GenomeNet

Database: RefSeq
Entry: NC_016481
LinkDB: NC_016481
Original site: NC_016481 
LOCUS       NC_016481            1536206 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Naumovozyma dairenensis CBS 421 chromosome 3, complete genome.
ACCESSION   NC_016481
VERSION     NC_016481.1
DBLINK      BioProject: PRJNA79341
            BioSample: SAMEA2272418
            Assembly: GCF_000227115.2
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Naumovozyma dairenensis CBS 421
  ORGANISM  Naumovozyma dairenensis CBS 421
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Naumovozyma.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1536206)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1536206)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE580269.
            Accession numbers for all the chromosomes in this genome project:
            HE580267-HE580278.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1536206
                     /organism="Naumovozyma dairenensis CBS 421"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 421"
                     /db_xref="taxon:1071378"
                     /chromosome="3"
     gene            complement(<628..>4278)
                     /gene="NDAI0C00100"
                     /locus_tag="NDAI_0C00100"
                     /db_xref="GeneID:11494735"
     mRNA            complement(<628..>4278)
                     /gene="NDAI0C00100"
                     /locus_tag="NDAI_0C00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668865.1"
                     /db_xref="GeneID:11494735"
     CDS             complement(628..4278)
                     /gene="NDAI0C00100"
                     /locus_tag="NDAI_0C00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668913.1"
                     /db_xref="GeneID:11494735"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7A9"
                     /translation="MDVIRIDENHWVIDHFLVQERNGVKYIKHFTNSDRYLDQYRRHK
                     VNLMNTINLKKLSSEYPNTSIIPCQSKLIFDHVQTFTYEFYRKGEGLFKVNARTPRRF
                     RDISSPFTVIPFFPKAGPAKYLYYQNNSLQTNVIPPAFNRIIHSHNSSFFVKTLCLEN
                     IKLKTSDIEILLEYQPVKSIYQNLSVEMATRTYKDVREEYKERPFIRSFTSRDTKEPF
                     PKQYRSTTFSRYAKSFAFILYLIDNFRRFSFGTPRICNNLPIPLFNIDSTIEERTEKY
                     SDFFCYLYESKDKALACINILFRVMAFDWNRSLETKYEVKTLSHFKSTIDTFKGISIY
                     LCLHRHIHPTDKYSNTDKYFITDCTTVWDWIKKIYSILLTEYRTTKVISKPCAPDGYL
                     IGGLRFSRQYIQIFYQDIINRYDSNLEVIKKSYLNVQAPSVMGRKLLGTQGLCLEDDR
                     ANHKGSLVNLFPMELISKFLPYLSTAQIVEEEAKQEIKSAIDDMGVCLMWLIYFSTGG
                     PYRFPDLQIIKYAGNERNIFFDATGKCIELDTTYSKFRISKRLCKVVDQHTTFYLVHY
                     ILVCRSLLNNILGDFYAEINRDLFASGRKPNSVADDERNNVESKNSMGNVDEDEDEEE
                     SNQLFDEEEDAEEDADENKDDIIVPPINIFNEGKNLTDLDYSRQILHSTLFIDINTNK
                     IVHYERFKKFISQYPSSWEGKRLTFRDMRHGMIGLLREYVASGYNERFELSKEEYAGH
                     DANTGYTDYAVNPYKARHTPISKRSEVLSKLWQEWLGLRTYHEKKKFTPLHRTKEPKL
                     PTLTQSLYDIAYVRSSFFYDSRCLSEQENMLLLDIYMGQANLHPIQISPKDDAFNWYK
                     LPIYALSEVAANKNQISFIFEPTLSAKILALQKLSEIKSSLKVGGFDSIENIEFGPEE
                     HDFKYSIYVGTFENLLDRNFCDLIHKWDETMVKLSLCYLVINGFEKVNEDLIKDLNIG
                     SIKWFFKILLFTKVDARHQTKILMKNLGILKQLISVKRIDISECIYYHNLLKELPLKD
                     VYKELWKEESGYGTLQKCCSYSKRYLQLFNSRTNKKIVIISKQADAADALHAMLGDIS
                     IKITEKIDIRERFRLMDTFREQPNSKILIGTKVLLDFPNVENVALVLLMDYMPTISDY
                     ITFSSMITKENGIISSIFCEGSFEKDSMTLDCPTNQIRKFYGISETQPCNCCNNSNER
                     VRELLIEVHSND"
     gene            <12523..>13101
                     /gene="NDAI0C00110"
                     /locus_tag="NDAI_0C00110"
                     /db_xref="GeneID:11496446"
     mRNA            <12523..>13101
                     /gene="NDAI0C00110"
                     /locus_tag="NDAI_0C00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668866.1"
                     /db_xref="GeneID:11496446"
     CDS             12523..13101
                     /gene="NDAI0C00110"
                     /locus_tag="NDAI_0C00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668914.1"
                     /db_xref="GeneID:11496446"
                     /db_xref="UniProtKB/TrEMBL:G0W7B0"
                     /translation="MDFATVNGLKLRRPFSESRRNNIWRFLTNMYSVKQDNWILDEPT
                     TLLDDRGTSNTMFKEYIMKYFLIDKGRVMPDTVLETHFHKLMLKGNNHTLLVFGPNLF
                     KEQAFFSCDIEEAGKELLNNRYLLSSSRLRGFVRGLHSLPNILYKGYSYNESYKPSDL
                     PSKPNRLLYLPPSQDSNIPLQAFFMGFLKRMQ"
     gene            complement(<14961..>17153)
                     /gene="NDAI0C00120"
                     /locus_tag="NDAI_0C00120"
                     /db_xref="GeneID:11496447"
     mRNA            complement(<14961..>17153)
                     /gene="NDAI0C00120"
                     /locus_tag="NDAI_0C00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668867.1"
                     /db_xref="GeneID:11496447"
     CDS             complement(14961..17153)
                     /gene="NDAI0C00120"
                     /locus_tag="NDAI_0C00120"
                     /inference="similar to DNA sequence:INSDC:YKL025C"
                     /note="similar to Saccharomyces cerevisiae PAN3 (YKL025C);
                     ancestral locus Anc_2.669"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668915.1"
                     /db_xref="GeneID:11496447"
                     /db_xref="GOA:G0W7B1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W7B1"
                     /translation="MDKINAEWAKDIPCRNITIYGYCKKIKDGCPFKHGDDVENENLI
                     ESTTPKPQTTTIADIIPTLPRLSNTIVTPTPSPVPKFNAKNSASFTPMSTKTPELNNT
                     PIFDNNPIVSSPILTAGTIPLTNVNNTNTIAPVHSTHDSNNIQDDIQMKSASKSPSTI
                     INPLAQSSYLPISTNDQYNSVESSNQAATQSPIMNNSNNLSQNINAMPHSSFPLAQTG
                     KTLLHGDPNLPSTGILNSQQMLLSNYQSILPQSENTIPEIDFKYPSIYPPPHSILQYH
                     LYAPDPPPQLKLPLKPNERTPESLFISNNLREQLVKRNLASLQVFPAGGAIPDIVQDY
                     FGLVPLDFHQKSNSKDYIDFYSGHKNSLFKVFSNLDGKLYLLRRIHDVTINDPQQITK
                     SFSKWNELACNSIIKLKDMFTTLKFGDSSLCLVYDYYPLAISLYEYHFINFPLIPLTQ
                     DYLWTYLVQLTNAINVAHSKGLTLGKELLNWDKILIVGDPGRIKISSCGAYDVLTQRT
                     DTSTIPNNSNNNNNNIINMEEQLQIQKQNDFSQLGIFLQKLSCKINGVDNTSNVEKID
                     DLNVDDQFKTVLKYLLDKSNKNKNIKELSQLFIDKILSNLESFQGYAEFTEATLSKEL
                     ENARLFRLICKLNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQLDSNGKPIMDLT
                     HVLRCLNKLDAGIQEKIVLVTPDELNCIVITYKELRDLIDSTFRSLSQ"
     gene            <17937..>18695
                     /gene="NDAI0C00130"
                     /locus_tag="NDAI_0C00130"
                     /db_xref="GeneID:11496448"
     mRNA            <17937..>18695
                     /gene="NDAI0C00130"
                     /locus_tag="NDAI_0C00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668868.1"
                     /db_xref="GeneID:11496448"
     CDS             17937..18695
                     /gene="NDAI0C00130"
                     /locus_tag="NDAI_0C00130"
                     /inference="similar to DNA sequence:INSDC:YIR035C"
                     /note="similar to Saccharomyces cerevisiae YIR035C;
                     ancestral locus Anc_2.668"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668916.1"
                     /db_xref="GeneID:11496448"
                     /db_xref="GOA:G0W7B2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W7B2"
                     /translation="MPKIIIVTGVSRGIGRSIVDKTIELSDDSIVFGVARSETPLKEL
                     KEKYGDRFHYAVGDITDENVINKLVKDAIATGGKIDSVVANAGVLEPVQDVNNIDVNA
                     WKRLFDINFFSVVALTSATLPYLKKTNGNIIFVSSDASDTHFSSWGAYSASKACINRF
                     AMTVGHEEPAVKCLSVAPGIVDTSMQVNIRENVGTSMSAEHHQMFKDLKETNKLASSE
                     DVATVYSKLALNGIPKDLNGTYISYDDPLLKDFA"
     gene            complement(<19018..>19656)
                     /gene="NDAI0C00140"
                     /locus_tag="NDAI_0C00140"
                     /db_xref="GeneID:11496449"
     mRNA            complement(<19018..>19656)
                     /gene="NDAI0C00140"
                     /locus_tag="NDAI_0C00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668869.1"
                     /db_xref="GeneID:11496449"
     CDS             complement(19018..19656)
                     /gene="NDAI0C00140"
                     /locus_tag="NDAI_0C00140"
                     /inference="similar to DNA sequence:INSDC:YKL024C"
                     /note="similar to Saccharomyces cerevisiae URA6 (YKL024C);
                     ancestral locus Anc_2.667"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668917.1"
                     /db_xref="GeneID:11496449"
                     /db_xref="GOA:G0W7B3"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006266"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7B3"
                     /translation="MTTPSTLTSESKPVFSADQISVIFVLGGPGAGKGTQCAKLVEDY
                     GFVHLSAGDLLRAEQAREGSEYGTLIKHYIKEGLIVPQEITLALLKNAIQEHYNNKGA
                     KNFLIDGFPRKMDQAISFEEQIAPSKFTLFFDCPENVMLERLLERGKTSGRVDDNIES
                     IKKRFKTFVETSMPVVNYFDKQSKVVKIRCDEPVEKVYNQVKAAVDERVPKI"
     gene            complement(<19693..>20004)
                     /gene="NDAI0C00145"
                     /locus_tag="NDAI_0C00145"
                     /db_xref="GeneID:11496450"
     mRNA            complement(<19693..>20004)
                     /gene="NDAI0C00145"
                     /locus_tag="NDAI_0C00145"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668870.1"
                     /db_xref="GeneID:11496450"
     CDS             complement(19693..20004)
                     /gene="NDAI0C00145"
                     /locus_tag="NDAI_0C00145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668918.1"
                     /db_xref="GeneID:11496450"
                     /db_xref="UniProtKB/TrEMBL:G0W7B4"
                     /translation="MYYSFPKHIVFISHKTGFLKRHSLNISAKRFSTYTFLCYEQNNS
                     TSNNEKSFHTRQSSNIEKKSKQNKNTKTSLLLLGLLAIGTTFISISYSKGEPEEYLEK
                     S"
     gene            <20313..>21638
                     /gene="NDAI0C00150"
                     /locus_tag="NDAI_0C00150"
                     /db_xref="GeneID:11496451"
     mRNA            <20313..>21638
                     /gene="NDAI0C00150"
                     /locus_tag="NDAI_0C00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668871.1"
                     /db_xref="GeneID:11496451"
     CDS             20313..21638
                     /gene="NDAI0C00150"
                     /locus_tag="NDAI_0C00150"
                     /inference="similar to DNA sequence:INSDC:YKL023W"
                     /note="similar to Saccharomyces cerevisiae YKL023W;
                     ancestral locus Anc_2.666"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668919.1"
                     /db_xref="GeneID:11496451"
                     /db_xref="UniProtKB/TrEMBL:G0W7B5"
                     /translation="MNEGDILHFLLQNDEESTARGEEKNISDNQWLQPETHVVKVKET
                     QDLISKKVNDDRWPVPTHPDSSEDDFTDDLDDLLFMPTKGKNAIVFKPFRMKLGELDK
                     EASVQGEVRNKKSSNRKKAKAETVSKSQVEHDFPRDKLQNADSKRKGSRRKETSVISA
                     KKERTKEIVPKSAEDNSREENVQTDKKSMSRMKLKPNPANSKSTTKPFKESHLKSLNE
                     KLENRRKKNKNWKRNIVSDDVYEPLEPIAFKTRSGEIINAEKIEFIDVTNNKTVQKPE
                     SKNRRKEDIKLDKNEGDVKENKKSIRKKKSKRDQGPKTTNTNADTDTNTTSKNAEGHI
                     FDTITQKSSVISTSVTATEVTLESDPRPSQVKDDTQPTKNKNRNRNRNKKGKSKPVDD
                     GNVKEEKKVLDQQDSSSVNDSNPRKENLIKARKGERKRNSRKKSHLTEK"
     gene            complement(<21850..>24186)
                     /gene="NDAI0C00160"
                     /locus_tag="NDAI_0C00160"
                     /db_xref="GeneID:11496452"
     mRNA            complement(<21850..>24186)
                     /gene="NDAI0C00160"
                     /locus_tag="NDAI_0C00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668872.1"
                     /db_xref="GeneID:11496452"
     CDS             complement(21850..24186)
                     /gene="NDAI0C00160"
                     /locus_tag="NDAI_0C00160"
                     /inference="similar to DNA sequence:INSDC:YKL022C"
                     /note="similar to Saccharomyces cerevisiae CDC16
                     (YKL022C); ancestral locus Anc_2.665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668920.1"
                     /db_xref="GeneID:11496452"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W7B6"
                     /translation="MKNQMSPSQSAQQLHPSQTPSQHNSTLAISPFVVTKSSSRLPTQ
                     RPSQGQHAQSVQEGSHHQSPYRALATSPLFQRTNQRATIDDALTTPHQKSTTSQNNNS
                     SLLASMSKIGTFGTTIPSTLRKVSVQREYRDDDINSQPQGDNTGEKGNNANGNNLLSV
                     DASSYNAGHTTTTTTLTTTTRTTATSAEIDYTDLTSIEKLRLWRHDALMQHMYRTAEY
                     IGNKIYTITADPNDAFWLAQVFYNNGSYLRAIELLSKDSYATSNVICRYLMGLCLFKL
                     ERFDDALDIVGETNPFATSKEKIDVENPEIPIQADGGIKIESSLCFLRGKIFLSQNNF
                     TKAKQSLKDAILIDVKNFEAYEELICKNLLSPEEQWNLYQSLDFSGLDDNEEMIRNLY
                     KISLSQYLNNAEIESSETLLTQEYGLGNSVDVMRSKLEKLFIQWKFNECLELCERALE
                     DDEFNPTVLPIYLSCLFELGGDNKLFLISHNLAENFPKWAITWFSVATYYMSLNNIPM
                     ARKYFSKASILDPTFSSAWLGFAHTFALEGEHDQAISAYSTASRFFPGIHLPNMFLGM
                     EYMASSTLSLAEEYFTLAYDTCRFDPLLLNEMGVLYFKKNELSKSKKYLKKALESLRA
                     SNMTSKMAFSIQMNLAHTYRKLGENERAIKCFKAVLEESGHDADIYCSLGFLYLKTNQ
                     LEKAVDYLHNSLSLKPTNNSAQELLLHALELNVSMTIDDLHPLMVNAKLQDDTSLQRK
                     RSTGSSFDPINITKKLKITGKSRKPTVDGDGDETMELE"
     gene            complement(<24683..>25888)
                     /gene="NDAI0C00170"
                     /locus_tag="NDAI_0C00170"
                     /db_xref="GeneID:11496453"
     mRNA            complement(<24683..>25888)
                     /gene="NDAI0C00170"
                     /locus_tag="NDAI_0C00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668873.1"
                     /db_xref="GeneID:11496453"
     CDS             complement(24683..25888)
                     /gene="NDAI0C00170"
                     /locus_tag="NDAI_0C00170"
                     /inference="similar to DNA sequence:INSDC:YKL021C"
                     /note="similar to Saccharomyces cerevisiae MAK11
                     (YKL021C); ancestral locus Anc_2.663"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668921.1"
                     /db_xref="GeneID:11496453"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0W7B7"
                     /translation="MPRNQFRIIVGSYEHNILCLSLDLTLSTPVFTPIFHFQAHSLSV
                     KCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKTKHGSTEGEGS
                     NNKWLLSASEDHKIIIWRVKDWENFGTLKGHIARINDIDIHPSNRVAISVSDDHSIRL
                     WNLMTVKKAAVLKLRKYSQNGQFVRWLGKDGEFFAVALLNKILIYRTSTAKVHCEIDI
                     EKKTIMHMEIAYLKEKLSNDDNQTKEEDEQEYICVGISDGNILFYPTKALLKEEPNVQ
                     EPEFSLLGHTNRVKDFKFYQNEFGTYLVSIGSDGKVVVWDMKDRNQIAVYDCGERLNC
                     LSLVDETVEKYDTMKKRSLESADLGEQSEVESDTEELKKVMFGKKNNKKSKKAKKNQN
                     KKKVDVQLE"
     gene            complement(<26262..>30002)
                     /gene="NDAI0C00180"
                     /locus_tag="NDAI_0C00180"
                     /db_xref="GeneID:11496454"
     mRNA            complement(<26262..>30002)
                     /gene="NDAI0C00180"
                     /locus_tag="NDAI_0C00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668874.1"
                     /db_xref="GeneID:11496454"
     CDS             complement(26262..30002)
                     /gene="NDAI0C00180"
                     /locus_tag="NDAI_0C00180"
                     /inference="similar to DNA sequence:INSDC:YIR033W,YKL020C"
                     /note="similar to Saccharomyces cerevisiae MGA2 (YIR033W)
                     and SPT23 (YKL020C); ancestral locus Anc_2.662"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668922.1"
                     /db_xref="GeneID:11496454"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002909"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W7B8"
                     /translation="MITSMQNTVPLKTPPDTVKKDDLNIDPLEATTLDNFIMSASSLL
                     SSLDNNTHQLLPSTNQNSAIIPVESQLFLQSPIQQQQQQQQNGTGTAPGTGAIETRQE
                     QNNNDVTPLRIKSITTAMTYHDSEASPYNTTTSITNQFQKPKAISTSKSTSTSTKGKL
                     TNELRSQIDETFSFGKIESFDTQLQNLTEFIKIDSNQLPFQLQVGNLPKVSRVENQMN
                     INLKLSPTISTSSSSSSPFLKENLLYLPTNTIAKEKFYLQKPLNQYPQDIIEKLLHLE
                     AFVVSIENNTNTFKQIYVCDRCVKREQRRASRRKSGLCDNLLWCQDSNKSVLIFNNKQ
                     IIPLIEEENNDSNDSTKQFELSSRIVCYCRHHKSPFGFKILFLIKNFKNEIIAKALTD
                     SIMIIDKKSNSSEELWLNGNNELSVPSDSDIISNFAHPSSYSTINPLNLNHNKTSSFG
                     NNNSDTNNLSMNTYLDNHPYQPTTTNSSSSSSSQILNINMATNNNKIYTNNNNNTMLF
                     PSPNSVSEASSEVNSSTYHNSQPPPPPHQYHQYPHHHHHHHQRKFSTQSSISSINETA
                     PAFSFSSSSISMNNNIDRNMNINNNNNNNVTNFVTNKRVRHNIDDDQFPQQYQQQQQQ
                     QMQMQMQMQVQQAHQQNPLTTLYPKTPSFAHLSAEFIHPSFVNQPIVQRIIPSQGSIN
                     GGIEITILGSKFKQGQIIKFGENIALSSQCWNETTMVTYLPPSSVAGQVYVTVLNSNN
                     NNNNNNNGNTTNENHLEIPQNYKGVFTYIDDTDKQLIELALQIVGLKMTGKLEDAKNI
                     AKRIIGQENSKFITPQSQPSSSSTSSSSCSSSWCFSDSIYQNKESYEGILCSIIKKSD
                     SSYNLSIRDNVGRTLLHLASHKGYFHLCSNLIYKGARIDSRDSFGFTPLHYACISGNI
                     KIIELLMKCNVADINSKICNGLTARDLFMKNHIHTTEPSNILSLDDIEYILDLFEKYE
                     DGNVISQRNDSNSSFQSSLGLIDYPNNDIITYQNSQSLQRTSNLSSSNEKEHGYEQDN
                     DSLSLLDHDDDNISVIDLIAANNTVNNNNNNNNNNNTLWNRMIHRFNDRELPKYEDLF
                     PNGNLFWDSTNKQSKTSNENVPTLPINNSIIISNNTLTSCQSLTDDIDSPSNDEADDI
                     ELFTKSINNFFEHKRRSLKNDKMLLFFWIPLMAVLLSWLFLYSISSNDTIIPRISTMI
                     PKYLRNSLAKIVLGNQRMQSALKEQISNFQTTTRVFQNGIGA"
     gene            complement(<30838..>32319)
                     /gene="NDAI0C00190"
                     /locus_tag="NDAI_0C00190"
                     /db_xref="GeneID:11496455"
     mRNA            complement(<30838..>32319)
                     /gene="NDAI0C00190"
                     /locus_tag="NDAI_0C00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668875.1"
                     /db_xref="GeneID:11496455"
     CDS             complement(30838..32319)
                     /gene="NDAI0C00190"
                     /locus_tag="NDAI_0C00190"
                     /inference="similar to DNA sequence:INSDC:YNL261W"
                     /note="similar to Saccharomyces cerevisiae ORC5 (YNL261W);
                     ancestral locus Anc_1.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668923.1"
                     /db_xref="GeneID:11496455"
                     /db_xref="GOA:G0W7B9"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7B9"
                     /translation="MSSLIPDVLFRDYQVELLESYLLDDPNVSPLNLFIQGYKATGKT
                     YTLEKYFQYHPDDLLHAWIKPLELVSWKPFIQAIARTVQETLQTKYPSVSNNDDRNEK
