK
                     KKSPDVPLPTDDVKEPEETKQDVEDAKPKPKGRGRGRGKAKKTAPSDFTSTVEKLFEE
                     MRSITDNADGHAVTEVFEKLPSRKLYPDYYTLIQKPIALDKIIKDCKKGSYNSIEEVK
                     EDLQTMYQNARFYNEEGSWVYNDADTLDKFTSEWFQKHSEQEK"
     gene            complement(<970366..>973158)
                     /gene="NDAI0B03850"
                     /locus_tag="NDAI_0B03850"
                     /db_xref="GeneID:11498284"
     mRNA            complement(<970366..>973158)
                     /gene="NDAI0B03850"
                     /locus_tag="NDAI_0B03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668614.1"
                     /db_xref="GeneID:11498284"
     CDS             complement(970366..973158)
                     /gene="NDAI0B03850"
                     /locus_tag="NDAI_0B03850"
                     /inference="similar to DNA sequence:INSDC:YIL130W"
                     /note="similar to Saccharomyces cerevisiae ASG1 (YIL130W);
                     ancestral locus Anc_2.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668662.1"
                     /db_xref="GeneID:11498284"
                     /db_xref="GOA:G0W6K8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W6K8"
                     /translation="MSDQNNQPDPKAENMPQNRLLQDPAQQHMAKRRRVTRACDECRK
                     KKVKCDGQQPCIHCTVYSYECTYNQPTKRSLQHLTTYAPSKTNNSSSSPLKQTTNQVK
                     STSSSSNIIKLSQRTAPPVTALPTSTNNTTTRKYTTKSIRLQSQLDRYKLLFDGLFPT
                     LPDINNLDIPTFLQICHNFRENSSFIDDIVKEYFFITNDTTSPPQQSQLSRYGTPEGS
                     GSIDSQLNGPGSAGSTNTFDLRQSDNNDKLPMGREIKIILPPKPIAIQFIKKTWEHCC
                     VLLRIYHRPSFIKQVDELYETDPHNYSAKQMQFLPLCYSVIAVGALFSKSIANEELNH
                     TPTDLASDTNPSTDTKFLQDEGYKYFIAARKLIDITSARSLDSIQAILMMFIFLQCSA
                     RLSTCYSYIGVAMRSALREGLHRQVGPNSGFNPIEIEMRKRLFYTIYKLDIYVNAMLG
                     LPRSISANDFDQTLPLELSDENITEQGYFPENQNGVLSSTGIANEHTKLLMILDAIVG
                     ELYPIKKTNTFISHETIATLEQKLRNWLDDLPNELAPNLENIPPRYERANKLLHLSFL
                     HVQIILYRPFIHYLSRNFADSNSDALSLQCARNSIKVARAVVRLAEEMLKKNLISGSY
                     WYASYTIFYSVATLLFYIHEAELPDKESAREYHAILKDAQIGREVLNHIKDSSMAAMR
                     TYNLLNKLFEKLNSKTIMLTTMHTSPPLKNNIVTNKENPITTQSLPQRYLPGYAGAEM
                     KQPRQILQGEESVSSYSVSDYPSDLQPPIENELLAQPQQQLSTTSLPVNRENRTNFAP
                     PQMKTFNTTNNSGLKTVNSANNFMKQNENPINNDPLNLSDIFGFNGNPDDILTTQSEN
                     LGLDNNTNNMDKNVEKKDNSTMNDKIKSETLDQTGILDVFDQLDAHLFGKYMPLNYPM
                     DPQNEPQQQQSQQQGQ"
     gene            <973741..>975168
                     /gene="NDAI0B03860"
                     /locus_tag="NDAI_0B03860"
                     /db_xref="GeneID:11497925"
     mRNA            <973741..>975168
                     /gene="NDAI0B03860"
                     /locus_tag="NDAI_0B03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668615.1"
                     /db_xref="GeneID:11497925"
     CDS             973741..975168
                     /gene="NDAI0B03860"
                     /locus_tag="NDAI_0B03860"
                     /inference="similar to DNA sequence:INSDC:YIL131C,YNL068C"
                     /note="similar to Saccharomyces cerevisiae FKH1 (YIL131C)
                     and FKH2 (YNL068C); ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668663.1"
                     /db_xref="GeneID:11497925"
                     /db_xref="GOA:G0W6K9"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G0W6K9"
                     /translation="MSEPESAYRKQKIKETKQQKNFIQSITSVLTTTPEPAVVTAQYA
                     NDLVIEPEIEAYAKLAGHGWTFFARDLKITLGRNTDSIQSDSSIHNIGGIDIDLGPTK
                     VVSRKHATIRYNMESMAWQLFVMGRNGAKVDCVRVPVGPDAPPTTLHSGSLLDVGGIQ
                     MLFILPGKKPLFSDTVLNILVPRLINLYGKATNENKFLRALINDSQYMKEHNLHADPV
                     ATSSQSPRNNHLNDIDGSVELFQNSLNSSDMHTKSNATSDGHSFTTDSPVEAGDTLLS
                     NGDESRVEQSNDNINQIVYNKSMKRDHEKSSRKTSWAAMIAEAILSKEEGTITLSDIY
                     VYITDNYPLYILKSAGWKNAVRHNLSLNAAFEKVPRRANETGKGMYWRIAEAYKTNFL
                     NQWKRGEVNKVRRGGAVDRVLHLYISRHSKFPEQKPVETKPVHVELQEMSVALQNDKI
                     PDQGEEILPLEPSVDTKDVAASNNS"
     gene            <975805..>976458
                     /gene="NDAI0B03870"
                     /locus_tag="NDAI_0B03870"
                     /db_xref="GeneID:11497926"
     mRNA            <975805..>976458
                     /gene="NDAI0B03870"
                     /locus_tag="NDAI_0B03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668616.1"
                     /db_xref="GeneID:11497926"
     CDS             975805..976458
                     /gene="NDAI0B03870"
                     /locus_tag="NDAI_0B03870"
                     /inference="similar to DNA sequence:INSDC:YIL132C"
                     /note="similar to Saccharomyces cerevisiae CSM2 (YIL132C);
                     ancestral locus Anc_2.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668664.1"
                     /db_xref="GeneID:11497926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6L0"
                     /translation="MENEEWDLITAWISSTGSHLSQYMSSHLRPTEKSNEVRQLYFID
                     ATNSFPLQQFQNLIPYNGEDENKRIYDNIRIITCLELGELAMVLNKIIQSIQLNKIKR
                     QKNTTTQSEKPKEGNLNILIVVNGLETMFRNTRFKENVEVTHSVLRMALLKLRILSNE
                     RNGYHLRSLVLFPLEEMKNLSTKQLKRLKSSSNRGQNDGSSVGDYVCKYYVDRVIIM"
     gene            <976847..>977449
                     /gene="NDAI0B03880"
                     /locus_tag="NDAI_0B03880"
                     /db_xref="GeneID:11497927"
     mRNA            <976847..>977449
                     /gene="NDAI0B03880"
                     /locus_tag="NDAI_0B03880"
                     /product="ribosomal protein L16"
                     /transcript_id="XM_003668617.1"
                     /db_xref="GeneID:11497927"
     CDS             976847..977449
                     /gene="NDAI0B03880"
                     /locus_tag="NDAI_0B03880"
                     /inference="similar to DNA sequence:INSDC:YIL133C,YNL069C"
                     /note="similar to Saccharomyces cerevisiae RPL16A
                     (YIL133C) and RPL16B (YNL069C); ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="ribosomal protein L16"
                     /protein_id="XP_003668665.1"
                     /db_xref="GeneID:11497927"
                     /db_xref="GOA:G0W6L1"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G0W6L1"
                     /translation="MSSFEPVFVVDGKGHLLGRLASIVAKQILNGQKVVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATRFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAALER
                     LKVFEGIPPPYDKKKRVVVPNALRVLRLKPGRKYTTLGKLSSSVGWKYEDVVSKLEEK
                     RKVRSAEYYAKKRAFNKKIASADASVAETEAAKQLVTFGY"
     gene            complement(<977801..>978820)
                     /gene="NDAI0B03890"
                     /locus_tag="NDAI_0B03890"
                     /db_xref="GeneID:11497928"
     mRNA            complement(<977801..>978820)
                     /gene="NDAI0B03890"
                     /locus_tag="NDAI_0B03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668618.1"
                     /db_xref="GeneID:11497928"
     CDS             complement(977801..978820)
                     /gene="NDAI0B03890"
                     /locus_tag="NDAI_0B03890"
                     /inference="similar to DNA sequence:INSDC:YIL134W"
                     /note="similar to Saccharomyces cerevisiae FLX1 (YIL134W);
                     ancestral locus Anc_2.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668666.1"
                     /db_xref="GeneID:11497928"
                     /db_xref="GOA:G0W6L2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W6L2"
                     /translation="MSRHDTTYLTSLQREILCGLTAGSLTTLIVHPLDLLKVRVQLLA
                     SNKTIHNKGYLFIIKDLIHTAKIHHNRNKFWENLIKESYRGLPINLIGNTVAWGLYFG
                     LYNHSKSYIFDNWHKINPSSDKKEPNKSSVFLVSGLFSGVMTTLLTNPLWVIKTRIMS
                     TSKTNSHSYTSIMNGFKSIMKEEGPRALWKGLVPSLFGVSQGALYFMVYDNLKLKFNI
                     YNDKNNHYEQEKSRLRKKTENYKIIFITSISKMISVSAVYPFQLLKANLQIIKSLHNT
                     NNNRNSSTVTTKVHNERFLTLTKQIYKDNGFKGLYKGLLANLIRAVPSTCITFCIYEN
                     LKAFL"
     gene            <980356..>982581
                     /gene="NDAI0B03900"
                     /locus_tag="NDAI_0B03900"
                     /db_xref="GeneID:11497929"
     mRNA            <980356..>982581
                     /gene="NDAI0B03900"
                     /locus_tag="NDAI_0B03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668619.1"
                     /db_xref="GeneID:11497929"
     CDS             980356..982581
                     /gene="NDAI0B03900"
                     /locus_tag="NDAI_0B03900"
                     /inference="similar to DNA sequence:INSDC:YIL135C,YNL074C"
                     /note="similar to Saccharomyces cerevisiae VHS2 (YIL135C)
                     and MLF3 (YNL074C); ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668667.1"
                     /db_xref="GeneID:11497929"
                     /db_xref="UniProtKB/TrEMBL:G0W6L3"
                     /translation="MTATTAVTTTTTTTTSATATAPIQDNNSNNTSSTRNNNTNTGSH
                     HPNENNRNDIFESRSYDTGSAINEDDTCEPQIFERNVEDPYILTKTASNSNLGLNLSR
                     NASHTSLLQRRISTSSSASNRPRYFSTSNLNTLTPQLTNSSSASLSLSRSGSRSYNNP
                     DNAPGSPDYVLPNHNSLDHHHNLENFVPPALDAGCSIVTDKDTNLDDIDMIYSKRPST
                     IGLDLALGRTSSFSTLIDNNNYTNYDEDYNNEMNNPSISLNGTNTNLSNSSNNNDKNI
                     NNNGRNSPRLLRFYSYVDMLSDENIRRNSTNNNNNTINGSVSNNPIGSNRYVGGIPNN
                     NAYYTNRHRPSLINHYSSGYNQNFRLHLNQKQMQNDLSASPSTSPTQFTNPFVPSNVN
                     QNSLLRRYSNTNSPFNNTATTNGNTKPNNNILLRKSITNTNPLVKLPSNSLSTTFMKS
                     DKVSNNTDKNESKKNKLLKNSRFHIDSSGSEDTSTDEEENYDDNIKDDAKMYDDVFEE
                     CNPEALTDTANNNSVSLKQPFSPPSSYSNVLGAKSGVSSYVSQQQKQVRPRTLSHVRH
                     STSPNISFNTTATNNLSSTLFRPRTLSNSTRTPVINSAAAATRSPPQVNKNDLFKIQT
                     TEPVANFSSLSSTSQAPMIDENLQTERLSDVLRRRVYVSNSLSNNNSRSSSQPSSPSP
                     PSMSSFSSPIQKHSSVNNSSISNSSGIFTHDDLKENADANVSNSNSNSNSTITAIGSS
                     K"
     gene            complement(<983740..>984948)
                     /gene="NDAI0B03910"
                     /locus_tag="NDAI_0B03910"
                     /db_xref="GeneID:11497930"
     mRNA            complement(<983740..>984948)
                     /gene="NDAI0B03910"
                     /locus_tag="NDAI_0B03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668620.1"
                     /db_xref="GeneID:11497930"
     CDS             complement(983740..984948)
                     /gene="NDAI0B03910"
                     /locus_tag="NDAI_0B03910"
                     /inference="similar to DNA sequence:INSDC:YIL136W"
                     /note="similar to Saccharomyces cerevisiae OM45 (YIL136W);
                     ancestral locus Anc_2.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668668.1"
                     /db_xref="GeneID:11497930"
                     /db_xref="UniProtKB/TrEMBL:G0W6L4"
                     /translation="MSSRLVIGTTAATIATLTSYILYNNNKTNTSLPARVRNKDNPIY
                     ITFEKLQDLNSSSNTNYNKKLVKYHLPPYSEHWSSKLKQGIQDDLSALKTTFWNPSSQ
                     HMETEQERQIRDDLQNKKKYALSQYNDAVKAFNEFIDNSKYNNKEWLYNSVKNQVIDA
                     KEALDQAIYNMNHQENNSSILRPKKVNVDAVANQGVFGWGDTAQEFAREELEQNGNPT
                     PSTTSANETLNKFTKKAKDKGWFTSNDNKVEKPDLEDEKLMAEGALKGLEGWGENAAQ
                     FAKDEYEDIKWQFSNSTEKLNGKIDEATQKLNEAQRKVNETKQKWWEFGEKKNDELYK
                     EAQRQYENAKVELDNANKSLQDWNDKISGKFWEKTDKSIDSLKKGSNEVNESVQRNMN
                     KAQDYVQDKK"
     gene            <986626..>989592
                     /gene="NDAI0B03920"
                     /locus_tag="NDAI_0B03920"
                     /db_xref="GeneID:11497931"
     mRNA            <986626..>989592
                     /gene="NDAI0B03920"
                     /locus_tag="NDAI_0B03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668621.1"
                     /db_xref="GeneID:11497931"
     CDS             986626..989592
                     /gene="NDAI0B03920"
                     /locus_tag="NDAI_0B03920"
                     /inference="similar to DNA sequence:INSDC:YIL137C"
                     /note="similar to Saccharomyces cerevisiae TMA108
                     (YIL137C); ancestral locus Anc_2.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668669.1"
                     /db_xref="GeneID:11497931"
                     /db_xref="GOA:G0W6L5"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G0W6L5"
                     /translation="MATPLSIQNGFNIDQYNLQLDIDPSKTNFKGIVTIAATLLTNAT
                     SLKEIKLHSKNLAVTSAHILYSTKDDSKTNLSINYDEINQLVILKPENNAQSLSLSST
                     TFEIQLSYTGSINETSTYGVFKTLLKNNSKKDNFIIATHCQPSFARYIFPCIDELSSK
                     SVIELSIITTKGLTVLSNAPIEQVVEKKSVRSNCTLTTFNKTPLMTTSLFGFVISNQL
                     EVITAKIPSSSSSPESKDFSVSVYSPIRINDATFTLDTIQKYVPLLEKFFQFNFASIF
                     KNGFKTKLDFVLLPNLADMAMENFGLIVIQMNHLLLTPHQLANDSLRNQLEQLIVHEL
                     VHQWIGNYISFDSWEHMWFNESFATWLAIHLTNSGNEMHEDSSSYWYDDQYLIGMIDS
                     QLNNVHNHSLSSMTIHQNSAMIKEENEKKRKDILVTNDVFDNDSYIKGIIMLRSLQLT
                     IQQQEDGNHVDLLSNAFASLFQQEKTENNNLHLKPCKLMDIWNQIGKYLKSENIPNFI
                     SSWTRLPGFPLLSVKQDEDDSKKTKLIQNRFLDGYAPLDKIENVPYHIPLLIKLPMDN
                     KLDYENVLMTDRTLTLNHPIFLCNNESQAMYRVSYESEIYYDQFISNTTTTTTTIGGS
                     TTLDRINLIKILKDLSAIINNVHYCKPIHIKGLFKITNHLIDQLKDRDAHDDNLWEPL
                     SIAMSILLNLERCYSKYSGDYYDNEKKFNEIVEKLVGESSTINWELTKSRRYEAFELE
                     TLSYISIIFKNHPEIIKINEKYYDLLRSDNLKISGNLIPFKLIGSIFLVNVEQFTNGK
                     QWKRFINYAKDYDRLMANVRLEGESSKEVQELFHHELWSYAGYTNKTEEVVMKVLNYI
                     DSNLELELVPLILEGISSNFNRVVVASKKQESDCSDVSLSVGDIFWKWFMDNFNKWTN
                     KCKNNKSMADNFHTLISIAFDYRSTESKNILIEDFIESYKGQEDIYKLLRTTRKVMKK
                     DQELPLAVLKALTPLS"
     gene            <990168..>990653
                     /gene="NDAI0B03930"
                     /locus_tag="NDAI_0B03930"
                     /db_xref="GeneID:11497932"
     mRNA            <990168..>990653
                     /gene="NDAI0B03930"
                     /locus_tag="NDAI_0B03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668622.1"
                     /db_xref="GeneID:11497932"
     CDS             990168..990653
                     /gene="NDAI0B03930"
                     /locus_tag="NDAI_0B03930"
                     /inference="similar to DNA sequence:INSDC:YIL138C,YNL079C"
                     /note="similar to Saccharomyces cerevisiae TPM2 (YIL138C)
                     and TPM1 (YNL079C); ancestral locus Anc_2.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668670.1"
                     /db_xref="GeneID:11497932"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:G0W6L6"
                     /translation="MDKIREKLNNLKLEAESWQEKYEELKEQFKQVEQENIEKENEIK
                     SLSTKNQQLEDEVEKLEDELKETKLLAEDSTNLKSNNENFTKKNQDLEEELEESDAKL
                     KETIEKLRESDLNAEQLGRKVIALEEERDDWEKKHEEITAKYEEAQKELDEIAASLEN
                     L"
     gene            <991029..>991877
                     /gene="NDAI0B03940"
                     /locus_tag="NDAI_0B03940"
                     /db_xref="GeneID:11497933"
     mRNA            <991029..>991877
                     /gene="NDAI0B03940"
                     /locus_tag="NDAI_0B03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668623.1"
                     /db_xref="GeneID:11497933"
     CDS             991029..991877
                     /gene="NDAI0B03940"
                     /locus_tag="NDAI_0B03940"
                     /inference="similar to DNA sequence:INSDC:YIL139C"
                     /note="similar to Saccharomyces cerevisiae REV7 (YIL139C);
                     ancestral locus Anc_2.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668671.1"
                     /db_xref="GeneID:11497933"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:G0W6L7"
                     /translation="MNKWITKWLKIYLKSYINLILYYRNVYPSTTFDFTTYQTFNLPQ
                     FTPINRHPQLQSYIEELILDLLSKLNHIYHISLCIINKSNEICVEKYVLDFGEFKHIT
                     TTTNNARDDGDDDEDNQILSESEVFDEFRSSLNSLISHLEKLPKIKDNMVTFQIVINA
                     VELQLGHHPHYSLNHESINNENELLQFDRDVNWVKCKEDENLPKYDYTTTRNNNNHEL
                     NQPRIKMSSLVGCDVGPMIIHQFSERLILRASLNGDDNEDEDEDVYLNNDVNNKDGFS
                     SLDSFP"
     gene            complement(<992045..>994642)
                     /gene="NDAI0B03950"
                     /locus_tag="NDAI_0B03950"
                     /db_xref="GeneID:11497934"
     mRNA            complement(<992045..>994642)
                     /gene="NDAI0B03950"
                     /locus_tag="NDAI_0B03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668624.1"
                     /db_xref="GeneID:11497934"
     CDS             complement(992045..994642)
                     /gene="NDAI0B03950"
                     /locus_tag="NDAI_0B03950"
                     /inference="similar to DNA sequence:INSDC:YIL140W"
                     /note="similar to Saccharomyces cerevisiae AXL2 (YIL140W);
                     ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668672.1"
                     /db_xref="GeneID:11497934"
                     /db_xref="GOA:G0W6L8"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR008009"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="UniProtKB/TrEMBL:G0W6L8"
                     /translation="MINYNQRSLLLVIVSLFYLLIFKDTSIFVQSLPYEAYPVNKQLP
                     PVARINEQFQFQISNDTYKSNVDKSSQISYQTFNLPSWLTFNSESRTISGTPSSSVLH
                     NDIDTFYFNFILEGTDSADNMAINNTYQLVVTNKKSIEIASDFNLLALLKNYGNTNGK
                     DGLIISPNEIFNITFDRSAFTDRDSIVAFYGRSKQYNAPLPNWLFFDSNTLKFSGTAP
                     VVNSLIAPEMYYDLTLIATDIEGYAGIELPFELVIGAHQLTTSIQNTLIINVTDSGTF
                     NYDIPLNYIFLDDEEISSSDLGSIQLVDAPNWVTLSNSTLSGSLPSDLLDSSYNGTFS
                     VSVYDKYGDVIYLNFEVVSTTDLFAVSSLPNINATRGEWFQSSFLPSQFTDFDNTNVS
                     IFFPNTTETHDWLSFQLSNLTLQGDTPMDFISLELGVKAEKKSKSQDLTFTIIGMDPK
                     SKNHSSSSSTTTKNSTSSHSSTVITTRSSSTSSSHSSTSSFTATITSSSSSSSSSSSS
                     SSAAVAAVTRNTNNSNSKTIAIACGVAIPVGVIIIVIILFFLFWRRKNEKKNSDNENK
                     NNDIENGPPFAPVTPLNNPFDDDDDNDDKKNKDPSMRGISDLRELPLDNSSFSSNSSR
                     SSSINDEKLPYNDPLNSQSQEILIPKTESHNSLIFDPNNMSSSLYMNMLPSNKKSWKY
                     NSKLSPTIISHSNRDSSISLNTVTTSELLNTELSNDSPIPKDPKKSTLGLRDSVFWSS
                     NSMKQQKGISTMTPSSSISFTNNSNGKNNNKNNNVLPSLSELTYPEPARHASNNDNQS
                     NRTPRTVVSSSSSDDFIPVKDGNNFKWIHSNDVNRKPSKKRLVKFPNKGIVNIGQVKH
                     FEGHVPEEI"
     gene            999167..999240
                     /gene="NDAI0Btrna18V"
                     /locus_tag="NDAI_0Btrna18V"
                     /db_xref="GeneID:11497935"
     tRNA            999167..999240
                     /gene="NDAI0Btrna18V"
                     /locus_tag="NDAI_0Btrna18V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11497935"
     gene            <999856..>1000956
                     /gene="NDAI0B03960"
                     /locus_tag="NDAI_0B03960"
                     /db_xref="GeneID:11497660"
     mRNA            <999856..>1000956
                     /gene="NDAI0B03960"
                     /locus_tag="NDAI_0B03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668625.1"
                     /db_xref="GeneID:11497660"
     CDS             999856..1000956
                     /gene="NDAI0B03960"
                     /locus_tag="NDAI_0B03960"
                     /inference="similar to DNA sequence:INSDC:YNL084C"