                     EEDEENLKRLDTLSVEEPYLLMNFLETILSKYATALMEPRSFYLILDGFDSFHDLDTQ
                     LIQTIFKLSEILNVSNGGQQLKIKLKFIHIIQDSSFLNRYTSYCLPTIIFPRYNIDEL
                     IEILIFSRSKDLLMNYKFTEKCNELLIFNNEEKLSIVINFIQLIIQSFNSYTGNDIYA
                     INDLIDFKWEIYVDGMNSDNISNPLALYKKTLKIFTSTDCSLVQENDNEQQESDTVTT
                     TTTYSISKMSKYLLIAAYLCSYLEPRFDSFLFSLKSELKTGRSSTGRRKKKDINPRFL
                     QASLFSIERLLAIFQNIYPMEMNWKSGSLASLGENSLIRSNVEVFQNLAELDSLKLLA
                     TTKNIDLLNHKNKWKVNVPWEIIEEVAKSVDFDINQYFSGIHD"
     gene            <32604..>33434
                     /gene="NDAI0C00200"
                     /locus_tag="NDAI_0C00200"
                     /db_xref="GeneID:11496456"
     mRNA            <32604..>33434
                     /gene="NDAI0C00200"
                     /locus_tag="NDAI_0C00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668876.1"
                     /db_xref="GeneID:11496456"
     CDS             32604..33434
                     /gene="NDAI0C00200"
                     /locus_tag="NDAI_0C00200"
                     /inference="similar to DNA sequence:INSDC:YGL128C"
                     /note="similar to Saccharomyces cerevisiae CWC23
                     (YGL128C); ancestral locus Anc_1.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668924.1"
                     /db_xref="GeneID:11496456"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G0W7C0"
                     /translation="MSSNLKEIIKEGKDLYEDLEITDALTRRISIQEIKRQYRTLALK
                     YHPDKHPNDSNLIHKFHEISIATNILTDEKLSEEYISWYRVAKKKQLKLHKEDQERHE
                     MINKLNILESEPAHVDVDIRNRNIEMIQKYGETLRKLKHFGIPYGSWKGNVSMEDITK
                     EKQNYNKIIIHDDDDDDXXXXXXXNEEETLNNLRDILQCPEIIGIKQSDPMTGEPMSI
                     DQNEVFLSFANPKKALEALSRLQSNRVCENVMPFINPECFARKDNPIFQQILTLPLLP
                     "
     gap             33136..33155
                     /estimated_length=20
     gene            <33765..>34715
                     /gene="NDAI0C00210"
                     /locus_tag="NDAI_0C00210"
                     /db_xref="GeneID:11496457"
     mRNA            <33765..>34715
                     /gene="NDAI0C00210"
                     /locus_tag="NDAI_0C00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668877.1"
                     /db_xref="GeneID:11496457"
     CDS             33765..34715
                     /gene="NDAI0C00210"
                     /locus_tag="NDAI_0C00210"
                     /inference="similar to DNA sequence:INSDC:YKL019W"
                     /note="similar to Saccharomyces cerevisiae RAM2 (YKL019W);
                     ancestral locus Anc_2.661"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668925.1"
                     /db_xref="GeneID:11496457"
                     /db_xref="GOA:G0W7C1"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:G0W7C1"
                     /translation="MEFNIEDYKDVDRLPITTGLEDELCAIMYTDEYKEVMGIARSLF
                     QSKEFSNRAKRLTSKVIQLAPAYYTIWNYRYEIIESEIKKMSEPDSTNFLNKELSWLD
                     EITLNNPKNYQIWSYRQAIIKLHPNPDLKLEFPIISMMIDDDTKNYHVWSYRKWCILY
                     FQDFSNELTFCDNFIQRDVYNNSAWTHRMFVWKNLNPSKVQIMDELNYLKEKIELVPQ
                     NISVWTYLRGLYENFLNDQYDQEIINFAETFINGLFDNTTTLPKIESTYALEFLADIY
                     SRNPETLQNSITAYNALSIKYDPVRINFWNHKLKKLTPCA"
     gene            complement(<34841..>35116)
                     /gene="NDAI0C00220"
                     /locus_tag="NDAI_0C00220"
                     /db_xref="GeneID:11496458"
     mRNA            complement(<34841..>35116)
                     /gene="NDAI0C00220"
                     /locus_tag="NDAI_0C00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668878.1"
                     /db_xref="GeneID:11496458"
     CDS             complement(34841..35116)
                     /gene="NDAI0C00220"
                     /locus_tag="NDAI_0C00220"
                     /inference="similar to DNA sequence:INSDC:YKL018C-A"
                     /note="similar to Saccharomyces cerevisiae YKL018C-A;
                     ancestral locus Anc_2.658"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668926.1"
                     /db_xref="GeneID:11496458"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:G0W7C2"
                     /translation="MSVKSIIHIGFDMTLIAMLLAAIRRDTGLILKYEKFDFSTVIYG
                     YLNWGEHWYTKLVNYCKKSPKFRKLSPTDRFIDDDNTTTIGRIEELD"
     gene            <35404..>36426
                     /gene="NDAI0C00230"
                     /locus_tag="NDAI_0C00230"
                     /db_xref="GeneID:11496459"
     mRNA            <35404..>36426
                     /gene="NDAI0C00230"
                     /locus_tag="NDAI_0C00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668879.1"
                     /db_xref="GeneID:11496459"
     CDS             35404..36426
                     /gene="NDAI0C00230"
                     /locus_tag="NDAI_0C00230"
                     /inference="similar to DNA sequence:INSDC:YKL018W"
                     /note="similar to Saccharomyces cerevisiae SWD2 (YKL018W);
                     ancestral locus Anc_2.657"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668927.1"
                     /db_xref="GeneID:11496459"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W7C3"
                     /translation="MSLTISKENLQKFKAVKSFKVQEKELTPITSIGFDDYGQYLLTA
                     SANDNMHLYDSVSCRFINTIASKKYGCHSAKFTHAQNECIYSSTMKSFDIRHLNLETN
                     QYLRYFMGHDALVSDIQMSPLNDTFLSASYDESVRLWDLRVSKAQALIPTVVPVCIAY
                     DPSGLVFALGNPESFEIGLYNVKQLKNGPFLIIKIQQQTETTTTTTNNSKKFDQWNKL
                     EFSNNGKYLLVSSSMGKQLIFDAFDGSQLFELTGTKPFPLREFMDSGSACFTPDGDFV
                     LGTDYEGKIALWNLSDQISNKTLKPQTTIQAVPTSSPRTIAFNPKYSMFVTADECVDF
                     YVYDEN"
     gene            complement(<36560..>38659)
                     /gene="NDAI0C00240"
                     /locus_tag="NDAI_0C00240"
                     /db_xref="GeneID:11496460"
     mRNA            complement(<36560..>38659)
                     /gene="NDAI0C00240"
                     /locus_tag="NDAI_0C00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668880.1"
                     /db_xref="GeneID:11496460"
     CDS             complement(36560..38659)
                     /gene="NDAI0C00240"
                     /locus_tag="NDAI_0C00240"
                     /inference="similar to DNA sequence:INSDC:YKL017C"
                     /note="similar to Saccharomyces cerevisiae HCS1 (YKL017C);
                     ancestral locus Anc_2.656"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668928.1"
                     /db_xref="GeneID:11496460"
                     /db_xref="GOA:G0W7C4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004483"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7C4"
                     /translation="MNKQLASKFLDAISHERDQDVEITSQLLNSLPLSKLIENGYAIS
                     NLLLENIKTGLGGKLYLELSPDNAINDSIVNNGNIKTGDIVLIKPLISHSNKAKHHRN
                     KKAHEHNGDIDTNDTDNIQCDGTIFKISDQQITIALNESSQEPQENITTKLYSFNRLY
                     LLKTTNTITYKRMESTMRKLSEFEGIPSNKIIQYLLNERPFLKQTTSSNNIQFHNENL
                     NQSQREAIKFALINDISIIHGPPGTGKTYTLIELIQQLVERGQRILVCGPSNISVDTI
                     LERLNGVLPGNLLLRIGHPARLLDSNLRHSLDILSKSGDAGAIVKDIYHDIDKTISGI
                     KKLKSYKDKRESWKEVKELRKELRIRERKVINDLILEAKVVVATLHGSSSRDLCKLYN
                     DESVTSLFDTLIIDEVSQSLEPQCWIPLISHYKSDISKLVLAGDNKQLPPTIKTEDNK
                     LVQKLLQTTLFDRLVSIYGDQFRKLLNVQYRMNEEIMEFSSNEMYEGKLLADVTVASH
                     LLSDLSGVDSNEDTDIPLIWYDTQGDEFMESVSDSNTNNNNNNNNNNPLASSKFNENE
                     ALVVKDHVEKLIASNVPQECIGIISPYSAQVNLLKSLIRTDYPLIEISTVDGFQGREK
                     EVIILSLVRSNDKFEVGFLSDDRRLNVAMTRPKRQLCVVGNIECLQRSQVPFLKKWAD
                     WSEENSEIRYPDINDLL"
     gene            complement(<38990..>39514)
                     /gene="NDAI0C00250"
                     /locus_tag="NDAI_0C00250"
                     /db_xref="GeneID:11496461"
     mRNA            complement(<38990..>39514)
                     /gene="NDAI0C00250"
                     /locus_tag="NDAI_0C00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668881.1"
                     /db_xref="GeneID:11496461"
     CDS             complement(38990..39514)
                     /gene="NDAI0C00250"
                     /locus_tag="NDAI_0C00250"
                     /inference="similar to DNA sequence:INSDC:YKL016C"
                     /note="similar to Saccharomyces cerevisiae ATP7 (YKL016C);
                     ancestral locus Anc_2.655"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668929.1"
                     /db_xref="GeneID:11496461"
                     /db_xref="GOA:G0W7C5"
                     /db_xref="InterPro:IPR008689"
                     /db_xref="UniProtKB/TrEMBL:G0W7C5"
                     /translation="MSLSKSAANKLDWAKVITSLKLSGSTATQLSNFKKRNDEARRQL
                     LELQSKPTTVDFNHYRSILQNSEIVDKIESFYKSYTPVTLDIKSQLNSLSKFENHAME
                     NAKETESMVASELKALDETLQNIQNARPFDQLTVDELVQAKPEIDEKVEKMVKTGQWD
                     VPGYKEKFGDLTIM"
     gene            <40019..>43144
                     /gene="NDAI0C00260"
                     /locus_tag="NDAI_0C00260"
                     /db_xref="GeneID:11496462"
     mRNA            <40019..>43144
                     /gene="NDAI0C00260"
                     /locus_tag="NDAI_0C00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668882.1"
                     /db_xref="GeneID:11496462"
     CDS             40019..43144
                     /gene="NDAI0C00260"
                     /locus_tag="NDAI_0C00260"
                     /inference="similar to DNA sequence:INSDC:YKL015W"
                     /note="similar to Saccharomyces cerevisiae PUT3 (YKL015W);
                     ancestral locus Anc_2.654"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668930.1"
                     /db_xref="GeneID:11496462"
                     /db_xref="GOA:G0W7C6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W7C6"
                     /translation="MSSQLEHNSKYGNSNYNGNNHKEEGHQDIVPPIPRKSNACIQCR
                     RRHVKCPNGNPCLRCVKSKLQCEYSEPSRKIVVSLSYLQNLQDSIITLKKNNLKLQSQ
                     LSTCQRTHPPLTSTSTVSPTSMSDLKKILNSDDGRSSSSSNNENDNDDNSGFATHEQS
                     RYLPVSNLQQDLANDVVFNNNTVPNDINAVNHPELIYTDNTFRDDDDNKNEQIESSLS
                     QRSGRLVETPTGQLYFVGSSSMTLFGIEIQALASKYLIDKKVCKPLPINEKEEDEQEI
                     IKINNSKKDEKSTNKNQKKTTRNQTGSIESRKSNILKQRLSLISSLTDPVAHIEKNLD
                     NDDAGSIAITLTFNESSILNDSAKVQFKLPSYQYSLLLIDTFVAYNDGSFYFFNEGII
                     KNELKIIYNHNRKNETNGRVFQSNLLQSIWYCKILLIFALGEMYHGTRNDLNGNLQKK
                     SSKLLRYNNLRKRRKLNDNNNTTPTRHHNYKNNLLLLQSSNLPGSEFFNEASKIFNCL
                     FSSEHLDCITKDGGVEVLLLYAFYLQVADCTVASYFYFGQALRTCLILGMHVDAQRDT
                     LSRFELEHHRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELPDNFDMNYPPPGCEHY
                     IFPEAEYISNCVKIVQINAQILNQLYQRQPDSNILPTVQNIITKLLNWRNELSSNSQV
                     DFNVPNLTISRLSTNLFTEYFQGINLAVRPLLFHFVSIQLKKFQNKNYNSYLNLQDYP
                     NSITTLLNCSLQSSVNTIRSLWLLMKQNMLALFGYMDREYLFTSSCTLLLFNATFGIH
                     EQTSQYLDQSLEILTKMQILGNNPAGLRKTQLLTMMINLDFHGIMKNLISKYSIEDES
                     IIIEYEKNENISVHNKESESTYSIPKFYENILNGMIEENNTSTNHSTSPAYDDTKGEL
                     NRDENIIDLPVDSNDDGTKMMHTPLMNSISRTASLANLFNPSVAPNYQTEPLTDKGNE
                     IIEQNGTQLRPTNYVDNDELQEMLDSLDQLSNTDNKLWKEISDQAMWLGDTMDPTAAV
                     GSELDVKDFLS"
     gene            complement(<43317..>43832)
                     /gene="NDAI0C00270"
                     /locus_tag="NDAI_0C00270"
                     /db_xref="GeneID:11496463"
     mRNA            complement(<43317..>43832)
                     /gene="NDAI0C00270"
                     /locus_tag="NDAI_0C00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668883.1"
                     /db_xref="GeneID:11496463"
     CDS             complement(43317..43832)
                     /gene="NDAI0C00270"
                     /locus_tag="NDAI_0C00270"
                     /inference="similar to DNA sequence:INSDC:YKL013C"
                     /note="similar to Saccharomyces cerevisiae ARC19
                     (YKL013C); ancestral locus Anc_2.650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668931.1"
                     /db_xref="GeneID:11496463"
                     /db_xref="GOA:G0W7C7"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:G0W7C7"
                     /translation="MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNQS
                     AELLLQPMHISRNEHEQVLIEPSINSIRVSLKVKQADEIEQILVHKFTRFLEQRAESF
                     YILRRVPIQGYSISFLITNKHTESMKTGKLVDFIIEFMEEVDKEISEMKLFLNARARF
                     VAEAYLGEFVY"
     gene            complement(<44255..>44761)
                     /gene="NDAI0C00280"
                     /locus_tag="NDAI_0C00280"
                     /db_xref="GeneID:11496464"
     mRNA            complement(<44255..>44761)
                     /gene="NDAI0C00280"
                     /locus_tag="NDAI_0C00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668884.1"
                     /db_xref="GeneID:11496464"
     CDS             complement(44255..44761)
                     /gene="NDAI0C00280"
                     /locus_tag="NDAI_0C00280"
                     /inference="similar to DNA sequence:INSDC:YIR022W"
                     /note="similar to Saccharomyces cerevisiae SEC11
                     (YIR022W); ancestral locus Anc_2.648"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668932.1"
                     /db_xref="GeneID:11496464"
                     /db_xref="GOA:G0W7C8"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="UniProtKB/TrEMBL:G0W7C8"
                     /translation="MNLRLELQRLLGLCFMFSSAYMFWQSLSLLANTESPIVVVLSGS
                     MEPAFQRGDILFLWNRDTQNKVGDVVVYEVEGQSIPIVHRVLREHHSTKKEKQFLLTK
                     GDNNAVNDISLYKGKKIYLSKEKDIVGTVKGFFPQLGYVTIWVSENKYAKFALLGFLG
                     ISSLLSGE"
     gene            complement(<45135..>46385)
                     /gene="NDAI0C00290"
                     /locus_tag="NDAI_0C00290"
                     /db_xref="GeneID:11496665"
     mRNA            complement(<45135..>46385)
                     /gene="NDAI0C00290"
                     /locus_tag="NDAI_0C00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668885.1"
                     /db_xref="GeneID:11496665"
     CDS             complement(45135..46385)
                     /gene="NDAI0C00290"
                     /locus_tag="NDAI_0C00290"
                     /inference="similar to DNA sequence:INSDC:YIR021W,YKL011C"
                     /note="similar to Saccharomyces cerevisiae MRS1 (YIR021W)
                     and CCE1 (YKL011C); ancestral locus Anc_2.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668933.1"
                     /db_xref="GeneID:11496665"
                     /db_xref="GOA:G0W7C9"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:G0W7C9"
                     /translation="MNPFLSKLNIYCGNLKAKTLKDLSIITGSPIGITKSERTKDILN
                     QCLDLEQLRQRKLQQGYIIINSIDTGISNFSFTKFKWNINDKLPILLSWEKIQLQQKF
                     LTNLPNNHHKKFDKLSSNMSPKEFSLLTHNLVNYLLLLSSSQSSQRSYTIPDVFTIER
                     QRTRTISSKFVLDPIINCNILENLLFSSLENRLRNLKDVDSIKPYLVLSSNPQRMTSF
                     WCPNMKTMNNNNNNNNNNNNNNNNNNNNNNTEDHEPLSEKKEKRVKLNDNKLSKTFKI
                     NLVKDILRTRCLSQQHSNDQFIELDSHWGDHLNHVITKNPTKFKLYDCLINDDEEMNN
                     LGQNGTKKDDDLADSFLHGLSWIEWLRSYEGIYKLLNEGKEGEDRDSNSGYINETLLN
                     DFIEYCHERKLFVDKIQERVINLP"
     gene            complement(<46870..>47778)
                     /gene="NDAI0C00300"
                     /locus_tag="NDAI_0C00300"
                     /db_xref="GeneID:11496666"
     mRNA            complement(<46870..>47778)
                     /gene="NDAI0C00300"
                     /locus_tag="NDAI_0C00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668886.1"
                     /db_xref="GeneID:11496666"
     CDS             complement(46870..47778)
                     /gene="NDAI0C00300"
                     /locus_tag="NDAI_0C00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668934.1"
                     /db_xref="GeneID:11496666"
                     /db_xref="GOA:G0W7D0"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:G0W7D0"
                     /translation="MSNTYLEQQKTTDTLSHHDTGHIENDDHLHDDKQKDPMSLKHSR
                     FNIGRDSFRTHLIAAVGEFCGTFMFLWCSYVVANVANHDALMDAYPDGTHPEQLLMIA
                     FGFGFSVMFSVWCFADVSGGALNPAVSLSLVLARAITPQRCIVHWLSQWIAGMAAGGA
                     AHAMTPGSVKFANTLGNGCSRSRGVFLEMFGTAILCLTVLMTAVEKRASSFMAALPIG
                     ISLFISHAALTAYTGTGVNPARSFGAALAAKSFPPYFWIYIVGPILGATLAWSVWQLL
                     QWLDYTTYVQAEKDGVKSTGEVRTEV"
     gene            <49848..>51743
                     /gene="NDAI0C00310"
                     /locus_tag="NDAI_0C00310"
                     /db_xref="GeneID:11496667"
     mRNA            <49848..>51743
                     /gene="NDAI0C00310"
                     /locus_tag="NDAI_0C00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668887.1"
                     /db_xref="GeneID:11496667"
     CDS             49848..51743
                     /gene="NDAI0C00310"
                     /locus_tag="NDAI_0C00310"
                     /inference="similar to DNA sequence:INSDC:YKL088W"
                     /note="similar to Saccharomyces cerevisiae YKL088W;
                     ancestral locus Anc_2.646"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668935.1"
                     /db_xref="GeneID:11496667"
                     /db_xref="GOA:G0W7D1"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:G0W7D1"
                     /translation="MSQNSNKLTTHGEPSLITIKKDAATQPVSILNKINTTTTNGGKP
                     LAVNDTAKSKLATTIEKIYPTNGNLNINPVTNPISNRQQISDNQKDPTDTLTNSRPSD
                     KKARLYMNNDINNNILPADQLRSVSNVSIKTAVSFSTNNENEKQLHHRYSISNKPTSK
                     NNSQENLNNNNNNNNHRLSIDTTGVNNKKVTSKTKNEDNIQDDGTLEEKNSIVHMPGD
                     FIYLEPKTPTSSSIDSNNKQITQSHARLITPHRNDTASTIVGTGTATTTSTATVTPAT
                     NSSTHNTKSNVKNPKEIIGTPKGPQIPFYEFFQKQDDKKIHILMGTTGSVATIKVPLI
                     IDKLFKIYTPERVSIQLIVTKPAEHFLKGLKISSHVKIWREEDVWYEYKLDGNEPILH
                     HELRKWADILLIAPLSANTLAKIANGICNNLLTSVLRDWSPLTPVLVAPAMNTFMYIN
                     PMTKKHLTILQNECPYVTILKPMEKVLICGDIGMGGMREWTDIVEIMRKRINELVKIQ
                     NLSNDLTNTSHVIGDNKANIINSNAKDLQQNKKTSTPNDSLAISQDEVENEENEDDDD
                     DDDEEDEDEDDELRNDTASDDSGISDDDDDDNDDSDEAEDEDDDDDDDDYDDDTEQDG
                     KTEQRQI"
     gene            complement(<52132..>52785)
                     /gene="NDAI0C00320"
                     /locus_tag="NDAI_0C00320"
                     /db_xref="GeneID:11496668"
     mRNA            complement(<52132..>52785)
                     /gene="NDAI0C00320"
                     /locus_tag="NDAI_0C00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668888.1"
                     /db_xref="GeneID:11496668"
     CDS             complement(52132..52785)
                     /gene="NDAI0C00320"
                     /locus_tag="NDAI_0C00320"
                     /inference="similar to DNA sequence:INSDC:YKL087C"
                     /note="similar to Saccharomyces cerevisiae CYT2 (YKL087C);
                     ancestral locus Anc_2.644"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668936.1"
                     /db_xref="GeneID:11496668"
                     /db_xref="GOA:G0W7D2"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:G0W7D2"
                     /translation="MSSNNNEQPKCPVDEKTRELWLQQHQQQQPQKNTLAKVSTTLEC
                     SPDNLKQDLQNPPVVGSTSTTPSSSTITDERTVSSIPRTGTDSNWIYPSEKQFFEAMK
                     RKNWNPNETDMKTVVPLHNSINERVWNYINQWEHSTPCNDIKLTNFKGDSKKLTPRAW
                     FRSTILHYSKPFDRHDWQIDRCGKKIDYVIDFYCDEIETRDKKMKRYLIFIWMYDLN"
     gene            <53872..>54261
                     /gene="NDAI0C00330"
                     /locus_tag="NDAI_0C00330"
                     /db_xref="GeneID:11496669"
     mRNA            <53872..>54261
                     /gene="NDAI0C00330"
                     /locus_tag="NDAI_0C00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668889.1"
                     /db_xref="GeneID:11496669"
     CDS             53872..54261
                     /gene="NDAI0C00330"
                     /locus_tag="NDAI_0C00330"
                     /inference="similar to DNA sequence:INSDC:YKL086W"
                     /note="similar to Saccharomyces cerevisiae SRX1 (YKL086W);
                     ancestral locus Anc_2.642"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668937.1"
                     /db_xref="GeneID:11496669"
                     /db_xref="GOA:G0W7D3"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="UniProtKB/TrEMBL:G0W7D3"
                     /translation="MSSIQTHNLQRITEIPLSQIRRPIMPVLDTQKIDAMVSTMNGIP
                     MASKTCSLESAQSMDGKLPPIDVMVVRHNDENYYFAFGGCHRFQAYDRQAKDKDDSNY
                     LVRCKLIPATERQLKMYVGGSIDNMFN"
     gene            <55186..>56214
                     /gene="NDAI0C00340"
                     /locus_tag="NDAI_0C00340"
                     /db_xref="GeneID:11496670"
     mRNA            <55186..>56214
                     /gene="NDAI0C00340"
                     /locus_tag="NDAI_0C00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668890.1"
                     /db_xref="GeneID:11496670"
     CDS             55186..56214
                     /gene="NDAI0C00340"
                     /locus_tag="NDAI_0C00340"
                     /inference="similar to DNA sequence:INSDC:YKL085W"
                     /note="similar to Saccharomyces cerevisiae MDH1 (YKL085W);
                     ancestral locus Anc_2.641"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668938.1"
                     /db_xref="GeneID:11496670"
                     /db_xref="GOA:G0W7D4"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G0W7D4"
                     /translation="MLRSTFQTLSKRTFSSTSINPYKVAVLGASGGIGQPLSLLLKLN
                     HNVTDLRLYDLRNAKGVATDLSHIPTNSTVKGFAPDQQQPDALRDTIKDSDLILIPAG
                     VPRKPGMTRDDLFNINAGIVHDLAQTIAKEAPNSSILVISNPVNSTVPIVAEVLKEHN
                     VYNPKKLFGVTTLDLIRSSRFLSEILKTDPTKEHVNVIGGHSGITIIPILSQLENCST
                     LSQEQKNELIHRIQFGGDEVVKAKDGAGSATLSMAYAGATFADAVMRGLNDEKNVVMS
                     SFVDSPLFKNEGIDFFASKVTLGPNGVEKIHEFGKLNQHENEMLETCKETLKKNIEKG
                     YTFVKNKK"
     gene            <56670..>57176
                     /gene="NDAI0C00350"
                     /locus_tag="NDAI_0C00350"
                     /db_xref="GeneID:11496671"
     mRNA            <56670..>57176
                     /gene="NDAI0C00350"
                     /locus_tag="NDAI_0C00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668891.1"
                     /db_xref="GeneID:11496671"
     CDS             56670..57176
                     /gene="NDAI0C00350"
                     /locus_tag="NDAI_0C00350"
                     /inference="similar to DNA sequence:INSDC:YKL084W"
                     /note="similar to Saccharomyces cerevisiae HOT13
                     (YKL084W); ancestral locus Anc_2.640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668939.1"
                     /db_xref="GeneID:11496671"
                     /db_xref="GOA:G0W7D5"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="UniProtKB/TrEMBL:G0W7D5"
                     /translation="MVHKQITRVRYPLLLSSVFVYQPSEAPFDDLSSWPLSNDMSKKI
                     RGKTIDEYSRCIHWNSELDIISLKFKCCSDVYYACYQCHEELTTHPVKRFDLNANPDV
                     KVIICGNCCKEMTFEEYVESKNEYDRLCCFNCQSLFNPGCKLHYDLYFELDSDKYGRD
                     HDIVDCKI"
     gene            complement(<57247..>58560)
                     /gene="NDAI0C00360"
                     /locus_tag="NDAI_0C00360"
                     /db_xref="GeneID:11496672"
     mRNA            complement(<57247..>58560)
                     /gene="NDAI0C00360"
                     /locus_tag="NDAI_0C00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668892.1"
                     /db_xref="GeneID:11496672"
     CDS             complement(57247..58560)
                     /gene="NDAI0C00360"
                     /locus_tag="NDAI_0C00360"
                     /inference="similar to DNA sequence:INSDC:YMR068W"
                     /note="similar to Saccharomyces cerevisiae AVO2 (YMR068W);
                     ancestral locus Anc_2.639"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668940.1"
                     /db_xref="GeneID:11496672"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G0W7D6"
                     /translation="MMQIEPSERLREAIITGRLLSVKRLLRRYPELLYNIDPQNGWTS
                     LHYAAFNGRYLVCVYLIQLGHDKNETLRTFQGNTCVHLALKNGHEQTTHLLLQHFSRF
                     LNDKGEGNLAPIHIACINDYHQCLSMLISLGADLSIVDENGDNSLNLCLQYGSLDCLK
                     LLLMDDHFHNEMLNKDKNKNHWKPDDIVGSYETQKIYQQLLKENLEAKQARLPRNNSF
                     QSLRSPIVKSVQAFTDNNKGIINEKQPKLTISTNERTSYHNDMSDTRSLMSPKLDIPI
                     FTPTQRFLPRVESPLSMSPSSISTESQSLSNNEIVSYSINDVDSITESNIINNSNQDC
                     GNNVGSINDVTHTRTETINHHNIESINRYLLVDVPNSIQEEREEEEEEEQLVLGNQER
                     RSSIIPNSYISSTNNNSSGIDPSVNRSKASTKLSLLSIPISKVRR"
     gene            <59084..>60328
                     /gene="NDAI0C00370"
                     /locus_tag="NDAI_0C00370"
                     /db_xref="GeneID:11496673"
     mRNA            <59084..>60328
                     /gene="NDAI0C00370"
                     /locus_tag="NDAI_0C00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668893.1"
                     /db_xref="GeneID:11496673"
     CDS             59084..60328
                     /gene="NDAI0C00370"
                     /locus_tag="NDAI_0C00370"
                     /inference="similar to DNA sequence:INSDC:YKL081W"
                     /note="similar to Saccharomyces cerevisiae TEF4 (YKL081W);
                     ancestral locus Anc_2.635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668941.1"
                     /db_xref="GeneID:11496673"
                     /db_xref="GOA:G0W7D7"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G0W7D7"
                     /translation="MSQGTLYAHLGGRGLALEALIEHFNLDFEVVECKGNATFEEKFP
                     LKMSPALVGPKGAKLTETIAIAYYLVNFIEDEKVKAKLVGSTEIEKAQVLRWISFANM
                     EVGSNWFKAFASITGSTPFNKKEVDAAFAKLNAYAAAFEVRLRDFTYLATENVSLADM
                     QAVSTWGSAFKLLLGEEFRSKYPHLMRWFKTVSASPIMASKFEGYQFIEKTLQFVPPK
                     KEKKAEKKPKAEQKPKVEKKPEAEADAEAAPAKKPKHPLEALGKSTFILDEWKRQYSN
                     EDTRPVALPWFWEHYNPEEYSLWKVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYMF
                     GCLVVYGENNNNGITGAIMVRGQDNVPAFNVAPDWESYSYSKLDPTKEEDKEFINNMW
                     AWDKPVVVNGESKEIVDGKVLK"
     gene            complement(<61056..>61334)
                     /gene="NDAI0C00380"
                     /locus_tag="NDAI_0C00380"
                     /db_xref="GeneID:11496674"
     mRNA            complement(<61056..>61334)
                     /gene="NDAI0C00380"
                     /locus_tag="NDAI_0C00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668894.1"
                     /db_xref="GeneID:11496674"
     CDS             complement(61056..61334)
                     /gene="NDAI0C00380"
                     /locus_tag="NDAI_0C00380"
                     /inference="similar to DNA sequence:INSDC:YKL068W-A"
                     /note="similar to Saccharomyces cerevisiae YKL068W-A;
                     ancestral locus Anc_2.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668942.1"
                     /db_xref="GeneID:11496674"
                     /db_xref="UniProtKB/TrEMBL:G0W7D8"
                     /translation="MSTQTFMSNNNINPFSSINQNWSHTNQKDSRISTNNHTRETSYS
                     SLQMSSSVAYQEYDDEDLIVDLNTGSFTPVNLRSWALMTEVTDKLGKL"
     gene            complement(<63036..>65537)
                     /gene="NDAI0C00390"
                     /locus_tag="NDAI_0C00390"
                     /db_xref="GeneID:11496675"
     mRNA            complement(<63036..>65537)
                     /gene="NDAI0C00390"
                     /locus_tag="NDAI_0C00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668895.1"
                     /db_xref="GeneID:11496675"
     CDS             complement(63036..65537)
                     /gene="NDAI0C00390"
                     /locus_tag="NDAI_0C00390"
                     /inference="similar to DNA sequence:INSDC:YMR049C"
                     /note="similar to Saccharomyces cerevisiae ERB1 (YMR049C);
                     ancestral locus Anc_2.613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668943.1"
                     /db_xref="GeneID:11496675"
                     /db_xref="GOA:G0W7D9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR028598"
                     /db_xref="UniProtKB/TrEMBL:G0W7D9"
                     /translation="MTKGTNLVKGGKKILSKKRTSEEVEAETNVNVNKDEFKVDGLLD
                     GASDSESDNEDAEDDEAFESAVEERESESSDIEGQEIEQEQKQNHVQDEMSDSEDELN
                     KLFAQEAEGNDDEEEYNTSDFDDTDDTKSLVDKLSGIQLKTIADPNIYTKYIDGTPRI
                     IKPEINPVYDSDDSDVETKNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKGSALDQLL
                     DTIELPEGWTGLLDQDSGAGLNLTEEELELISKIGRNEQTDDQTNPYEPYVDWFTRHE
                     EVMPLTAIPEPKRRFIPSKNEAKRIMKIVRAIREGRIIPPKQLKEIREKEKLENEYKY
                     DLWGDSEETNDHVMNLRAPKLLPPTNEESYNPPEEYLLTEEEKKEWENTEFSEREKNF
                     IPQKYGSLRKVPGYGENIRERFERSLDLYLAPRVRKNVLNIDPESLIPELPSPKDLRP
                     FPIRCSTIYAGHQGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYNVTLIEDTE
                     ENTDDHIECIEWNPDKETGILAVSVGEHIHLIVPPIFGFDIENKGKSKIEHGFGFDTF
                     GSIKKSNLEVNGSDDDENAANGENIAAVKKQVAQWNKPTQKQLEKDICITITCRKTVK
                     RLSWHRKGDYFVTVQPDSGSTSVLIHQVSKHLTQSPFKKSKGIIMDAKFHPFKPQLFV
                     CSQRYIRIYDLSQQTLVKKLLPGARWLSKIDIHPRGDNLIASSFDKRVLWHDLDLAST
                     PYKTLRYHDKAVRSVNFHKKLPLFSSVADDGNIHIFHATVYDDMMKNPMIVPLKKLSG
                     HKIKNNLGVLDAIWHPKEAWLFSSGADNTARLWTT"
     gene            complement(<65845..>66381)
                     /gene="NDAI0C00400"
                     /locus_tag="NDAI_0C00400"
                     /db_xref="GeneID:11496676"
     mRNA            complement(<65845..>66381)
                     /gene="NDAI0C00400"
                     /locus_tag="NDAI_0C00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668896.1"
                     /db_xref="GeneID:11496676"
     CDS             complement(65845..66381)
                     /gene="NDAI0C00400"
                     /locus_tag="NDAI_0C00400"
                     /inference="similar to DNA sequence:INSDC:YKL069W"
                     /note="similar to Saccharomyces cerevisiae YKL069W;
                     ancestral locus Anc_2.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668944.1"
                     /db_xref="GeneID:11496676"
                     /db_xref="InterPro:IPR000614"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:G0W7E0"
                     /translation="MGDNQHHANYSIFSPESSREETLEFLLVSYESLAKEQTNWVCNL
                     ANAASLIWHAYKALQVNVNWAGFYVTDKTKQNELILGPFQGKPACQTIIFGKGVCGTA
                     ASTQRTQLIPDVNKFPGHIACDGETKSEIVVPILDLQTAETLAVIDLDCLDFEGFNEI
                     DQKYLEKLAILISKTCKF"
     gene            complement(66600..66707)
                     /gene="NDAI0Ctrna2W"
                     /locus_tag="NDAI_0Ctrna2W"
                     /db_xref="GeneID:11496246"
     tRNA            complement(join(66600..66636,66671..66707))
                     /gene="NDAI0Ctrna2W"
                     /locus_tag="NDAI_0Ctrna2W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:11496246"
     gene            complement(<69145..>71598)
                     /gene="NDAI0C00410"
                     /locus_tag="NDAI_0C00410"
                     /db_xref="GeneID:11496748"
     mRNA            complement(<69145..>71598)
                     /gene="NDAI0C00410"
                     /locus_tag="NDAI_0C00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668897.1"
                     /db_xref="GeneID:11496748"
     CDS             complement(69145..71598)
                     /gene="NDAI0C00410"
                     /locus_tag="NDAI_0C00410"
                     /inference="similar to DNA sequence:INSDC:YKL072W,YMR053C"
                     /note="similar to Saccharomyces cerevisiae STB6 (YKL072W)
                     and STB2 (YMR053C); ancestral locus Anc_2.616"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668945.1"
                     /db_xref="GeneID:11496748"
                     /db_xref="UniProtKB/TrEMBL:G0W7E1"
                     /translation="MTTDSPELNHYTTTERSESHSSSKKLELQPTVPLVSFIFPDMRA
                     LHRLNIQSSENPPYEVVKIHGFEIYIVEQWTAERSFSTVITSYTGNSQDEITAVRILL
                     PENPEFWPGNFKKYYQELISISQPKIIKNSTLFITNLSVVPSSLYLIHVECGDIREVW
                     ENFKVNFNLKRLHCGGRQGLLLNGVSTAALEKFSQLYKIPIKTQNTGSKQRQQQQPND
                     LQAGIGEDHGLQEGKPAKVSSDVFCAKKHTSPVVELITIIQLSLSYFGLFNFKIHKSG
                     LLCEETKRAIDRWWEIYGKTYMGIAKPRNETTMGPTTVTSIISLVLSCYFKLMVEDCI
                     SAKDPFQETEMYSGIYTFQKKNGLAKHHKLLYFDPETLESLFEISAKSSNTDIFKFKR
                     VVKSRVQDMAGKGNFMQLSNDILTSDLDVLVNNIHGGALGLLWKGKGKCVRDLNNGWK
                     KKRFTELDFNHGNLDEVLKKQELYLDKLKIDETILRKQSPEKFKSSDLSPDDPLFQSK
                     NEHDGSGKELQGLKSQNGSNSLLSISSMFCNYDRSKYLRSHDTNVQYQAEFYRRKSYP
                     FINDQTEIAAYQDSIGEYRLNLHRSNSLSEASTAIEIWDLPFDSSVVKMARDLLKVKV
                     RLHKQEQQKTRDKIVNLCDGENAGIEDEKFSSSLHQLHLEFTSCSKKADKFNETQSKL
                     ENKHNYLLKEMQELNSLTSKLKYNVRLLNTRMRDVQDSVNEFDNKLNVYRKLLLKQGP
                     NMTLAIETVDNDIEFDKCLRNLIHAEKTKYGGICLRVLRKDFLNQLSKNLFSWSEWLY
                     HKFFYKTEFAEAPTSELYN"
     gene            complement(<72037..>74940)
                     /gene="NDAI0C00420"
                     /locus_tag="NDAI_0C00420"
                     /db_xref="GeneID:11496678"
     mRNA            complement(<72037..>74940)
                     /gene="NDAI0C00420"
                     /locus_tag="NDAI_0C00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668898.1"
                     /db_xref="GeneID:11496678"
     CDS             complement(72037..74940)
                     /gene="NDAI0C00420"
                     /locus_tag="NDAI_0C00420"
                     /inference="similar to DNA sequence:INSDC:YKL073W"
                     /note="similar to Saccharomyces cerevisiae LHS1 (YKL073W);
                     ancestral locus Anc_2.618"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668946.1"
                     /db_xref="GeneID:11496678"
                     /db_xref="GOA:G0W7E2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G0W7E2"
                     /translation="MKLLSRQCSLLSITLMLVTLVTTISAAVIGIDYGQQNIKAMVIS
                     PQAPLEIVLTPEAKRKDISGLAIKKLPDGIERIYGSAVGSLATRFPQNTLLNLKPLLG
                     KSIANEPTVLNYLKEHPGVNITATSTGRNSLSFVVDGVEYPLEEIVAMNLEEIVDRAN
                     VLLKEKDARTNDNVDMMAITVPGYFYQAQRNALLDVSSLVSGISKTSLINDGLSIAIN
                     FAIKKRDFELDKAEYYIVYDMGSGSTKATLVSILKSSNESEPLRIELGGYGYRSHLGG
                     STFTLEVATLIENNFLAQHPKIRTETLHANPKAIAKINQAAEKAKLILSANTEAFVSI
                     ESLIDDIDFKTTVTRQELEDISEDHLAEIIEPIQEALDNQLWDNNVTMKNLSGVILHG
                     GSTRVPLVQRQLIDFVGEDNILRNVNADESAVNGVVLRGVQQFDAFKTRPLDIIERSI
                     SDYSIKVSSSSSQATNKIFPKGSIFPATITMELHSINDTTMAPFSIDLYENGKILSNV
                     TVDVSNAEDSFSNNKCKHGVSYNGTFSLSSDRVFKLEKVEAICLNSLSKTDEEETDGG
                     IMNKLFKHKPKNETAAETTKKPKYNKTIKLITTSTDINVKPLSPSEKYNIIRNIKDLG
                     EFDRQRFQLQESKNLLESSLYSARNFLEEDDVIKNGPKAQVDKLSQLVSGTLEWLEED
                     SDHATKKQIDKKLGEINSLKDRVELYIKTSKEPLDSNQFSDILDKAALVYKDVSDQQK
                     MLELNLKALEKKISSSLLNVTDEFYKIRLPISMNRTLANIETLFSKFNKTVAAIEDLV
                     DLDSFEEMGREQLYELKLKFDNVHPKIQEKLAALRTSYEYRFNELNSLHQRKLRAQKR
                     KEEKAKRQLEKKLANATETIQGESSSTLTSTETAKVTKESTTTILSTDMTSKTTTVKS
                     SSDSSSSSSSLSPSPASPNLSYKTKRKPGKKANGKKSRSSKSSSSSTIMHDEL"
     gene            <75348..>77084
                     /gene="NDAI0C00430"
                     /locus_tag="NDAI_0C00430"
                     /db_xref="GeneID:11496679"
     mRNA            <75348..>77084
                     /gene="NDAI0C00430"
                     /locus_tag="NDAI_0C00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668899.1"
                     /db_xref="GeneID:11496679"
     CDS             75348..77084
                     /gene="NDAI0C00430"
                     /locus_tag="NDAI_0C00430"
                     /inference="similar to DNA sequence:INSDC:YKL074C"
                     /note="similar to Saccharomyces cerevisiae MUD2 (YKL074C);
                     ancestral locus Anc_2.619"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668947.1"
                     /db_xref="GeneID:11496679"
                     /db_xref="GOA:G0W7E3"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W7E3"
                     /translation="MSSGNEHTLEELRSKIIASMGKKENPPAVIKGGNDDRLKRKRDE
                     GSNGSGPRGKHDIPLGPRGVKAPSPVNRNMHQSLRNNAAGYPKGTQERLSVAGNQVQN
                     RNGIYDRQERMKDDKGDDDRGFANGSYQADGRRRVRYTKRTPPQQPQPQQHQNTRPGA
                     SRDRNENRRYRRNDQMDTVRPRNDYHKGTWNSNNSNGRNNYKNSHNTYNNNGNKNKET
                     IPNISRIPVQNSFMAPTIYPNITKSRSSCIIIVSSLKNASNDESEVGHTRILLKNSVE
                     TFLKGLKLEQDELKNFTIGPVDEDYCVFEFKSAKTTTMVLSCRSYFNKKLGLSNATWE
                     RPNDYIEPFDNLEKLCGGNVLTIEGLDDVKILDLESKIKELLQPYGIVTNCSMFPLMY
                     KEETRDQQSVSQNEEPRNETEGEFTGCVILLFEENIDDKLEPFKTSMKYMRPNNGRLS
                     QMTSAFTFFNLPHMAVENKHPESSILLLMNCVDPLDLKVPEFAQEIEETLRYTVDEVN
                     DIKIIKPNIDYRLNFECIDQGVGNIYLRFTTVDAAKKAMEKLSGTQFNDRSILCSYVD
                     EDDYKRTGVLRI"