                     /note="similar to Saccharomyces cerevisiae END3 (YNL084C);
                     ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668673.1"
                     /db_xref="GeneID:11497660"
                     /db_xref="GOA:G0W6L9"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /db_xref="UniProtKB/TrEMBL:G0W6L9"
                     /translation="MPKLEQFEIKKYWQIFSGLKPVENKVTHDQVLPILYNSKLDSSI
                     LNKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIEKVPDELPEWLIPGSKAKLVKE
                     RMKMKQQENADIPKKEPPKMDWYMSPEDKTLYEDLWNSCTKFTDGTATFPALTIVLKS
                     KFFNIGTSDFSKIWELINPKNLASIDKDPALLFIHCLRQRNDVNAAIPKELPPALANI
                     CNKQTIKYDLDSNQPNLTRPTTTAPITTNTDNESPSTSDAEIKRLENKLKELDTKSEA
                     KRNQPVASSTSSIDPERLNVVREQFEGLLDYLRQQTLNNASNAQPPSADIRVITEDLD
                     SIEQQVKVLENYLTKKKDELQSLKQEIQSHSN"
     gene            complement(<1001308..>1002891)
                     /gene="NDAI0B03970"
                     /locus_tag="NDAI_0B03970"
                     /db_xref="GeneID:11497936"
     mRNA            complement(<1001308..>1002891)
                     /gene="NDAI0B03970"
                     /locus_tag="NDAI_0B03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668626.1"
                     /db_xref="GeneID:11497936"
     CDS             complement(1001308..1002891)
                     /gene="NDAI0B03970"
                     /locus_tag="NDAI_0B03970"
                     /inference="similar to DNA sequence:INSDC:YIL142W"
                     /note="similar to Saccharomyces cerevisiae CCT2 (YIL142W);
                     ancestral locus Anc_2.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668674.1"
                     /db_xref="GeneID:11497936"
                     /db_xref="GOA:G0W6M0"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G0W6M0"
                     /translation="MSVQIFGDQVTEERAENARMSAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSDKALVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKLIEQSKIHPQTIIEGFRIASRAALDALEKAAVDNSHDEAKFRNDLIHIAKTT
                     LSSKILSQDKEYFSNLATDAILRLKGSTNLEHIQIIKILGGNLSDSFLDEGFILQKKF
                     GNNQPKRVENAKILIANTTLDTDKVKIFGTKFKVDSTSKLAQLEKAEREKMKSKITKI
                     SKFGINTFINRQLIYDYPEQLFTDLNINSIEHADFEGVERLALVTGGEVVSTFDNPEK
                     CKLGECDLIEEIIIGEESFLKFSGCKAGEACTIVLRGATDQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKSVDTEAQNVDGKKALAVEAFARALRQLPTILADNAGF
                     DSSELVSKLRSSIYNGISTSGLDLNNGTIADMRELGIVESFKLKSAVVSSASEAAEVL
                     LRVDNIIRAKPRTANRQHM"
     gap             1007080..1007611
                     /estimated_length=532
     gap             1007964..1008242
                     /estimated_length=279
     gene            <1008865..>1009362
                     /gene="NDAI0B03980"
                     /locus_tag="NDAI_0B03980"
                     /db_xref="GeneID:11497937"
     mRNA            <1008865..>1009362
                     /gene="NDAI0B03980"
                     /locus_tag="NDAI_0B03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668627.1"
                     /db_xref="GeneID:11497937"
     CDS             1008865..1009362
                     /gene="NDAI0B03980"
                     /locus_tag="NDAI_0B03980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668675.1"
                     /db_xref="GeneID:11497937"
                     /db_xref="UniProtKB/TrEMBL:G0W6M1"
                     /translation="MLLLNIYTGQAKVHPIQISPKDDAFNWYKFPIYALSEVASNKNQ
                     ISFIFETTMSAKIITLKKIPSIKSSFKVGDFDSFENTKTGPEEHAFKCPIYVGTFENL
                     MNRSFCDLIRKWDETMVQLSLCYLAINGFDKINQDLFESVNIGSLKWFFKILVFTKVD
                     GVSAN"
     gene            <1012170..>1013933
                     /gene="NDAI0B03990"
                     /locus_tag="NDAI_0B03990"
                     /db_xref="GeneID:11497938"
     mRNA            <1012170..>1013933
                     /gene="NDAI0B03990"
                     /locus_tag="NDAI_0B03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668628.1"
                     /db_xref="GeneID:11497938"
     CDS             1012170..1013933
                     /gene="NDAI0B03990"
                     /locus_tag="NDAI_0B03990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668676.1"
                     /db_xref="GeneID:11497938"
                     /db_xref="GOA:G0W6M2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6M2"
                     /translation="MHYHKFQSLLKVYPMSVDRFSRLSFRELRHGMIKLVREYVKVEG
                     EDIDVMNVKERLAGHSAATGQGIYGNDVGSGVGADASLEEKYASLINSAWQNWLGLGY
                     GKEKEEGEPAVARNNCVKKYVSSNGSIKDLFVAGKKLYGKEFQFREGQFDVSVEIYLW
                     GTQIIPIQALPGFRKTALFQIPSVVLSYGEQKTVSFVFVPYVCLLSNMKLRLSSCGIN
                     CGILKDLFVNGPAVEEKNLFCDVYVGTFNDLGSENFLRLVNNWYNIYQDCILGMIVID
                     EFHNLETEQLYRGQSFRLISEINFNLAWKVVVMTGTAGKKGMVKPMNFIGYDKEMCTS
                     MVSNKNRILYFDLVNQTPLKNIVKKFQVFERSTMTESEVEMLVDRFMEYDTKSKVIIV
                     CKEKVTVEKLYFRQDSEWVHGDLPSEEKIKKSRRFIEDEKCRIMIGTKLVSEGIDIKG
                     VKLVIMLDYLPSIGEYIQTAGRLREGGVCLSYWTKRSVQTCSVKPDVCITKQVSKFYD
                     LDYDRHDLCCGHHHNISEDVANLYHYLNGDGGPGVVGVGVSIGESDEVGSGNSFSSAN
                     KSSIFEDLSPDMDQSDNFYCL"
     gene            <1014465..>1015043
                     /gene="NDAI0B04000"
                     /locus_tag="NDAI_0B04000"
                     /db_xref="GeneID:11497939"
     mRNA            <1014465..>1015043
                     /gene="NDAI0B04000"
                     /locus_tag="NDAI_0B04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668629.1"
                     /db_xref="GeneID:11497939"
     CDS             1014465..1015043
                     /gene="NDAI0B04000"
                     /locus_tag="NDAI_0B04000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668677.1"
                     /db_xref="GeneID:11497939"
                     /db_xref="UniProtKB/TrEMBL:G0W6M3"
                     /translation="MIFDKFKVSALAKFWEVIVSKLKLPVPGELFSNDMVMTRSYNIM
                     REEIQGQKLDILMYFSVKDSRDQMEGLWEASNGDDLTFKDIEADVKRASTTRYQSLPF
                     IINFVGRFNYLVSTCGYVFGEYMILYFIDKNFKSRSLYDARERSRKPPKVKVSAHQYI
                     IMMFAAFHNRDFLGYFYRSFHHCLESNVLVTG"
     gene            complement(<1016190..>1018673)
                     /gene="NDAI0B04010"
                     /locus_tag="NDAI_0B04010"
                     /db_xref="GeneID:11497940"
     mRNA            complement(<1016190..>1018673)
                     /gene="NDAI0B04010"
                     /locus_tag="NDAI_0B04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668630.1"
                     /db_xref="GeneID:11497940"
     CDS             complement(1016190..1018673)
                     /gene="NDAI0B04010"
                     /locus_tag="NDAI_0B04010"
                     /inference="similar to DNA sequence:INSDC:YNL085W"
                     /note="similar to Saccharomyces cerevisiae MKT1 (YNL085W);
                     ancestral locus Anc_2.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668678.1"
                     /db_xref="GeneID:11497940"
                     /db_xref="GOA:G0W6M4"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G0W6M4"
                     /translation="MPIKSLETYLFERGLVGAYPIESLKNSTLGIDINHYVSRLLSYK
                     KEQFLDAIGGFPTSLKMYLESDLKIFKEYKITPIFIFNGSMTYNQLESNGYFNASAAE
                     ASASSNLEISLGSGSPPGSSTPKTSKELLLAQRHRGWTQWSNLMTSNQSSYIDQPIQP
                     QEPFRYNSVIELKRYQSDLINYFIDHDIVYQVAPYCSWIQLAYLYDNGYIDAIYGPTD
                     CLLLKNIEKFILGMEFPNKDFRFIDKTKVLKDFQCTHEDFIDIAMAVGNDLQSSTLPP
                     LQIYPNSKIFDIALEMFLSTGTNFYAYQLSNPIKEESDKYRQRYEKGVSSLKFMPVLK
                     TNGKVELYTYDGDNSGTSSINDNDNNNNDNDSATNIKHKKDTVSTSPSSSSSSTHEIQ
                     SDIPNDVHDFIAQQLPSEYYFYRSLGLVTGKLFDAISTGIYPEEPPLDGGSSDSYREL
                     LKLSVDMFKNKDINLLTQPINRYFQMKQIKQIKWFSPNYPTSLINRTSPSLFEKINRI
                     IVKTQDKEKQFSIAELIKLLSESSDISADFVSEEVIFPNSVPMEKKLSTSFDLLSTSM
                     LRVLTQLEFFDFNIPTKSLKPTKLGSVLLNLPKLSIDDKHYDSILLLLIFLKTKVMSL
                     SEDVKPSVRSALSDVTLRTYPQESQYILLITRILTLFQINQRPTNYHGPIDKKTLIFR
                     EHLDFIRENMNEIYEATLISSLTANEFDRLSLDNFEWQSKVVRNMPFKLATPNTIMAM
                     MWEFFLQKYLHNGNVKTDALALVATEFGTYKSVPNLNEQFEHSYEYLMQILKVLKELN
                     AIGLFDRKDLKIVEEALEFCSNAIKEQEN"
     gene            <1019311..>1020357
                     /gene="NDAI0B04020"
                     /locus_tag="NDAI_0B04020"
                     /db_xref="GeneID:11498524"
     mRNA            <1019311..>1020357
                     /gene="NDAI0B04020"
                     /locus_tag="NDAI_0B04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668631.1"
                     /db_xref="GeneID:11498524"
     CDS             1019311..1020357
                     /gene="NDAI0B04020"
                     /locus_tag="NDAI_0B04020"
                     /inference="similar to DNA sequence:INSDC:YOR085W"
                     /note="similar to Saccharomyces cerevisiae OST3 (YOR085W);
                     ancestral locus Anc_2.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668679.1"
                     /db_xref="GeneID:11498524"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G0W6M5"
                     /translation="MKLCIYSSVLTILSLCTFGALALDNASLLKEARKSSDNIINVSG
                     KDYETILSGHRDANILVLFTSNSPQFGCSLCAELESEYEALVSSWFHDHPDALSKDDS
                     EKALFFAKAMVKSPQNIPKIFADFGIEQIPRLHLLKAGSNNMLDSEIVDIPADKDIAR
                     VQHLINALKSATSITDFEVHEKVNWGSTIITAVSVFIIVFLLKKHTYIATYLLNSRLV
                     WGVLSVSFIILMIGGHMFNKIRNTMLAGTSKNGEIIYFIPNDFQNQFAIETQAIGVVY
                     GILATMVVTLAIGIPKLGELYKGNKRRSVVEASFSILCALFVYMFFAALTYVFNLKTG
                     GYPFQLLKISSLFH"
     gene            complement(<1020592..>1024095)
                     /gene="NDAI0B04030"
                     /locus_tag="NDAI_0B04030"
                     /db_xref="GeneID:11498525"
     mRNA            complement(<1020592..>1024095)
                     /gene="NDAI0B04030"
                     /locus_tag="NDAI_0B04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668632.1"
                     /db_xref="GeneID:11498525"
     CDS             complement(1020592..1024095)
                     /gene="NDAI0B04030"
                     /locus_tag="NDAI_0B04030"
                     /inference="similar to DNA sequence:INSDC:YNL087W,YOR086C"
                     /note="similar to Saccharomyces cerevisiae TCB2 (YNL087W)
                     and TCB1 (YOR086C); ancestral locus Anc_2.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668680.1"
                     /db_xref="GeneID:11498525"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:G0W6M6"
                     /translation="MSKEGTELTRQKTLEKTSANISESKAEHVGALKVNRPHIDATYV
                     GWKQLGGWEEKDELTPEDDLMDMSKETILDNIIPDTLYGDWYHSVGIFALGGILSFAI
                     GKFHFSFAPAFFVVLITGLLYRTSIKKYRGSIRDLVQKEMTVQRVEDDYETLEWLNTL
                     LDKYWPIIEPNASQMVVQQVNEIIRTNPSIPTFIKALWIDKFTLGIKPPRVDRVKTFQ
                     NTASDVVVMDWSLSFTPHDLSDMNAKQVRNYVNQGVVIKANIFGFVIPVSVSDVSFKA
                     DARLRFKLMTPFPHMETVNIQLLEVPDIDFVASLFGNSLFNMEILAIPGLLPLIHRMA
                     SKYMGPMLLPPFSLQLNIPQLISSSALSIGVLEVTIKNVKDIKRSSSMLNISIDPYLA
                     FEFGGKRIAKTRTVRDTLNPVWNETMYILLQSFTDPLTISLYDKRAKLKDKVLGRIEY
                     NLNSLHDNDSQRNVHANFLRNSKPIGEMNFDLRFFPTLVAKRLPSGVVEELPDLNTGI
                     SKIVVEEVRIVQDEPDKKVNAYVELYVNAKLVLTTKKATSDEDTIKWSQDYEAVIMDR
                     RKTRCKFVIKNGDDDSIVGTSVQTLNDLIDRTQIDKKSIPLKDAKGELTITTHWKPVS
                     LDVGTTSIAYTPPIGVVRVFVEKATNLKNLEKIGKIDPYAKVLVNGISKGRTDTQPQT
                     LNPVWEQAIYVAVTSSNQRITIECMDVETVNKDRSVGKFDLKIQDLFHKDENDRYAIN
                     IDDKSRVGPLVRKKGSQGNITYKVSFYPTMPVLTLEELQDVEKIQSRKKKIEDRKKTV
                     DEKKLSTDEKRKLQQEETEIKDIGRNVFRQGKVGILTNQLTNYNAGVLSISVLDGELP
                     QTGLYVQAFFDANGHPRFVSPQISSRIIRTGWTGDVMIKELQDSVTTFKVTKKKFSNK
                     VDNSICQVSISTIDLVKECYYKPSIIDISGESNAKIMVQVSWFPIDVDELPQADLKSN
                     SGELTILAKSAENLISADTNGYSDPFIKFYINDEDDPRWKTKIVKKTLNPTWNDSGTI
                     EIHNRMHDRLILKVMDWDAASGDDTIGWGSVPLSKVDPEGTTSLDVKIKGVNGEDGGV
                     AHLEFTYSSRYITGVTKREAKVGDIASKGIGSGLKAGQTVVSTGLGTVGKIGRGIFGG
                     KKNKHNNNYKSDEEREDEEEE"
     gene            1025029..1025102
                     /gene="NDAI0Btrna9N"
                     /locus_tag="NDAI_0Btrna9N"
                     /db_xref="GeneID:11498526"
     tRNA            1025029..1025102
                     /gene="NDAI0Btrna9N"
                     /locus_tag="NDAI_0Btrna9N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11498526"
     gene            <1025150..>1027258
                     /gene="NDAI0B04040"
                     /locus_tag="NDAI_0B04040"
                     /db_xref="GeneID:11496189"
     mRNA            <1025150..>1027258
                     /gene="NDAI0B04040"
                     /locus_tag="NDAI_0B04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668633.1"
                     /db_xref="GeneID:11496189"
     CDS             1025150..1027258
                     /gene="NDAI0B04040"
                     /locus_tag="NDAI_0B04040"
                     /inference="similar to DNA sequence:INSDC:YOR087W"
                     /note="similar to Saccharomyces cerevisiae YVC1 (YOR087W);
                     ancestral locus Anc_2.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668681.1"
                     /db_xref="GeneID:11496189"
                     /db_xref="UniProtKB/TrEMBL:G0W6M7"
                     /translation="MTCDEMKVKVDLEVEKNQDSSVYQPTYAGFTKFTMSYQTLPLTR
                     QDCPLEGFCPGEHNVPNPRQILKIALNLKFLIDETIKVALSTDEIIQDGSSILNSKIV
                     TLAYDACGGNHNDKRNLLKYRSVIIFAILRVVKWNNELALRELHDSELYEMRSLASQK
                     LCKMIIDKEETRDLDFLFMQLLLRKYVINEKDKDMEPMNAVELATDLHCIIVIGSSGF
                     QRCLKWVWRGWILQNYRDPTMFIKDEKISSMKFMDHFNPERIKTPKYQNILQILFAVV
                     FLILYTIVVNGKSGTNVVPLDFWEYIFYLFTLGYISSEFSKFYYIGNAYFSFWTCFND
                     TLYGIVLTSMIFRFNSLYSFKLDKPGEDYDRISYRILSCAAPFVWSRLLLYLESERIV
                     GALLVVLKHMLQQSIVFFALLLLIMLGFLQGFLGLDSADGKREITMPILTNLIITVFG
                     LGTFDMFDRFAPPYAAILYYGYCFIVTVILLNILIALYANAYQEVIENTDDEYMALMS
                     QKTLRFIRAPDEDVFVAPLNLIEICTVPVTRLLSMEKRRDLNYLIMLILYSPMLLYVA
                     IKEVHVAKRIKYNRLNNLPDDANETDTEWDLTDGYFGFEDSLFDDVESEIGIRKTTLK
                     NKRSLELQREAENVDKHFVVSKEWYKKVQKLKSSSERTTSNGLTKEQLEARLRKTEEK
                     ISDLATSINNLTEVIKEKNG"
     gene            complement(<1027616..>1028029)
                     /gene="NDAI0B04050"
                     /locus_tag="NDAI_0B04050"
                     /db_xref="GeneID:11498527"
     mRNA            complement(<1027616..>1028029)
                     /gene="NDAI0B04050"
                     /locus_tag="NDAI_0B04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668634.1"
                     /db_xref="GeneID:11498527"
     CDS             complement(1027616..1028029)
                     /gene="NDAI0B04050"
                     /locus_tag="NDAI_0B04050"
                     /inference="similar to DNA sequence:INSDC:YNL093W,YOR089C"
                     /note="similar to Saccharomyces cerevisiae YPT53 (YNL093W)
                     and VPS21 (YOR089C); ancestral locus Anc_2.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668682.1"
                     /db_xref="GeneID:11498527"
                     /db_xref="GOA:G0W6M8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6M8"
                     /translation="MYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALV
                     GNKIDILENNENERKVAREEGEKLAEEEGLLFFETSAKTATNINEAFVAIGEKIPLKK
                     PGDGDNPDSAGVTNEQRIDLANSAHAASQVSGCNC"
     gene            complement(<1028624..>1030330)
                     /gene="NDAI0B04060"
                     /locus_tag="NDAI_0B04060"
                     /db_xref="GeneID:11498528"
     mRNA            complement(<1028624..>1030330)
                     /gene="NDAI0B04060"
                     /locus_tag="NDAI_0B04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668635.1"
                     /db_xref="GeneID:11498528"
     CDS             complement(1028624..1030330)
                     /gene="NDAI0B04060"
                     /locus_tag="NDAI_0B04060"
                     /inference="similar to DNA sequence:INSDC:YOR090C"
                     /note="similar to Saccharomyces cerevisiae PTC5 (YOR090C);
                     ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668683.1"
                     /db_xref="GeneID:11498528"
                     /db_xref="GOA:G0W6M9"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G0W6M9"
                     /translation="MSPLNQLLLRRTTRYISRNILRKKSSALNKLIVERSYFSTHNSK
                     HLNDTSSSSRHSSSFHSRDVSLTLLSGGILLLSYSYLTTKGNPLSLDSINTIKEFSTF
                     FNNQNSGKNGNTQNKEGTIMILAEDQIEKKLHDNEESHSINRNKGIFRYDVSQLPSNH
                     PIEDNHVEQIITIPNEDQSSNDEEDLYFFGIFDGHSGTFTSKKLSQDLVRYVANQIHN
                     SYDSITTATMNGLFPSSTKIDNAIKSGFLKLDNDIVQESFRKLFQSPTNENMINTLPA
                     ISGSCALLTMYNSLNKTLKVAVTGDSRALLCGKDENGNWTVESLSIDQTGDNVREVER
                     IRNLHPNEPNVIRNGRILGSLQPSRAFGDYRYKVKEVDGKQLSELPDHVKIYFRKEPR
                     DFLTPPYVTAEPEITTTKITDKTKFMVLGSDGLFELLTNEQVAGLVVRWMESNNLIET
                     VNATPLGKLPNVKDLTTDMDSQRPPFRYNTKDKNRDYAKNPEYLMQDKNVATHLIRNA
                     LSAGGKQEYVSTLVSIPSPMSRRYRDDLTVTVAFFGDSGENSDGSMVINPEATTPPKP
                     RL"
     gene            <1031710..>1032249
                     /gene="NDAI0B04070"
                     /locus_tag="NDAI_0B04070"
                     /db_xref="GeneID:11498529"
     mRNA            <1031710..>1032249
                     /gene="NDAI0B04070"
                     /locus_tag="NDAI_0B04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668636.1"
                     /db_xref="GeneID:11498529"
     CDS             1031710..1032249
                     /gene="NDAI0B04070"
                     /locus_tag="NDAI_0B04070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668684.1"
                     /db_xref="GeneID:11498529"
                     /db_xref="UniProtKB/TrEMBL:G0W6N0"
                     /translation="MEHNCMYFNSGCNLTGNFMCDQGKAFESAIREGHGKEAITCVTH
                     LSKNLIRNAKGRVIEAFQAATHTLDPQVYGESINELIKKFPENKRNSGNSTFKKLTQS
                     PRSFSRLKRDCPHWEIFTTNPVEQSHSIIKVLKRESLVNMIVNLTSCQISCHNRLFLN
                     PHFQAPPIYLPLLIRPHLS"
     gene            complement(<1032275..>1032775)
                     /gene="NDAI0B04080"
                     /locus_tag="NDAI_0B04080"
                     /db_xref="GeneID:11498530"
     mRNA            complement(<1032275..>1032775)
                     /gene="NDAI0B04080"
                     /locus_tag="NDAI_0B04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668637.1"
                     /db_xref="GeneID:11498530"
     CDS             complement(1032275..1032775)
                     /gene="NDAI0B04080"
                     /locus_tag="NDAI_0B04080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668685.1"
                     /db_xref="GeneID:11498530"
                     /db_xref="UniProtKB/TrEMBL:G0W6N1"
                     /translation="MKVIIVSLIRVNIPLLSSITASGKTFLTGVMPKREDVAFSLNPF
                     RDFRGRRIPSIFPDNFTWMLRAYISLGNISGLPKFKRGKCFPAGFLRHFSVFFPFSLK
                     KLKKKERKSNPRDYPGKANKERVMFKFVIRFRVRKYENFEYIFSTKWNERRPRKKNVL
                     NTDHSH"
     gene            <1033489..>1035435
                     /gene="NDAI0B04090"