     gene            <77442..>78929
                     /gene="NDAI0C00440"
                     /locus_tag="NDAI_0C00440"
                     /db_xref="GeneID:11496680"
     mRNA            <77442..>78929
                     /gene="NDAI0C00440"
                     /locus_tag="NDAI_0C00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668900.1"
                     /db_xref="GeneID:11496680"
     CDS             77442..78929
                     /gene="NDAI0C00440"
                     /locus_tag="NDAI_0C00440"
                     /inference="similar to DNA sequence:INSDC:YKL075C"
                     /note="similar to Saccharomyces cerevisiae YKL075C;
                     ancestral locus Anc_2.623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668948.1"
                     /db_xref="GeneID:11496680"
                     /db_xref="UniProtKB/TrEMBL:G0W7E4"
                     /translation="MANSKEKLRIIEAHERSPVEGKGPVQDGKNTKSNAKSKDKKKYE
                     QNERRSRRCRKRPLFNFQKDMQLKGTYYDVITSVKYINEKYGLRESYYVEKFIKCIHR
                     KINHDVSRISDHYVNSLSPWVKVKFFFLLVTLCERGGPEYWFDKSDESKEPAKDPSST
                     NVSTLDSGNSTAVEEPAISSKNSDTSNGIAKESSSTNEDFISILKNSISPEFTLSELI
                     MKQNINPDYNESTHDENYLYSSTWANFMEGLINHYLEKVIIPSSELKVCQQLYKPMMK
                     IISLYNEYNELMEKSERNGFLSTPKETNSESTPTTTNDGEECDTASKKDSLDENEDVI
                     TQERLDRAQKLLWQAREDIPKTISKELTMLSEMYQTLSADEQDYELDEFVCCAEEYIE
                     TEYVPCLINVLFANCGTVNFWKIMLVLEPFFYYIEDLGEEDDDDEIGTEEPFDITGST
                     VITHNDTDANLTGAKIDNSKRVFSPDPRVMTLEKICKVAAKQKWI"
     gene            complement(<79165..>80346)
                     /gene="NDAI0C00450"
                     /locus_tag="NDAI_0C00450"
                     /db_xref="GeneID:11496681"
     mRNA            complement(<79165..>80346)
                     /gene="NDAI0C00450"
                     /locus_tag="NDAI_0C00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668901.1"
                     /db_xref="GeneID:11496681"
     CDS             complement(79165..80346)
                     /gene="NDAI0C00450"
                     /locus_tag="NDAI_0C00450"
                     /inference="similar to DNA sequence:INSDC:YKL077W"
                     /note="similar to Saccharomyces cerevisiae YKL077W;
                     ancestral locus Anc_2.624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668949.1"
                     /db_xref="GeneID:11496681"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:G0W7E5"
                     /translation="MKLTLSSLFLSSLSISLLGKGALAYKQVHRPNEKETTSEEAKPW
                     LRTVYDTQVEIVTPTVIAGVTFSGKPLPTPDPLEPWVSLKKDGTPQTIKPEVKNGRTK
                     KGRPNYSTYFKTATVVTYSYEQLKAHNMDPNDVYEEEVYLDEDDTYVSLNPVIRCTPE
                     RYFFKGLAKDISSEPFCTPRENSQWKVGKTYFVSWFTQFFDDEHSGTVIDKVRVHLSY
                     VKEKASDKGYHKRDIPATFFSSEWVKNVDGMYPIEVDEDWLQGQYERRIVVSVQPFNV
                     PDDEFNPLERGVLLYMILGSKVAKTTKEEWAMIDAGISDDKWYYVALTIPTLVVVVCV
                     AIYFFLHFNGRYRDFSDVTQRALASRHRIIGKVSEMKKFRKMKNHRYDELPSYNKRKT
                     K"
     gene            <80731..>81102
                     /gene="NDAI0C00460"
                     /locus_tag="NDAI_0C00460"
                     /db_xref="GeneID:11496682"
     mRNA            <80731..>81102
                     /gene="NDAI0C00460"
                     /locus_tag="NDAI_0C00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668902.1"
                     /db_xref="GeneID:11496682"
     CDS             80731..81102
                     /gene="NDAI0C00460"
                     /locus_tag="NDAI_0C00460"
                     /inference="similar to DNA sequence:INSDC:YMR059W"
                     /note="similar to Saccharomyces cerevisiae SEN15
                     (YMR059W); ancestral locus Anc_2.625"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668950.1"
                     /db_xref="GeneID:11496682"
                     /db_xref="GOA:G0W7E6"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR018593"
                     /db_xref="UniProtKB/TrEMBL:G0W7E6"
                     /translation="MSAVYNRSEIEELVRNNLLQFHLWTEVTVATETLSWKESNIRLL
                     TGRPPHKLSNDDEDVMTEYVLPVEMSQYKTSYLTLEFLDKIFDNLCPENTKRLTLAII
                     NDDGTTVFYFVYKGIHKPKKN"
     gene            complement(<81586..>83808)
                     /gene="NDAI0C00470"
                     /locus_tag="NDAI_0C00470"
                     /db_xref="GeneID:11496683"
     mRNA            complement(<81586..>83808)
                     /gene="NDAI0C00470"
                     /locus_tag="NDAI_0C00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668903.1"
                     /db_xref="GeneID:11496683"
     CDS             complement(81586..83808)
                     /gene="NDAI0C00470"
                     /locus_tag="NDAI_0C00470"
                     /inference="similar to DNA sequence:INSDC:YKL078W"
                     /note="similar to Saccharomyces cerevisiae DHR2 (YKL078W);
                     ancestral locus Anc_2.629"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668951.1"
                     /db_xref="GeneID:11496683"
                     /db_xref="GOA:G0W7E7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7E7"
                     /translation="MVSMSSKHKIVTTTKKQSKSVVKKPHPFKRSTVHPTARKIIRFE
                     ETETNNAEDDEYDGPTNHIQNNKQQLKLKVQSLLKTRKTLPVYQNKDEIMNHLRSNPV
                     TVLIGETGSGKSTQIPQFLLDDLYKDKKHGSIAVTQPRRVAAINLATRVAQEFGCNLG
                     STVGYSVRFDNCTNSKTRLKYLTDGMLLRELMMDRNLKEYSVVIIDEAHERTVLTDLI
                     LGFLKSLIQGPRPDLKIIVMSATIQAEKFSQFFNNAPILFVEGRKFRVTQYYLKAPSD
                     DIVDSIIRCCVQINQSEQMGDILCFLPGQEEIDKAVTILNKVSEVIAKETKVPLMIGH
                     PLYAALSPAQQSLVFSPVKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQ
                     LGLATLLTVPISQASAMQRSGRAGRESEGKCYRLYCESDYKKLPFETEPEIARSDVTS
                     PVLMLKRYGIKDIVNWTWFENPGRDSLIMGLQELYTLAALDDSGKITERGKNMALLPI
                     QPHLSSVLIKASESGCLSEVIDIVSCLSVENLLLNPQPEERDEVNERRLTICNGGKRY
                     GDLIMLKELFNVYFYELDKSSSSADERRDWCKELCISYRGFKNVIKVREQLRMYCKRL
                     FGKNDQDLFIAEEGIPKIGENKDEISKILKCFLTGFTKNCAIGMPDRSYRTVSTGETI
                     SVHPSSMLFSNKSCPGIMYTEYVFTTKGYARNVSRIELSWLQEVVNNGTAVAKQKVSE
                     "
     gene            complement(<84502..>86298)
                     /gene="NDAI0C00480"
                     /locus_tag="NDAI_0C00480"
                     /db_xref="GeneID:11496684"
     mRNA            complement(<84502..>86298)
                     /gene="NDAI0C00480"
                     /locus_tag="NDAI_0C00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668904.1"
                     /db_xref="GeneID:11496684"
     CDS             complement(84502..86298)
                     /gene="NDAI0C00480"
                     /locus_tag="NDAI_0C00480"
                     /inference="similar to DNA sequence:INSDC:YKL079W"
                     /note="similar to Saccharomyces cerevisiae SMY1 (YKL079W);
                     ancestral locus Anc_2.633"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668952.1"
                     /db_xref="GeneID:11496684"
                     /db_xref="GOA:G0W7E8"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G0W7E8"
                     /translation="MYWNLTAPKATKPTTITLNTPNDSPFQQYKETEPIRVVLNLSSL
                     KANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQNEMLTVSTIKDLFDGYNQSFI
                     TYGKSNSGKSDTLFNEKDGLIRLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLS
                     MMEIFSSEKIYDLLSNEYTKDNPILKSLKVHQHDIIENGIKGDKHVKNLSHIQIASLD
                     DLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLY
                     GIDKFTKKDIQLTNDEMKKLNTLMSSFQNLITTLSDPKSLPYTSSLYKDSALNKILQD
                     YIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVFGLNLQKQMLLF
                     IKSSKLREENCQTKINYLQSELALKNKLLEPVATDHHEENYNDESSCSDKETIMKLKL
                     KIESLEQVLEHISTSENPKSKTETNEHDELLKKLMDKCEDVAKLQVEIEAEKNTNSKL
                     KQDLKYSASKQHALETMNLKLLEQLQNQEKECKELLISEERLKRELASAENLKNSKAE
                     RIVILERAIKDYRAFEKQNTILDATRIYNHTT"
     gene            complement(<86833..>88011)
                     /gene="NDAI0C00490"
                     /locus_tag="NDAI_0C00490"
                     /db_xref="GeneID:11496685"
     mRNA            complement(<86833..>88011)
                     /gene="NDAI0C00490"
                     /locus_tag="NDAI_0C00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668905.1"
                     /db_xref="GeneID:11496685"
     CDS             complement(86833..88011)
                     /gene="NDAI0C00490"
                     /locus_tag="NDAI_0C00490"
                     /inference="similar to DNA sequence:INSDC:YKL080W"
                     /note="similar to Saccharomyces cerevisiae VMA5 (YKL080W);
                     ancestral locus Anc_2.634"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668953.1"
                     /db_xref="GeneID:11496685"
                     /db_xref="GOA:G0W7E9"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:G0W7E9"
                     /translation="MASTLYSTSEFILLSLPLNVKPVTTPDLDTDSWLQQNLLNGKAL
                     VSNFNVPEFKVGSLDSLIVDSEELKKIDTQIETSLSKIIEILNGLNESSSNAYRTLPI
                     NNVPVPQYLENFQWQVRKFKLDKSIKELIDLISNESAQLDTDVRATFTNYNNAKTNLA
                     AAERKKTGDLSVRSLHDIVKPEDFVLNSDHLTTVLIAVPKNLKSDFEKSYERMTDNVV
                     PGSAGIIATDSEYILYNVHLFKKNAQEFVNVAREKKFIPREFNYSEELIDQLKKEHDS
                     AASLEQSLRVQLVRLAKTAYVDVFINWFHIKTLRVYVESVLRYGLPPHFNTKIVAVPP
                     KNLEKCKKELIEAFGFLGGNAFVKDKKGKINSKDTSLNQYSTLIDTDYEPFVLYTITL
                     "
     gene            <88367..>91633
                     /gene="NDAI0C00500"
                     /locus_tag="NDAI_0C00500"
                     /db_xref="GeneID:11496686"
     mRNA            <88367..>91633
                     /gene="NDAI0C00500"
                     /locus_tag="NDAI_0C00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668906.1"
                     /db_xref="GeneID:11496686"
     CDS             88367..91633
                     /gene="NDAI0C00500"
                     /locus_tag="NDAI_0C00500"
                     /inference="similar to DNA sequence:INSDC:YKL068W,YMR047C"
                     /note="similar to Saccharomyces cerevisiae NUP100
                     (YKL068W) and NUP116 (YMR047C); ancestral locus Anc_2.610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668954.1"
                     /db_xref="GeneID:11496686"
                     /db_xref="GOA:G0W7F0"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:G0W7F0"
                     /translation="MFGSNRSMFGGGTNTSQPFGSTASTTTPAFGGLGNNSNPQSNAQ
                     SGFGGFGNTSNSNTGMFGNTNANTQTNSAGGGLFGQPVANTANSPFGSLSNNTNTTNT
                     NAFGSGAGTASNNAFGANTSTASPFGMNKPTVGGGLFGQSNNTQNSMFGQQQQQQQPG
                     QTNAFGQPKPMTNAFGSASNSAGSATGSTGLFGGALNTNAGGGGGGLFGQNNNANRVG
                     TGAGMFGQNQQTAGGLFGQNQRNNQQQQQGATGGGLFGQSNATNTGMGMFGNQQNNQQ
                     QQGRGGMFGQANTQQQSGGMFGQSANNSNQLGGGLFGNRQPQQQQQGTGLFGQQQQQP
                     QQNTASGGLFGSKPTNTGLFGQNNMQQQQQQPFGAAANQQSTGLFGSNTNTQTSGGGL
                     FGNANQQQQAPGVFGQANNTGMGGTTSGGLFGAKPNATPTGLFGQSNNTNTLGGMGST
                     GGGLFGQQQQQQPQTQQQGTLGGGLFGNKPTSQPSTGGLFGQANTNQQPSQFGQNTVT
                     TGGGLFGQQPQTGTTGGGGLFGANTNTNTTQLGGGMGQGATPNNTTGGGLFGATNNAN
                     TGGILGGNTANNATGGLFGNNKPTLGGATNTTSTGGLFGNKAALGSTTTTAGQSGSLF
                     GAAKPVATAPTGNLGGLFGSKPATTGLSNTNAPPSTATSTTTSSLGTGLFGAKPTTAQ
                     GLQLNAPQAQTQGQGQGQLQEQPPVDNNLFKTVNLPSSITNSTNPTTGKVNAEVKRNA
                     TLSTMYRSSPKPLFSTKKIRNHSLNRFAAAPSPAPSPLLKESSSPLPGTVDNETAFSI
                     FQEFLGYPNSKENSNDIGAKSSLAFQPDKESLKHLILNSRRTAKMEGVSSQTKNVKLA
                     EPSSTYDTSKSNDSKQNSDNNLAVNDPRGIDKEPKKTPISIFDPKSSSSVSNDGKVPL
                     PSPSTSLSPESSLAVQTIKKPKDDISFLGNGYYISPSIDSLKSKTLVQLRTVSNLKVG
                     HEVFGKVEFLKPVDLSNILIDSICGKLVQFEPRSCFISKPTSQRVAKGEGMNVPARIT
                     IYNCFPVDKSTRKPIKDINHPLVKRHIMSMKKNNGTKFESYDPLVGTYVFVCEAPIED
                     "
     gene            complement(92461..92532)
                     /gene="NDAI0Ctrna1H"
                     /locus_tag="NDAI_0Ctrna1H"
                     /db_xref="GeneID:11496687"
     tRNA            complement(92461..92532)
                     /gene="NDAI0Ctrna1H"
                     /locus_tag="NDAI_0Ctrna1H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11496687"
     gene            complement(<93150..>93728)
                     /gene="NDAI0C00510"
                     /locus_tag="NDAI_0C00510"
                     /db_xref="GeneID:11496739"
     mRNA            complement(<93150..>93728)
                     /gene="NDAI0C00510"
                     /locus_tag="NDAI_0C00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668907.1"
                     /db_xref="GeneID:11496739"
     CDS             complement(93150..93728)
                     /gene="NDAI0C00510"
                     /locus_tag="NDAI_0C00510"
                     /inference="similar to DNA sequence:INSDC:YMR043W"
                     /note="similar to Saccharomyces cerevisiae MCM1 (YMR043W);
                     ancestral locus Anc_2.608"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668955.1"
                     /db_xref="GeneID:11496739"
                     /db_xref="GOA:G0W7F1"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:G0W7F1"
                     /translation="MSDTNSKTPIEEPSTKERRKIEIKFIENKTRRHVTFSKRKHGIM
                     KKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNVPDEEEE
                     EEEDEDPENEGTNGMDTRSGIISPDTDNIHPDANVTYSNEAPQAHLDPETYSVPANQQ
                     PQFHDNRSNDVNNQNTYRYYQESQQHHQQPPF"
     gene            complement(94030..94085)
                     /gene="NDAI0Ctrna1F"
                     /locus_tag="NDAI_0Ctrna1F"
                     /db_xref="GeneID:11496677"
     tRNA            complement(join(94030..94066,94030..94085))
                     /gene="NDAI0Ctrna1F"
                     /locus_tag="NDAI_0Ctrna1F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11496677"
     gene            <94440..>94898
                     /gene="NDAI0C00520"
                     /locus_tag="NDAI_0C00520"
                     /db_xref="GeneID:11496738"
     mRNA            <94440..>94898
                     /gene="NDAI0C00520"
                     /locus_tag="NDAI_0C00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668908.1"
                     /db_xref="GeneID:11496738"
     CDS             94440..94898
                     /gene="NDAI0C00520"
                     /locus_tag="NDAI_0C00520"
                     /inference="similar to DNA sequence:INSDC:YKL067W"
                     /note="similar to Saccharomyces cerevisiae YNK1 (YKL067W);
                     ancestral locus Anc_2.606"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668956.1"
                     /db_xref="GeneID:11496738"
                     /db_xref="GOA:G0W7F2"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:G0W7F2"
                     /translation="MSQTERTFIAVKPDGVQRGLVSQILSRFEKRGYKLVGIKMLNAS
                     EELLTQHYAEHVGKPFFPKMVSFMMSGPIVATVWEGKDVVKQGRTILGATNPLSSAPG
                     TIRGDFGIDLGRNVCHGSDSVESAEREINLWFKSEELTSWESNQSKWIYE"
     gene            complement(<96017..>96682)
                     /gene="NDAI0C00530"
                     /locus_tag="NDAI_0C00530"
                     /db_xref="GeneID:11496506"
     mRNA            complement(<96017..>96682)
                     /gene="NDAI0C00530"
                     /locus_tag="NDAI_0C00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668909.1"
                     /db_xref="GeneID:11496506"
     CDS             complement(96017..96682)
                     /gene="NDAI0C00530"
                     /locus_tag="NDAI_0C00530"
                     /inference="similar to DNA sequence:INSDC:YKL065C,YMR040W"
                     /note="similar to Saccharomyces cerevisiae YET1 (YKL065C)
                     and YET2 (YMR040W); ancestral locus Anc_2.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668957.1"
                     /db_xref="GeneID:11496506"
                     /db_xref="GOA:G0W7F3"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:G0W7F3"
                     /translation="MSLYFMALFGLLILEMSVLFISVLPLPNKIRKGIYKAYFKTTSS
                     QESKTIIIILSVLVSLLFIDSWKRSQFRVTTYQSKQYQNVRRGGSGNEGIDDAPVTPL
                     QALASRAYNQRNVYISGFILYFLVGIPTVMSIVRRLVKYDDLIKEQKKITEKTSIADD
                     TKIGDTPSSKEIEGLENDLYEKMISLKGLQKQIKHLENYFDEMNKPLPIVKKEEVILK
                     KDI"
     gene            <97223..>100561
                     /gene="NDAI0C00540"
                     /locus_tag="NDAI_0C00540"
                     /db_xref="GeneID:11496507"
     mRNA            <97223..>100561
                     /gene="NDAI0C00540"
                     /locus_tag="NDAI_0C00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668910.1"
                     /db_xref="GeneID:11496507"
     CDS             97223..100561
                     /gene="NDAI0C00540"
                     /locus_tag="NDAI_0C00540"
                     /inference="similar to DNA sequence:INSDC:YKL064W"
                     /note="similar to Saccharomyces cerevisiae MNR2 (YKL064W);
                     ancestral locus Anc_2.601"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668958.1"
                     /db_xref="GeneID:11496507"
                     /db_xref="GOA:G0W7F4"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:G0W7F4"
                     /translation="MSNFNNNNNSSNSNTDNDTVPLLSGQNSLRSSHHQKIHHQATSS
                     PREGEKRRRRRKLKSHTGHKSLIDDVSNTDDETDTTRDHITLPQHHDHMNITDFEQAD
                     SWGMLHESETGYGMDQSDIGGGGGGVTGNSLDDNDAFLDHRLSQSHPVMIKPKKKQKN
                     TTQTSSSKKYPRQSNCSGADNDSIKSDPTLLMNELSRKREEFSKSPISKLSPSEVENY
                     VRERKGELVGNSYHHGNHNPSNGFHNINHMLPRRKTYANDDVVIDVDALMKHVIDTNI
                     EGNSHDHFSKKSSNTSIDDVDEDEYNSRPSSRGSSSNSSLDDVCLVLEDEENAETKIW
                     PDVSVLEEFSKEEIERLRKQAAQDAEAFHFHYDEDESEDDRSNGPYGSCTNKNNNDNG
                     IFFSQPIVTNIDVPELDYRKVNEAEHLSSGRLRPKKLAPWHLMQRPLPPSTTTSSRSY
                     NNNKKNQLLSPSMRLERETMRDNFLVGRNIQYPPHIVSNNPEHFRFTYFRVDLDSTIH
                     SPTISGLLQPGQKFQDLFVSSVYSQEGNINPATPATTLAVPSGRIPSMSPLRTASNNN
                     NTTTTTTMGGTPVPLANLKDKRFGLSTTTGGGSTLSTTSLSNTPGVGVEDVSPFWLDV
                     SNPTEEEMKVISKAFGIHPLTTEDIFLGEVREKVELFKDYYLICFRSFDIVAERHVRR
                     RKEKVSLGSISERDGVSHTDNNNGNNSGNADGENDSNKGSNWFSSLLKGRRRSSGNKS
                     VNTSATSYRRRKSILKKQEEKEKFKRKSGDRHKPREGELEPLNVYIIVFRTGLLTFHF
                     APTPHPINVRRRARLLKDYLTVTSDWIAYALIDDITDAFGPMIELIEDEVYEIEDAIL
                     KMNHSGDSSDSSNSSDSDDSDDSDSILLDDERRLKNGMRRRHSTMERRSINRRSIFSN
                     KGSNHSSNTSSTSTSSSSSRSSRSSDSTFNANLIGWKKKGDMLRRIGECRKRVMSILR
                     LLGSKADVIKGFSKRYNGQWDTVSQSEIGMYLGDIQDHIITMVSSLNHYEKLLSRSHS
                     NYLAQINIDMTKVNNDMNDVLGKITILGTIVLPMNVITGLWGMNVIVPGQFNESLKWF
                     VGILISMLTLAYVAYIYTKRRFGF"
     gene            complement(<100689..>101738)
                     /gene="NDAI0C00550"
                     /locus_tag="NDAI_0C00550"
                     /db_xref="GeneID:11496508"
     mRNA            complement(<100689..>101738)
                     /gene="NDAI0C00550"
                     /locus_tag="NDAI_0C00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668911.1"
                     /db_xref="GeneID:11496508"
     CDS             complement(100689..101738)
                     /gene="NDAI0C00550"
                     /locus_tag="NDAI_0C00550"
                     /inference="similar to DNA sequence:INSDC:YKL063C"
                     /note="similar to Saccharomyces cerevisiae YKL063C;
                     ancestral locus Anc_2.599"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668959.1"
                     /db_xref="GeneID:11496508"
                     /db_xref="UniProtKB/TrEMBL:G0W7F5"
                     /translation="MQGGIKRKNDILPRYKSGKYNPKKKNFNGSRFALTTPMKKLLGY
                     SVLLVLVYLILNFVTSDFNKKSSFELDHINDLSSSLLNGDAAAAAPPITNSHASSNNN
                     NNNNNMVDSNNILDKNTVNHPEKVSKDKFNNEVAKQQEVKNLEKNNEFNKKDSSASNK
                     NSQQQQQQQQQQQQQQQQQQQQKESKNIPKDVDIDSNNGDDVNENVNSSGTQLKKEDF
                     ELEGLKQNEKIERLKKLEKELDLFEKRLAKQIDQRVNKKDNNKQEQKQEQQPQEEKEI
                     PKEEKTPKNESLEKLQNEQLKKEELNSETNKHDSPEQLEENKKLQQELLEKEKDSEPD
                     ANNLAAADAADAAKV"
     gene            <104390..>107308
                     /gene="NDAI0C00560"
                     /locus_tag="NDAI_0C00560"
                     /db_xref="GeneID:11496509"
     mRNA            <104390..>107308
                     /gene="NDAI0C00560"
                     /locus_tag="NDAI_0C00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668912.1"
                     /db_xref="GeneID:11496509"
     CDS             104390..107308
                     /gene="NDAI0C00560"
                     /locus_tag="NDAI_0C00560"
                     /inference="similar to DNA sequence:INSDC:YKL062W,YMR037C"
                     /note="similar to Saccharomyces cerevisiae MSN4 (YKL062W)
                     and MSN2 (YMR037C); ancestral locus Anc_2.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668960.1"
                     /db_xref="GeneID:11496509"
                     /db_xref="GOA:G0W7F6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W7F6"
                     /translation="MFSTAANLTANNVTNQNPTFNNTTTNDTNDNKQSLSLALTQDSN
                     TMNQNSDLNYVSPNSPDYIFSNDSVDYSQRRTDSSITPVSNTNTNTTSNSTTMSATNN
                     VINNSLTNTALTTANNSTINLKNDFLDFKTISNNNNNNNNNNNNDNKRVINNHSVSTP
                     TAMNDLLALLDDANEKKIHHQLSNNNNKYSTAVTLQNLDLSLDLNLNLDLDLDLDVDM
                     VDINNNNNTNTRDNKGGKEIPNSEMDLDALSPLLNDHHQFTNKNMFTMSSSSASSPPQ
                     STTKSLPASRDLASTSNSNNKNNPNIFLDSLISTTNSPTNSNSNNDFNLDELMVLGTN
                     EEKDLHDSKVNNDETMELDDDDNNNNNDQEDKNNTINNFNIDEFQRRLSEVVSPSLRP
                     ITDSRNSISHSIDFWNLSKPASTNNNNNTGVADPNSPGSGSSSLKKDSHIENQDNSLK
                     NDYSLNFSNIPTQERQQQQQQQQEKNLSKNNTRKNSIIMSPSSPKQIPSQLSLSKTKT
                     NPIMLSSSFSSSSNNNNHNHYRHSHSSHHRSQSHSYHHNSNNNKFLTPISPRSTLRKY
                     SHNDITLSSSSSSTNKDKDNNNGILKNRRTSVPAVINSTIFDKLYDQTNNNNNRIKTI
                     TNANVNLIPWENVLSDNDIDDNDFDNSHPPTNTATANGNDRMFRSQSIEQALQSFNIN
                     FNGESAASVAAATAAATTATATATSNLEKQVRPPKFIKPSMVLSENASRAAKLATIGV
                     DSLDSVHISDKGLIKTTTLSSPSSSSMSPSSLLLPAISSSSLVKENINNNGNLSQNMI
                     INNNSNNNNNNNNNNTPIDYDLSSGTNFMPIPLSLPIPTLQNSISKKKSSSSSSSTTT
                     SSSSSRRRKSTANSGTTTPKLPSTTTTLSTASLSTVTSSGKNTRGSSTTTIYDDQNKP
                     FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF
                     "
     gene            <108274..>110547
                     /gene="NDAI0C00570"
                     /locus_tag="NDAI_0C00570"
                     /db_xref="GeneID:11496510"
     mRNA            <108274..>110547
                     /gene="NDAI0C00570"
                     /locus_tag="NDAI_0C00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668913.1"
                     /db_xref="GeneID:11496510"
     CDS             108274..110547
                     /gene="NDAI0C00570"
                     /locus_tag="NDAI_0C00570"
                     /inference="similar to DNA sequence:INSDC:YKL048C"
                     /note="similar to Saccharomyces cerevisiae ELM1 (YKL048C);
                     ancestral locus Anc_2.597"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668961.1"
                     /db_xref="GeneID:11496510"
                     /db_xref="GOA:G0W7F7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G0W7F7"
                     /translation="MDELITKTKPNWATPNGNSLWPQISAKVTLGHSQLIRLIQPISR
                     VTKKEGKMNTKSRTYPTLLQPLSVTNTSKNQQDPHEFPRLEQTYHSLIESPEITQTII
                     NSIKSITHPTNDSPYKAITKIGVGQFSKVYKMSNVKTNQIFAMKLISKKPQNSSQYSM
                     NQIMKWIQRNKQYYTHDGDDDGAALTTDEIIMLMNIQKCRWEIFVWVYLSRNNNRYNN
                     IVRLIQCFDDVYSSDICIINEFCNLGELLWKRDYTSSTMTTEVNKQWLQLIGQDDNED
                     AAAKTRRFALKVLWDMAHALKFLFDMGCIHRDIKPQNILCDSVNRCCKISDFGCSVII
                     PDKLPFQDSYQEKNPSLLMKCFQMELNKIVGTPAFIPPELCHFGKDPTDEDIIGNDIQ
                     MSVDSGFKLDTWSLGVTIYCLLYNDLPFCGDNEFDAYHKIVTQSLSSKLNGELLNDLI
                     IMHLLEKDPKKRIHINTLLTVLKQDQDGTIIIDMDAMSKVPEAFTNSVTMKEHEFISE
                     KGTKEKNLDKKKKENKSVQKFFQKLFKSSKNSKNSKNSTHKKDSVMEETKLQKQTDGI
                     PIQKEEFNQQLPISPIGSVTSSLESSFDEPVQLLDFRDAKTAFSYDDCVYKLANEEHN
                     HDGIVTPHNTTKDDSSLTKRKSTGTTSSLSLSPIKIATPIKNLIRIKTTPQRTQLLDA
                     SHRPSLSNSPLKNKQPSNQIVHIVDTQSSSFEKGLTSSRNILNFQKYFQNSSSRANND
                     SQETVQEIREYLDYADQ"
     gene            complement(<110741..>112246)
                     /gene="NDAI0C00580"
                     /locus_tag="NDAI_0C00580"
                     /db_xref="GeneID:11496511"
     mRNA            complement(<110741..>112246)
                     /gene="NDAI0C00580"
                     /locus_tag="NDAI_0C00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668914.1"
                     /db_xref="GeneID:11496511"
     CDS             complement(110741..112246)
                     /gene="NDAI0C00580"
                     /locus_tag="NDAI_0C00580"
                     /inference="similar to DNA sequence:INSDC:YMR033W"
                     /note="similar to Saccharomyces cerevisiae ARP9 (YMR033W);
                     ancestral locus Anc_2.593"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668962.1"
                     /db_xref="GeneID:11496511"
                     /db_xref="GOA:G0W7F8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027665"
                     /db_xref="UniProtKB/TrEMBL:G0W7F8"
                     /translation="MAPIRSENTLIIYPRSQTTLVQLGLGDETFAVPNLEIPSEIYRT
                     FDELNQCFKYHANPIESDSSCVLIKFIENGSIIDLEAFLQFIKLIYVSILDSKSKENP
                     DTAFSTELSNIPFLLITHYTWSQPQLEKITQFIFESLKILNAMLLPSSLSTSVAMISL
                     QNCCIIDIGKSHTDIIPIIDYTPLSFLASTLPMGGDNINKFLKTQLPSNFTDDQIESL
                     KKSPIFEVLNDEDIAKYSKYSDISDIINPRDNAEGMDADNDGGLDVAQIIISDRDTRE
                     LLAERERAKTEKNVPNSELENNSFIDKNGDEITVGKQRFQGCKTLIEKISKRVGLVLS
                     QIDDISKCKAAWENIVIVGGSSSIQGFKEALLTRLIKDHIVMEPENEKIKREQDSLDA
                     ANAAASETTTTTAAATTTTKGKRNANKLSGMTRSVFLPDIEYVQGPNVIRLAKYPEYF
                     PDWKKHGYAEIPFLGGEIVTKQFFNHSRDSFYITKEKYEEKGPLALWDVEF"
     gene            <112583..>113512
                     /gene="NDAI0C00590"
                     /locus_tag="NDAI_0C00590"
                     /db_xref="GeneID:11496512"
     mRNA            <112583..>113512
                     /gene="NDAI0C00590"
                     /locus_tag="NDAI_0C00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668915.1"
                     /db_xref="GeneID:11496512"
     CDS             112583..113512
                     /gene="NDAI0C00590"
                     /locus_tag="NDAI_0C00590"
                     /inference="similar to DNA sequence:INSDC:YKL049C"
                     /note="similar to Saccharomyces cerevisiae CSE4 (YKL049C);
                     ancestral locus Anc_2.592"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668963.1"
                     /db_xref="GeneID:11496512"
                     /db_xref="GOA:G0W7F9"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0W7F9"
                     /translation="MQSRKWIPSDRGNESTSHLFSSVNNSANNNYERARSIHNVNGLL
                     PSIIAHRINEEDEDEEEDADFDDLDADLRLEQDDIDQKALLLLQRTRERKNLLNGQLP
                     PEEDRGRYYQNTMNDDIGSVISGISEFNNAEEEYFGDQAGNIDDYNFQHYDGEEDISS
                     LEHPEPEHKQIRSRKLNSRVSKPLRSHDRQHQRRLEEKAEQIREDKERRAKYTPSTLA
                     LYEIRKYQRSTELLISKIPFTKLVKEVTDQFTVEEQQLHWQSMAIVALQEASEAYLVG
                     LLEHANLLALHAKRITLMRKDIQLARRIRGQFI"
     gene            <113989..>116799
                     /gene="NDAI0C00600"
                     /locus_tag="NDAI_0C00600"
                     /db_xref="GeneID:11496513"
     mRNA            <113989..>116799
                     /gene="NDAI0C00600"
                     /locus_tag="NDAI_0C00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668916.1"
                     /db_xref="GeneID:11496513"
     CDS             113989..116799
                     /gene="NDAI0C00600"
                     /locus_tag="NDAI_0C00600"
                     /inference="similar to DNA sequence:INSDC:YKL050C,YMR031C"
                     /note="similar to Saccharomyces cerevisiae YKL050C and
                     YMR031C; ancestral locus Anc_2.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668964.1"
                     /db_xref="GeneID:11496513"
                     /db_xref="InterPro:IPR024527"
                     /db_xref="UniProtKB/TrEMBL:G0W7G0"
                     /translation="MSLVSPANYLGEERKYVSTNKSYLTSSPNNPDHAPSGYDTSDEN
                     TAVSTKTTTTKTTTVTSATYVDMNDTSDTSKKKNQLSQEAIYRTKLKYGIFDSPAKHS
                     SGIADNKLAAQTAAYLTTTKILPELSGQRSTSPEPSSLPPSIAPDAQAAANKLVMSTL
                     RPEDMNLPHYLSKSSDRSSKPDITSHTAALKALSRDKSIIENAHLQASPVSSSHSHTA
                     LGKTPSKTITKEHPTQISRKLNLSQVLKGAERRANERITQRWDPTADKIERIKQSEKN
                     YAVAVASYLTNKSSMEEQTKLKNMELQRLKHQSDVGDSYKVFNMAQVKTNMKLNSIDL
                     AQKEVQLFNNEEFNRLAITKATDEYKKGQLGRVKTLKGQEGKVNLGGGLWVPWENVDK
                     LAHERTDPVLKNVHETVAREKKTTLDIKDRYKQNRLDWENWKTFQRVKDEHDQLVFEK
                     TAARNQDEKARLERDSKIKYNTMLAQMEDQINVKNEELNTAKTVHGSILATSNQELKN
                     QTVNGMNDLQTWFHSSDQRNEIHKMNQEQDLLLKPYYDDMKEVESLNEKLIEQCNDAA
                     KKIDILEKEIDVHRLNLNHIAVSIEEEHQHHIVNRGNIDILLARKTKEQSSIDEKQAT
                     IEKMKLDTLLIDKKIEENEKELALAAERLNMVEALRKNAQVEEDTAEENIKEILAYDP
                     KIFATLPTAEEYEAKADELEAEEREKLASEEENTEQEQEQEQEATPVQQDEINDQGNL
                     KEESVALNNYGGGATPTASARSVTNVSGVIVENTPATVDKPITKSNTIASSKPKDISR
                     SNRVMNNGPSTSSGAKTSNWRDNFFMGSAERKKSQRVKRQQAQQQQQQKQQQPMANKK
                     LGSITDNANVNKRGSPLATAPPIVAEEVAAGHKASTGNSQEGDLVASFTGFSQGSSPE
                     LVDANGQQGDQKNTNSLFKEVF"
     gene            complement(<117094..>118143)
                     /gene="NDAI0C00610"
                     /locus_tag="NDAI_0C00610"
                     /db_xref="GeneID:11496514"
     mRNA            complement(<117094..>118143)
                     /gene="NDAI0C00610"
                     /locus_tag="NDAI_0C00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668917.1"
                     /db_xref="GeneID:11496514"
     CDS             complement(117094..118143)
                     /gene="NDAI0C00610"
                     /locus_tag="NDAI_0C00610"
                     /inference="similar to DNA sequence:INSDC:YKL051W"
                     /note="similar to Saccharomyces cerevisiae SFK1 (YKL051W);
                     ancestral locus Anc_2.589"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668965.1"
                     /db_xref="GeneID:11496514"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="UniProtKB/TrEMBL:G0W7G1"
                     /translation="MPNNKYRPGNYFFLLPWIAFIPWYGMLITMLICWAAQGHPIYWF
                     MHSEQFPVYISDIGATNLRPLFISCAGWQGLGYVITVMCEFVQRYGFKNWYGMQPWFT
                     KDERNLIWAALILGAIGELGLLFLSIFSTARYHDAHTAMVVVFCIFMLLSIICLTTQY
                     FIMGRHYALLHPKNYQNRDYNTKTIHELKWWQWDGVVWNKFVISGYAKTVWMVLAIVF
                     AICFGAIDNDSTSASFEWLLAFWFGVIFMIISVDFYLGSRWQFSKYFNKIEDFNGYYK
                     YGKFQQVRKDKHGNGMYDNDLEKQTNEHSQAIIQDTSSGTISSSSAAIAERGNSEFVT
                     ASESDNATNERPVVV"
     gene            complement(<118964..>121021)
                     /gene="NDAI0C00620"
                     /locus_tag="NDAI_0C00620"
                     /db_xref="GeneID:11496515"
     mRNA            complement(<118964..>121021)
                     /gene="NDAI0C00620"
                     /locus_tag="NDAI_0C00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668918.1"
                     /db_xref="GeneID:11496515"
     CDS             complement(118964..121021)
                     /gene="NDAI0C00620"
                     /locus_tag="NDAI_0C00620"
                     /inference="similar to DNA sequence:INSDC:YKL054C"
                     /note="similar to Saccharomyces cerevisiae DEF1 (YKL054C);
                     ancestral locus Anc_2.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668966.1"
                     /db_xref="GeneID:11496515"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G0W7G2"
                     /translation="MVSQFKSKKLDPATKSKIETLKELFPNWSNDDLIDLVREFNDLE
                     TIIDKITTGSVTKWDEVKKPTKKDKSDYNNITSNPLFQQYLPDPEDELIAERSLKNKP
                     IKNSTAYLKPKARGVTLKQTTTLSNLNGSSSISSKPVSKKTSWASVVAANKTPISVQS
                     TPEIHESSNPVPIVKEQSETVIEKKKIKNLPSLPSLNNNSNTTINGGGMTTGSITTKK
                     MSWAALAKPKPKSIEKVKETTPNGSPLENLESLKLNINKVAEEEQEEQEEEETSSEEE
                     ETSEEEETSSEEEETSEEEESNEEEASSEEEESGEEEESGEEEESSEEEEEEAPKVKK
                     LPQKVVKEAESSEGEGESSEEESTEEEEEEEETKEEPETQKPVKPETGRRSEDNVPAS
                     APTDKISEESSKTVPQTAVSQPNTEVPQNYALPPQPQPQQQNIQSKSLSPVPQNPAMT
                     AAQQSYYMYQHQFPGYSYPGVFDGQNFAYGQQPMQGNPMNQYNMHMGYDQQQINGSEV
                     QSNSNQPPPNAMNVAGMPDQQGQGQSPVQQPYGSSFIPYYGQHFYQQSFPYNQPHYGG
                     QYGYQNPNAVNYSNYYYQNATQYPNGQPGQQGQDNRQELKKNETSDMAEAQNRSQYQQ
                     YYQFQQQQQQQQQQAAQYQQMPHQGQQQQSTSLNQQGATPQGGSYDYSNYNYSARNTG
                     NFF"
     gene            complement(<121653..>121961)
                     /gene="NDAI0C00630"
                     /locus_tag="NDAI_0C00630"
                     /db_xref="GeneID:11496516"
     mRNA            complement(<121653..>121961)
                     /gene="NDAI0C00630"
                     /locus_tag="NDAI_0C00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668919.1"
                     /db_xref="GeneID:11496516"
     CDS             complement(121653..121961)
                     /gene="NDAI0C00630"
                     /locus_tag="NDAI_0C00630"
                     /inference="similar to DNA sequence:INSDC:YKL053C-A"
                     /note="similar to Saccharomyces cerevisiae MDM35
                     (YKL053C-A); ancestral locus Anc_2.587"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668967.1"
                     /db_xref="GeneID:11496516"
                     /db_xref="InterPro:IPR007918"
                     /db_xref="UniProtKB/TrEMBL:G0W7G3"
                     /translation="MGNIMSSSFAPECTELKTKYDDCFNEWYSEKFLKGKSVENECSK
                     EWYAYSTCIDAALVKQGIKPALDEARKEAPFENGASCKVLKKVRTNIDIELGAFIIIK
                     "
     gene            complement(<122215..>123180)
                     /gene="NDAI0C00640"
                     /locus_tag="NDAI_0C00640"
                     /db_xref="GeneID:11496517"
     mRNA            complement(<122215..>123180)
                     /gene="NDAI0C00640"
                     /locus_tag="NDAI_0C00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668920.1"
                     /db_xref="GeneID:11496517"
     CDS             complement(122215..123180)
                     /gene="NDAI0C00640"
                     /locus_tag="NDAI_0C00640"
                     /inference="similar to DNA sequence:INSDC:YKL052C"
                     /note="similar to Saccharomyces cerevisiae ASK1 (YKL052C);
                     ancestral locus Anc_2.588"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668968.1"
                     /db_xref="GeneID:11496517"
                     /db_xref="GOA:G0W7G4"
                     /db_xref="InterPro:IPR013964"
                     /db_xref="UniProtKB/TrEMBL:G0W7G4"
                     /translation="MTSIEKLDQEITLNLQKIDSNLGYCFKKITQDIIPQIRNYSTIC
                     DQITDSTNWLNVMFQQTANVDLNMHVNASAIVANTNGNNLTSNNNSGSDDKSQSQRDS
                     IFPVGVRTQKRSTNGLDSSSEITIPKLKNSLSASNGQKIDRKTIDSNNNNNDSKEDEY
                     EFHAANITSTGQVLAVPDSSDDDSAGALTNSNTKLTKPRDDATNGTDDPDGSTYQRQN
                     KKRKVSLLLQQEYGSSSSVLPSPVALTRKENNDLESAGSMLNSTSSGNNDLMNSSPLK
                     QGTTTGTTNANTVTVTHSTTTNDDALSNEEHSTKETNLVIHFPTN"
     gene            <127492..>128574
                     /gene="NDAI0C00650"
                     /locus_tag="NDAI_0C00650"
                     /db_xref="GeneID:11496518"
     mRNA            <127492..>128574
                     /gene="NDAI0C00650"
                     /locus_tag="NDAI_0C00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668921.1"
                     /db_xref="GeneID:11496518"
     CDS             127492..128574
                     /gene="NDAI0C00650"
                     /locus_tag="NDAI_0C00650"
                     /inference="similar to DNA sequence:INSDC:YKL060C"
                     /note="similar to Saccharomyces cerevisiae FBA1 (YKL060C);
                     ancestral locus Anc_2.577"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668969.1"
                     /db_xref="GeneID:11496518"
                     /db_xref="GOA:G0W7G5"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W7G5"
                     /translation="MGILEQLKRKSGVIVGDDVAALFAYAKEHKFAIPAINVTSSSTV
                     VAALEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIKGSVAAAHYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWFDGMLEADEAYFKVHGEPLFSSHMLDLSEETDEENISTCVK
                     YFKRMAAMQQWLEMEIGITGGEEDGVNNESADKEDLYTKPEQVFAVHQALAPISSNFS
                     IASAFGNVHGVYAGTMDLRPEILADQQAYAAKQLGQPAGSKPLNFVFHGGSGSTDAQF
                     HTGIDNGVVKVNLDTDCQWAYLTGIRDYVLNKKDYIMTTVGNPTGPEAPNKKYFDPRV
                     WVREGEKTMTARIAQALAIFRTQNTL"
     gene            complement(<130315..>130635)