                     /locus_tag="NDAI_0B04090"
                     /db_xref="GeneID:11498531"
     mRNA            <1033489..>1035435
                     /gene="NDAI0B04090"
                     /locus_tag="NDAI_0B04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668638.1"
                     /db_xref="GeneID:11498531"
     CDS             1033489..1035435
                     /gene="NDAI0B04090"
                     /locus_tag="NDAI_0B04090"
                     /inference="similar to DNA sequence:INSDC:YNL095C,YOR092W"
                     /note="similar to Saccharomyces cerevisiae YNL095C and
                     ECM3 (YOR092W); ancestral locus Anc_2.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668686.1"
                     /db_xref="GeneID:11498531"
                     /db_xref="GOA:G0W6N2"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:G0W6N2"
                     /translation="MHITLGQAIWSSVKPIIKIYLIIGTGFLLSKMNILTSEATRTIS
                     DVVLTILLPCLSFNKIVANIEDNDIKQVGIICLTSVILFATGLGFAFLVRKFLPVPKQ
                     WYGGILAGGMFPNISDLPIAYIQTMDQGFIFTPTEGDKGVANVIIFLAMFLICVFNLG
                     GFRLIENDFKYNDEENAIMESEEEENSNIDVGQEDADSHSSTLSKGSHAKTESSEDDD
                     PTHLNEKKNHDENQEKNNGDSSTSSTTATHSQVGNSIAENNKSKDSIPKRIHSATIPE
                     EQEEENEDVSSETSSVVTSIDSHINNSSILDNMNFTKSRRTASQPVAFTSRSSSVSGM
                     GIHAYKTTSHQSIRSIDHRSLPAQDMNDLINEYSNVDQFGNKRSNTALSLDSNNVRNP
                     YDSPVEQPIARTQTAQSRIEKIRSSNLTRILTSDATVSKKDIEESGSSLPKWLQKFPL
                     TSLIVFFVKNCLRPCSMAVIIALIIAFIPWVKALFVTTATTPNIKQAPDEQPALSFIM
                     DFTAYVGAASVPFGLILLGATLGKLKIGKLYPGFWKSAILLIFLRQCIMPIFGVLWCD
                     RLVKAGWATWEKDKMLLFVIAITWNLPTMTTLIYFTASYTPVDCKEPIQMQCVAFFLM
                     LQYPLMAVSMPFLVSYFLKVQMKL"
     gene            complement(<1035994..>1041192)
                     /gene="NDAI0B04100"
                     /locus_tag="NDAI_0B04100"
                     /db_xref="GeneID:11498532"
     mRNA            complement(<1035994..>1041192)
                     /gene="NDAI0B04100"
                     /locus_tag="NDAI_0B04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668639.1"
                     /db_xref="GeneID:11498532"
     CDS             complement(1035994..1041192)
                     /gene="NDAI0B04100"
                     /locus_tag="NDAI_0B04100"
                     /inference="similar to DNA sequence:INSDC:YOR093C"
                     /note="similar to Saccharomyces cerevisiae YOR093C;
                     ancestral locus Anc_2.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668687.1"
                     /db_xref="GeneID:11498532"
                     /db_xref="GOA:G0W6N3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010506"
                     /db_xref="UniProtKB/TrEMBL:G0W6N3"
                     /translation="MDFSIPANLPIELQNRLNELIQDYKEENLTRKGYETKRLQILEQ
                     YGIRKTAYQYQSKNGRNSTIKSSSTLRMSPANGNNNNNKNKKDTIYLPGRNQSLYIKN
                     TNISVATQNNNSLNDLSSAIYSPPINTRDSISDMQKSIYRVTTMSSNSSRRHKRKSST
                     FQLSLPFNSSSHTTSPSLSSSHSNSSHPVDSSCSSKKKIYDPMFPLLPRPIENENESM
                     PNANTPNSNNKTNPVASFGSLPVILRGRFENNNDENAMISLNSKGKETFISWDKLYLR
                     AEKVANELNNSKNKLYKMDKILLWYNKDEIIEFAVAILGCFIAGMVAVPISFETYSLG
                     EIIEIIKLTNSKFILISNECYKQLDNLHSTQNNTKIKLIKNDFFQQINFLKTDDLGTY
                     SKAKKSSPVYDIPNISYIEFTRTPLGRLSGVVMKHKTLITQFQILSKIIDSRAMLHWK
                     KKNHIMRPYDKKPAHRTSSTYTLQNERFIVLNTLDPTRSTGLIFGILFNIFTGNLLIS
                     VDTKLIETPGGYESLISTYRADILLNDQLQLKQVAINYLENPELSIAKKKRKIDFSCI
                     KACLTSCNTIDTEVTEMVVHKWLKNLGCLDATLCYSPMLTLLDFGGIFISTRDQLGNL
                     QNFPIHNSKLQLQDQLFVNKEKLKSNIVESSITAMINSSSSFKDYSKFETFGFPIPGT
                     MLCVVNPDDNTLVSDLNVGEIWVSSKNLTDEFYQMDKVNDFVFKAKLNYSKMYSFIND
                     SSASLNNPDEINVMREKLDTILNVCPSNTSFLRTKLMGFIHNGKIYVLSLIEDMFLQN
                     KLIRLPNWAHTSDLNKAKKNRTSSSKHESNSTIDTINMDSDSNKDIEREDENIKPMKR
                     EVQTHYLQQITETVVRTVNTIFEVAAFELNDNKEEHFLVVVVESSLAKLTPTYGDSSL
                     LVTSSRQKDLFEKSMNDLTDQIYRILWIFHKIQPTCILVVPKDTLPRRYCSLELANST
                     IEKRFLNGELDSRFVKFQFDNIILDFIPHSGYFNESIFSERLSTLRRTCLEDIHKARI
                     ADFQMNSIWQTSGIDYRDTSLDPRNPLKKLTDFKTVLEVLEWRIINNGNEFAFSDGSN
                     SSFATINSNENNIHKKVSWKAFDLIVASFLKKIVGSKVPLKNGDRVIIMCDNSVEYVA
                     MVMACMYCNFVIIPLPIFDENNIEEEFEFLKTIIKSYKVKRMFIDAKTHNLLENNPTV
                     NKYYKRFKPSIPKITIFSKVKQKTGVTIRIFKTILKDKYGYKSGSKSNTNPCIIWISR
                     EYSVTRNLHVSMTHHILMNNCKILKETLQLSTDAPIFSLCSHTTGPGFIHSCLLGIYV
                     GSTTNLFSISNVMTDPKDFLFGLQNLNVKNLYLDMKTFRIILEKAYNLIRALPYTKDG
                     KHHSSSSSSSKNISTAVLRSDFLRNVQNLMIPFINRPQTVLVENLLKRYNNVFVSPTQ
                     INYVYQHHFNSLISLRSYLNVPPVDLYLDTVSLREGIVKEVDPAITDESEYVRIQDSG
                     IVPVCTDVSVVNPETLLQCYDGEFGEIWCCSEGNAFNYYICDEENNKLSKDPFITEQF
                     KSKFKKDVDDGLTYLRTGDLGFIKNVSVPDSQGDLINLNLLFLLGAINETIEVLGLTH
                     FVVDLEKTVRLAHPSIITCIVSKAGGLLVCLVKCKDTVQDKLANITALIVTQLLNGHG
                     VVLDLCAFVATRGSMGYSLTDWPKNRDIVMENWLSQDIEIKEQYGINYGENISIYLLS
                     ESQRND"
     gap             1041370..1041397
                     /estimated_length=28
     gene            <1042191..>1042736
                     /gene="NDAI0B04110"
                     /locus_tag="NDAI_0B04110"
                     /db_xref="GeneID:11498533"
     mRNA            <1042191..>1042736
                     /gene="NDAI0B04110"
                     /locus_tag="NDAI_0B04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668640.1"
                     /db_xref="GeneID:11498533"
     CDS             1042191..1042736
                     /gene="NDAI0B04110"
                     /locus_tag="NDAI_0B04110"
                     /inference="similar to DNA sequence:INSDC:YOR094W"
                     /note="similar to Saccharomyces cerevisiae ARF3 (YOR094W);
                     ancestral locus Anc_2.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668688.1"
                     /db_xref="GeneID:11498533"
                     /db_xref="GOA:G0W6N4"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6N4"
                     /translation="MGNSISKTLGRLFGSREMKILMLGLDNAGKTTILYKLKLNKIKT
                     STPTVGFNVETVKYKNVKFNMWDVGGQARLRPLWRHYFPATTALIFVIDSNDDDRLIE
                     AKEELYSIISEKEMEDVVLLVWANKQDLKNAKKPQEISEFLELDRNLKNQQWCVIGSN
                     ALTGQGLVEGLSWISNNTNNK"
     gene            complement(<1042962..>1043729)
                     /gene="NDAI0B04120"
                     /locus_tag="NDAI_0B04120"
                     /db_xref="GeneID:11498534"
     mRNA            complement(<1042962..>1043729)
                     /gene="NDAI0B04120"
                     /locus_tag="NDAI_0B04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668641.1"
                     /db_xref="GeneID:11498534"
     CDS             complement(1042962..1043729)
                     /gene="NDAI0B04120"
                     /locus_tag="NDAI_0B04120"
                     /inference="similar to DNA sequence:INSDC:YOR095C"
                     /note="similar to Saccharomyces cerevisiae RKI1 (YOR095C);
                     ancestral locus Anc_2.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668689.1"
                     /db_xref="GeneID:11498534"
                     /db_xref="GOA:G0W6N5"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:G0W6N5"
                     /translation="MVPEISQLPRLSDQLEEAKRKAAYRAIDENIDFENHKIIGIGSG
                     STVVYVAERLGQYLKDEKYASKVSQFICIPTGFQSKKLILDNGLQLSNMELYSQLDIA
                     FDGADEVDYNLQLIKGGGGCLFQEKLVSSNAKKFIIVADYRKKSPKYLGTNWVQGVPI
                     EVVPSAYVSVCKDLENKLGAKKAVLRECKGGKAGPVVTDNNNFIIDADFGTIEDPKQL
                     HKDIKLLVGVIETGLFIDNAAKVYFGNEDGSVELVSK"
     gene            <1045680..>1045868
                     /gene="NDAI0B04130"
                     /locus_tag="NDAI_0B04130"
                     /db_xref="GeneID:11498535"
     mRNA            <1045680..>1045868
                     /gene="NDAI0B04130"
                     /locus_tag="NDAI_0B04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668642.1"
                     /db_xref="GeneID:11498535"
     CDS             1045680..1045868
                     /gene="NDAI0B04130"
                     /locus_tag="NDAI_0B04130"
                     /inference="similar to DNA sequence:INSDC:YNL096C,YOR096W"
                     /note="similar to Saccharomyces cerevisiae RPS7B (YNL096C)
                     and RPS7A (YOR096W); ancestral locus Anc_2.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668690.1"
                     /db_xref="GeneID:11498535"
                     /db_xref="GOA:G0W6N6"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:G0W6N6"
                     /translation="MVFPTEIVGKRVRYLVGGNKIQKVLLSAKDVQQIDYKLESFQAV
                     YNKLTGKQIVFEIPTETH"
     gene            complement(<1046162..>1046701)
                     /gene="NDAI0B04140"
                     /locus_tag="NDAI_0B04140"
                     /db_xref="GeneID:11498536"
     mRNA            complement(<1046162..>1046701)
                     /gene="NDAI0B04140"
                     /locus_tag="NDAI_0B04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668643.1"
                     /db_xref="GeneID:11498536"
     CDS             complement(1046162..1046701)
                     /gene="NDAI0B04140"
                     /locus_tag="NDAI_0B04140"
                     /inference="similar to DNA sequence:INSDC:YOR097C"
                     /note="similar to Saccharomyces cerevisiae YOR097C;
                     ancestral locus Anc_2.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668691.1"
                     /db_xref="GeneID:11498536"
                     /db_xref="UniProtKB/TrEMBL:G0W6N7"
                     /translation="MDSVITFQGLKIDVPSFVLGTFITILGSLLLPILQQLIGEILIN
                     VLILIKYALFFGGMVFIFNYFVLRKQTLSPKEDHVHVTDKKQDDDVHLRSFEPAKVTE
                     LKVTDINEKEENYEGTVGSFRYFEIPITKLDDKVNGDDKYDKSSIGPDLNPITFTTRG
                     AAVLNKSARYENFVKRADR"
     gene            complement(<1047061..>1050330)
                     /gene="NDAI0B04150"
                     /locus_tag="NDAI_0B04150"
                     /db_xref="GeneID:11498537"
     mRNA            complement(<1047061..>1050330)
                     /gene="NDAI0B04150"
                     /locus_tag="NDAI_0B04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668644.1"
                     /db_xref="GeneID:11498537"
     CDS             complement(1047061..1050330)
                     /gene="NDAI0B04150"
                     /locus_tag="NDAI_0B04150"
                     /inference="similar to DNA sequence:INSDC:YOR098C"
                     /note="similar to Saccharomyces cerevisiae NUP1 (YOR098C);
                     ancestral locus Anc_2.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668692.1"
                     /db_xref="GeneID:11498537"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:G0W6N8"
                     /translation="MSSSSIHSSSKKISDIQEKDTWHLNDKNGQDSVILYQSDSSSNT
                     RPPILPILPIQRLRLLRQKQQWRIGKESQLLRLLPSISSNSRSTSISTSRSRSRSRSI
                     SRPQSTNIPENGSANDTVLYHKSQTPSPIKKLPSNIKFANPNPNRNDNGNDNDDTKHA
                     LTLELKSLNNINPILNNSHNNTSKKKKFKGTTWSGDFEYDLNDFSTTSDIVSQDKPSP
                     SRDTKMTQDLSENIILRGSDRKNDKRTFTNNINKDVNVNSITDIQKDVLLNGPRKIKE
                     KETTSELPLQQKKKETIEEPQLQHNEQQILSNKSQEKAKIILPTSGFDFLKDSNTPSK
                     KVSFDLKPSIATTTTTTSTTSEPKIPVATKPFSFKSPSITDAPSTKPSLSFNFNKSTK
                     PPKLEPIKSSDDRTSINLPFKLNQKDTAQKAFTFGATKTNIHEDENADENENEPKRKK
                     RPVPDVVIDMTKDTSEKNSTPIFSFGTSKSATTAKEDQQKKPTFNFGTKPPIDNDPKA
                     AVTTSEQSKPSFSFGATKSPDAAKPSFTFSSLPTNDTSPSVKPAFSFGSTAAKKDTTT
                     DSTSAAANAPSFSFGSTPANKHSATTIEKPFFSFKSTTTTAAQTEHTENKEDQTISKE
                     KDASLNVPFKFGTTSTAPESKEATTAATAKPTFSFGVSKPTETLANKPEAIPSISEGP
                     PSKKLTFSFNKPAAHNASEGTGSSVAKPTFSFGKQSTTEGAKPSFSFSKPTEANTVPP
                     SAATTGTTGFSFNKTTNPLLDANKATTTTVTPTTGLFSSKSNTNPLISTTTTSKPSFS
                     FKNPSLAGKSSTASPNLSPSPGFAFGKPAEEAQQPTKPSFSFGATASTTNNDAKKLGI
                     SLTNPTASATGSQTSLFGQTSAPPSTAGSTFTFTNKPSTSPVGAFGSNNPLQTTASGT
                     SLFGNTNPLISTNQQPSGSLFGNKPPVFGGVTANQQPPSSSVFGNTNPLQNPTTGAKI
                     PPSSASASSSGMFGNMQPSGFSMNQNAGFGTRPNMMGSSVFNSNLSQQNPFGGNAANQ
                     LTNQPQSQSTFNPSTTANLHFVAGNTTALPSSIFNSGAPNTQSSAPFPQRKLARMRQR
                     R"
     gene            <1051193..>1052386
                     /gene="NDAI0B04160"
                     /locus_tag="NDAI_0B04160"
                     /db_xref="GeneID:11498538"
     mRNA            <1051193..>1052386
                     /gene="NDAI0B04160"
                     /locus_tag="NDAI_0B04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668645.1"
                     /db_xref="GeneID:11498538"
     CDS             1051193..1052386
                     /gene="NDAI0B04160"
                     /locus_tag="NDAI_0B04160"
                     /inference="similar to DNA sequence:INSDC:YOR099W"
                     /note="similar to Saccharomyces cerevisiae KTR1 (YOR099W);
                     ancestral locus Anc_2.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668693.1"
                     /db_xref="GeneID:11498538"
                     /db_xref="GOA:G0W6N9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W6N9"
                     /translation="MVKFSIPPGRENQFKKIGVFIIAILTIFIIFHGASSSSDSSGST
                     RRSMKQVSTSVKGQNGYKYEKVSYPKYTGPKVKATFVTLARNSDLYSLLESIKSVEDR
                     FNHKFQYDWVFLNDEEFSDEFKNVTTAMVSGTTKYGLVPAEHWSFPPWIDQERAAKVR
                     DEMRAKKIIYGDSISYRHMCRFESGFFYRHPLMDDYDWYWRVEPDIKLHCDIDYDIFK
                     FMADNGKKYGFTISIHEYMDTIPTLWDTTKEFMKRHPEHVHKNNMMNFVSDDNGESYN
                     SCHFWSNFEIASLDFWRGPAYTEYFDYLDKAGGFFYERWGDAPVHSIAAALFLDRNEI
                     HHFGDLGYFHAPFHQCPLDDSIRLGNKCDCDPKEDFTWNGFSCGVKYYSVNHLKKPAG
                     WQEHA"
     gene            complement(<1052647..>1053636)
                     /gene="NDAI0B04170"
                     /locus_tag="NDAI_0B04170"
                     /db_xref="GeneID:11498539"
     mRNA            complement(<1052647..>1053636)
                     /gene="NDAI0B04170"
                     /locus_tag="NDAI_0B04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668646.1"
                     /db_xref="GeneID:11498539"
     CDS             complement(1052647..1053636)
                     /gene="NDAI0B04170"
                     /locus_tag="NDAI_0B04170"
                     /inference="similar to DNA sequence:INSDC:YOR100C"
                     /note="similar to Saccharomyces cerevisiae CRC1 (YOR100C);
                     ancestral locus Anc_2.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668694.1"
                     /db_xref="GeneID:11498539"
                     /db_xref="GOA:G0W6P0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W6P0"
                     /translation="MSQDSSLTDTTLLNEEKHTLESSELPPLSSPIRDNLKSLAAGGV
                     GGVCAVVTGHPFDLIKVRCQSNQAKGTTDAITKILKEARLATKGSFFTNSIRGFYKGV
                     IPPLLGVTPIFAISFWGYDIGKKIVTYNKNANSNNAISNELSIGQMATAGFISAIPTT
                     LVTAPTERIKVVLQTTKNGSFFGAAKDIIKNGGGIRSLFKGSLATLARDGPGSALYFA
                     SYEISKKYLNKQSGNDEKISIKNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSGTGSQ
                     SMLSATKEIYLKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSFFKKYNI"
     gene            <1055285..>1056274
                     /gene="NDAI0B04180"
                     /locus_tag="NDAI_0B04180"
                     /db_xref="GeneID:11498548"
     mRNA            <1055285..>1056274
                     /gene="NDAI0B04180"
                     /locus_tag="NDAI_0B04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668647.1"
                     /db_xref="GeneID:11498548"
     CDS             1055285..1056274
                     /gene="NDAI0B04180"
                     /locus_tag="NDAI_0B04180"
                     /inference="similar to DNA sequence:INSDC:YNL098C,YOR101W"
                     /note="similar to Saccharomyces cerevisiae RAS2 (YNL098C)
                     and RAS1 (YOR101W); ancestral locus Anc_2.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668695.1"
                     /db_xref="GeneID:11498548"
                     /db_xref="GOA:G0W6P1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6P1"
                     /translation="MSLNKSNIREFKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIE
                     DSYRKQVVIDDKVTVLDVLDTAGQEEYSAMREQYMRTGEGFVLVYSITSKNSFEELMT
                     YYQQIQRVKDSDYIPVVIVGNKSDLEDERQVSYQAGVNLAKQMNAPFLETSAKQAINV
                     EEAFYTLVRLVRDNGGEYNKNNAEVENAKENQHITDETNNINSNTIISQQGLTTQGEN
                     VVVNGTTSPSSIGTAPNVASIDQDQFSNEQRLKQQAQAQAQQKQPQPQQLTKDQHKAE
                     ASTVNATTDNTTKVPVNKSNQAAKQARTKQSQPAPAKAATTESSSGGGCCVIC"
     gene            <1057037..>1057747
                     /gene="NDAI0B04190"
                     /locus_tag="NDAI_0B04190"
                     /db_xref="GeneID:11498549"
     mRNA            <1057037..>1057747
                     /gene="NDAI0B04190"
                     /locus_tag="NDAI_0B04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668648.1"
                     /db_xref="GeneID:11498549"
     CDS             1057037..1057747
                     /gene="NDAI0B04190"
                     /locus_tag="NDAI_0B04190"
                     /inference="similar to DNA sequence:INSDC:YOR104W"
                     /note="similar to Saccharomyces cerevisiae PIN2 (YOR104W);
                     ancestral locus Anc_2.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668696.1"
                     /db_xref="GeneID:11498549"
                     /db_xref="UniProtKB/TrEMBL:G0W6P2"
                     /translation="MIICQVRSTLFPRDWTDDIKTTGKSFRNWDSCMNDKPCKIIAIV
                     GICLAVVVGLWLIGALLTCCRQGVSGISEFICWCCASGNRNRNNNVTNDGYARNSRVN
                     NIPVMPAMAGHHPSTVIYQPVQQPQTAATYYNNKRGNAKQNTNSYYDEFGRSNNDEVF
                     ELEEDFDLEKQKELSNKRKASSKSKPKRNSSFMSRFTSSGNHNTTPTATVSQPYPKND
                     YYSGATESSPYTNTGNFY"
     gene            <1058568..>1059422
                     /gene="NDAI0B04200"
                     /locus_tag="NDAI_0B04200"
                     /db_xref="GeneID:11498550"
     mRNA            <1058568..>1059422
                     /gene="NDAI0B04200"
                     /locus_tag="NDAI_0B04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668649.1"
                     /db_xref="GeneID:11498550"
     CDS             1058568..1059422
                     /gene="NDAI0B04200"
                     /locus_tag="NDAI_0B04200"
                     /inference="similar to DNA sequence:INSDC:YOR106W"
                     /note="similar to Saccharomyces cerevisiae VAM3 (YOR106W);
                     ancestral locus Anc_2.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668697.1"
                     /db_xref="GeneID:11498550"
                     /db_xref="GOA:G0W6P3"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G0W6P3"
                     /translation="MSFFDLEAQNQSSRIPTNIEQLPTSNDHNNIPRINDLLNTLANH
                     IATLKRECRKIGSKRDNNETRKKIEYDLIPLCNELRDRIDDNQPTWQNTFHEGSKLYN
                     DFKILKTELISVERSYETQKVTYPLKEIHVDSTSTGQPAAESNYVSLHINEQTPLVSS
                     NQQRQRQQQQLLEEQKQQQRQVSQNDVDFETIIQQERSEQITRIHSAVQEVNAIFHQL
                     GSLVKEQGEQVDTIDGNVTQLSSNMHKANQQLKKADEHQRQRNRCGMLTLIILVIVVL
                     IVVLAVLS"
     gene            complement(<1059621..>1061435)
                     /gene="NDAI0B04210"
                     /locus_tag="NDAI_0B04210"
                     /db_xref="GeneID:11498551"
     mRNA            complement(<1059621..>1061435)
                     /gene="NDAI0B04210"
                     /locus_tag="NDAI_0B04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668650.1"
                     /db_xref="GeneID:11498551"
     CDS             complement(1059621..1061435)
                     /gene="NDAI0B04210"
                     /locus_tag="NDAI_0B04210"
                     /inference="similar to DNA sequence:INSDC:YNL103W"
                     /note="similar to Saccharomyces cerevisiae MET4 (YNL103W);
                     ancestral locus Anc_2.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668698.1"
                     /db_xref="GeneID:11498551"
                     /db_xref="UniProtKB/TrEMBL:G0W6P4"
                     /translation="MPTNPAGNTSSPYSIDFISLFGTDTDMDTNNNNMDKDANSKSTD
                     NTTSKNIVNNADIINDQHIISNSLNFSPDFNETPDLLLEQLAYLDNFIPSMENTNSIQ
                     VSKWMGDNNMNNDSTNHMESNITKNNINGSTLSFLEDERLAFELGAFANDTFIFPDEE
                     KINNNNDNNNNNNNNNTESDNIHDSTNNIHNNLQQGDGPSKPITGANRHYLSQKRNHL
                     LESQYDRYKSRCSSKRQKPNNTSFSESITAMNNSPDDTNIFQISDIQGNSKATKISPI
                     STVTSKDSYLFSSSSLSIPRSISTLSNIELPDYSKISTSTLVSTLPKVAIPPSAFNSL
                     LLAGFKPDQIYAISAIMAYHQKQQQNHLNGTNSPSSSSTTAFSSPNNSQNNNTNNNNI
                     GLLLNLLSGTNTNNNHANNKKPSVKIQNNVIRTKGNNSFDSTKETLGKYNEIHKFEEL
                     EGDSSSNDDDHDDDEEEEEEDDDPNFTFDAATLASIFELDIKKKSESKQAIKVEATQE
                     LQVSVKVDREQQLKSIKLEEELPLNDVKIPRTEYEDKKIKEINPHEKRKLRENELKSS
                     IDDLNELSLKLQDRIHKLETENKVLQKLVKASGNINEI"
     gene            <1063010..>1063900
                     /gene="NDAI0B04220"
                     /locus_tag="NDAI_0B04220"
                     /db_xref="GeneID:11498552"
     mRNA            <1063010..>1063900
                     /gene="NDAI0B04220"
                     /locus_tag="NDAI_0B04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668651.1"
                     /db_xref="GeneID:11498552"
     CDS             1063010..1063900
                     /gene="NDAI0B04220"
                     /locus_tag="NDAI_0B04220"
                     /inference="similar to DNA sequence:INSDC:YOR107W"
                     /note="similar to Saccharomyces cerevisiae RGS2 (YOR107W);
                     ancestral locus Anc_2.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668699.1"
                     /db_xref="GeneID:11498552"
                     /db_xref="GOA:G0W6P5"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G0W6P5"
                     /translation="MPFTATTPTLNDILSEMDDADGKIASINVASNSSIRYPYTLEEF
                     YKYLINCHCNENLEFLLATKKFLIPKRQRSSAPASSTEEREQQRQSYIEKFDLNAWNE
                     EVYDQFIDPESPLECNFPQNIKSMFEKCYRDNSIPKQCQILTARQHAATLLLDPYRKF
                     LSYVNTSPIYNNSFTSSEQAITNIHEGDSPDDERSLYSDDSSGDQHGSRHQHNNNNNH
                     DIWTSSSELQRSSSLGTPIECEKKKRGIREIRSKNIGVNLRKSKTYEPQPSSPSRNKF
                     LDSSKRFFSKMKFKSKRNAQ"
     gene            <1064932..>1066773
                     /gene="NDAI0B04230"
                     /locus_tag="NDAI_0B04230"
                     /db_xref="GeneID:11498553"
     mRNA            <1064932..>1066773
                     /gene="NDAI0B04230"
                     /locus_tag="NDAI_0B04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668652.1"
                     /db_xref="GeneID:11498553"
     CDS             1064932..1066773
                     /gene="NDAI0B04230"
                     /locus_tag="NDAI_0B04230"
                     /inference="similar to DNA sequence:INSDC:YNL104C,YOR108W"
                     /note="similar to Saccharomyces cerevisiae LEU4 (YNL104C)
                     and LEU9 (YOR108W); ancestral locus Anc_2.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668700.1"
                     /db_xref="GeneID:11498553"
                     /db_xref="GOA:G0W6P6"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W6P6"
                     /translation="MVKQSFITFAEQASRASRSIKPVQLSYRNMLKDPSSKYRPFPAP
                     KLPQRKWPNNSITKAPRWLSTDLRDGNQSLPDPMSVDQKKEYFHKLVDIGFKEIEVSF
                     PSASQTDFDFTRYAVENAPDDVNIQCLVQSREHLIKRTVEALTGAKRATIHTYLATSD
                     MFRDIVFNMSQEEAVAKAVEATKLVRKLTKDDPSQQATNWTYQFSPECFSDTPVEFAV
                     EICEAVKAAWEPTVENPIIFNLPATVEVATPNVYADQIEYFATHITEREKVCISTHAH
                     NDRGCGVAASELGMLAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVSPKLDFSDI
                     ESVLEVVERCNKIPVSPRAPYGGDLVVCAFSGSHQDAIKKGFALQEKRRAKGDTQWRI
                     PYLPLDPKDIGRDYEAVIRVNSQSGKGGAAWIILRSLGLDVPRNMQIQFSTTVQDTAD
                     SLGRELKSDEITKLFKETYNYNNEEYKYVSLVDYNVEKVDSELRTLTGQVEINGQIVD
                     IKGNGNGPISSLVDALSNLLNVKLAVENYTEHSLGSGSATQAASYVQLRYRNDTDNEL
                     TYKWGIGVSEDVGDSSVRAIFSTVNNIINSGDISVPNVENKKSAASN"
     gene            <1067308..>1070592
                     /gene="NDAI0B04240"
                     /locus_tag="NDAI_0B04240"
                     /db_xref="GeneID:11498554"
     mRNA            <1067308..>1070592
                     /gene="NDAI0B04240"
                     /locus_tag="NDAI_0B04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668653.1"
                     /db_xref="GeneID:11498554"
     CDS             1067308..1070592
                     /gene="NDAI0B04240"
                     /locus_tag="NDAI_0B04240"
                     /inference="similar to DNA sequence:INSDC:YNL106C,YOR109W"
                     /note="similar to Saccharomyces cerevisiae INP52 (YNL106C)
                     and INP53 (YOR109W); ancestral locus Anc_2.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668701.1"
                     /db_xref="GeneID:11498554"
                     /db_xref="GOA:G0W6P7"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G0W6P7"
                     /translation="MNILLSTKPERRIAIVSSSYALVLKSVSEDPTKKPLCAIELVPK
                     EDLKNQGFQKLTTNEVFGFIGLIEINGCLFVGTITGKSRVAQPIPGETVNKIFAVDFF
                     CLNNNTWDFFEIDSSGYPILPETESQEFQEALPKHPCFELRKLLSNGSFYFSSNFDLT
                     STLQNRGFNEHSLSVDNFEDEYMWNSFLMQEIITYRDRLDATAKQVLDDEGFLTTVIR
                     GFAETFITFVKKLKVAITTISKQSWKRAGTRFNARGVDDEANVANFVETEFIMYSNHY
                     CYSFTQIRGSIPVFWEQDTSLINPKVQITRSMEATQPIFDKHFLKSIEKYGPVHIVNL
                     LSTKSSEIELSQRYKDHITNSKKLRMDDNVFWTGFDFHKETAQEGFSAVKRIIPLISE
                     SLLTEGYFSYDVKEKKVLSEQHGIFRTNCLDCLDRTNLVQQTISFFAFRTFLEDFNLI
                     TTNTYIDDDDFVNKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSLAGALSDATKS
                     VSRMYINNFMDKGKQQNIDTLLGRLPHQNAVQLYDPISDYVFSKLEDLSEKFTSYSTI
                     NLLVGTFNVNGATEKADLTKWLFPIGDKFKPDIIVLGLQEVIELTAGSILNADYTKGS
                     FWETMVTECLNKFNEKYLLLRVEQMTSLVILFFVKADKSNNIKQVEGATKKTGFGGMT
                     GNKGAVAIRFEYGNTSFCFVNTHLAAGVNNVDERRTDYENIEKGITFTRSKRIAHHDS
                     IFWLGDMNYRINLSNEEVRREILQKSEGYIDRLLRFDQLSQEIAAGNVFPGFKEPTLK
                     FPPTYKYDHGTNIYDSSEKARTPSWTDRIVYKGENLHPLAYSDAQLLISDHKPVFSAY
                     RAKVISTNEEAKLQLTKQLYIDYKKMHPDETTNLSSQLINLGLEDKELTGRRLSNKSK
                     DISLIDFANDSSESSTPISTLSSKPSSLSISNIIENPTEPQMQRKKPILRPPPPPAAK
                     PLPSRSVTASPSQSNSEIPETKSAHIGVTAAQTNMKTSSETELVRKKPPPGFSDFVLT
                     PKNSSGKGSPLTSSSAVNLVASKPKDEETSTVDEKHEEATEEKKEPSSVLADKTLDTW
                     QPLTPK"
     gene            complement(<1070866..>1071525)
                     /gene="NDAI0B04250"
                     /locus_tag="NDAI_0B04250"
                     /db_xref="GeneID:11498555"
     mRNA            complement(<1070866..>1071525)
                     /gene="NDAI0B04250"
                     /locus_tag="NDAI_0B04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668654.1"
                     /db_xref="GeneID:11498555"
     CDS             complement(1070866..1071525)
                     /gene="NDAI0B04250"
                     /locus_tag="NDAI_0B04250"
                     /inference="similar to DNA sequence:INSDC:YNL107W"
                     /note="similar to Saccharomyces cerevisiae YAF9 (YNL107W);
                     ancestral locus Anc_2.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668702.1"
                     /db_xref="GeneID:11498555"
                     /db_xref="GOA:G0W6P8"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:G0W6P8"
                     /translation="MAPPVSKRIKTLSVRRPIIYGNTAKKLGEVRPENAPAEHTHLWT
                     IFVRGPQNEDITYFIKKVVFKLHETYPNPTRVVETPPFELTETGWGEFDINIKIYFVD
                     EANEKMLSFYHRLRLHPYVIPGPEGQQNPARNITVTENGEIRSTFYDEIVFNEPNEEF
                     FKTLMTKPGNLLPANITENQVFSRQLEQEEIDRIDIGMTKIDEEIKKLRDELTNTIKE
                     T"
     gene            <1071752..>1072858
                     /gene="NDAI0B04260"
                     /locus_tag="NDAI_0B04260"
                     /db_xref="GeneID:11498556"
     mRNA            <1071752..>1072858
                     /gene="NDAI0B04260"
                     /locus_tag="NDAI_0B04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668655.1"
                     /db_xref="GeneID:11498556"
     CDS             1071752..1072858
                     /gene="NDAI0B04260"
                     /locus_tag="NDAI_0B04260"
                     /inference="similar to DNA sequence:INSDC:YNL108C,YOR110W"
                     /note="similar to Saccharomyces cerevisiae YNL108C and
                     TFC7 (YOR110W); ancestral locus Anc_2.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668703.1"
                     /db_xref="GeneID:11498556"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0W6P9"
                     /translation="MAIKTIYIARHGYRSNWLPHGPYPPPPTGIDSDVPLAEHGLQQA
                     RELAHYLLSIENQPELLFTSPFYRCVQTSEPIMNLLEIPMYVDNGIGEWYMPTRPIIP
                     TPANYETLNHFFPGKIQEGWEASIIPSDKGETEDDIFIRCKKFWPIFIDAVEKKFPNV
                     ETILLVTHAATKIALGLNLLKLDSCRDPIDSEGNLIRSGSCSLDKYEVKDVSKDENGE
                     PIEDIPFQKRKWTLTMNGNTEFLRNGEEMNWNFQKNVEAGSDADIKARLNKDKESTGT
                     ANVVAATKDDDQMETVYVSLDLPNKNYRKKSEIPKDAIFQYSGLEQKHPLIKIGSNVY
                     EGTWKNLMALNWPFRMPLVFIRKLLRTMLTVQLH"
     gene            <1073338..>1074123
                     /gene="NDAI0B04270"
                     /locus_tag="NDAI_0B04270"
                     /db_xref="GeneID:11498557"
     mRNA            <1073338..>1074123
                     /gene="NDAI0B04270"
                     /locus_tag="NDAI_0B04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668656.1"
                     /db_xref="GeneID:11498557"
     CDS             1073338..1074123
                     /gene="NDAI0B04270"
                     /locus_tag="NDAI_0B04270"
                     /inference="similar to DNA sequence:INSDC:YOR111W"
                     /note="similar to Saccharomyces cerevisiae YOR111W;
                     ancestral locus Anc_2.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668704.1"
                     /db_xref="GeneID:11498557"
                     /db_xref="GOA:G0W6Q0"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q0"
                     /translation="MLSYYPGLSAERFNKKFQMILGSSSPRRYEILHDEMDFRDIEVR
                     KPNFPEKLDKSKYINRPLEYVKDTAGFKAEEMMEYLEKEEQKPPKKGLPNKIEKVDEI
                     NKVKVVICADTIVIDPNNKIYEKPITESAQLEMLETFCYKFDKPIRVATAVNIIIWEN
                     SEKNMNSAFCKVTELHFDKNIPKTLIEEYVRSGAGLQAAGGFNIQDLNGTIIKKVQRD
                     DDYYNVMGLPILPTYEKIFVLIKLFFQMYPIAQDCKQEDDERY"
     gene            <1074653..>1076869
                     /gene="NDAI0B04280"
                     /locus_tag="NDAI_0B04280"
                     /db_xref="GeneID:11498558"
     mRNA            <1074653..>1076869
                     /gene="NDAI0B04280"
                     /locus_tag="NDAI_0B04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668657.1"
                     /db_xref="GeneID:11498558"
     CDS             1074653..1076869
                     /gene="NDAI0B04280"
                     /locus_tag="NDAI_0B04280"
                     /inference="similar to DNA sequence:INSDC:YOR112W"
                     /note="similar to Saccharomyces cerevisiae CEX1 (YOR112W);
                     ancestral locus Anc_2.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668705.1"
                     /db_xref="GeneID:11498558"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q1"
                     /translation="MNFSSLFKSFSNFQFPYTIEDRPIHETPLWQVFHGTRKSDSLPV
                     TIFKGNRTHENEKLILNAVHKSKVLKIPGLCNVLETFDSDPQSTFIITEHVIPFPWDK
                     LSDLNQNKQSIQLGISQILNTMKILNTFVLGTLTMSNIYLNTKGEWLIFGLELCVKKS
                     EFDANKFISSLELYTLMAKDGRMPSHRGKMIDIDSTLVSKLIENVLGDSQPRDWQPLT
                     TSLSKGQITITEFVEKLHDTQSWFANPLISLYEEFKEFHIKDPEGKLVVMTDVENLFL
                     DSKDSFTNLVPGFLENLIIPELSNMIGLLMAPATNSPFSSPIATNKLISFIAILLSLS
                     FENKIFNNNFNEIIFLSFKLQDRQIRFLLLVYFPKLMNLISDSDASNKIYPHFIQGLT
                     DSDSLLRLQTLKSIPLLTPKLTERQLNNELLRYLAKTQVDQDIEIRTWTIVILTKIAS
                     SLARSTRSNILATAFTKSLKDPDIKPRLASLYGLAKSIDLFEVNTIANKILTVIAPGL
                     LDKEPLVRFKAKNLFEKYLNKLENEAKLLQDENLQVDKSKDIDFDKYESGINVSDSDH
                     VNDEMITQFMNTLRIHSLETNKDLLREISHNQQRRTESATTINNNSNDMNDAFDFDNE
                     DDDNGWNDFNDETDSTDDLTNSQFFNKPVKITKSWNDELNADSKPFVKETPMRLHIKR
                     QPKKTNILNVKTTKPKSGPISHNAKGNVHMPMDKRNGKTSRWEGHSAKMTMGWDSG"
     gene            <1077647..>1080841
                     /gene="NDAI0B04290"
                     /locus_tag="NDAI_0B04290"
                     /db_xref="GeneID:11498559"
     mRNA            <1077647..>1080841
                     /gene="NDAI0B04290"
                     /locus_tag="NDAI_0B04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668658.1"
                     /db_xref="GeneID:11498559"
     CDS             1077647..1080841
                     /gene="NDAI0B04290"
                     /locus_tag="NDAI_0B04290"
                     /inference="similar to DNA sequence:INSDC:YOR113W"
                     /note="similar to Saccharomyces cerevisiae AZF1 (YOR113W);
                     ancestral locus Anc_2.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668706.1"
                     /db_xref="GeneID:11498559"
                     /db_xref="GOA:G0W6Q2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q2"
                     /translation="MNDQEEYTLASKSSHVNDKNKGTSGQLERDPQDTLRKNQHEMNE
                     EMNHHTNKDTTIGMGNDQQILPQYQRQPSQSQPQPQQRNDSISLFANFNQNPRLSTDS
                     SINSYLNISDNNNIPPNTANINGSVSYGSKRPTLPRLSDFSAQTQQQQNPIPDLSQIG
                     RGFSIVNNIWNQQPQPPMSIRRQTNDSNDLFNIPKFKTPSFSSSSTAPGVPSYQDYFS
                     SSASKNPSEKSLPPSKRNSFFLNTTDIPDFEFFNPANIPLPNYQGLPYPPPPQQQQQQ
                     QHQFKFENGNLLIDPRSRRQSSTTMKPPTFIPLPNTKNVNDNNEVMKNSIILPNTNTT
                     NNNDNKTTSGENVMNAMILSRNNSLKFMPEEMNFQYKRRNSSLNDPLFETFTNAGMPT
                     IANNKSTSNIDNGIPYPLKKEPKDNNPRFETIQELSNTEDNVLSNIQTQNSSPNKIVK
                     PQSKPNKIKQELSPTERFFWENENVQDEDIMNEQQKQSSTRFVDKSDTTNPFSFPNKI
                     DESINNNNIKDIKMENGRDSKDLNTRSLLGSTKVDQLMLMIQARKKGVTEVVHTTPDG
                     QLLITNDSHILPSKNELVGGVEKPKVVHEGSKQHECPYCHRLFSQSTHLEVHIRSHLG
                     YKPFQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAHKLTHRDVK
                     PFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLELTSKIAEMNPNETIPEEDRELLEYF
                     ASIYKNSNRGIKGRGKVHSNKTQRNEESNVSPSNDTTEDSFAHDDQKIGATSSRFAEP
                     MQAIPLSTQQKERLDAIINSKGTEVDSQDDQYQFPANINAENLEDSKTKTKPNKRKSG
                     NKTHGKSKSDSITLLPYLQNLNSHMMSHSSSTTNHGNEQQLPQIQPKAHQRSTASSSY
                     NYTTLPHTQINYNVPQSSQDDATTAHFYKNNVTTENPNVVENNGHIPSLPDTSFPFSF
                     SRSGTLTSNINDMINNAGSFVTPPTSSFNNIQDSSKIINDHTLTSDSSNPNINISSVP
                     PADTKTSSHFPLQNASQEQQHSGPISFKNINYKR"
     gene            <1081332..>1083443
                     /gene="NDAI0B04300"
                     /locus_tag="NDAI_0B04300"
                     /db_xref="GeneID:11498560"
     mRNA            <1081332..>1083443
                     /gene="NDAI0B04300"
                     /locus_tag="NDAI_0B04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668659.1"
                     /db_xref="GeneID:11498560"
     CDS             1081332..1083443
                     /gene="NDAI0B04300"
                     /locus_tag="NDAI_0B04300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668707.1"
                     /db_xref="GeneID:11498560"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q3"
                     /translation="MDFKQDYELRDINFDESRSTSPNLRDVPASHYNNTSKFKRFFGL
                     IFRKMLGGSIKTIILRLITLALSIYVIAIISHPSTRTVTIQWIQDNTNSLAQEVASAD
                     QIIDANIAPYFKFKKWNKSPVTNVTLSHKYIDYNTTGFVWNLNVQPATKNEEEISSVS
                     DFNVLNHDSYEKSTNCSSLQYTNTIKYSNWTKYIGDDLVEFRRELLALKNDLTKEVTS
                     DDGASEKKKDPKAPDLSEEEIVKKYWSKFGAAAAWLESEQCYVVYSRVMYWHSGVKKM
                     PHTSLVRAQAFDRNWNEIKGKQIPYIDVKAPSSLEKELASLDKELNLADCDAFLDVNP
                     EAYDDCKVSNAKGTLNAKKRRENILTKHFITYPTMLDVPFNSKVDWAGPEDPRVITRK
                     IDGIDEPIVVFNLPIDDKNQRRMYGIFPHRRVNNIIEFKVPDHKMRYAEKNWTPFFEQ
                     SNQASGTSSFSRGSINFIYSFFPMEIFKCSLDDGICEVVFEGKDLGLSDDASFGGVRG
                     GTQFLPLPDVLPKVEGKQFWFGFPKLHINSCGCGEKFYRPMLSLLVEENGVYHQDLLV
                     PFVDFDMTIPNWEEDGTKCDSINILSPNSIAYWEILDQNKEDSSIADYLALSVSTSDS
                     NSQIIILKGVANYILGVYKKMDIKDTFDVSKESDSIIKQSLNCVIDNAKGECKAYGLL
                     HGESAQETSKKSTPLENKKIR"
     gene            complement(<1083723..>1084544)
                     /gene="NDAI0B04310"
                     /locus_tag="NDAI_0B04310"
                     /db_xref="GeneID:11498561"
     mRNA            complement(<1083723..>1084544)
                     /gene="NDAI0B04310"
                     /locus_tag="NDAI_0B04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668660.1"
                     /db_xref="GeneID:11498561"
     CDS             complement(1083723..1084544)
                     /gene="NDAI0B04310"
                     /locus_tag="NDAI_0B04310"
                     /inference="similar to DNA sequence:INSDC:YOR115C"
                     /note="similar to Saccharomyces cerevisiae TRS33
                     (YOR115C); ancestral locus Anc_2.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668708.1"
                     /db_xref="GeneID:11498561"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q4"
                     /translation="MDPTQVQRQGTDQERIQHQFQLFQESLPKVSHHVYEMLLNEIIP
                     MTVSVENQLEMIASEDTSKGDLKEVPIEKLALEDKEIKEEKSDRISTNYNTNGPLYQS
                     HKMLWELSEMEDEEKCNNISERLRNIGFQLGKKLSELLVFTNNPNLKFKGMDLLMVMK
                     FICRDVWKQIFGKQIDNLKTNHRGTFYLIDYEYRPIQSFSLSETASKMELKLAEPFFE
                     LPLGIIKGVLASLGYFPDDVICLASFIDRPPDRAKNAFSKGVSFHIQVNLKPQKI"
     gene            <1084783..>1086681
                     /gene="NDAI0B04320"
                     /locus_tag="NDAI_0B04320"
                     /db_xref="GeneID:11498562"
     mRNA            <1084783..>1086681
                     /gene="NDAI0B04320"
                     /locus_tag="NDAI_0B04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668661.1"
                     /db_xref="GeneID:11498562"
     CDS             1084783..1086681
                     /gene="NDAI0B04320"
                     /locus_tag="NDAI_0B04320"
                     /inference="similar to DNA sequence:INSDC:YHR114W"
                     /note="similar to Saccharomyces cerevisiae BZZ1 (YHR114W);