                     /gene="NDAI0C00660"
                     /locus_tag="NDAI_0C00660"
                     /db_xref="GeneID:11496519"
     mRNA            complement(<130315..>130635)
                     /gene="NDAI0C00660"
                     /locus_tag="NDAI_0C00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668922.1"
                     /db_xref="GeneID:11496519"
     CDS             complement(130315..130635)
                     /gene="NDAI0C00660"
                     /locus_tag="NDAI_0C00660"
                     /inference="similar to DNA sequence:INSDC:YKL061W"
                     /note="similar to Saccharomyces cerevisiae YKL061W;
                     ancestral locus Anc_2.572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668970.1"
                     /db_xref="GeneID:11496519"
                     /db_xref="InterPro:IPR020491"
                     /db_xref="UniProtKB/TrEMBL:G0W7G6"
                     /translation="MDNREFSNSSGGKNKFLQTKVEACVNSLQELLDTEAARSISTFA
                     GKTGSNKVWLEELSAEYKLKPDRKLDAIGELYAQQLKQLDDLEEKSFIMKIYVMKLKS
                     FKKN"
     gene            <130848..>132401
                     /gene="NDAI0C00670"
                     /locus_tag="NDAI_0C00670"
                     /db_xref="GeneID:11496520"
     mRNA            <130848..>132401
                     /gene="NDAI0C00670"
                     /locus_tag="NDAI_0C00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668923.1"
                     /db_xref="GeneID:11496520"
     CDS             130848..132401
                     /gene="NDAI0C00670"
                     /locus_tag="NDAI_0C00670"
                     /inference="similar to DNA sequence:INSDC:YKL047W"
                     /note="similar to Saccharomyces cerevisiae YKL047W;
                     ancestral locus Anc_2.571"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668971.1"
                     /db_xref="GeneID:11496520"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="InterPro:IPR028115"
                     /db_xref="UniProtKB/TrEMBL:G0W7G7"
                     /translation="MNRYISLATTPYTVQDVLSELLKASSTKKKLPIVGMFLCQFDMR
                     KGNVKIWSQLNEQYKDNELVLENIEFKTLPSGLHASSEDVITFTIPRNSLANEDVRNE
                     PFYGVAYYNQNSYDIMEGHSEIDRSKVRMYAFGVIVNPVEKVKDNPFASITMVNKYID
                     NLEDTLKEWLNLNDDLNFAIFEEFFTENSTRENQSQILDSVVEENITINSSRRRHMVE
                     YLPFWFRKFGPLIFTIWKECLLDKRILILNGSGESLETCNSLCFYMSLLSMKTNEIST
                     DQKFITPLFTVGTTDIDSLKRLSHYSYIACTNDEILADKQELYDILIRLPSHTMESEE
                     EAPVKIFTNNGTQIKATRNDFEQYELFVKEHLHEEVSGSLKRSCLNVTEPVSWSQFFI
                     DSAYCIATAGTVAAPFHFHPEVIDIGDINEASDKADGISSIAEPLKFSLFFNIKTKRL
                     YDALETILNENESLDSDGPIHISSHSLLKLNLDCFSSQDKQFVEQFCQLYFNRKIAID
                     YYEYFKAFC"
     gene            complement(<132980..>134338)
                     /gene="NDAI0C00680"
                     /locus_tag="NDAI_0C00680"
                     /db_xref="GeneID:11496521"
     mRNA            complement(<132980..>134338)
                     /gene="NDAI0C00680"
                     /locus_tag="NDAI_0C00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668924.1"
                     /db_xref="GeneID:11496521"
     CDS             complement(132980..134338)
                     /gene="NDAI0C00680"
                     /locus_tag="NDAI_0C00680"
                     /inference="similar to DNA sequence:INSDC:YKL046C"
                     /note="similar to Saccharomyces cerevisiae DCW1 (YKL046C);
                     ancestral locus Anc_2.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668972.1"
                     /db_xref="GeneID:11496521"
                     /db_xref="GOA:G0W7G8"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:G0W7G8"
                     /translation="MLLTNTLLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAY
                     GLMDYYTGNQYGKTIGMFSDPYYWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQT
                     GDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAERNFTNPPEDSPQWLYLAQAVFNTMAL
                     RWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALFHMAARLARYTGNQSYVDWAEKVYD
                     WMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTYNHGLVMAGAAYLYNFTENEVWH
                     NRTKMLVDASTVFFNNSIMYEAACQGPNSCNTDQRSFKAYFSRFLGATAQLVPETRSK
                     ILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMYGLGEQMCALEVMVNTRCLHK
                     PAPYTSTNGGSSVGDGAAGTEHHPTNLAPLHITKGSRAGAGIITAVIGISILACALWL
                     VF"
     gene            complement(<134897..>136849)
                     /gene="NDAI0C00690"
                     /locus_tag="NDAI_0C00690"
                     /db_xref="GeneID:11496522"
     mRNA            complement(<134897..>136849)
                     /gene="NDAI0C00690"
                     /locus_tag="NDAI_0C00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668925.1"
                     /db_xref="GeneID:11496522"
     CDS             complement(134897..136849)
                     /gene="NDAI0C00690"
                     /locus_tag="NDAI_0C00690"
                     /inference="similar to DNA sequence:INSDC:YDR463W,YHR006W"
                     /note="similar to Saccharomyces cerevisiae STP1 (YDR463W)
                     and STP2 (YHR006W); ancestral locus Anc_5.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668973.1"
                     /db_xref="GeneID:11496522"
                     /db_xref="GOA:G0W7G9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G0W7G9"
                     /translation="MPSVALLNPLKNEKISSSTSKGSKLWNLFKQIIDTVITPSYRDD
                     SNTSIKNTPKVLEKDTISKVSIPEHNIRNVTQGKSEELEERQYSKTDNTSTNRDSDNN
                     DDDDNNSNNSNNSNDENLIYSLFPKKIIIDKNLDSETSINPCSLDMTKTTSSMTMTLT
                     PQGNITCDLSTTNFNDLDFNREPSTFNINNKQTQVPPRPPQQQQQHVVQPISPESNDS
                     PANNKKNKTAAAATLVHSPSSSSDKNINNSTENGHLSTSTSSSPLVEDTEEEGTFVCH
                     YCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTYKTHLKA
                     RHFIYPKGVKPQDRNKSSGHCSQCGEFFNSTDIWISKHLESGNCKALPKDYLKIIKPE
                     RKKTGKLKMIKTSTGHSRFISTAQSVVEPKVFLNKDALEAMAIVAHDTNRNDVLLNYG
                     NNKLMMNTEDFQGEAKLKRKTNRTAKKIQQNKSLPNHTNIISSHSTNQNNNNNVNTHT
                     HTKNGGYNPLFFNGTSQQDINLLETIPSSSSSLSSAESFRLNHYNLTSSQSPVLENHL
                     LSSSDSHQTNTYDDDDTISVVPLDMEQSPYISITGTNTNNITQHPNVDKNVQKLQFNP
                     VIINDRHIKETQQYLNFYNYSSGSNL"
     gene            complement(<137486..>138862)
                     /gene="NDAI0C00700"
                     /locus_tag="NDAI_0C00700"
                     /db_xref="GeneID:11496523"
     mRNA            complement(<137486..>138862)
                     /gene="NDAI0C00700"
                     /locus_tag="NDAI_0C00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668926.1"
                     /db_xref="GeneID:11496523"
     CDS             complement(137486..138862)
                     /gene="NDAI0C00700"
                     /locus_tag="NDAI_0C00700"
                     /inference="similar to DNA sequence:INSDC:YDR058C"
                     /note="similar to Saccharomyces cerevisiae TGL2 (YDR058C);
                     ancestral locus Anc_1.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668974.1"
                     /db_xref="GeneID:11496523"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W7H0"
                     /translation="MFSETFNTLFSGIFQKNIIPINPYHIYINNDQKKHRSNTDTIRR
                     KEEQTDILTFTNLIEINTTTHAEEEEEEEAGKNVIIDFVTSYRDFLKLKKSKERKVED
                     IILNNFEPNPDYKPPKYPVVLCHGLSGFDRLVLIPSIYSLTKLIMNSINSDKSDNFLI
                     DDRDDDSDGKTTVGNVSERAKDDKKIAHRLGEVEYWIGIKEILEEKGCSVLTTRVPSF
                     GSIEERALALHEFLESEIKRKLNSKGKDNSNGKVKLNLIAHSMGGLDCRYLISKIPKK
                     NYQVVSLTTISTPHHGSEMADYVVNLFEKLKTVPSFGTNDSTTSSTQILPLCFYQLTT
                     DYMKYFNFITPDDPKVAYFSYGCYFQPKWYNVFAMSWKIVYDASNGARNDGMVTVDSS
                     KWGQYQGTLANIDHLDIINWKNKVKLDLGKMILNLKNENLKKMVEPDIDILEFYVNIT
                     DNLAKKGF"
     gene            <139100..>139990
                     /gene="NDAI0C00710"
                     /locus_tag="NDAI_0C00710"
                     /db_xref="GeneID:11496524"
     mRNA            <139100..>139990
                     /gene="NDAI0C00710"
                     /locus_tag="NDAI_0C00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668927.1"
                     /db_xref="GeneID:11496524"
     CDS             139100..139990
                     /gene="NDAI0C00710"
                     /locus_tag="NDAI_0C00710"
                     /inference="similar to DNA sequence:INSDC:YKL055C"
                     /note="similar to Saccharomyces cerevisiae OAR1 (YKL055C);
                     ancestral locus Anc_2.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668975.1"
                     /db_xref="GeneID:11496524"
                     /db_xref="GOA:G0W7H1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G0W7H1"
                     /translation="MHKGIPIAIVTGATRGIGKAIVKKLSQQGVSCLGIGSSMESISG
                     ITTNDHLHFTEPNQIHRSMAIDLTNWPQWTRRQQQKDNKLMFKGYQYQDPATSSSSSD
                     ADATIRTEICKSLFDSQWSSSNPQHRYYVNLLVNCAGITQDSVSIRTSTEMILKILNV
                     NFASCVTLSNLTLKKMIKWQNMIKREQLTPPKDVPSPCIINISSILGQGDITLPGTSI
                     YSASKAALIQYTKTLAQETETWGIRTQSMTPGLIPNTDMIQDLDQVTRNQLTKLMGLN
                     VTSSEVVANDIWDRYIRRDN"
     gene            <140374..>140877
                     /gene="NDAI0C00720"
                     /locus_tag="NDAI_0C00720"
                     /db_xref="GeneID:11496525"
     mRNA            <140374..>140877
                     /gene="NDAI0C00720"
                     /locus_tag="NDAI_0C00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668928.1"
                     /db_xref="GeneID:11496525"
     CDS             140374..140877
                     /gene="NDAI0C00720"
                     /locus_tag="NDAI_0C00720"
                     /inference="similar to DNA sequence:INSDC:YKL056C"
                     /note="similar to Saccharomyces cerevisiae TMA19
                     (YKL056C); ancestral locus Anc_2.584"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668976.1"
                     /db_xref="GeneID:11496525"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:G0W7H2"
                     /translation="MIIYKDIFSNDELLSDAYDIKEVDGVIYEADCAMIKVGGDNIDI
                     GANPSAEDGDDDVEDGAEVVNNVVNSFRLQPTGFDKKSFLTYIKGYMKAVKAKLQESN
                     PDAVSTFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMIVMLNYREDGTTPFVAIWKH
                     GITEEKI"
     gene            complement(<141319..>141687)
                     /gene="NDAI0C00730"
                     /locus_tag="NDAI_0C00730"
                     /db_xref="GeneID:11496526"
     mRNA            complement(<141319..>141687)
                     /gene="NDAI0C00730"
                     /locus_tag="NDAI_0C00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668929.1"
                     /db_xref="GeneID:11496526"
     CDS             complement(141319..141687)
                     /gene="NDAI0C00730"
                     /locus_tag="NDAI_0C00730"
                     /inference="similar to DNA sequence:INSDC:YKL058W"
                     /note="similar to Saccharomyces cerevisiae TOA2 (YKL058W);
                     ancestral locus Anc_2.580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668977.1"
                     /db_xref="GeneID:11496526"
                     /db_xref="GOA:G0W7H3"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="UniProtKB/TrEMBL:G0W7H3"
                     /translation="MAVPGYYELYRRSTVGNSLVDALDTLISDGRIEASLAMRVLETF
                     DKVISETLKDNTQAKLTVKGNLDTYGFCDDVWTFIVKNCKVTVEGNSQINGDSNNSDD
                     QNIINVDKLRIVACNSKRSD"
     gene            <142062..>143450
                     /gene="NDAI0C00740"
                     /locus_tag="NDAI_0C00740"
                     /db_xref="GeneID:11496527"
     mRNA            <142062..>143450
                     /gene="NDAI0C00740"
                     /locus_tag="NDAI_0C00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668930.1"
                     /db_xref="GeneID:11496527"
     CDS             142062..143450
                     /gene="NDAI0C00740"
                     /locus_tag="NDAI_0C00740"
                     /inference="similar to DNA sequence:INSDC:YKL059C"
                     /note="similar to Saccharomyces cerevisiae MPE1 (YKL059C);
                     ancestral locus Anc_2.579"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668978.1"
                     /db_xref="GeneID:11496527"
                     /db_xref="GOA:G0W7H4"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="UniProtKB/TrEMBL:G0W7H4"
                     /translation="MSSTIFYKFKSQRNTSRILFDGTGLTVFDLKREIIQENKLGDGT
                     DFQLRIYNPDTNDEYEDDQEVIPRSTSVTVRRSPSLKSSSVHNRNKPQSHNSMVIGNA
                     TRYVTGKPRVFANTSKKPERSSAATPAAVSGVTEEERIANMFANQENQWEQTQQAMSD
                     ATPIFHRSNNAAATSNADNEGPPPPGYMCYRCGARDHWIKNCPTNTDPNFEGKRIKRT
                     TGIPKKFLKTVDIDPEKMSAEEMAQRKIMITDEGTFVVQIADEHSWENYQRKQQNRLI
                     DGEDSIWEKDHFKDLPDTLKCPITGGLLSSPVKTSNCCNVDFSKKAIEDTLVESDFVC
                     PNCGKEDILLDSLIDDEDKKKEVEEFLKEHADEKKKGQDISPSSGTVDGADNVEDVHV
                     DKKIKLTPNGAPILPPHMPVPPFGMPFPMFPMPFMPPPPPHMMQNNKQSNPQSQNSSS
                     TQQSMPSQVQSK"
     gene            complement(<143572..>145005)
                     /gene="NDAI0C00750"
                     /locus_tag="NDAI_0C00750"
                     /db_xref="GeneID:11496528"
     mRNA            complement(<143572..>145005)
                     /gene="NDAI0C00750"
                     /locus_tag="NDAI_0C00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668931.1"
                     /db_xref="GeneID:11496528"
     CDS             complement(143572..145005)
                     /gene="NDAI0C00750"
                     /locus_tag="NDAI_0C00750"
                     /inference="similar to DNA sequence:INSDC:YML038C"
                     /note="similar to Saccharomyces cerevisiae YMD8 (YML038C);
                     ancestral locus Anc_5.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668979.1"
                     /db_xref="GeneID:11496528"
                     /db_xref="GOA:G0W7H5"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G0W7H5"
                     /translation="MKTITLIYIAGWYFSAIALSLYNKWMFDPKNGLGVSYPILVTVF
                     HQTILWILAFIYIKIENFNKRPKISLDDMENIPRASAPAPAPTTTTTTTTTNEHKNDW
                     KFYLKYLIPTAVATAGDIGFSNVSFKFVPLTIYTTIKSSSIAFVLLFSCIFKIEKFHW
                     KLSMIVSIMFIGVVMMVYKPNSTSNDEIDDYSALIFGAFLVLAAACLSGLRWVYTQLI
                     LRNKPEPSIESRSSSNQTSEVSDLRIQQRVTSSLKKRKTHPMYTIYQLAPIMGITLFI
                     TALIIEKPFPGIFQSNLFKVSPGVNDTITKFSICKGFILLIIPGICVFILTYCEFGIL
                     QHTKVLTMSIAGIIKEVLTIIFSMIVLGERLSGIYNWIGMTIVLLDVSYYNYFRYKQK
                     IEQKYEHIGNDNVDDTNANDNSMTEQYASDSFIEEDDEGETSNQEEAEFVPYSITTDS
                     VLQEYELHYVVSNKLPDAIATPSENKV"
     gene            complement(<145635..>147044)
                     /gene="NDAI0C00760"
                     /locus_tag="NDAI_0C00760"
                     /db_xref="GeneID:11496529"
     mRNA            complement(<145635..>147044)
                     /gene="NDAI0C00760"
                     /locus_tag="NDAI_0C00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668932.1"
                     /db_xref="GeneID:11496529"
     CDS             complement(145635..147044)
                     /gene="NDAI0C00760"
                     /locus_tag="NDAI_0C00760"
                     /inference="similar to DNA sequence:INSDC:YML037C"
                     /note="similar to Saccharomyces cerevisiae YML037C;
                     ancestral locus Anc_5.582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668980.1"
                     /db_xref="GeneID:11496529"
                     /db_xref="UniProtKB/TrEMBL:G0W7H6"
                     /translation="MEELLADIFNTNDVERKMLSDEDKTEPKDCNEGEDASLYKLLDE
                     VSGGRKLMSFLFQHHDVTQDSFSTRSWYRRDNPIINKCYDIGEEWLEEEKYASNFQSG
                     NNISMALPIDTPVLFAWSNKGTTTSNKLLKTKQAKGKEEAEDEEDVSRQPQKERKEES
                     TNQKLFKLASIGLKEIVRERDLSSSEMYNTIQGKRQDSNNILIMTNSSTNVYSVGSQD
                     TDKNTSVFGESTFKIDPLQKFVPRGISHTKNADKDGIDHKRTKHKSKGKSSFWFWSSH
                     SKKKNESKGSRHTKDKKEKSPEKAKNGSVPVFALAENDDSENVIFNSEGQSFNEPNSD
                     VKPHIMRQEPRISDNVSELENSKEENAVDDGYDGEGKKDDASESGSEDDFGDFEQGTV
                     ASNVNNVQESLESPSLPNSETISFGSTKYNSPSETPTLTETASPPSKPTKPIFPISHN
                     LDTRINSISDFTPLQPKKR"
     gene            <147324..>147857
                     /gene="NDAI0C00770"
                     /locus_tag="NDAI_0C00770"
                     /db_xref="GeneID:11496530"
     mRNA            <147324..>147857
                     /gene="NDAI0C00770"
                     /locus_tag="NDAI_0C00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668933.1"
                     /db_xref="GeneID:11496530"
     CDS             147324..147857
                     /gene="NDAI0C00770"
                     /locus_tag="NDAI_0C00770"
                     /inference="similar to DNA sequence:INSDC:YML036W"
                     /note="similar to Saccharomyces cerevisiae CGI121
                     (YML036W); ancestral locus Anc_5.581"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668981.1"
                     /db_xref="GeneID:11496530"
                     /db_xref="GOA:G0W7H7"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="UniProtKB/TrEMBL:G0W7H7"
                     /translation="MTLITIPQFPEYNVSITLFKDVTNSKVIRSHIADSKIAFLDAKL
                     IVSTEQVYSAIYKALIENKYNRLRTKTILSECLFCLSPTSNIGDAFKKFGIKDDSKNV
                     ICLKVLSNGESLDDVNKEVLDVVDGTMIEFNDDNLKDMYDVTLVRKIYKLEKDFQPAT
                     TTELSRALVNAIQIRGL"
     gene            complement(<148032..>150392)
                     /gene="NDAI0C00780"
                     /locus_tag="NDAI_0C00780"
                     /db_xref="GeneID:11496531"
     mRNA            complement(<148032..>150392)
                     /gene="NDAI0C00780"
                     /locus_tag="NDAI_0C00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668934.1"
                     /db_xref="GeneID:11496531"
     CDS             complement(148032..150392)
                     /gene="NDAI0C00780"
                     /locus_tag="NDAI_0C00780"
                     /inference="similar to DNA sequence:INSDC:YML035C"
                     /note="similar to Saccharomyces cerevisiae AMD1 (YML035C);
                     ancestral locus Anc_5.578"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668982.1"
                     /db_xref="GeneID:11496531"
                     /db_xref="GOA:G0W7H8"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="UniProtKB/TrEMBL:G0W7H8"
                     /translation="MNLDQTSQNFSDLSLEVTPSNDELNPNYSNLALNNDSRKVDRKN