                     ancestral locus Anc_2.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668709.1"
                     /db_xref="GeneID:11498562"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q5"
                     /translation="MSAQLSIGNELKDSFQQTHKWVENNIKWLKELEQFYRERSKLEK
                     EYSEKLTRLSSEYFTKKSSSSVPLSVGDTPATTPGSLEAAGIVAWNEVLAQTEMISKD
                     HNKLAQDFDTQVANQLSGLHSKLDMTLVKIAGFNGEIQGKRDNAYQAMEKAKKNYDDA
                     CQSMELTRSKYTKSSNERNERKLAEKETAMNVSKNDYLIKISLANRLKDKYYFQDIPE
                     ALDLLQDLNEARILFLNDIWKTATAVERDAGARITKRVDTVDGVVAQNMPHLSTAMYI
                     KHNLKQWKEPADFQYKPSPVWHDDENFIVKSNTEVQELKIKLAKSEQDYNKFQDMTQA
                     ERSKLASLNKTKQALKSNENAIDSNKFYENLKSYLSLISPFTSHETLKLEAEVTIESI
                     QNNVPQEYDLSTDNIDVSKQKHKSGFFSKFKQNLLNPDNKPKRTSMNIHSGSSNRISI
                     FGSQKRPTSSAGGSEDVASNDVDDLSSNYTTTTSGATSSRTGIKKNKVLYAYAKQDTD
                     EISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVKITENVAVDGGHGNGHAP
                     AVPPPRRTTMPSRTLTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKG
                     LVPTSYCK"
     gene            <1087146..>1087529
                     /gene="NDAI0B04330"
                     /locus_tag="NDAI_0B04330"
                     /db_xref="GeneID:11498563"
     mRNA            <1087146..>1087529
                     /gene="NDAI0B04330"
                     /locus_tag="NDAI_0B04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668662.1"
                     /db_xref="GeneID:11498563"
     CDS             1087146..1087529
                     /gene="NDAI0B04330"
                     /locus_tag="NDAI_0B04330"
                     /inference="similar to DNA sequence:INSDC:YHR116W"
                     /note="similar to Saccharomyces cerevisiae COX23
                     (YHR116W); ancestral locus Anc_2.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668710.1"
                     /db_xref="GeneID:11498563"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q6"
                     /translation="MSTTSEANKTSGKVTPITSQTESRTPPRKEQQNTTKDTVNFTPD
                     EKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRNNFDRDKCHE
                     YFDAYRECKKQWLMARRNNRSQWQK"
     gene            <1087851..>1089845
                     /gene="NDAI0B04340"
                     /locus_tag="NDAI_0B04340"
                     /db_xref="GeneID:11498564"
     mRNA            <1087851..>1089845
                     /gene="NDAI0B04340"
                     /locus_tag="NDAI_0B04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668663.1"
                     /db_xref="GeneID:11498564"
     CDS             1087851..1089845
                     /gene="NDAI0B04340"
                     /locus_tag="NDAI_0B04340"
                     /inference="similar to DNA sequence:INSDC:YHR117W,YNL121C"
                     /note="similar to Saccharomyces cerevisiae TOM71 (YHR117W)
                     and TOM70 (YNL121C); ancestral locus Anc_2.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668711.1"
                     /db_xref="GeneID:11498564"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q7"
                     /translation="MSGNDNPSSFKNFFINHRKLIITTITAGTAAFGAYYYYNQLQKL
                     QPSGSISKETAGSTEKNTKNHDTINNDLNTSSPPPPISKSKKKKLKKKLKKNHQKTDE
                     NNNNNNNSQSTSSASSSNSASPILKPSYPLDSQNDPDFNEINKLIANNENLKSKFAKE
                     LKNKGNQYFKSKDNENAIKYYEYALRLDQDPVFYSNISACYFAMNQLDKVIESSNKAL
                     ELKPDYSKALLRRANAYEALGNNKEALYDFSILSLFGEYSGQYLEPLLNRILDKVSTD
                     VLRAKLDNKKTDNFILLSDSALVSFFGIFPPETTITNYNPDDEADKELVQGLEALAKK
                     TSEGFLDADKHFIKANELFMEKLLSSEDNDENSGLLEKVAIALEYSGVFKFLKFDLLG
                     SETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYFKYFDKATTLNPNFAPTYYHR
                     GQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYYNSTFKKCQELFDEARTKF
                     PTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIHVGIAPLIGKAAALARIP
                     TQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAIALFEETADLARTYQD
                     KLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII"
     gene            complement(<1089949..>1091286)
                     /gene="NDAI0B04350"
                     /locus_tag="NDAI_0B04350"
                     /db_xref="GeneID:11496191"
     mRNA            complement(<1089949..>1091286)
                     /gene="NDAI0B04350"
                     /locus_tag="NDAI_0B04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668664.1"
                     /db_xref="GeneID:11496191"
     CDS             complement(1089949..1091286)
                     /gene="NDAI0B04350"
                     /locus_tag="NDAI_0B04350"
                     /inference="similar to DNA sequence:INSDC:YHR118C"
                     /note="similar to Saccharomyces cerevisiae ORC6 (YHR118C);
                     ancestral locus Anc_2.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668712.1"
                     /db_xref="GeneID:11496191"
                     /db_xref="GOA:G0W6Q8"
                     /db_xref="InterPro:IPR008721"
                     /db_xref="InterPro:IPR016811"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q8"
                     /translation="MSNQQIIRSLRDILNLTEKGEQDWNHGDMKKLVSATGTLYASSV
                     NKIALKPDEETARYHICAFIAAEKLHEKYSPDLKFSTNNIPLEPKKVRHLLQIFKNTI
                     FQSSPVKNISWTPSPKKKRNDKNSPVKDNGRFTAKDPKQLRKELFGAPTKVTPSKNVP
                     SLSNSPTKSSTNDDDSPTKVRRKLAFEEDSGDDENNAIQASDKDRVVNAINNKEYTTD
                     DNTDGEEEGEEQYNNDEGFETANEDTPSRVDADDNDVEESPERLIKRRKRSPNKKTGR
                     PYSKMCLLSRKYYKVKPIEVIELCNQFELPQDVAYNVLEQYMSYASYLVCPWQLVCGL
                     VMNCVFVVFNEKRRQDPRIDHRIIERICLLMKADNYDDVSECIKIVKELIIGERWFRD
                     LQIKHNCFEGGSYEEVISVKLGSMFQPNKSLVSDEQYENWLNKVKQDIDLRDN"
     gene            <1091754..>1095071
                     /gene="NDAI0B04360"
                     /locus_tag="NDAI_0B04360"
                     /db_xref="GeneID:11496192"
     mRNA            <1091754..>1095071
                     /gene="NDAI0B04360"
                     /locus_tag="NDAI_0B04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668665.1"
                     /db_xref="GeneID:11496192"
     CDS             1091754..1095071
                     /gene="NDAI0B04360"
                     /locus_tag="NDAI_0B04360"
                     /inference="similar to DNA sequence:INSDC:YHR119W"
                     /note="similar to Saccharomyces cerevisiae SET1 (YHR119W);
                     ancestral locus Anc_2.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668713.1"
                     /db_xref="GeneID:11496192"
                     /db_xref="GOA:G0W6Q9"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR017111"
                     /db_xref="InterPro:IPR024636"
                     /db_xref="InterPro:IPR024657"
                     /db_xref="UniProtKB/TrEMBL:G0W6Q9"
                     /translation="MSGYYGHSNPHHPPGPYRYRNNATNNRYQRPEPIRPTPAISRYQ
                     TDSEQSASRYNSINGNGATQHRQSRYPPSQHHSHNTRYDQTRQPVDNQSYHPTNTSYA
                     RTLREGTTKPWVRSSSYSKQESRYGNEKPLHTSSRLSNPLPKRTLSMTSKGDLRPKPE
                     LRYAEDPALNNKYHYFNPTLKTLINKDEMHHWNAKKKFPQMGYITVQDPIQQKQVLVS
                     RIPDIKSRDPRSTKEHGPSSHRKLREELTLTSRVPFDKFSVGPPPICELVIYPADDTN
                     ITTIQDISIKNYFRKFGTISHFESFSDPNSALPLHIYLIKYTSPNDKLNNLDLPGKSA
                     YEAVKDFNKKECLILGHHFNVILNKGKILQTIKDKTIDENLKKVNALNKDKLPATPTS
                     KASLDSTIPDKPITSKWLDRRLPNDLVRIVNNKACLFVPKTFLFFHGFRIEDFKYKLR
                     RYRYSRVLNHATGIYIVFNDLKECQNCRNIESGKLTLLSRKLHAPIEIKFVLIPPVDT
                     LPTRFGGFDRTSSVTNTSSKGTTTIVKTYNTRTELLEATVQYILEDLSKAINIDIKRR
                     LIGPTVFDTLNPSNYPALMEEKKLRERESKKAAIEEAERKKKEEVKTQDFDIFKLYGG
                     YSRSNLKKRRYSQVSSDNISSISSTNKKRLTKGIKPMAHILNEDTGSKETTPTIELSQ
                     GVEGYDDIEELASSASSSEDENELLEEDEDIEMKSESELTSPEPIHGQKIAIEAATAE
                     VEQEDIIPEWYKPSMAEYPETVFPESPAIFKKSIDILDFQEVIKDTEDISILQELLDA
                     NETKPTEEMKHAGCISEYAIWKYRENEKNLRLTNEWHLNLNEVPFDVELTKGKGSFKA
                     EGFRKIPDNLKACYLPHRRKLNQPLNTVNQHGSDRPTGNKFTPEPSARREESNDPDAS
                     ESVSIQEISSSRDNRASNRRFQQNIEAQRAAIGAESDLLSLNQLNKRKKPVTFARSAI
                     HNWGLYALEPIAAKEMIIEYVGESIRQAVAEMRERRYLKNGIGSSYLFRVDENNVIDA
                     TKKGGIARFINHCCDPSCTAKIIKVGGRRRIVIYALRDIAANEELTYDYKFEREIDAE
                     ERLPCHCGSVNCKGFLN"
     gene            <1095356..>1098220
                     /gene="NDAI0B04370"
                     /locus_tag="NDAI_0B04370"
                     /db_xref="GeneID:11496193"
     mRNA            <1095356..>1098220
                     /gene="NDAI0B04370"
                     /locus_tag="NDAI_0B04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668666.1"
                     /db_xref="GeneID:11496193"
     CDS             1095356..1098220
                     /gene="NDAI0B04370"
                     /locus_tag="NDAI_0B04370"
                     /inference="similar to DNA sequence:INSDC:YHR120W"
                     /note="similar to Saccharomyces cerevisiae MSH1 (YHR120W);
                     ancestral locus Anc_2.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668714.1"
                     /db_xref="GeneID:11496193"
                     /db_xref="GOA:G0W6R0"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6R0"
                     /translation="MSCVKWYRQLCTRVYVRYNHSEQRIIRKPQITKLPISFNNPPRP
                     ISTDTSSGLAEIDKPKSLEKTSDDHSANGTIQNLSPTLRYVRKLMDEHKDNVVLTQIG
                     SFYELYFEQATKYAPKLNISLTSKTLSQGKIPFAGFPVPQLGRHLKVLVNDYGYSVTI
                     ADQFPKNEIADNEQYKFVRRVTRIVTPGTFIDDAFENFQENTYLLNVEFPGNCMKHIA
                     DPSLKIGLSWCDISTGEIFVQQVLLRDLVSSITRIKPKEILLNDDLIPFNILSGQWYP
                     ELVELKKYFVKYQKLPAQHRTIETFSNLFTSGTTKLARKQLMIQLQTFTQKEIVALRN
                     LLIYISDHLPHFSTNLQVPQRQLTTSIMQIDSRTSTALELHSTVRNNSRKGTLLSSIR
                     RTATPSGTRLLTQWLSGPSLALTEITNRQKLVSFFKDNPDISGNVLTMLKKTYDLTRI
                     LQKFSFGRGEALELIQLAQSLQMCNGISDYILSNLSSLQLKKTVRDLLQGLANSLLFD
                     KEYLANVLENLNEEELINLQTQEEREGDPYLNNEASTGTNSSFPLSVNVVKPSFSKKL
                     QNLHDDYKKLLSEKTSLEKTYNDVFVSLGARHVLLKKKQNNDFALHITGSPSNLKKVN
                     EYINSCSKINDSTFVSLQQSNQTRWVSHKSWTDLGYKLDLGELKIKKEESFIMDTFKN
                     RFIENSDIIRKVSYSLGYLDVMLSFASLAKEKNLVCPKLDNSTKLEIIGGRHLMVEEG
                     LSLNSLNKFVLNDCILSGGELWVVTGPNMGGKSTFLRQNAIIVILAQIGCFVPCARAH
                     IGLVDKIFSRVGSADDLYNEMSTFMVEMVETSFILRGATEKSLAILDEIGRGTSGKEG
                     VSIAYATAKYLIWNNSCRSLFATHFGTELKKIIDEQKDKAISDSVSFYRSGIIELGKG
                     EFIYDHKLRSGICQKSDAIKVARTAGFPEEALEEAIKLLQ"
     gene            <1098856..>1099536
                     /gene="NDAI0B04380"
                     /locus_tag="NDAI_0B04380"
                     /db_xref="GeneID:11496194"
     mRNA            <1098856..>1099536
                     /gene="NDAI0B04380"
                     /locus_tag="NDAI_0B04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668667.1"
                     /db_xref="GeneID:11496194"
     CDS             1098856..1099536
                     /gene="NDAI0B04380"
                     /locus_tag="NDAI_0B04380"
                     /inference="similar to DNA sequence:INSDC:YHR122W"
                     /note="similar to Saccharomyces cerevisiae YHR122W;
                     ancestral locus Anc_2.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668715.1"
                     /db_xref="GeneID:11496194"
                     /db_xref="UniProtKB/TrEMBL:G0W6R1"
                     /translation="MSEFINENPDVIDSDELPSRKENITGDLLLSGISNETTLQRKKL
                     LLSIDNSKSKVLQNIELLDKLLLINPPELTSDEESIEESDDEDDAYGNTDPKDVVDTQ
                     EIYDLTAHISDPEHPLSLGQLSIVNLPDIEVHDCGDPNKMVEVIIRITPTITHCSLAT
                     LIGLGIRVRLERALPPRFRITILLKKGTHNSENQVNKQLNDKERVAAACENEQLLGVV
                     SKMLLTCK"
     gene            <1100175..>1101221
                     /gene="NDAI0B04390"
                     /locus_tag="NDAI_0B04390"
                     /db_xref="GeneID:11496195"
     mRNA            <1100175..>1101221
                     /gene="NDAI0B04390"
                     /locus_tag="NDAI_0B04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668668.1"
                     /db_xref="GeneID:11496195"
     CDS             1100175..1101221
                     /gene="NDAI0B04390"
                     /locus_tag="NDAI_0B04390"
                     /inference="similar to DNA sequence:INSDC:YHR123W,YNL130C"
                     /note="similar to Saccharomyces cerevisiae EPT1 (YHR123W)
                     and CPT1 (YNL130C); ancestral locus Anc_2.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668716.1"
                     /db_xref="GeneID:11496195"
                     /db_xref="GOA:G0W6R2"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:G0W6R2"
                     /translation="MAPNVITLLGLSFILMNSLTVLYYDPYLNEASPRWVYFSYAIGL
                     FLYQTFDGCDGVHARRTGQSGPLGELFDHSIDAVNTSLSFFVFCSAAALGYSPKMIIC
                     QFFLLCNFYVSTWEEYHTHKLFLSEVSGPVEGILCICLSFLITGFFSSQFWHITLMNL
                     QFGNNMIDIEVLDLFLLSLCIGIIFNIAAARENIRKYYENEKTNTLVGNNTEPFTEYD
                     ALKGLLPFFIYYISVFVLIMIDTEFVSFPLFISIGFSVAFVVGRIIVAHLTKQYFPYI
                     NFPMFIPSVQLILYLITVRMLGYDPSKITFALTWFGLGSSVGIHAMFMNEIIYEFTTF
                     LDVWALSVKHSKYT"
     gene            <1101632..>1103686
                     /gene="NDAI0B04400"
                     /locus_tag="NDAI_0B04400"
                     /db_xref="GeneID:11496196"
     mRNA            <1101632..>1103686
                     /gene="NDAI0B04400"
                     /locus_tag="NDAI_0B04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668669.1"
                     /db_xref="GeneID:11496196"
     CDS             1101632..1103686
                     /gene="NDAI0B04400"
                     /locus_tag="NDAI_0B04400"
                     /inference="similar to DNA sequence:INSDC:YHR124W"
                     /note="similar to Saccharomyces cerevisiae NDT80
                     (YHR124W); ancestral locus Anc_2.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668717.1"
                     /db_xref="GeneID:11496196"
                     /db_xref="GOA:G0W6R3"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:G0W6R3"
                     /translation="MTRFCKRAPNRDFRNITETGERKEKKIIKKLSVSSQEKEEVNNS
                     KRINESVEEQKVDEETVAESMIMTCVNDDGTTSNYFDKRKLKIAPRSTLQFKIGPPFE
                     LFRKYYKIYDKTTDKIVDFHMIPRIDRGFDHIDNEWVGYKRNYFTLVSAFGVADYGLK
                     EFLNGSYLLHLQDSFNDERLDVEYFAMIIKARNDDDSNEIPLVQHTAKRDKGPQFSPK
                     ICPLIPSHLPQHQIIREASNVRNSVKMKKYDSTFYFHRDREKNQFSKNSLLFSYPKDC
                     IEKVARYERVQFSSSISVKKPSQQNKHFRLHVIFGAVTCLPFINQFERPDSFDKLTMD
                     DGRQGYFIQLQEMRTPPLIIRGRSPSNYTNPKQQHFQSQTSQILYSNGSSKHLSQDLE
                     QGTPTLENHIMVSKANKTKPPKRQKTRKLASPSPLISKPVEFRRPTKRESKVVTLPKN
                     MNKDKKSFPRPHIRVETIENIENRLYAGTSSQLSAAAEIQNLYSNNGSPKLERPNQER
                     HISVDLRDIELKPSYTPLSFPIPMVDKKGTIMDNKNFEIESGPKMLVERDLNKEIKSK
                     RTIQNKNHLPKCRELSREDVTLSNISSFSFLFEKSDVTGKPLAQEKSEISFNVIPRLS
                     AGSSESNNQPFIKDKSMSFEMPRMLLKENMKLNLWNAFNILPSEILSAGNFLEDDSFY
                     NH"
     gap             1104326..1104849
                     /estimated_length=524
     gene            complement(1105280..1105335)
                     /gene="NDAI0Btrna9F"
                     /locus_tag="NDAI_0Btrna9F"
                     /db_xref="GeneID:11497978"
     tRNA            complement(join(1105280..1105316,1105280..1105335))
                     /gene="NDAI0Btrna9F"
                     /locus_tag="NDAI_0Btrna9F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11497978"
     gene            <1108144..>1108770
                     /gene="NDAI0B04410"
                     /locus_tag="NDAI_0B04410"
                     /db_xref="GeneID:11496188"
     mRNA            <1108144..>1108770
                     /gene="NDAI0B04410"
                     /locus_tag="NDAI_0B04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668670.1"
                     /db_xref="GeneID:11496188"
     CDS             1108144..1108770
                     /gene="NDAI0B04410"
                     /locus_tag="NDAI_0B04410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668718.1"
                     /db_xref="GeneID:11496188"
                     /db_xref="InterPro:IPR022036"
                     /db_xref="UniProtKB/TrEMBL:G0W6R4"
                     /translation="MTTDKSITHPITWKQVNDYVSKNELYNLRRSPEQTLKYHKHRDS
                     LKGINVTEFILQKLHWNLDELENLNSIKFKTDDEKTKACFSNSSLYQVTLNDFPYFFE
                     PNVVHLLVWSKIRIPMYKNDETEKHEEVDHIPEVNGTMKNNVETFLEGILTDKYHISK
                     DNYCWFMNYTKLQSIRSISHLHVLIRLEDIKDEHDKNVFVENLMNNFK"
     gene            complement(<1108991..>1109875)
                     /gene="NDAI0B04420"
                     /locus_tag="NDAI_0B04420"
                     /db_xref="GeneID:11496198"
     mRNA            complement(<1108991..>1109875)
                     /gene="NDAI0B04420"
                     /locus_tag="NDAI_0B04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668671.1"
                     /db_xref="GeneID:11496198"
     CDS             complement(1108991..1109875)
                     /gene="NDAI0B04420"
                     /locus_tag="NDAI_0B04420"
                     /inference="similar to DNA sequence:INSDC:YHR126C"
                     /note="similar to Saccharomyces cerevisiae YHR126C;
                     ancestral locus Anc_2.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668719.1"
                     /db_xref="GeneID:11496198"
                     /db_xref="UniProtKB/TrEMBL:G0W6R5"
                     /translation="MKSVFATIAFLSVIPTGSIAQALNSTISSNSLPNADYKPFHLEF
                     DQDSIASLQKSLNVTNSVLNGPLPLRTIPTEDDKSVKFIIDLFNKTASTSPSIFKLSS
                     DGALLTEQEEGVLLSDVSNITSFEETLKGFNITQDGILSFNGSNFWTIVSNLPDFTIA
                     PVTDGTIIDTQMFSLKAVLDEEKLEKREEKISFEDIVNWNNTLLTDRNKTSNGINNDK
                     FQYRREDNVTNEHVLFGHVKKDSNVVQICDGQVQAGNSSNVMPNASSVSIMVSDSAAM
                     QKGVSLFTVFSLLMFAFI"
     gap             1111265..1111284
                     /estimated_length=20
     gene            <1111300..>1111866
                     /gene="NDAI0B04430"
                     /locus_tag="NDAI_0B04430"
                     /db_xref="GeneID:11496199"
     mRNA            <1111300..>1111866
                     /gene="NDAI0B04430"
                     /locus_tag="NDAI_0B04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668672.1"
                     /db_xref="GeneID:11496199"
     CDS             1111300..1111866
                     /gene="NDAI0B04430"
                     /locus_tag="NDAI_0B04430"
                     /inference="similar to DNA sequence:INSDC:YHR127W"
                     /note="similar to Saccharomyces cerevisiae YHR127W;
                     ancestral locus Anc_2.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668720.1"
                     /db_xref="GeneID:11496199"
                     /db_xref="UniProtKB/TrEMBL:G0W6R6"
                     /translation="MNQTKENNHLEIRVRNDNRNKSNNSNSYRDSNDSDDDLRVLSTN
                     VIQKRQPRRIITRKSAFSNNNDGAKQGTAMVDLTTDIEHGYDSNNNLVISTNTNAADR
                     VLVLYNLTLGVNAGNLKAVLQRLSNVKIAHVRVKDLPSGSATANVWLLHPTMEELERV
                     RKIFHGALVDGRTIQVLIASSSAKSFSY"
     gene            complement(<1112119..>1112835)
                     /gene="NDAI0B04435"
                     /locus_tag="NDAI_0B04435"