                     VANRLALQTSRDNIESQDDFMSGNDANYSYHEEQQLNEHNLKQLATDGSIPANSVIYD
                     QPLHSTNLDGSAKKSRTLSTSAQHTIPDPLRNTWVDDSNKKDSYAYKMGMLADDAAQQ
                     FLDSPSPELIGLYSNVTDCRNLRAKYQTLSCQNPSQNPKNKPDWEVYPPPPKPSYNAE
                     TKTVINVVNKPDMEVFDFDKCEIPGEDLDWDFDVNDDDSYFVHKSGDKDSKIAEIPTL
                     RDYYLDLEKMITISSDGPAKSFAFRRLQYLEARWNLYYLLNEYQETTVSKRNPHRDFY
                     NVRKVDTHVHHSACMNQKHLLRFIKHKLRHSKDEKVIFRDGKVLTLAEVFQSLNLTGY
                     DLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTDNYIKGKYLADITKQVL
                     SDLENSKYQNCEYRISIYGRSIDEWDKLAGWIVDNKIISHNIRWLIQIPRLYDIYHKS
                     GIVNNFQDICRNIFQPLFEVTKNPKSHPKLHVFLQRVIGFDSVDDESKVDRRFHRKYP
                     KPSLWEAPQNPPYSYYLYYQYASMASLNQWRAKRGFNTLVLRPHCGEAGDPEHLVSSY
                     LLAQGISHGILLRKVPFVQYLYYLDQVPIAMSPLSNNALFLTYDKNPFPRYFKRGLNV
                     SLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNSVLQSGWEAQIKEHWIG
                     KNFNRPGVEGNDVVKTNVPDIRINYRYDTLSTELELVNHFANFRNK"
     gene            <151077..>154331
                     /gene="NDAI0C00790"
                     /locus_tag="NDAI_0C00790"
                     /db_xref="GeneID:11496532"
     mRNA            <151077..>154331
                     /gene="NDAI0C00790"
                     /locus_tag="NDAI_0C00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668935.1"
                     /db_xref="GeneID:11496532"
     CDS             151077..154331
                     /gene="NDAI0C00790"
                     /locus_tag="NDAI_0C00790"
                     /inference="similar to DNA sequence:INSDC:YDR458C,YML034W"
                     /note="similar to Saccharomyces cerevisiae YDR458C and
                     SRC1 (YML034W); ancestral locus Anc_5.577"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668983.1"
                     /db_xref="GeneID:11496532"
                     /db_xref="GOA:G0W7H9"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:G0W7H9"
                     /translation="MNSDTDYLKPGFNFKKLRVPDLRRILTENHVTYLSSSKKSDLLK
                     LFKENIEPRLPELREIHLHAQPSSEGIIDTNHTSGRNTSTSQSPDIRSSKHGLVWQAD
                     SDSNLNSDSSDSDSDSLTSFASQIKSKGSITPKPKKRKIGIPNDGTPIVNKVSKKSPS
                     KSPNKSTSINNFDLSSGSDSETIEGLSINRSHPHISPNKGIEGFFHQENKNAGSNDED
                     PNKLKEAAAHVKPLAKLIKNNEKKKNIVRTYSSFSSDDSDIELEYQKAKRLVSGSNDN
                     TNDESSSFQKEKDTSNRASTPTMDQQIIEILESDEEEEEDVGSNNTEKSLETESPNIQ
                     PIESPPKKQTVNTTRSILPKQEPSSENATPIKQKEIGSEENDADVNDNTNISSSEEES
                     SSKSVTQRITTPELPTAEDVQESEDRVEELDKILNEEKTDTNNDFNKTTNQELIKEQV
                     SPTSKVKETQMVSSLGEKNTSTPSSSKGEPATQRFPSHTKNHGSPRIKTPSKDVIKRS
                     PIFKAYKLASPKISKKAPFSDKPHISNQQNSIVKPIKRDALPKVDITQPIVSLADTST
                     TTKETSSQKHPLSQDELEELSEMLSSTDGELEKDLEPEDNDINMEETERSTQSENETV
                     SSSPLETEKVAITKNGKRALESDDVEEIKQVPKKKRRVIVGIKKILKTLCSLLKKIIL
                     LLLLIIPVIIALWYREQRIMVGYCGTEVDNRPSLIMRNVDYPYAYEIDSALQTYLKPE
                     CLPCPENAICYSNMEMKCRPKYRLVESRWNLFGLLPVSASCQRDDQRDQLVSEVVKKS
                     LEFLRTKNAQIECGRSTDDIGSGLSEEELYEIFNEARVPWIDDDEFNDIWNQVISNLK
                     EEPEVIWRQVSTNFFFNAFSIERPKNNNTNIFYLNYRTMTRSLQRIPPMTQAQPMIIK
                     GRKDIFTKIPKSKKEKGTFRSTSTKHVSVKCKFQWEIYETYRRNRYLIWTGLSTATLA
                     KIVEKKLKNYFEEKAKIVTVTRDVLKRLQKVKKQGSNPPYLSSIQLRDIFLADVVDFK
                     RKAYLWKHVEKNLEHNNSNIKSTLMEIHGDIMKCWEWIGPLDTEDEEEEHENLA"
     gene            complement(<154820..>156226)
                     /gene="NDAI0C00800"
                     /locus_tag="NDAI_0C00800"
                     /db_xref="GeneID:11496533"
     mRNA            complement(<154820..>156226)
                     /gene="NDAI0C00800"
                     /locus_tag="NDAI_0C00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668936.1"
                     /db_xref="GeneID:11496533"
     CDS             complement(154820..156226)
                     /gene="NDAI0C00800"
                     /locus_tag="NDAI_0C00800"
                     /inference="similar to DNA sequence:INSDC:YML032C"
                     /note="similar to Saccharomyces cerevisiae RAD52
                     (YML032C); ancestral locus Anc_5.575"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668984.1"
                     /db_xref="GeneID:11496533"
                     /db_xref="GOA:G0W7I0"
                     /db_xref="InterPro:IPR004585"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:G0W7I0"
                     /translation="MEEKKPTSLVNEEIQAKLDKKLGPEYISKRIGFGSSRVAYIEGW
                     RAINLANQIFGYNGWSTEVKNVTIDFLDERQGKFSIGCTAIVRVTLANGTYREDIGYG
                     TVENERRKPAAFERAKKSAVTDALKRALRGFGNALGNCLYDKDFLSKIDKVKFDPPDF
                     DEGNLFRPSDEISENSRSNTMDASDSAVPTKRRQIGKIGVPHNNIPIETPQQTNRPIR
                     NAASIDQQNKQNTSMSEPPKTGPAGENVPPTTAKSEQDDLLDDSFMFSDDFQDDDLMD
                     NEEDQVLKDTMEVPLVPPASRGPIINEPVTFVTAKAATTLQNKAQVTDDSIFDPKYQA
                     QSIKHTIDQTTSKHVPADTLKEKGVSPSREELYQKFAPKGKQLDSNTTNHQQTESPES
                     STTTAKPSSQQHAFVTNQTTQKPSTTAQTSRFAPPSKVIHPNPALSSTMSANSSKSMR
                     REIGRPKINPLQMRKPTP"
     gene            <156298..>158556
                     /gene="NDAI0C00810"
                     /locus_tag="NDAI_0C00810"
                     /db_xref="GeneID:11496534"
     mRNA            <156298..>158556
                     /gene="NDAI0C00810"
                     /locus_tag="NDAI_0C00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668937.1"
                     /db_xref="GeneID:11496534"
     CDS             156298..158556
                     /gene="NDAI0C00810"
                     /locus_tag="NDAI_0C00810"
                     /inference="similar to DNA sequence:INSDC:YML031W"
                     /note="similar to Saccharomyces cerevisiae NDC1 (YML031W);
                     ancestral locus Anc_5.574"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668985.1"
                     /db_xref="GeneID:11496534"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:G0W7I1"
                     /translation="MAKANLHSTLFKLWRSVKLFMFLLTFAIRIIEEFYFPCNSSFMK
                     KTLMISSHSLRRHYKGELLQLLDINLDIQYERTGEVLIIMQRQKPLLSNTRYSYHAIF
                     SDICKTRFSHLVTRLFFVTTLLQTLLITILSSPQSFAWERVLLFFPRFLFIYIVSISI
                     IITRKNYLHVESIGYSNWYTTIFGQLCSTRFVVYQFIYCVGTFAIALALGDCFQISSL
                     SRNSASLHKLYVWLLIPTLYNLQHNIFDQDKISFPFESQIQLPQQYISRSLRHLVIKS
                     LIMTITLPIMVPILSLILPFNIVPRGLILIGFISNLKLAILSFWIFMNFEFINVAFSA
                     HMSIGCLHKGKPISSLSPNSMEILLDGLSSKRAFTKLTAFQELAYRATSSDSSLRLPL
                     YKPNFKDSNLWPLILRECLLVIQNTNESVTGYLRNIEIQSSVNQPKTMLATSNSNLGD
                     KSLFDRQRQEEIIRNEMIFGNAPSPNMLKYESLQNVPMPLPSRMATTSSRHRMPLRDE
                     NVLLTPPPAHGSRGRRFQPSSSPSIYQRSPSNVPTHPFNEPILTHSTGLTRFFHFIVN
                     TIKSSLSSFFFPSITPSSSSSSNAEKTIPHLSFFSMFCTSKKNEADKLVPLPICHAES
                     VISLMALLINSLDESPRGPVIASVGDVLRSLQLSINCLGKFTEWEPSPFKDVTAIYSE
                     GEEQEQKIKEEVDVISVLYNLSISAFLEIVLKYDDLLKDVNLDEDVVKLTRWVLEMCN
                     NSTFLAPSNEEL"
     gene            <158969..>159472
                     /gene="NDAI0C00820"
                     /locus_tag="NDAI_0C00820"
                     /db_xref="GeneID:11496535"
     mRNA            <158969..>159472
                     /gene="NDAI0C00820"
                     /locus_tag="NDAI_0C00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668938.1"
                     /db_xref="GeneID:11496535"
     CDS             158969..159472
                     /gene="NDAI0C00820"
                     /locus_tag="NDAI_0C00820"
                     /inference="similar to DNA sequence:INSDC:YML030W"
                     /note="similar to Saccharomyces cerevisiae YML030W;
                     ancestral locus Anc_5.571"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668986.1"
                     /db_xref="GeneID:11496535"
                     /db_xref="GOA:G0W7I2"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:G0W7I2"
                     /translation="MSSIPSSFDPKRGEALELEEMPIWDKIVFHCKREPLVPIGALLT
                     TGAVILAAQNVRIGNQVRAQHYFRWRVGLQGATLVALVTGSYLYGTTSAKAIKSKEDE
                     LKEKAKRREQLWIQELERRDQEIKDRRLKAEVARKKTVESEESIKDLETELADLESKL
                     HGSSTGK"
     gene            <159881..>162859
                     /gene="NDAI0C00830"
                     /locus_tag="NDAI_0C00830"
                     /db_xref="GeneID:11496536"
     mRNA            <159881..>162859
                     /gene="NDAI0C00830"
                     /locus_tag="NDAI_0C00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668939.1"
                     /db_xref="GeneID:11496536"
     CDS             159881..162859
                     /gene="NDAI0C00830"
                     /locus_tag="NDAI_0C00830"
                     /inference="similar to DNA sequence:INSDC:YML029W"
                     /note="similar to Saccharomyces cerevisiae USA1 (YML029W);
                     ancestral locus Anc_5.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668987.1"
                     /db_xref="GeneID:11496536"
                     /db_xref="UniProtKB/TrEMBL:G0W7I3"
                     /translation="MECIIEPPVHVFITSTNLEWIPDGEPININIHPKTPLYRVLQYV
                     HSRLPIQLGPITNYCLKYNEEEVDLSQLCDTFINEGNSGRPSATPNDNNTLFFQFEKT
                     ENEPHSSINLNYDRILEFKKIDLILKINSLSRDKFVTVVAKNSPIETTSVKNLLQFAL
                     DSVIQYEIFSSDRVDEHGNYLNICQNCEAHNFSDFTHLQIKGSEKMLTLNEMEPSSLE
                     DMKLDTLLDYTFLPAKNDYLTVMLKMNHKQEHDETCVKLEFISDIALSDYEMWINPQT
                     TVLQVKHFISCLYTHSKDLNVDHIRLIYKGHLLGSIDGSDIILNSINSMRRDSNSSSH
                     IHRYNGNNSEIKLHIQFDAEHLDLNHDFWDKPLRSSSAHHDDSRQSSKGSSTQENVDD
                     IPVNNEQSSHIEESVLEEQNCEEMLRDERKPLKLCYETESGEPIETTTEIYKKCFIDG
                     KECFIELSELEIKKYQLIINSKIIPLYSHDIQILTENNTIKLSPKVINEIESTLALKV
                     KKNQYKVLSPSSTIPVEPTRTIHIDSNNDAENVSIIQRLREILPFGALLVRTFILLIR
                     NSFITLFVLVEFGTLLPYKYTILLALIMIGRTLWTTREICDLWSAYFHLKEIDDTKIN
                     KILSFLEGQTISPKYFKKLINDKPSLDSFLISELKMDRIDLYINHNTFTGDDNELANI
                     ETDISRNADEKSLKQTLEKVIMTVTEGINEDEDNDGFQEKKDLIDDTYQLFIKCVNNY
                     QVNKDNMDPVQLENSKLLMFSILREIDQVNMDKLPIYKRIFEKIIIQLEKITDMRLLE
                     RIIPDPRTDNIIMATLKNISLFILLLIPGIAEKLATFINRQHGILEAGRHQERQEAES
                     QRRADVHALNEENTSGNASDTDDDDDDDDSSDNELDHLIIPDESETEDNEQPASSEEG
                     LDHDGNVDLDERIEEIILDHDLATEEVQEEDLYESNQDSSVVNDNNIIETVRNASDQP
                     NDDNVAEHCSSGVAIHSSDD"
     gene            <163744..>164334
                     /gene="NDAI0C00840"
                     /locus_tag="NDAI_0C00840"
                     /db_xref="GeneID:11496537"
     mRNA            <163744..>164334
                     /gene="NDAI0C00840"
                     /locus_tag="NDAI_0C00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668940.1"
                     /db_xref="GeneID:11496537"
     CDS             163744..164334
                     /gene="NDAI0C00840"
                     /locus_tag="NDAI_0C00840"
                     /inference="similar to DNA sequence:INSDC:YDR453C,YML028W"
                     /note="similar to Saccharomyces cerevisiae TSA2 (YDR453C)
                     and TSA1 (YML028W); ancestral locus Anc_5.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668988.1"
                     /db_xref="GeneID:11496537"
                     /db_xref="GOA:G0W7I4"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:G0W7I4"
                     /translation="MVAQVQKQAPKFNKTAVIDGVFDEVSLDKYAGKYVVLAFVPMAF
                     TFVCPTEIIAFSDAAKRFEEQGAQVLFASTDSEYSLLAWTNIARKEGGLGPVDIPLIA
                     DKNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLSVGRNVEEALRLVEGFQ
                     WTDKNGTVLPCNWTPGSATIKPDVDASKEYFESANK"
     gene            <166280..>167653
                     /gene="NDAI0C00850"
                     /locus_tag="NDAI_0C00850"
                     /db_xref="GeneID:11496538"
     mRNA            <166280..>167653
                     /gene="NDAI0C00850"
                     /locus_tag="NDAI_0C00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668941.1"
                     /db_xref="GeneID:11496538"
     CDS             166280..167653
                     /gene="NDAI0C00850"
                     /locus_tag="NDAI_0C00850"
                     /inference="similar to DNA sequence:INSDC:YDR451C,YML027W"
                     /note="similar to Saccharomyces cerevisiae YHP1 (YDR451C)
                     and YOX1 (YML027W); ancestral locus Anc_5.567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668989.1"
                     /db_xref="GeneID:11496538"
                     /db_xref="GOA:G0W7I5"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G0W7I5"
                     /translation="MFSNNNTKLPSVANLLNHEQATSNSKLYFPLPPTIRSNFQSDPR
                     GIIKLPPILSSNCNSLIRPSSVESALRHTVSFPSSNFNPLPTPEDDNKNLLHQRIDPQ
                     NKNSDSYSSPLPHRLIHTSSFEPLSTKIKVPARSPSTPLIKRQSPTASSLLVISQAKK
                     TNDTLTPIAAMKASITPSSNDKKRAFAFITHSKDTFGTKEPKIDNAPLARRKRRRTSS
                     QELLILQTEFERCPTPNKKKRLELAEICKMSDKSVQIWFQNKRQSVKKQKLAIAGSNS
                     TPSITSTASESLKLSDTSVNSSTEDFTEEDHHNNNTNTTPSVSNNENIPPLQLTPLAP
                     KTSKDNQNGNRMGSTTTLKLRMPSSHSTPPRHNNKSSRTIITPTKGPSPNGKKSQALT
                     FHLNNDKRILTPVKTSPNSRVNRLINGPQLITSPSKKNRNNLKLEFQPEFIEKSPLKE
                     IDSNTIN"
     gene            complement(<168136..>169079)
                     /gene="NDAI0C00860"
                     /locus_tag="NDAI_0C00860"
                     /db_xref="GeneID:11496539"
     mRNA            complement(join(<168136..168529,169033..>169079))
                     /gene="NDAI0C00860"
                     /locus_tag="NDAI_0C00860"
                     /product="ribosomal protein S18"
                     /transcript_id="XM_003668942.1"
                     /db_xref="GeneID:11496539"
     CDS             complement(join(168136..168529,169033..169079))
                     /gene="NDAI0C00860"
                     /locus_tag="NDAI_0C00860"
                     /inference="similar to DNA sequence:INSDC:YDR450W,YML026C"
                     /note="similar to Saccharomyces cerevisiae RPS18A
                     (YDR450W) and RPS18B (YML026C); ancestral locus Anc_5.566"
                     /codon_start=1
                     /product="ribosomal protein S18"
                     /protein_id="XP_003668990.1"
                     /db_xref="GeneID:11496539"
                     /db_xref="GOA:G0WEZ5"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:G0WEZ5"
                     /translation="MSLVVAEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSN
                     LVCKKADVDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQKDITDGKDYHSLA
                     NNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRG"
     gene            complement(<169994..>170809)
                     /gene="NDAI0C00870"
                     /locus_tag="NDAI_0C00870"
                     /db_xref="GeneID:11496540"
     mRNA            complement(<169994..>170809)
                     /gene="NDAI0C00870"
                     /locus_tag="NDAI_0C00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668943.1"
                     /db_xref="GeneID:11496540"
     CDS             complement(169994..170809)
                     /gene="NDAI0C00870"
                     /locus_tag="NDAI_0C00870"
                     /inference="similar to DNA sequence:INSDC:YML025C"
                     /note="similar to Saccharomyces cerevisiae YML6 (YML025C);
                     ancestral locus Anc_5.565"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668991.1"
                     /db_xref="GeneID:11496540"
                     /db_xref="GOA:G0W7I7"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:G0W7I7"
                     /translation="MVKLRRYQSTLSSLRLPNIATPPKYTLATLRAFPSLEPLSFIPV
                     PTSIFAVPLRRDILWKAVVYENDNRRVGASNPPGRGDVGYSRHKLLRQKGIGKARVGD
                     ANSPIRHNGGRALARNAPNDYSTELPKKMYSLAMVTALSHLYRKGALFVIGENDDVIS
                     SINKNDIGILDIIKTRSQEREEGEKEEQDYRSVMFKKFIRENELTKKRLLFVTSKPRI
                     GLLNFTGHFKKDVDIVQQEGLEVNDLLKSQKVFLELDVLKYLIKEHGRFPEEN"
     gene            <171423..>172300
                     /gene="NDAI0C00880"
                     /locus_tag="NDAI_0C00880"
                     /db_xref="GeneID:11496541"
     mRNA            join(<171423..171425,171893..>172300)
                     /gene="NDAI0C00880"
                     /locus_tag="NDAI_0C00880"
                     /product="ribosomal protein S17"
                     /transcript_id="XM_003668944.1"
                     /db_xref="GeneID:11496541"
     CDS             join(171423..171425,171893..172300)
                     /gene="NDAI0C00880"
                     /locus_tag="NDAI_0C00880"
                     /inference="similar to DNA sequence:INSDC:YDR447C,YML024W"
                     /note="similar to Saccharomyces cerevisiae RPS17B
                     (YDR447C) and RPS17A (YML024W); ancestral locus Anc_5.562"
                     /codon_start=1
                     /product="ribosomal protein S17"
                     /protein_id="XP_003668992.1"
                     /db_xref="GeneID:11496541"
                     /db_xref="GOA:G0W7I8"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="UniProtKB/TrEMBL:G0W7I8"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSKGVLNV
                     DNQTADLVKSLGLKLPLSVINVSAQRDRRFRKRN"
     gene            complement(<172614..>174287)
                     /gene="NDAI0C00890"
                     /locus_tag="NDAI_0C00890"
                     /db_xref="GeneID:11496542"
     mRNA            complement(<172614..>174287)
                     /gene="NDAI0C00890"
                     /locus_tag="NDAI_0C00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668945.1"
                     /db_xref="GeneID:11496542"
     CDS             complement(172614..174287)
                     /gene="NDAI0C00890"
                     /locus_tag="NDAI_0C00890"
                     /inference="similar to DNA sequence:INSDC:YML023C"
                     /note="similar to Saccharomyces cerevisiae NSE5 (YML023C);
                     ancestral locus Anc_5.558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668993.1"
                     /db_xref="GeneID:11496542"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:G0W7I9"
                     /translation="MRPSCSRSVDYVIGNKSNERRLPHYFVELTERHLGVFEVLNSMC
                     LLDNYDHILFFLECQMVNTKTLPIPPYDICLVLLTLATTSNYYKADILQASDAYNFTR
                     QSLDQRALKILRFYIRILLEFDTSKYEQYDLEFLRCQFFLVIDTLSPKRAYRNIDRFK
                     RRKVENSKLIYGESISINEDELKDLQNPYRSYLSSLERKKSVLGNTLINWKLTQPGEF
                     INMILWTLSNSLQDDPALYLSSHDVWMPILDIILELFNLRQKYFLKNEIGKGISADLC