                     /db_xref="GeneID:11496200"
     mRNA            complement(<1112119..>1112835)
                     /gene="NDAI0B04435"
                     /locus_tag="NDAI_0B04435"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668673.1"
                     /db_xref="GeneID:11496200"
     CDS             complement(1112119..1112835)
                     /gene="NDAI0B04435"
                     /locus_tag="NDAI_0B04435"
                     /inference="similar to DNA sequence:INSDC:YNL148C"
                     /note="similar to Saccharomyces cerevisiae ALF1 (YNL148C);
                     ancestral locus Anc_2.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668721.1"
                     /db_xref="GeneID:11496200"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:G0W6R7"
                     /translation="MMQIQINSELCSAVKDFPTDIKLGDLCHKIYQITGIEPNEMKLH
                     LNNGIKDVETIDRPLATSDCLILDGTFDTIIVEDTNSESITNQLKNKTTDDVEFKLSE
                     DDYKRRSDTALQWKRENKYGRFNPEYVGRLKKERALRDAKIETLKLNERCSVKTPDQP
                     ERRGWLRFIGKIPDINKEDIWCGIEFDEPLGKNNGSFSGKVYFGPTKDNYGGFIKPIH
                     VESGKQYTPFSDFEQSDDEI"
     gene            <1113180..>1113681
                     /gene="NDAI0B04440"
                     /locus_tag="NDAI_0B04440"
                     /db_xref="GeneID:11496201"
     mRNA            join(<1113180..1113191,1113328..>1113681)
                     /gene="NDAI0B04440"
                     /locus_tag="NDAI_0B04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668674.1"
                     /db_xref="GeneID:11496201"
     CDS             join(1113180..1113191,1113328..1113681)
                     /gene="NDAI0B04440"
                     /locus_tag="NDAI_0B04440"
                     /inference="similar to DNA sequence:INSDC:YNL147W"
                     /note="similar to Saccharomyces cerevisiae LSM7 (YNL147W);
                     ancestral locus Anc_2.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668722.1"
                     /db_xref="GeneID:11496201"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:G0W6R8"
                     /translation="MSETTKAQHQQQQPSQQQQRKKFEGPKRDAIVDLSKYKDSKVRV
                     KLMGGKIVTGILKGYDQLMNLVLDETIDYLKNPDDEIGTASLKNKSRSLGLTVVRGPL
                     LVSLSPIDGSEVIYMQNND"
     gene            <1114629..>1115279
                     /gene="NDAI0B04450"
                     /locus_tag="NDAI_0B04450"
                     /db_xref="GeneID:11496202"
     mRNA            <1114629..>1115279
                     /gene="NDAI0B04450"
                     /locus_tag="NDAI_0B04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668675.1"
                     /db_xref="GeneID:11496202"
     CDS             1114629..1115279
                     /gene="NDAI0B04450"
                     /locus_tag="NDAI_0B04450"
                     /inference="similar to DNA sequence:INSDC:YHR128W"
                     /note="similar to Saccharomyces cerevisiae FUR1 (YHR128W);
                     ancestral locus Anc_2.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668723.1"
                     /db_xref="GeneID:11496202"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G0W6R9"
                     /translation="MSTEPYKNVYLLPQTNQLLGLYSIIRDKSTARPDFIFYSDRIIR
                     LLVEEGLNHLPVTRKNVDTHTNEVFRGVAFKGKICGVSIVRAGESMEQGLRDCCRSVR
                     IGKILIQRDEETALPKLFYEKLPEDIEDRYVFLLDPMLATGGSAIMATDVLIKRGVKP
                     ERIYFLNLICSKEGIDKYHAAFPDVKIVTGALDRGLNEQKYLVPGLGDFGDRYYCI"
     gene            complement(<1115478..>1116623)
                     /gene="NDAI0B04460"
                     /locus_tag="NDAI_0B04460"
                     /db_xref="GeneID:11496203"
     mRNA            complement(<1115478..>1116623)
                     /gene="NDAI0B04460"
                     /locus_tag="NDAI_0B04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668676.1"
                     /db_xref="GeneID:11496203"
     CDS             complement(1115478..1116623)
                     /gene="NDAI0B04460"
                     /locus_tag="NDAI_0B04460"
                     /inference="similar to DNA sequence:INSDC:YHR129C"
                     /note="similar to Saccharomyces cerevisiae ARP1 (YHR129C);
                     ancestral locus Anc_2.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668724.1"
                     /db_xref="GeneID:11496203"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:G0W6S0"
                     /translation="MNHNDIIYNQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKY
                     DKIMITGQLENLDKYIGNRAQSIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNV
                     QNIEEHPLLITEAPLTIEKQRHIMCERLFETFNIPSLYVANPSVLSLYASGNTTGCVV
                     DCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSSNEKEIVR
                     TIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLPDGKELTLNKERFRSPEVLFNPQLM
                     GLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRLLGDLQELTNNRA
                     KIKILAPPERKYTSWIGGSILTGLSTFKNLWVTKSDWEESSGQKSFF"
     gene            <1118223..>1118327
                     /gene="NDAI0B04470"
                     /locus_tag="NDAI_0B04470"
                     /db_xref="GeneID:11496204"
     mRNA            <1118223..>1118327
                     /gene="NDAI0B04470"
                     /locus_tag="NDAI_0B04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668677.1"
                     /db_xref="GeneID:11496204"
     CDS             1118223..1118327
                     /gene="NDAI0B04470"
                     /locus_tag="NDAI_0B04470"
                     /inference="similar to DNA sequence:INSDC:YNL145W"
                     /note="similar to Saccharomyces cerevisiae MFA2 (YNL145W);
                     ancestral locus Anc_2.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668725.1"
                     /db_xref="GeneID:11496204"
                     /db_xref="UniProtKB/TrEMBL:G0W6S1"
                     /translation="MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA"
     gene            complement(<1118684..>1121062)
                     /gene="NDAI0B04480"
                     /locus_tag="NDAI_0B04480"
                     /db_xref="GeneID:11496205"
     mRNA            complement(<1118684..>1121062)
                     /gene="NDAI0B04480"
                     /locus_tag="NDAI_0B04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668678.1"
                     /db_xref="GeneID:11496205"
     CDS             complement(1118684..1121062)
                     /gene="NDAI0B04480"
                     /locus_tag="NDAI_0B04480"
                     /inference="similar to DNA sequence:INSDC:YHR131C,YNL144C"
                     /note="similar to Saccharomyces cerevisiae YHR131C and
                     YNL144C; ancestral locus Anc_2.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668726.1"
                     /db_xref="GeneID:11496205"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0W6S2"
                     /translation="MRYPTTFVSPFFVTITSKMSLFLPIQEGITQSTASDTINIERLK
                     SPTSSSSISEIESESQQDQDQEEEEREDGDSVTVSSSNKTASIFNPIVVNSPLPGSNN
                     KKKNMFLSKFSNCNNKNNNTTQQARIKGENSTTKLTTTSLSSEQKVIFADENNDFLKY
                     LDLKPVKPPKYNEMNPNKMIRFPIYEHTIPCNINDLPPNYTPTVDQITLISLKLEWNS
                     PYDISNSRNWKNFIMEINSTQLNFYHIDPSLTNHIRHYYNGYSSSNGSHSFSLTKTNS
                     LYQFTKTDQEQIIFNIKRDKLKYLSSNTLYKSYTLQFATFGIPVDYKKKCFVLRLRCE
                     TQQFLINFSHVDDMIDWTVHLNTGISVALDLDARQLPDYRIVPRRRRRRRHRRCRHHR
                     HGHKHSHRTNNSRQYSSSNDNNNAMPTYKTLIPDLLNLSITDDFTNSMRNYGTVQQTN
                     VSNNNNDIVGRNRSASLNAYTSQRSQLNLKSKIRNFFRSSSSSRFNSKIRTTLPLSCV
                     REEEIVQEYTTNTTITATTRTTRTTTTTSRLRSHTMNIETSNSNSETLPSKSCENMLR
                     MHDMSFQRELDEFRQVIEEHNESNHDDYDEEEEEEEDDDDDDDDEPPNIYEDEEDNDD
                     DRALHEPSNENPIYNNEEIYPSDGEYEDEDDNYEYTSTMQSNSSFRQRAASTASCLSN
                     IPYGSNDIKWAPFPKQMSRRRYIRDSIRCIKPLLEDSEWVGNVVLRPITPPKFKTNNQ
                     MLSSLQHNNNNNNNNPCSGTRNDLNKVKNHYLKSYIVGPAGFLKADPKTPHT"
     gene            complement(<1122098..>1123441)
                     /gene="NDAI0B04490"
                     /locus_tag="NDAI_0B04490"
                     /db_xref="GeneID:11496206"
     mRNA            complement(<1122098..>1123441)
                     /gene="NDAI0B04490"
                     /locus_tag="NDAI_0B04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668679.1"
                     /db_xref="GeneID:11496206"
     CDS             complement(1122098..1123441)
                     /gene="NDAI0B04490"
                     /locus_tag="NDAI_0B04490"
                     /inference="similar to DNA sequence:INSDC:YHR132C"
                     /note="similar to Saccharomyces cerevisiae ECM14
                     (YHR132C); ancestral locus Anc_2.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668727.1"
                     /db_xref="GeneID:11496206"
                     /db_xref="GOA:G0W6S3"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:G0W6S3"
                     /translation="MHFLSVFIPLSHLLITSWAQSEHSITSTGKLRAYDQYNIIRFHS
                     NNITHVLKDVIQPMTNDYDIWTRNTEFIDIKLLKTIKIPNSNEYSHEIIINDINSLIE
                     ETYDSSLGNNDQENIFDVSLKMNNNNNDFFYFKQYHPLQSIYLWLDLMKSTFPNLVTI
                     ENIGTTFENEPLKVVHISSNNSSMNPKNKTILITGGIHAREWISISTTLFTIYQLLTK
                     YGASKRETKYIDSLNFLIIPIFNPDGYKYTWTNDRLWRKNRQETYMSNCQGIDLDHSF
                     GYKWDNNFEFPCSEEYSGQYPMEALEVKHWDTFINDITTRGVHIYGFLDLHSYSQDII
                     YPYAYSCDELPRDYENLLELSYGLSKAIRNKSGKNYKVVAACKDRGSDLNPKLGSGTA
                     LDYMYHNKAYWAFQLKLRDTGNHGFLLPPKYILPVAKETYAAIKYFCDFILNPEI"
     gene            <1124239..>1124691
                     /gene="NDAI0B04500"
                     /locus_tag="NDAI_0B04500"
                     /db_xref="GeneID:11497610"
     mRNA            <1124239..>1124691
                     /gene="NDAI0B04500"
                     /locus_tag="NDAI_0B04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668680.1"
                     /db_xref="GeneID:11497610"
     CDS             1124239..1124691
                     /gene="NDAI0B04500"
                     /locus_tag="NDAI_0B04500"
                     /inference="similar to DNA
                     sequence:INSDC:YHR132W-A,YNL157W"
                     /note="similar to Saccharomyces cerevisiae YHR132W-A and
                     YNL157W; ancestral locus Anc_2.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668728.1"
                     /db_xref="GeneID:11497610"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:G0W6S4"
                     /translation="MSIQRGKMAEEQLSPTTSRVDLNNLAKTKDKDGNIVDLTNLTPQ
                     ELKLFKMYGKLPSKKDLLKHKMQERKYFDSGDYALRQAGVIKNNDVISNSNNNLPVTD
                     PSRLRESIIRRRLSNSSPNNSNSDNNSIERKGSISSGPPLSKSKSPIR"
     gene            complement(<1125143..>1126126)
                     /gene="NDAI0B04510"
                     /locus_tag="NDAI_0B04510"
                     /db_xref="GeneID:11497611"
     mRNA            complement(<1125143..>1126126)
                     /gene="NDAI0B04510"
                     /locus_tag="NDAI_0B04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668681.1"
                     /db_xref="GeneID:11497611"
     CDS             complement(1125143..1126126)
                     /gene="NDAI0B04510"
                     /locus_tag="NDAI_0B04510"
                     /inference="similar to DNA sequence:INSDC:YHR133C,YNL156C"
                     /note="similar to Saccharomyces cerevisiae NSG1 (YHR133C)
                     and NSG2 (YNL156C); ancestral locus Anc_2.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668729.1"
                     /db_xref="GeneID:11497611"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:G0W6S5"
                     /translation="MGKKSKKKTTSSTSSLGGSTGDKQPKQQQNIKKMRSTDSMVNLT
                     KPALASFYSTDIIKDTEDKASSLYKRSNLEKLKKKWAKSHGKSINDDDYDDDEVDEYY
                     NDDLDFIKQRKERDFARFLRDEEFNKKWYIRSINLIYSGSVLFICGLLFGELSKFLFD
                     NHDLQKGGLSIVFKNLVQLLDKIITVSKVTEYIGFGIQGIILGVILKISDNIFRPSKE
                     KTGINRKNSFRSIIRLVNAMLGISLGVRRLPWTSSNQGSILWLLLNVIVWLFFDGSLS
                     FLMSGIVQTLFIAFFYYNRFDHMSQLLYLINFHFLGMLFFGKLQRYLFKRL"
     gene            <1127041..>1127895
                     /gene="NDAI0B04520"
                     /locus_tag="NDAI_0B04520"
                     /db_xref="GeneID:11497612"
     mRNA            <1127041..>1127895
                     /gene="NDAI0B04520"
                     /locus_tag="NDAI_0B04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668682.1"
                     /db_xref="GeneID:11497612"
     CDS             1127041..1127895
                     /gene="NDAI0B04520"
                     /locus_tag="NDAI_0B04520"
                     /inference="similar to DNA sequence:INSDC:YHR134W"
                     /note="similar to Saccharomyces cerevisiae WSS1 (YHR134W);
                     ancestral locus Anc_2.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668730.1"
                     /db_xref="GeneID:11497612"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:G0W6S6"
                     /translation="MPTQSHENPHITKIAVLQRKPNAEYALSILKDITKQVSYLMKEN
                     KFKVSQLVEFYPKDKRLLGMNVNRGQKIMLRLRDSNDEFQFLARESILGTMLHELTHN
                     LFGPHDKKFYEKLDDLSARQWIIEQQGLFDTFLGSGNRLGGSTLGNNRNNNLTAGRIR
                     GNVVGRPIRNRFGKGRKLGSLEGPNKLQKYKTPREMAAIAAERRYNDDKWCGEKNSDE
                     TKRALQPSSDSLYEQDIIIIDDDDDDDDEGNLISRGIASTKHKHRDKKSIEGNSNKEK
                     DIEIIDLT"
     gene            complement(<1128472..>1130094)
                     /gene="NDAI0B04530"
                     /locus_tag="NDAI_0B04530"
                     /db_xref="GeneID:11497613"
     mRNA            complement(<1128472..>1130094)
                     /gene="NDAI0B04530"
                     /locus_tag="NDAI_0B04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668683.1"
                     /db_xref="GeneID:11497613"
     CDS             complement(1128472..1130094)
                     /gene="NDAI0B04530"
                     /locus_tag="NDAI_0B04530"
                     /inference="similar to DNA sequence:INSDC:YHR135C,YNL154C"
                     /note="similar to Saccharomyces cerevisiae YCK1 (YHR135C)
                     and YCK2 (YNL154C); ancestral locus Anc_2.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668731.1"
                     /db_xref="GeneID:11497613"
                     /db_xref="GOA:G0W6S7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W6S7"
                     /translation="MSHVQGPSAMAINNLTNIPNSTQIHQAQLQSQQQQQRSHDDNST
                     IVGLHYKIGKKIGEGSFGVIFEGINMINGTPVGIKFEPRKTEAPQLKDEYRTYKLLAG
                     TPNIPLAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQIAVQMITLIEDL
                     HAHDLIYRDIKPDNFLIGRPGQPDENSIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG
                     TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR
                     TTNVYDLAQGLPVQFGRYLEIVRNLTFEETPDYQGYRKLLLSALDEMGETMDGEYDWM
                     KLNGGRGWDLTINKRTNLHGYGHPTPPNEKSRRHRSNHKMVPNPLHQLSQQQQQQDNL
                     QPSPQGQYQQQQIPTSQGHTSMQPQVSMNQHNLSKRADPTSYESYQRQVQQKYSQQQP
                     QQQMKKENFNNNNNNTAPTSVNXXXXXXXNRQQHGVSVSPDQSQQPIAPNSRQQSQQQ
                     QQQQQRVHNQNVVPDDESSESHKGFFSKLGCC"
     gap             1128658..1128677
                     /estimated_length=20
     gene            complement(<1130728..>1131534)
                     /gene="NDAI0B04540"
                     /locus_tag="NDAI_0B04540"
                     /db_xref="GeneID:11497614"
     mRNA            complement(<1130728..>1131534)
                     /gene="NDAI0B04540"
                     /locus_tag="NDAI_0B04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668684.1"
                     /db_xref="GeneID:11497614"
     CDS             complement(1130728..1131534)
                     /gene="NDAI0B04540"
                     /locus_tag="NDAI_0B04540"
                     /inference="similar to DNA sequence:INSDC:YHR136C"
                     /note="similar to Saccharomyces cerevisiae SPL2 (YHR136C);
                     ancestral locus Anc_2.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668732.1"
                     /db_xref="GeneID:11497614"
                     /db_xref="UniProtKB/TrEMBL:G0W6S8"
                     /translation="MERTSQTIYSPIYHYGDNTKNKDTKIGNSTHLQHELQGQINGPA
                     YMSPAYSPRSFNSSNPFSATPTPNISTKSILSNSMKHYTIEPSNKLRKHVSIDSSDPF
                     IIGEPEQLSSEEQYTNDDTSTLNMEQREQYPRTNSTSAHPNSNNMEYAPTNNNFKRQK
                     RHKSAPINFFSEKISNNFHILNPARFHQSVSLAYPNEDPNNSVFTPYNNYQHEKEMKS
                     NHYTTTTTSKHNFTNQEENPITELNKLSDQFWFTDSGVDENIFDMSSDEE"
     gene            <1132653..>1134350
                     /gene="NDAI0B04550"
                     /locus_tag="NDAI_0B04550"
                     /db_xref="GeneID:11497615"
     mRNA            <1132653..>1134350
                     /gene="NDAI0B04550"
                     /locus_tag="NDAI_0B04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668685.1"
                     /db_xref="GeneID:11497615"
     CDS             1132653..1134350
                     /gene="NDAI0B04550"
                     /locus_tag="NDAI_0B04550"
                     /inference="similar to DNA sequence:INSDC:YHR137W"
                     /note="similar to Saccharomyces cerevisiae ARO9 (YHR137W);
                     ancestral locus Anc_2.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668733.1"
                     /db_xref="GeneID:11497615"
                     /db_xref="GOA:G0W6S9"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W6S9"
                     /translation="MTAIDDTKKTTHYCSSSRQQQIVSFDLKRSENCYPENYEHLEGK
                     YSKFLSKREKNRKVITFWSEDEFDPTHLQLSGGMPNEGFFPIESIDLNVLNSPSCKIN
                     NTSDCTTSTDTDSLSKIHVTKRFPQELPLSMSLQYSETQGMKPLLDFIKTFITKLNNT
                     PPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLMEEFTFVPVISNVMATGAKCIPL
                     KLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKPKILYTISTGQNPIGVTLSMEKRR
                     KIYTIAQRHDLIILEDDPYCYLTFPKYNQKNNNNDKQDQLNPYFDPNFTIEDYLRERF
                     YKSLITLDTDGRVIRLETFSKIFGPGLRLSFIVANKFLIDKFVVFSELSSRAPSGVSQ
                     SFVYSTIQAMTKKRISEIVWGNFDQVEMFNEMYKSWMDWIMKIAGHYTHRRNTTLKTL
                     YATEAFKNGLFSIIEPSAGMFINLGLQFPKFQEYYEDSFNIIDQMNKFDKVLTKNGVK
                     VVLGYKMAVSKEFSKENCNFIRLTISFAKNDNELIVAANKIAKSIQTFFKGMKPIQN"
     gene            complement(<1134749..>1134955)
                     /gene="NDAI0B04560"
                     /locus_tag="NDAI_0B04560"
                     /db_xref="GeneID:11497616"
     mRNA            complement(<1134749..>1134955)
                     /gene="NDAI0B04560"
                     /locus_tag="NDAI_0B04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668686.1"
                     /db_xref="GeneID:11497616"
     CDS             complement(1134749..1134955)
                     /gene="NDAI0B04560"
                     /locus_tag="NDAI_0B04560"
                     /inference="similar to DNA sequence:INSDC:YHR138C"
                     /note="similar to Saccharomyces cerevisiae YHR138C;
                     ancestral locus Anc_2.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668734.1"
                     /db_xref="GeneID:11497616"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:G0W6T0"
                     /translation="MESVEELVNELGGKITNRYKLIKGFSMEFDDSYLNILKNQIERL
                     NMNMDGRYHINLEEDQIVHANTVR"
     gap             1136225..1136936
                     /estimated_length=712
     gene            <1137147..>1138541
                     /gene="NDAI0B04570"
                     /locus_tag="NDAI_0B04570"
                     /db_xref="GeneID:11497617"
     mRNA            <1137147..>1138541
                     /gene="NDAI0B04570"
                     /locus_tag="NDAI_0B04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668687.1"
                     /db_xref="GeneID:11497617"
     CDS             1137147..1138541
                     /gene="NDAI0B04570"
                     /locus_tag="NDAI_0B04570"
                     /inference="similar to DNA sequence:INSDC:YFR023W,YHR015W"
                     /note="similar to Saccharomyces cerevisiae PES4 (YFR023W)
                     and MIP6 (YHR015W); ancestral locus Anc_1.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668735.1"
                     /db_xref="GeneID:11497617"
                     /db_xref="GOA:G0W6T1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W6T1"
                     /translation="MSSAENEQEADQSSSTLISGQSEGSDIVNLYGQTTNYEGKKIKI
                     LESGETFSLFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSE
                     RDSKQAIDDFNCTRLFDSVIRLMPSFRGKNIKKSNYNLFFSNLPEVDDTGQSFTPRRF
                     YELFRECGEIISCKFEENKNIGFISFQSENVAREVIINYNNKFLFGKQITCKLLSAEN
                     DESHSFNINTIESKGRRKTPPLDSEIKLSLSTTVVLQNLSFICSKEFLVQFCCQRHIQ
                     FEDIQIIGAYMGKVNHRAHVRCNSKLDAKKLVNEMNGRLLAGSIVKAQWEGSSGYIKK
                     QSYDEMNTFITKVPMTYLQPPFSYSADLGYTMSNVDKRHRRQAGRSELKGRYIMDVFK
                     RLIRENLDFLRYPFASREENIVYIASYIFKFYWNGNLSSLSHFLFSLESSLHLEQVFK
                     SQVEAAADKLGFGR"
     gene            complement(<1138779..>1140053)
                     /gene="NDAI0B04580"
                     /locus_tag="NDAI_0B04580"
                     /db_xref="GeneID:11497618"
     mRNA            complement(<1138779..>1140053)
                     /gene="NDAI0B04580"
                     /locus_tag="NDAI_0B04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668688.1"
                     /db_xref="GeneID:11497618"
     CDS             complement(1138779..1140053)
                     /gene="NDAI0B04580"
                     /locus_tag="NDAI_0B04580"
                     /inference="similar to DNA
                     sequence:INSDC:YFR024C-A,YHR016C"
                     /note="similar to Saccharomyces cerevisiae LSB3
                     (YFR024C-A) and YSC84 (YHR016C); ancestral locus
                     Anc_1.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668736.1"
                     /db_xref="GeneID:11497618"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:G0W6T2"
                     /translation="MLNRKAAKILSSFVKPNQVFGADQVIPPEVLKRAKGLAVITVFK
                     AGFLFSGRAGSGVIVARLNDGTWSAPSAIAMAGAGAGGMVGIELTDFVFILNSPEAVR
                     SFSEFGTITFGGNVSVSAGPMGRNAEAAASASTGGVAAVFAYSKSKGLYAGVSVEGSA
                     IVERREANRKFYGDSCTSKMILSGRVRPPPAVDPLFRILESRAFNFRTANDRDDYSDD
                     DFYDDIPSSFGSSDLSSTRPNTRSTRRDRSGSRGYRDNDFDDDDDYYNDRRRSGNRNF
                     DDFDDPSGAKDYYASHRRSDVPRRAGSTSKSRWEDDVYDRGNRNSYGDRDRNRDVDDL
                     SNRFSKSRISSGSAGNNTRYARTRNDSAVPSSAPKAVALYSFAGEETDDLPFRKGDVI
                     TILKKSESQNDWWTGRVNGREGIFPANYVELV"
     gene            1140940..1141012
                     /gene="NDAI0Btrna15A"
                     /locus_tag="NDAI_0Btrna15A"
                     /db_xref="GeneID:11497619"
     tRNA            1140940..1141012
                     /gene="NDAI0Btrna15A"
                     /locus_tag="NDAI_0Btrna15A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11497619"
     gene            <1141378..>1142409
                     /gene="NDAI0B04590"
                     /locus_tag="NDAI_0B04590"
                     /db_xref="GeneID:11497650"
     mRNA            <1141378..>1142409
                     /gene="NDAI0B04590"
                     /locus_tag="NDAI_0B04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668689.1"
                     /db_xref="GeneID:11497650"
     CDS             1141378..1142409
                     /gene="NDAI0B04590"
                     /locus_tag="NDAI_0B04590"
                     /inference="similar to DNA sequence:INSDC:YFR025C"
                     /note="similar to Saccharomyces cerevisiae HIS2 (YFR025C);
                     ancestral locus Anc_1.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668737.1"
                     /db_xref="GeneID:11497650"
                     /db_xref="GOA:G0W6T3"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:G0W6T3"
                     /translation="MHSHHSHSGDYVAHGVDCLELMVDHVIKADFHTYCLTEHMPRLE
                     YKFLYPEEKFNPENDEVSLKVLQAKFKNFLRHAQEIKNRHIPDRTKFIVGMEVEACDI
                     SHIEYAKTLMLEHKSVLKFCVGSVHHINGIAIDFDQENWNRALSVAGNNLKRLLIDYF
                     NLQYLLLVNLKPLIVGHFDLFKLLIPRNLIIDEETGTVLKGPTDGGVHAYGFPYVTKW
                     GTVRELIVRNLKYIKSYGGAVEINTSALRKNLPEPYPGKDVCELVKKYCSGRFVLSDD
                     AHALSQIGVCYDEALNYMTEELKLQQLFYLAENDNGELLFESTTIEDVKNDAFWIKRK
                     EGNSSYAKC"
     gene            <1143227..>1144012
                     /gene="NDAI0B04600"
                     /locus_tag="NDAI_0B04600"
                     /db_xref="GeneID:11497620"
     mRNA            <1143227..>1144012
                     /gene="NDAI0B04600"
                     /locus_tag="NDAI_0B04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668690.1"
                     /db_xref="GeneID:11497620"
     CDS             1143227..1144012
                     /gene="NDAI0B04600"
                     /locus_tag="NDAI_0B04600"
                     /inference="similar to DNA sequence:INSDC:YFR027W"
                     /note="similar to Saccharomyces cerevisiae ECO1 (YFR027W);
                     ancestral locus Anc_1.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668738.1"
                     /db_xref="GeneID:11497620"
                     /db_xref="GOA:G0W6T4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="InterPro:IPR028009"
                     /db_xref="UniProtKB/TrEMBL:G0W6T4"
                     /translation="MQTKVPVRKRSSLKAKYKQSVLRIESKVIKCPKCEMTYASTSLN
                     DVSMHDKYHNLHLRGRNWSSNWGIVVKDNVGNLPKSKRIPLSVQSTRSSKSNGSGNEY
                     IAMIRPNATAEVKATLEIMGIVNNELNAPHDENDFWTDEKGQGRAFVYVKDNKAVAVV
                     TMEILKPGRGRWMVYETKSIVDGMRPNFTLGISRIWVCRTQRANGIASMLLDVAREHT
                     IYGKEVNKFLTAWSQPTESGGKLASKYNGVIHKSGKLLLPCYV"
     gene            complement(<1144117..>1145655)
                     /gene="NDAI0B04610"
                     /locus_tag="NDAI_0B04610"
                     /db_xref="GeneID:11497621"
     mRNA            complement(<1144117..>1145655)
                     /gene="NDAI0B04610"
                     /locus_tag="NDAI_0B04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668691.1"
                     /db_xref="GeneID:11497621"
     CDS             complement(1144117..1145655)
                     /gene="NDAI0B04610"
                     /locus_tag="NDAI_0B04610"
                     /inference="similar to DNA sequence:INSDC:YFR028C"
                     /note="similar to Saccharomyces cerevisiae CDC14
                     (YFR028C); ancestral locus Anc_1.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668739.1"
                     /db_xref="GeneID:11497621"
                     /db_xref="GOA:G0W6T5"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:G0W6T5"
                     /translation="MPKDVSLDNTIEFLKGRVYLGAYDYTPENTDEIVFFTIEDTLYY
                     NSFHLDFGPMNIGHLYRFAVILHEILNDPINSKKSVVFYSSTFTRERANSACLLCCYM
                     ILVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDIVYGVWRAKEKGLIDLK
                     NFNLEDYERYEHVEEGDFNVLTPDFIAFASPQEENYKLNRNPIVVNLNRPFKSVLNFF
                     KDNNVQLVVRLNSHLYNKRHFETIGIQHLDMIFEDGTCPDLSIVQNFVGAAETIIKKG
                     GKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLNQN
                     NFRDWKHTMRISLEPSEIIGGLYPLIPLDEYRQQKRAMKESALYNDDNNVNDEFGDSL
                     TMTPPRKIRNNNALNDRRLDNRYQTVGLPQNSPGQPRKGQNGTYTIENIDKKNGTKKS
                     PVEDGDGDIIMKSNNDSKVSSSSIGHDDDADRDTLLRQLLPKNKRAVSGKRITSASGI
                     RKTR"
     gene            complement(1146015..1146065)
                     /gene="NDAI0Btrna9Y"
                     /locus_tag="NDAI_0Btrna9Y"
                     /db_xref="GeneID:11496197"
     tRNA            complement(join(1146015..1146051,1146015..1146065))
                     /gene="NDAI0Btrna9Y"
                     /locus_tag="NDAI_0Btrna9Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11496197"
     gene            <1147583..>1149748
                     /gene="NDAI0B04620"
                     /locus_tag="NDAI_0B04620"
                     /db_xref="GeneID:11496190"
     mRNA            <1147583..>1149748
                     /gene="NDAI0B04620"
                     /locus_tag="NDAI_0B04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668692.1"
                     /db_xref="GeneID:11496190"
     CDS             1147583..1149748
                     /gene="NDAI0B04620"
                     /locus_tag="NDAI_0B04620"
                     /inference="similar to DNA sequence:INSDC:YFR029W"
                     /note="similar to Saccharomyces cerevisiae PTR3 (YFR029W);
                     ancestral locus Anc_1.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668740.1"
                     /db_xref="GeneID:11496190"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W6T6"
                     /translation="MLIEKLINDIEQNLFLPKDLISIQTNENPISNADTPLEEQYSYK
                     IKYDIVADASVLTCGCCISNSLYFQISNKLNSNLIKCPTCDSCNAKLIGAINPLRNLY
                     HQLENYKSQLRSDSTDTQLMKTSSFPHTDHHSLDTEGSTPPLPIEYPSSYYSEKGYIP
                     SETTKKSLISLFHSIATEYNSDSLGFTNNNGGITNVSKNDLQSDINEKSYSQQERKLQ
                     KGGNDLPVLDTVSVTKTVPISQDNKSSTISITTKTVEQKLNKNNNGNNNHTIEKVSSN
                     TTPLANDTKSIQEKNLQSTTFDEQKEYYFAKCFPMYRKKSQYATHSKFLKTKSKLFIN
                     TAISPDCTKFALITEHKWEVYAIENENNITVSPTLLFCGKSNGQFGPNFDKLQYPDDK
                     SLLLDTRNNDTPPSNTKKKNKGDWEQFCCKLSNHFLVISGSHNIFRVFNLNKNGELIY
                     SHQSVFPIRCIDIDPSSKIIACGITGKEKHSGSEQALIAFHRIEKNKVTLEPEFLSPM
                     TIILPYRDPVKTVQLSNDGLYLSCSTALESRFLIISLKKINEPRLIMKSLRSIDTSLE
                     SEGITDTKLFPGNPNLMCVTSTAFKSPPIIINTKIENIDGIRNVAQPTLLIRLNKLGS
                     KIHKCEVSPRSDAIAFLDRNGSVYIMSAPTMLEDEKKRIVLVEMVSNAYKAHESASLK
                     FSPDGHKLYILDRKGILYVEDFAYGSPDNREITKCKQLD"
     gene            complement(<1150091..>1150510)
                     /gene="NDAI0B04630"
                     /locus_tag="NDAI_0B04630"
                     /db_xref="GeneID:11497623"
     mRNA            complement(<1150091..>1150510)
                     /gene="NDAI0B04630"
                     /locus_tag="NDAI_0B04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668693.1"
                     /db_xref="GeneID:11497623"
     CDS             complement(1150091..1150510)
                     /gene="NDAI0B04630"
                     /locus_tag="NDAI_0B04630"
                     /inference="similar to DNA sequence:INSDC:YBR258C"
                     /note="similar to Saccharomyces cerevisiae SHG1 (YBR258C);
                     ancestral locus Anc_1.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668741.1"
                     /db_xref="GeneID:11497623"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:G0W6T7"
                     /translation="MSTINVQTDPAKEFAEAFKKQGYFDQLKREILSKNWKSNNDDDD
                     GTNTTTSVTVEQTIKNKVADSVKDMVDKDPNLIFKNRGTTSALIEAQLFKDDYKKLSE
                     GDNKILLTDFIQQTLNDQELTDGIISKLESIIPDDKK"
     gene            complement(<1150965..>1153178)
                     /gene="NDAI0B04640"
                     /locus_tag="NDAI_0B04640"
                     /db_xref="GeneID:11497624"
     mRNA            complement(<1150965..>1153178)
                     /gene="NDAI0B04640"
                     /locus_tag="NDAI_0B04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668694.1"
                     /db_xref="GeneID:11497624"
     CDS             complement(1150965..1153178)
                     /gene="NDAI0B04640"
                     /locus_tag="NDAI_0B04640"
                     /inference="similar to DNA sequence:INSDC:YBR260C"
                     /note="similar to Saccharomyces cerevisiae RGD1 (YBR260C);
                     ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668742.1"
                     /db_xref="GeneID:11497624"
                     /db_xref="GOA:G0W6T8"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G0W6T8"
                     /translation="MINSPSDSKLNGSIDGNETFPQGSPNVNDTVHSSSSATSNSISS
                     LKTSNSQPFAQTTTQQSRPNEVSLLQRSEIKKVMDSDVAINALLSRLKQSLLTCEEFT
                     KFIRKKYIFEEEHTQELSKQYKHFFTTASQSSSLIFVRKPIHDVLAFDGKLSVVKESY
                     VKALQKMYDEISALLLTMTKMRKSVKEHSRRLEKDVSDAIHSAEKAQNRYTSLCQDWD
                     KLRMTDPTKTKLTLRGSKTTKEQEEELLRKIDSADLEYKQKVDHSNSLRTTFIIRERP
                     KIVSELKDLILEIDTAMTIQLQKYTIWTENLILNSGVSISPLDSNKSMKAVASSVKNE
                     KDLYDFLNKYNHAGKNSLLVNRNLIPVNYKKYPSMMKHNNKANKSPPKFAVDPSRNSI
                     PKRVISTHNETPFQDTPQAKSSIMTDPTITAGATLASTSISSPSSQPYTSPASSTYTT
                     PQSKQNIFNSNQQLPSTPSHSGVNAVDRVASNQSSVDQRFQSLDPGNQTARLPSMSTT
                     VDSMATSMSDRPISHIQADAAMPHGVNNNFKTFGVPLESLIEYEQDMVPAIVRQCIYV
                     IDTYGLDLEGIYRKSANVLDVSKLREDIDKDPSNVSMILPSKNFHDTDIYLVGSLLKA
                     FFSSLPDTLLPKSIAEEVKICCAIDDPKTRKNYMHGLIYKLPDAQYWTLRALLFHLKR
                     ILEHESKNRMNLKGLCIIWGPTIIPPNVDDEHDVNYQIRSMETLLSVADQAFEPE"
     gene            complement(<1153728..>1154435)
                     /gene="NDAI0B04650"
                     /locus_tag="NDAI_0B04650"
                     /db_xref="GeneID:11497625"
     mRNA            complement(<1153728..>1154435)
                     /gene="NDAI0B04650"
                     /locus_tag="NDAI_0B04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668695.1"
                     /db_xref="GeneID:11497625"
     CDS             complement(1153728..1154435)
                     /gene="NDAI0B04650"
                     /locus_tag="NDAI_0B04650"
                     /inference="similar to DNA sequence:INSDC:YBR261C"
                     /note="similar to Saccharomyces cerevisiae YBR261C;
                     ancestral locus Anc_1.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668743.1"
                     /db_xref="GeneID:11497625"
                     /db_xref="GOA:G0W6T9"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W6T9"
                     /translation="MSANNNKPDSHIDYEDAIDYWTNTPATVDGVLGGYGEGTTVPTM
                     DVLGSNHFLRKLKSRMIPEENYRKYGADIGAGIGRVTKTMLHKHCAVIDLVEPVDPFC
                     KQIKEEVKELSKQGKIGQIYQVGMQDWTPEEGKYWLIWCQWCVGHLPDEELVKFFQRC
                     VKGLQPNGTIIVKENNTPSNQDDFDPEDSSVTRSDKKFKELFEKSGLKLIATDRQKGL
                     PEELYPVRMYALKPKTV"
     gene            complement(<1154778..>1155110)
                     /gene="NDAI0B04660"
                     /locus_tag="NDAI_0B04660"
                     /db_xref="GeneID:11498125"
     mRNA            complement(<1154778..>1155110)
                     /gene="NDAI0B04660"
                     /locus_tag="NDAI_0B04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668696.1"
                     /db_xref="GeneID:11498125"
     CDS             complement(1154778..1155110)
                     /gene="NDAI0B04660"
                     /locus_tag="NDAI_0B04660"
                     /inference="similar to DNA sequence:INSDC:YBR262C"
                     /note="similar to Saccharomyces cerevisiae YBR262C;
                     ancestral locus Anc_1.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668744.1"
                     /db_xref="GeneID:11498125"
                     /db_xref="UniProtKB/TrEMBL:G0W6U0"
                     /translation="MRSILKLATLGAVSTATISSYYYIYGSNSQIPIIPKRWRRVEDE
                     VDQLLEDKMTLKGKTGRQLNEQLNLNTRHLQVDQELLMRSNLNETMKDIWNKQIRTIV
                     RWIFSVGN"
     gene            <1155545..>1157041
                     /gene="NDAI0B04670"
                     /locus_tag="NDAI_0B04670"
                     /db_xref="GeneID:11498126"
     mRNA            <1155545..>1157041
                     /gene="NDAI0B04670"
                     /locus_tag="NDAI_0B04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668697.1"
                     /db_xref="GeneID:11498126"
     CDS             1155545..1157041
                     /gene="NDAI0B04670"
                     /locus_tag="NDAI_0B04670"
                     /inference="similar to DNA sequence:INSDC:YBR263W"
                     /note="similar to Saccharomyces cerevisiae SHM1 (YBR263W);
                     ancestral locus Anc_1.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668745.1"
                     /db_xref="GeneID:11498126"
                     /db_xref="GOA:G0W6U1"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G0W6U1"
                     /translation="MLSARLLSARTVKPLLSSQCIIRSLSTKITNDQILISKHVREID
                     PEMNSILEQERNRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNQF
                     IDMAESLCQKRALELYNLNPEEWGVNVQALSGAPANLYTYSALMNVGDRLMGLDLPHG
                     GHLSHGYQLASGTKISYVSKYFNTMPYKVDVETGLIDYEQLSMTSKLFRPKIIVAGTS
                     AYARLLDYKKFKEIADGCGAYLMSDMAHISGLVAANVIESPFKYSDIVTTTTHKSLRG
                     PRGAMIFFRKGLRKTTKSGKEIHYDLEKKINFSVFPGHQGGPHNHTISALAVALKQAM
                     TPEFKQYQQNIVNNAKVLSEELLKRGFKLVSGGTDNHLLLIDLSSLGIDGARLEAILE
                     KINIAANKNTIPGDKSALFPSGLRIGTPAMTTRGFGPAEFTKVAEYIDTAVKLAIGLK
                     SQESPENKDVRSKLNNFKQLCDEDEHVQKLTKEVSEWVGHFPVPGELS"
     gene            complement(<1157279..>1157950)
                     /gene="NDAI0B04680"
                     /locus_tag="NDAI_0B04680"
                     /db_xref="GeneID:11498127"
     mRNA            complement(<1157279..>1157950)
                     /gene="NDAI0B04680"
                     /locus_tag="NDAI_0B04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668698.1"
                     /db_xref="GeneID:11498127"
     CDS             complement(1157279..1157950)
                     /gene="NDAI0B04680"
                     /locus_tag="NDAI_0B04680"
                     /inference="similar to DNA sequence:INSDC:YBR264C"
                     /note="similar to Saccharomyces cerevisiae YPT10
                     (YBR264C); ancestral locus Anc_1.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668746.1"
                     /db_xref="GeneID:11498127"
                     /db_xref="GOA:G0W6U2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W6U2"
                     /translation="MNESPIVTYCCDLKVVLLGESSVGKTSIVTKISTGKFQKGAATI
                     GAAFTTKQIQFNEIEENGVEQCFKVSIEIWDTAGQERYRSLTPMYYRNTDVALIVFDL
                     TQEASLKKARSWIDELKSYLDSSSRRDKHISMILVANKVDLVAKNDGTFDINQYLENW
                     DIPSEYPLKIVSAKTNEGINELFDDIIKKIPKDQFVKEDAQARRPSTIQLNSSIADNS
                     TGCNC"
     gene            <1158286..>1163994
                     /gene="NDAI0B04690"
                     /locus_tag="NDAI_0B04690"
                     /db_xref="GeneID:11498128"
     mRNA            <1158286..>1163994
                     /gene="NDAI0B04690"
                     /locus_tag="NDAI_0B04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668699.1"
                     /db_xref="GeneID:11498128"
     CDS             1158286..1163994
                     /gene="NDAI0B04690"
                     /locus_tag="NDAI_0B04690"
                     /inference="similar to DNA sequence:INSDC:YBR275C"
                     /note="similar to Saccharomyces cerevisiae RIF1 (YBR275C);
                     ancestral locus Anc_1.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668747.1"
                     /db_xref="GeneID:11498128"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:G0W6U3"
                     /translation="MSDSSKESSGPRKNDRAITLLDKHINQKSKMKSTSNSSPIVLTQ
                     WFNSQLPAPPSTSPVSVQTHKAANDVSPTPKRRRVNNMDQTSSTVPHLDLRRFELNND
                     TRLERSTSESNSASPIRKTVAFSDKIEIESSPTQTLPESSPRHPPSSDRKPPSKSILR
                     NSKTPSSPVKYNTIKASSDVTYSKTVSNNLAASNAGVATNDFLHADPRKVEYWADGEI
                     HSLLYPNNIKEFRDIIEGGISFLNMGLKKFEIFATFNNIIPIIPNGFNATDVIDKKIG
                     IIVENLDNLIKILISNLKDEQKELLEGNEKKNPFTSRQYVQIIRLLGIMLSNFKIICW
                     LDKRKPLQVMLKEIYKLSEEALVNENSSKVIIISQLTFLKDEKFSTYYLNKNEILRII
                     DTFTKIKDLKSTNLMNEKLLLMRCYINKFPKLMIPKISDWLPGELLSKIVLDEDMYAI
                     KITHTSIAVLLDLLKKCLDVEEGHQEIFKYVEVKTLNESVPEGTLEKFNSTAVLNDLE
                     IDINSMTLGQLLRNKIKYLVLVQKDYKVGIDLWLAMVGLLFNNKKNIIHLLDKDKTHD
                     KSSADWLNLVQLCFKNSDGKTKLLSLKVWRILTYCICTHVTELDSAYQIPLLNILKIP
                     LEISKTEHGNDNVRDGIIYYVTGIIYTAFLLLQKNLSYETFQFFFDNLVKPIYENFIF
                     NSPSFHVQTRLLGILLQLLGAPLFNLVSTSKHITSNAGKSKNIRNDKKVSPNNPVKVI
                     ASVGISRDHIVPLPTHLSHPGYTLISRLFLNSLPINAKFLTVKTEIILDLIAQIPDEL
                     KTEEVFQEYRNIVVSLTKLYKTSYTTKNKNDVLFECFSRCTCLLGKTFPNIILNPKRD
                     IFSKYLASFDNLFTDNADMLIKLLKDIIKYTRPQISELTVIELFLTNTNDKNSRDYIQ
                     NWVGSTLLSPMLTYPEFQSLTNIVNMIPSSQIVENYLDLCVKTSLAQNPCTTLNIRNW
                     KDKQLIFFIKTYISKCSNRLDDDILVLLHDVLPDNIDVFDSMVPLLIQINRTDLIRHC
                     IEKKPSYLNTPAIMNYHDLSEILPDDRKCYLLNNLKDFSAIVQYKIIMWVAKTDEFTL
                     FKKNYVKIESCLFLDEPCSENILDKKAFIKELFTIFYEKQAWQLVAILVVSCINHGYE
                     SNATEFLANIDSNTLNSFPPKAIATIVNRCGSMNPKLLLILHQFFSNKEKFFLLELVS
                     ELISLKKIDALLSVSSELINFFIDDQHIFTEDEQGKSIGILEKFLAQLQKYNERTSFN
                     FTKDLMSSLPKSKTKYLSKLASCVGSAQNSTVVGVTQEELKLFSQKLEDCDNQEVNKT
                     LAIVQPKAQFVVSRDIRDVYTNKIQDSDEIQVPATQKDEEKEIIAIGSQSQSNNDLNN
                     SSIEEENKNNTIVSKNLAIVTSIETPSGTQSQEIRQLTGNHLENESKEVSDLPEVYSP
                     SDTVNKRIDDSSFTQTLDEVEDPENVNMIQAKSTQIGPTTGDTQINNISDTNAEAPDL
                     EDKVDEEKQEGSSNLYTVGNVVLPFACSPEQRGVDNIQQGEISTLSTSRNLSIEDTGS
                     SYSNQEKGEDGASKSSRSPHREIETHVEDEHVTVPELNMHKHSIHIISNNVTENMEQP
                     RNKTHIEGTTISKEKKGLEDMTENSSIGEAKLALPMATIVDDPQSRSTNVDTEERENS
                     TTSKSSHLIGALEEQQATQDDFVLVEEPPKDTLLDELDKEISQDMTETNASTAHKDVV
                     LDSPMPAIRIPIFNTLKIGSGRIEKKKHTKIDKALNKRLNLDSSAIILHQQEDAPCDV
                     PIITKDHLPEEIDTVTKQAPAFGNIPVNNMAEEVPLENDLQSSFVIDGKEDGDGTSRD
                     TTPSLRMHFPCRKSRKLVNRLRTFNPDELASLPVEERRNLRIELLDFMMKLEYYTGDK
                     NN"
     gene            complement(<1164332..>1165918)
                     /gene="NDAI0B04700"
                     /locus_tag="NDAI_0B04700"
                     /db_xref="GeneID:11498129"
     mRNA            complement(<1164332..>1165918)
                     /gene="NDAI0B04700"
                     /locus_tag="NDAI_0B04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668700.1"
                     /db_xref="GeneID:11498129"
     CDS             complement(1164332..1165918)
                     /gene="NDAI0B04700"
                     /locus_tag="NDAI_0B04700"
                     /inference="similar to DNA sequence:INSDC:YBR274W"
                     /note="similar to Saccharomyces cerevisiae CHK1 (YBR274W);
                     ancestral locus Anc_1.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668748.1"
                     /db_xref="GeneID:11498129"
                     /db_xref="GOA:G0W6U4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0W6U4"
                     /translation="MNVSDNTQFPKIKDVVLGDTIGQGTFGCVKNAHLKIDPKVIIAV
                     KFIHIPTCKKNGLSDKDITKEVILHSKCSKHPNVLRLIDCNISNAYMWIVMEMADGGD
                     LFDKIEPDIGVDSEVAQFYFQQLIRAISYLHDECGIAHRDIKPENILLDRNGNLKLAD
                     FGLASQFKRNDGTIRVASDQRGSPAYMAPEILYSKGGYYANSTDIWSIGILLFVLLTG
                     EIPWELPVMEEKNFACFIQNNGNLNLGPWAKIDFSHLNLLRKMLQPDPKKRASLKILR
                     THPWFTKGVRFANSEGLCKDPAVLAKKLLSNLRISLSNETYERFTQDVSYSKQHFSAF
                     SSTQPVASDLAQIEHDYMNVNALTNTQTAFTQYPFDNRAETLMSQEAKWTQFISHDFA
                     ALQFSDESNATKNTTPHLHFNPNRLTKFYTVESFETIFPVLEKSLYLAGIKVKPDLYG
                     SFSELISELGYEKVVPLVINIKTHDRRGGTLVGSLAILNVDEDLKSIGFDRKSGDPLE
                     WRRLFKKVALFCRDIILIPN"
     gene            <1166413..>1167717
                     /gene="NDAI0B04710"
                     /locus_tag="NDAI_0B04710"
                     /db_xref="GeneID:11498130"
     mRNA            <1166413..>1167717
                     /gene="NDAI0B04710"
                     /locus_tag="NDAI_0B04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668701.1"
                     /db_xref="GeneID:11498130"
     CDS             1166413..1167717
                     /gene="NDAI0B04710"
                     /locus_tag="NDAI_0B04710"
                     /inference="similar to DNA sequence:INSDC:YBR273C,YJL048C"
                     /note="similar to Saccharomyces cerevisiae UBX7 (YBR273C)
                     and UBX6 (YJL048C); ancestral locus Anc_1.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668749.1"
                     /db_xref="GeneID:11498130"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0W6U5"
                     /translation="MLDKLFMDNVEQSVAQSLQKKLPLVVYSCESLEDDSWFKQWFHM
                     EKIDEIKDHAIWLRLIKGTEQFNNFEQLFPSVIIPSLYLINNGELLSVIQGVEDDHTH
                     WEDLLSILGVGNNQKGKDSTNRKTAHTHDNDKKSNKEKEKFGKSDREDIMETSERIYH
                     QQVLKERRLENEERERIIRLVRADRQERKAKEQKGILDDSKPLEVVDNFRDINKLHSE
                     KCTLQIKLTNSSTLTHTFNSKDTLNDVRTWVDHNRTDGNTAYYFHRNIPRMTFNDSDE
                     LKTLCDLELTPRSALILKVMETSTTKINSTNIEKPSLVSKVFNGISGWWNKTNRNEPV
                     EFGTSNFEPYHDEPSDDDTSRNASFGDISYGNNIKGSNTRVSELAKDEGSSRTNSNSR
                     AVSPNVFQFVNRDDMEDQDDKEKETFNGNNINLEKNKDDSSK"
     gene            <1170054..>1171511
                     /gene="NDAI0B04720"
                     /locus_tag="NDAI_0B04720"
                     /db_xref="GeneID:11498131"
     mRNA            <1170054..>1171511
                     /gene="NDAI0B04720"
                     /locus_tag="NDAI_0B04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668702.1"
                     /db_xref="GeneID:11498131"
     CDS             1170054..1171511
                     /gene="NDAI0B04720"
                     /locus_tag="NDAI_0B04720"
                     /inference="similar to DNA sequence:INSDC:YBR272C"
                     /note="similar to Saccharomyces cerevisiae HSM3 (YBR272C);
                     ancestral locus Anc_1.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668750.1"
                     /db_xref="GeneID:11498131"
                     /db_xref="UniProtKB/TrEMBL:G0W6U6"
                     /translation="MSTIQDVESAAITPMLEELNTALESAIIPGDINKLIERCSLNLS
                     TSIILKGDSKRLLANIKRMLLSDESENILDYELLLELLQSLIDVSSFDDVLEVFSTND
                     LLDALNSGITSIVRAACKIISKSYPKGIFASSLIIDIVLEIFFNLDTEISIINDIETL
                     FKNLSSDELIRRRILVNNHPLLKKIKRDFEPKSFTRLIELLKIEYEFITPSEFDESLF
                     VITINEIRKSIEKDIFIFISITNYYTSLVANIDAIGIHGTNHMWVISSIESTVYFYGD
                     LFANLETYFEVKNFGLSYMFELFRQCSYQKNGELFHTIDKAYVKLSHDTPYILEFMAF
                     VNPKYLFKFHQTLVHDFALVTPSRLGILRNIMADPDCFLLIEPKITSGNILALPYMEQ
                     MVLLEKMTQFKYGVEYLIQFLPQVMANLTQNLNGEVTEPETVELRREAVEHLLQFGEP
                     VLNVWYNPLRKLYGRIVNGDNYEKKVEPKLASAYL"
     gene            complement(<1171595..>1172893)
                     /gene="NDAI0B04730"
                     /locus_tag="NDAI_0B04730"
                     /db_xref="GeneID:11498132"
     mRNA            complement(<1171595..>1172893)
                     /gene="NDAI0B04730"
                     /locus_tag="NDAI_0B04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668703.1"
                     /db_xref="GeneID:11498132"
     CDS             complement(1171595..1172893)
                     /gene="NDAI0B04730"
                     /locus_tag="NDAI_0B04730"
                     /inference="similar to DNA sequence:INSDC:YBR271W"
                     /note="similar to Saccharomyces cerevisiae YBR271W;
                     ancestral locus Anc_1.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668751.1"
                     /db_xref="GeneID:11498132"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W6U7"
                     /translation="MFDPLDLYSPDEQVQLEKITEATTIFTKLHQDDPVVVITAVNDN
                     RIDGIKAQEEDEDEEEEDSIIDILDLPPATYATPQASLCVLLLLKPDKQVNFNTSNDD
                     YDDSTNSKSVEIICKEKEISSELLSSLLTWYTDLWPNSRLNTELKICTRIPRLRSYGQ
                     KELLLNYYTSLLKKYDNCNEDYINDQIVKELSLRISENCGRSAQPSMTRDFNLQNLVH
                     VIQLYEPSLTADNLGWKTWGSSLILSQELVNDLETNKNNKKSKSIRRVLELGAGTGLV
                     GIAWACKWRQLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNPEDFI
                     KKYSDEKFDTILIADPIYSPNHPEWVVNMICKFLAINGRCHLEIPLRAKYALEREKLS
                     NLLEQHGLVVYNERSSEGMDDWGVVKYLYKEIGWDTTLTD"
     gene            <1173400..>1175085
                     /gene="NDAI0B04750"
                     /locus_tag="NDAI_0B04750"
                     /db_xref="GeneID:11498133"
     mRNA            <1173400..>1175085
                     /gene="NDAI0B04750"
                     /locus_tag="NDAI_0B04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668704.1"
                     /db_xref="GeneID:11498133"
     CDS             1173400..1175085
                     /gene="NDAI0B04750"
                     /locus_tag="NDAI_0B04750"
                     /inference="similar to DNA sequence:INSDC:YBR270C,YJL058C"
                     /note="similar to Saccharomyces cerevisiae YBR270C and
                     BIT61 (YJL058C); ancestral locus Anc_1.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668752.1"
                     /db_xref="GeneID:11498133"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:G0W6U8"
                     /translation="MSVSNRKRSTTVLPLTPITPNTDFKSQNDHPKVTQQRNERGLGM
                     SRVYSIPAAIVPQTLTHPDDDDINSKNLPKSPNETIPKWTQVGFQSIFQGTERSNPSL
                     KSHHMIVPNADSDISRQRSPFASSSSHSNERLSRYNTRISESDEERLSTNDSIFTFDS
                     SVKETKSNSLFNAARKESASFSEKTSRLFKNGSSHKNKKAIGNTNENNSSSSSINSKT
                     SNGKPNSLSKVARKIFHGKTHRHIRKDENELAMPSSFSKFLHSSIGKHKSPVQFIHNT
                     KGALVDSGKSGYSFNPGSMVNNTNDVSMSLDDEDSFDSANVTILHDFLKNLSSLESNY
                     KLFNAQEVHILAGNIWSIYRNVVVELFKGRKLWHLEAKVEDIDRMLEFYLVLRTEIKN
                     PSSHTRLLSEIEELITSSLFIFENQIVFNYNNESAMNSPLKRLGIIWRIFYEEVFYDV
                     TACLLPLEKSFERNPKYWLDISSDIQSINHLLLKGFRDSIVLPYYQNFIHSHEGASKS
                     FQMYIFSEEEESSISEQDKLTLLQCLGILGTIQGKDRNQIVIEELLEGVRMSI"
     gene            <1175354..>1175764
                     /gene="NDAI0B04760"
                     /locus_tag="NDAI_0B04760"
                     /db_xref="GeneID:11498134"
     mRNA            <1175354..>1175764
                     /gene="NDAI0B04760"
                     /locus_tag="NDAI_0B04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668705.1"
                     /db_xref="GeneID:11498134"
     CDS             1175354..1175764
                     /gene="NDAI0B04760"
                     /locus_tag="NDAI_0B04760"
                     /inference="similar to DNA sequence:INSDC:YBR269C"
                     /note="similar to Saccharomyces cerevisiae YBR269C;
                     ancestral locus Anc_1.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668753.1"
                     /db_xref="GeneID:11498134"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:G0W6U9"
                     /translation="MMEALIKSSRAINLRISRTRLITQFSRTISINTNKIPSPPKLPR
                     EDQEEFEKLQKIASSQEAIEEYNRKIKEDPTKESLNSEILTKNDIGSFSPEFSKTLPE
                     FEGDVNPKTGEKGGPKQDPLKYGDYSFNGRVTDF"
     gene            complement(<1176179..>1176520)
                     /gene="NDAI0B04770"
                     /locus_tag="NDAI_0B04770"
                     /db_xref="GeneID:11498135"
     mRNA            complement(<1176179..>1176520)
                     /gene="NDAI0B04770"
                     /locus_tag="NDAI_0B04770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668706.1"
                     /db_xref="GeneID:11498135"
     CDS             complement(1176179..1176520)
                     /gene="NDAI0B04770"
                     /locus_tag="NDAI_0B04770"
                     /inference="similar to DNA sequence:INSDC:YBR268W"
                     /note="similar to Saccharomyces cerevisiae MRPL37
                     (YBR268W); ancestral locus Anc_1.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668754.1"
                     /db_xref="GeneID:11498135"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:G0W6V0"
                     /translation="MLRLFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLN
                     IKKTGKEPIALEDKEYPEWLWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRK
                     KIKQNNFLSQI"
     gene            complement(<1176912..>1178234)
                     /gene="NDAI0B04780"
                     /locus_tag="NDAI_0B04780"
                     /db_xref="GeneID:11498136"
     mRNA            complement(<1176912..>1178234)
                     /gene="NDAI0B04780"
                     /locus_tag="NDAI_0B04780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668707.1"
                     /db_xref="GeneID:11498136"
     CDS             complement(1176912..1178234)
                     /gene="NDAI0B04780"
                     /locus_tag="NDAI_0B04780"
                     /inference="similar to DNA sequence:INSDC:YBR267W"
                     /note="similar to Saccharomyces cerevisiae REI1 (YBR267W);
                     ancestral locus Anc_1.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668755.1"
                     /db_xref="GeneID:11498136"
                     /db_xref="GOA:G0W6V1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W6V1"
                     /translation="MSGIYTCNSCVMEFASSIEQRQHMKSDWHRYNLKRRVAQLPPIT
                     ESTFNTKVNAANTAATAETTKNNEDSKKQLTKKEIRRREKEALLQRKKELLELARENM
                     LKNMQQQQQQEQPITPQQQEEIPLVSEKQEQEQNQEQNQEQKSQVEAEQKQDNEEDLT
                     EEQLAERLMNQKLANKVDIPLEQCLFCTKRIFTDFETNLDHMFKSHGFYIPEQKYLED
                     KEGLVKYLSEKIGLGNVCIVCNYQGKSIEAVRAHMLAKRHCKIPYENENEKLEISEFY
                     NFTSTYDQFEKPARKKKTVIQINSGDNLEGEGEDEWEDVDSAEDDANGNGEIEEELYE
                     DDEDEPPKEYLYHDNVELHLPTGIKVGHRSLQRYYKQDLKPEKELTEGQGTLMAAETR
                     SFVNTLDAKEIQVRQRTWQTEIKDKKTHDKRRAKFVNNQPYYRDQLLQ"
     gene            complement(<1178539..>1179522)
                     /gene="NDAI0B04790"
                     /locus_tag="NDAI_0B04790"
                     /db_xref="GeneID:11498137"
     mRNA            complement(<1178539..>1179522)
                     /gene="NDAI0B04790"
                     /locus_tag="NDAI_0B04790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668708.1"
                     /db_xref="GeneID:11498137"
     CDS             complement(1178539..1179522)
                     /gene="NDAI0B04790"
                     /locus_tag="NDAI_0B04790"
                     /inference="similar to DNA sequence:INSDC:YBR265W"
                     /note="similar to Saccharomyces cerevisiae TSC10
                     (YBR265W); ancestral locus Anc_1.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668756.1"
                     /db_xref="GeneID:11498137"
                     /db_xref="GOA:G0W6V2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W6V2"
                     /translation="MPFTLENQIVLITGGSQGLGTQFARKYFKETKNTKIIIVSRSES
                     KLQTAIRSITSSSLEENIENYNLSNYSSGKKVNANKRLLYSPCDLSDYNSVSALLDIL
                     LAQDLSPTQIYLCAGGSIPKLFKDLTSKELEMGVQMNYLTSLYLSHKIAQLQLQSHLI
                     FFSSVTAFFPFIGYSQYAPLKVSMKSLVSILRQELLGTNRISCVYPGNFQSEGFELEE
                     LTKPEITREIEGPSSPIPVDRCCDIIVKQLQYGYDDITTDLIGWLLMSLDMGLNKHNN
                     NSIAWMVQLIVGALVNLIVVPFYMAFCKFQIKNWFKKEQAKKDLDNKKKEQ"
     gene            complement(<1179801..>1180070)
                     /gene="NDAI0B04800"
                     /locus_tag="NDAI_0B04800"
                     /db_xref="GeneID:11498138"
     mRNA            complement(<1179801..>1180070)
                     /gene="NDAI0B04800"
                     /locus_tag="NDAI_0B04800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668709.1"
                     /db_xref="GeneID:11498138"
     CDS             complement(1179801..1180070)
                     /gene="NDAI0B04800"
                     /locus_tag="NDAI_0B04800"
                     /inference="similar to DNA sequence:INSDC:YJL062W-A"
                     /note="similar to Saccharomyces cerevisiae YJL062W-A;
                     ancestral locus Anc_1.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668757.1"
                     /db_xref="GeneID:11498138"
                     /db_xref="UniProtKB/TrEMBL:G0W6V3"
                     /translation="MVLEPSRYQDPRTWKMTPAMLRARKPFFKGNMIGLGILGALSVG
                     IYFYTYSFLHKDNDFIDVPIPPIDEKELEQLKREFELERSKRSGN"
     gene            <1180796..>1181581
                     /gene="NDAI0B04810"
                     /locus_tag="NDAI_0B04810"
                     /db_xref="GeneID:11498139"
     mRNA            <1180796..>1181581
                     /gene="NDAI0B04810"
                     /locus_tag="NDAI_0B04810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668710.1"
                     /db_xref="GeneID:11498139"
     CDS             1180796..1181581
                     /gene="NDAI0B04810"
                     /locus_tag="NDAI_0B04810"
                     /inference="similar to DNA sequence:INSDC:YJL063C"
                     /note="similar to Saccharomyces cerevisiae MRPL8
                     (YJL063C); ancestral locus Anc_1.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668758.1"
                     /db_xref="GeneID:11498139"
                     /db_xref="GOA:G0W6V4"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:G0W6V4"
                     /translation="MTVGITRKLNRTKPHRDALFKNLVTQLFQHGTIISTHEKCKEAS
                     RLADRLITMGKKIASDDQNTTKSSSLYLPHIQSKLFLSGDNSKLISKLFNDIIPVFKN
                     RNGGYTRVLKLESRLGDRADQSILELVDFLPVKTNSTEMGLNKGNMKLWLLINNIVKS
                     NHLNDVKDITWKNLYKIGQFKDKETFSNDILQITKFLKLNENNTNDWNESKEIDNVNK
                     IIEKIYSFIPNKCKTARINEFQKKGYVIMDKRPERPSPEQQLH"
     gene            complement(<1181777..>1184629)
                     /gene="NDAI0B04820"
                     /locus_tag="NDAI_0B04820"
                     /db_xref="GeneID:11498140"
     mRNA            complement(<1181777..>1184629)
                     /gene="NDAI0B04820"
                     /locus_tag="NDAI_0B04820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668711.1"
                     /db_xref="GeneID:11498140"
     CDS             complement(1181777..1184629)
                     /gene="NDAI0B04820"
                     /locus_tag="NDAI_0B04820"
                     /inference="similar to DNA sequence:INSDC:YBR276C"
                     /note="similar to Saccharomyces cerevisiae PPS1 (YBR276C);
                     ancestral locus Anc_1.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668759.1"
                     /db_xref="GeneID:11498140"
                     /db_xref="GOA:G0W6V5"