                     VQRLSESPLSRFFQSVDSIHFTSRFCDYMFINCDYSLKGSDNSSTSIHPVYHGENQLS
                     KLYVPRTKYTKVYKARKSFQLRRKIIGSCFKLLIHVPDKHKLISPRGMSSNDIVDGIS
                     RTLATFQNIEQFRSFFLSDSLSQEVFFIPLLAEGTLAEIIENHRQHQEEGPKTSIKVV
                     KYLGDTEQFLLEFISLFEKGFMVPYCDKKITEKVILEIKKGDICVLVLFRYLLHLIPS
                     KKLKCVKSFNHFIEVLKWNDSKRLDVANTQDSPLDIPTLYLTISKMLEI"
     gene            <174686..>175249
                     /gene="NDAI0C00900"
                     /locus_tag="NDAI_0C00900"
                     /db_xref="GeneID:11496366"
     mRNA            <174686..>175249
                     /gene="NDAI0C00900"
                     /locus_tag="NDAI_0C00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668946.1"
                     /db_xref="GeneID:11496366"
     CDS             174686..175249
                     /gene="NDAI0C00900"
                     /locus_tag="NDAI_0C00900"
                     /inference="similar to DNA sequence:INSDC:YDR441C,YML022W"
                     /note="similar to Saccharomyces cerevisiae APT2 (YDR441C)
                     and APT1 (YML022W); ancestral locus Anc_5.557"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668994.1"
                     /db_xref="GeneID:11496366"
                     /db_xref="GOA:G0W7J0"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G0W7J0"
                     /translation="MSIESYAKELKAALRQYPNFPSEGILFEDFLPIFRDPSLFQKLT
                     DAFKMHLDKAFPGTKVDYIIGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECVQAT
                     YEKEYGTDVFEMQKDAIPAGSNVVIVDDIIATGGSAAAAGELVEKVGSKVLEYDFVME
                     LDFLRGREKLNAPVFTLLNGQEEGLKK"
     gene            complement(<175497..>176585)
                     /gene="NDAI0C00910"
                     /locus_tag="NDAI_0C00910"
                     /db_xref="GeneID:11496367"
     mRNA            complement(<175497..>176585)
                     /gene="NDAI0C00910"
                     /locus_tag="NDAI_0C00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668947.1"
                     /db_xref="GeneID:11496367"
     CDS             complement(175497..176585)
                     /gene="NDAI0C00910"
                     /locus_tag="NDAI_0C00910"
                     /inference="similar to DNA sequence:INSDC:YML021C"
                     /note="similar to Saccharomyces cerevisiae UNG1 (YML021C);
                     ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668995.1"
                     /db_xref="GeneID:11496367"
                     /db_xref="GOA:G0W7J1"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:G0W7J1"
                     /translation="MTNTATTGKRKQTTITDFFNKSTLKKAKVSNEITGGKSAVKNIE
                     EQNDNVLPNGETAIKEDEVKGETSATATIAKEKVQTEPALKPTTEYLIKAHFRNTLDP
                     GTSKLLSCELDTIEDTWFRHLIEEFKKPYFLNLKQFILNEQAKYEVFPPAKDIYSWTR
                     LTPFDKVKVVIIGQDPYHNDNQAHGLAFSVKPPVPAPPSLRNIYKELKQNYSDFEINN
                     KVGDLSPWALQGVLLLNTALTVRAHNANSHSKRGWEEFTKRVIEILIKDREKEGKTLV
                     FLLWGNNAIKLVTSILKSDEQKYKNILVLKSVHPSPLSASRGFFGNNHFKKINEWLAN
                     ERNEKMIDWSVVPGNTLKEIAASNENLN"
     gene            <177216..>179141
                     /gene="NDAI0C00920"
                     /locus_tag="NDAI_0C00920"
                     /db_xref="GeneID:11496368"
     mRNA            <177216..>179141
                     /gene="NDAI0C00920"
                     /locus_tag="NDAI_0C00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668948.1"
                     /db_xref="GeneID:11496368"
     CDS             177216..179141
                     /gene="NDAI0C00920"
                     /locus_tag="NDAI_0C00920"
                     /inference="similar to DNA sequence:INSDC:YML020W"
                     /note="similar to Saccharomyces cerevisiae YML020W;
                     ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668996.1"
                     /db_xref="GeneID:11496368"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W7J2"
                     /translation="MASATPSSKISVRAKSATSLRSKSTSTFSNNNVGDKGEDNDTKG
                     KDSSIPPPLQKNTKDDDSNKKANKSWSIWGSSNTPAEQNSIPPTTKLSSTRTTGSIRS
                     NNSSEEVPDSITTATNANANVSNEVTQKDTASTDTNNIDENHDETSRARGWSFWQRQP
                     KITTYVETESTTKTQPTTEPFNPLVNTLIPPSSEKESLLSRIKSNMPGFQSPNIMVPD
                     INILPKQSLWTSLSHMFTFNEEKQKFLYRADPYSKLSEMSNGGKRPIKVLIVGIHGFF
                     PTKMIRPFIGEPTGTSTKFIKEAEEIVEKYFHDHDQACEISKIALEKEGDIFDRVEYF
                     FSIMQKWAKEINDSDFIYFVSHSQGCPVSIILLAKLIESGIINVDNSKFFTGSASAEV
                     GFCSQKKIISVLAMAGINNGPFYGADQTLFVRAYQTIERDSLRELFEFQKFDSIQSKK
                     FINGLRVIIANNVKVTFVGSINDQLVPLYSSTCLFADHPNIFRTTFIDKSSMTPSFIM
                     RIIKIAGTLLNLGYDDHGIVKEISGSLAGPLTGGGHSTVYNEKQVYELGVKFALETTD
                     TTTTTSVTYTPYKLSELGTNPYHLPWSMRGLIYETKKYLGDEEINQLYKEFEEWKPET
                     KQLKDIKYRLNGLRYKL"
     gene            <179701..>180672
                     /gene="NDAI0C00930"
                     /locus_tag="NDAI_0C00930"
                     /db_xref="GeneID:11496369"
     mRNA            <179701..>180672
                     /gene="NDAI0C00930"
                     /locus_tag="NDAI_0C00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668949.1"
                     /db_xref="GeneID:11496369"
     CDS             179701..180672
                     /gene="NDAI0C00930"
                     /locus_tag="NDAI_0C00930"
                     /inference="similar to DNA sequence:INSDC:YML019W"
                     /note="similar to Saccharomyces cerevisiae OST6 (YML019W);
                     ancestral locus Anc_5.552"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668997.1"
                     /db_xref="GeneID:11496369"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G0W7J3"
                     /translation="MQRYLYFLGFLLNSIQCVIGFANIEHVQKLKDQDNIIRITEENY
                     QELSTGVHDFYNVLYITMSGANNQGQFCEMCGEFETTLRKVSHAMKNQVPDTNVLFFI
                     ADVNEVPSLVSDLQLTNVPHLVVYPPPFNETFKWSVAHFYQYELPPERAGDLLRFGNY
                     IAKLLNVQLRLETEFDMNEFLMYFCGFMALFLFFKKIIFPKFNNKIKLAMIILSSLIL
                     LPSITGYKFTEMNGIPFIARDKDDNIMYFSGGTGWQFGIEIFSVSSMYIILGSLVIGL
                     VYNPRWHKDSKKFQDLQSVVVACALFYMFSFFLSCYKIKSQDYPFTY"
     gene            complement(<180857..>182200)
                     /gene="NDAI0C00940"
                     /locus_tag="NDAI_0C00940"
                     /db_xref="GeneID:11496370"
     mRNA            complement(<180857..>182200)
                     /gene="NDAI0C00940"
                     /locus_tag="NDAI_0C00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668950.1"
                     /db_xref="GeneID:11496370"
     CDS             complement(180857..182200)
                     /gene="NDAI0C00940"
                     /locus_tag="NDAI_0C00940"
                     /inference="similar to DNA sequence:INSDC:YDR438W,YML018C"
                     /note="similar to Saccharomyces cerevisiae THI74 (YDR438W)
                     and YML018C; ancestral locus Anc_5.551"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668998.1"
                     /db_xref="GeneID:11496370"
                     /db_xref="GOA:G0W7J4"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G0W7J4"
                     /translation="MVVTFSKRWTLGLIMLGIVIILWVLSSFLINLIFEDDSYRKPFF
                     ITYLNTAAFIFYLLPTGNSILTNYKETGNFNIHHELIIEEEGDPNDENSWEYADMPTG
                     QEQEQEQEQSSTPEIEGDDLLSVRSPLIPKDHQQISTSTSNYIDAERNNNNVYTTNRN
                     SSTVTAHLKRLSLKETIKLSAEFCILWFLANFATNASLAYTSVASQTILSSTSSFFTL
                     FIGALFHVEMINPLKVIGSTVSFIGIMSVIESDSHSLRKGRHLPTSSSIDENGNDTTR
                     ILIGNLLAIAGALFYGIYSTLLKRKVKDESRINVKIFFGFVGLFTLVFLWPTIIILHY
                     LGWESFEIPTDPRVICIVLMNCMITFVSDFCWAKAMLLTSPLTVTVGLSITVPLAMVG
                     DLIFKHKSMPFLYLIGATLILGSFFIINESSAEDNLDQLINERERSADVEASTVT"
     gene            <184618..>186402
                     /gene="NDAI0C00950"
                     /locus_tag="NDAI_0C00950"
                     /db_xref="GeneID:11496371"
     mRNA            <184618..>186402
                     /gene="NDAI0C00950"
                     /locus_tag="NDAI_0C00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668951.1"
                     /db_xref="GeneID:11496371"
     CDS             184618..186402
                     /gene="NDAI0C00950"
                     /locus_tag="NDAI_0C00950"
                     /inference="similar to DNA sequence:INSDC:YML017W"
                     /note="similar to Saccharomyces cerevisiae PSP2 (YML017W);
                     ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003668999.1"
                     /db_xref="GeneID:11496371"
                     /db_xref="UniProtKB/TrEMBL:G0W7J5"
                     /translation="MSLEEFLGDDSLGDSVWNEDEINLDAINNTTNIDVLKPTTTTME
                     QGFNGLSQNNTPGNFSRSPSSALNQPIPANHPGLGGHAVYRTYPDTSNQPQGPPYIIK
                     FSNLPPKFSDYDIKDLFQAKYTKFVKFKLFWELNKKPTIAVLKSGSIFDQNFKHDSKV
                     AFVELYTSRDMDKVRNNWVVPLKEIYQINTEPAHFDDFKEYIAKNTLLTDPKDDPSKP
                     YVLPKPKPNPFGTAKPVDTQSKVLDIEEKMRHLHVEDTTTLRRLSQGDSNNNGNTRPK
                     VTILKKEHKETTIPTEQTEHTPETEESKEQEKTKNIPKPLSYSQVLQRSVEDIKKGSV
                     SPTAPNGLSSSSGNGGPLNERSSSSVENSQSSSTSSRENKTEQINEDNNTHNDDVDDD
                     HDGKENMQDHNDGKPFVFKNSERETSADTTGSRPTTFTSPSSSSYDYKSNMRGGYRGG
                     SSRGSYNRRGGRGRGGSYQSRNNTYNNSEQQSQQSQERNFNDNNDSNENNNNNNNNTN
                     NGANEEKGQYSLFAPASGFLQSSDGSRTSSRGGGRGNLNTRRGGSGGSGRGSSRGGSG
                     VRRGGRGGGGYNRGYRGGASNNDRFTTA"
     gene            complement(<187376..>189907)
                     /gene="NDAI0C00960"
                     /locus_tag="NDAI_0C00960"
                     /db_xref="GeneID:11496372"
     mRNA            complement(<187376..>189907)
                     /gene="NDAI0C00960"
                     /locus_tag="NDAI_0C00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668952.1"
                     /db_xref="GeneID:11496372"
     CDS             complement(187376..189907)
                     /gene="NDAI0C00960"
                     /locus_tag="NDAI_0C00960"
                     /inference="similar to DNA sequence:INSDC:YDR436W,YML016C"
                     /note="similar to Saccharomyces cerevisiae PPZ2 (YDR436W)
                     and PPZ1 (YML016C); ancestral locus Anc_5.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669000.1"
                     /db_xref="GeneID:11496372"
                     /db_xref="GOA:G0W7J6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G0W7J6"
                     /translation="MGNSSSKSTKRKQSLSSSSSSSSPGPNKLDHKSNDTAHSIKSSK
                     SASSRRSSSAIKSNKNEKTINSVSGPPEYVNVLNQKQRPLRPNGSHARSHSHSYSQSP
                     AQANSASVAGTPKLKPSSRSMENIHDATTGSLTSHNATKKDRSPSPSSAKKNSMHLFP
                     QTHGHRRSSSHHSQSELMGQQQDNNNAGLNLSRQSTNNNNNNNNSEATTNPFLHPLLN
                     SSRRRSSSRRLSNNTGADLPPSMIQMEPKSPILKNSKYTTSSNSFQYYENALTDDDND
                     NDNDTDMFSDATKTNHQNLIRHKTSSRPSSIRSGSSSRPRRKSSNNNINISATATGGS
                     PNMDNLNLPNQDHTSQHSLSLSRSNSFASSLHSRKSSMGSSNNTTAYSTPLNSPGLLR
                     TNDTLTQDDYFGTTAVPTANSNDNANLQTDDTTHIDSVSINPANDNNNNVDGYTSVND
                     GNNSMDRRDSISKSRYPASHSNMDNFPTHDYINNNMENNNTMTQELQTDSNINLPLND
                     GQLPLKKKKPIKPIDIDETIQKLLDAGYAAKRTKNVCLKNSEILQICQASREIFLSQP
                     SLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSANYLFLGDYVDRGKQSLETILLLL
                     CYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKTFIDTFNTLPLAAIVA
                     GKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVS
                     YCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAV
                     MSVSEGLLCSFELLDPLDSAALKQVMKKGRQERKLANQQQYQVEE"
     gene            <190703..>191551
                     /gene="NDAI0C00970"
                     /locus_tag="NDAI_0C00970"
                     /db_xref="GeneID:11496373"
     mRNA            <190703..>191551
                     /gene="NDAI0C00970"
                     /locus_tag="NDAI_0C00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668953.1"
                     /db_xref="GeneID:11496373"
     CDS             190703..191551
                     /gene="NDAI0C00970"
                     /locus_tag="NDAI_0C00970"
                     /inference="similar to DNA sequence:INSDC:YML014W"
                     /note="similar to Saccharomyces cerevisiae TRM9 (YML014W);
                     ancestral locus Anc_5.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669001.1"
                     /db_xref="GeneID:11496373"
                     /db_xref="GOA:G0W7J7"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W7J7"
                     /translation="MSMADLKEQEFVHDVYNEIAPHFSQTRYKPWPIVTSFLNDQKTG
                     TIGIDVGCGNGKYLNVNPNVFLIGSDRSSGLIECAHDINNQYNILIADGLNLPHRENT
                     FDFAISIAVVHHWTTRERRIDAIAHIMSKVRSGGQVLIYCWALEQGESRRGYHEGMEQ
                     DVLVPWVLPETTKDTKKKGENSKIILKEKMPDLTNIPPKDRSEFIANWKKEQEEKRVA
                     AEKERQKEEEKEWKSENDKESKTKYRFYHLYREGELEEDCKSAGGIIVKTGYEKDNWY
                     VMMSKP"
     gene            <191931..>193919
                     /gene="NDAI0C00980"
                     /locus_tag="NDAI_0C00980"
                     /db_xref="GeneID:11496374"
     mRNA            <191931..>193919
                     /gene="NDAI0C00980"
                     /locus_tag="NDAI_0C00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668954.1"
                     /db_xref="GeneID:11496374"
     CDS             191931..193919
                     /gene="NDAI0C00980"
                     /locus_tag="NDAI_0C00980"
                     /inference="similar to DNA sequence:INSDC:YML013W"
                     /note="similar to Saccharomyces cerevisiae UBX2 (YML013W);
                     ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669002.1"
                     /db_xref="GeneID:11496374"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0W7J8"
                     /translation="MGQQSKTDSTRYKKKRRTITQIMPIITSGAQEFHLSHEEEDKLN
                     EFQTITNFPEDEIPNIIKLLQNNGWNLEISLSRYFDNDWKESLNAPPVPSHPLASPPL
                     PVDDNLNQALPLRPAANDFNPFPFIPQLRLISKLPLGFKEKYRMIGLQPTAKSSLSST
                     NPLIFMLMILPNLIFKLGSFIWSLLTMGLFKGKEEKANNVIGEGKYRICSIPKNPQYV
                     EFNEIQKNKLKMIVDDFTALADEKKDNNSSLICWDLSFNEFLDVCKNEFKFGLIVLVG
                     DLLGKTEEENEKLEGIEEISVDNESQQIDMNSQLFVDKILNDERIVQLLRSHSDDLIV
                     YFGSVVELETWLIAKQLNLKYTPECLLIGNVMNGNGNVTKLSILSKLKVTTVKRFTKS
                     FNSAVAKYQPELVISRNEKNELDLARQIKLSQEEAYENSLKQDQLKEQQKEMERQTME
                     LMKRKEEMMKIEESYKHVKWLHSCLQILEDDYSKKPEGSEPQKMATLQIRTSQGTRLV
                     RKFDSRATLHDIYINIGCHLFLDNHSLDLNEWTKSIVDKIKNLSDNDTVLCFKDREII
                     EDEIIDDANELRAIINEELIKWESQLIGNSEMHGDMETFELDFDFELVSPFPRFIVPT
                     DKNMTVKEVTQLWPNGSLLVEKIAAAEEDEEEEEELEN"
     gene            <194352..>194987
                     /gene="NDAI0C00990"
                     /locus_tag="NDAI_0C00990"
                     /db_xref="GeneID:11496375"
     mRNA            <194352..>194987
                     /gene="NDAI0C00990"
                     /locus_tag="NDAI_0C00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668955.1"
                     /db_xref="GeneID:11496375"
     CDS             194352..194987
                     /gene="NDAI0C00990"
                     /locus_tag="NDAI_0C00990"
                     /inference="similar to DNA sequence:INSDC:YML012W"
                     /note="similar to Saccharomyces cerevisiae ERV25
                     (YML012W); ancestral locus Anc_5.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669003.1"
                     /db_xref="GeneID:11496375"
                     /db_xref="GOA:G0W7J9"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G0W7J9"
                     /translation="MKTIRQLSVVLFLTLLNLAFGLHLDIEAKQESDPEPVCIRDFVS
                     EGQLVVINIDSDGRVGDGQQLNVFVRDSNGNEYRRKNDFAGNVRVAFTAPSSTSFDVC
                     LVNMGTKGMKRSVELDIESGSEARDWNQISANEKLKPIEVELRRIEELTDEIVDELQY
                     LKNREERLRDTNESTNRRVRNFSILIIIVLASLGAWQITYLKRYFRTKHII"
     gene            complement(<195063..>195611)
                     /gene="NDAI0C01000"
                     /locus_tag="NDAI_0C01000"
                     /db_xref="GeneID:11496376"
     mRNA            complement(<195063..>195611)
                     /gene="NDAI0C01000"
                     /locus_tag="NDAI_0C01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668956.1"
                     /db_xref="GeneID:11496376"
     CDS             complement(195063..195611)
                     /gene="NDAI0C01000"
                     /locus_tag="NDAI_0C01000"
                     /inference="similar to DNA sequence:INSDC:YML011C"
                     /note="similar to Saccharomyces cerevisiae RAD33
                     (YML011C); ancestral locus Anc_5.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669004.1"
                     /db_xref="GeneID:11496376"
                     /db_xref="InterPro:IPR014841"
                     /db_xref="UniProtKB/TrEMBL:G0W7K0"
                     /translation="MAGHDNKTSAKVSQEQVDKFINATVPDEIEDEILNALVGFNLNH
                     DMNTNDLNDFFELLQLPRDLYKLVPVDNVVVEGTNIIDFNKIVRATYELLIFLDNSEI
                     INNLWQLMVTCSGRDKQYPHVILVNHILSVKDLQKIATFADLDQSSGIIQMMTCATSG
                     KRVYMTYLDFAIILGKLGYLRF"
     gene            <196074..>199052
                     /gene="NDAI0C01010"
                     /locus_tag="NDAI_0C01010"
                     /db_xref="GeneID:11496377"
     mRNA            <196074..>199052
                     /gene="NDAI0C01010"
                     /locus_tag="NDAI_0C01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668957.1"
                     /db_xref="GeneID:11496377"
     CDS             196074..199052
                     /gene="NDAI0C01010"
                     /locus_tag="NDAI_0C01010"
                     /inference="similar to DNA sequence:INSDC:YML010W"
                     /note="similar to Saccharomyces cerevisiae SPT5 (YML010W);
                     ancestral locus Anc_5.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669005.1"
                     /db_xref="GeneID:11496377"
                     /db_xref="GOA:G0W7K1"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="InterPro:IPR024945"
                     /db_xref="UniProtKB/TrEMBL:G0W7K1"
                     /translation="MSDKENSLDTSTSDTTPKTATSDQVSPPVEDVASTASSDDKKRP
                     RDDGKDVENSTENKEGESSKETENNDDNNDNNENDNGDDDDDDDDDDDDDDDEDEEQP
                     AKRRRQERNRFLDIEAEVSEDEEDEEDEEDSELVREGFITHEADEEEGATASGRSDKL
                     HRQLDQDLNKTSEEDAQRLAKELRERYGRSSSKQYRAAAQSGYVPQRFLLPSVDTATV
                     WGVRCRPGKEKELVRKLLKKKFNLDRAMGKKKLKILSIFQRDNYVGRIYIEAPKQSVI
                     EKFCNGVPDIYIAQKLLIPVQELPLLLKPNKSDDVTLSEGNYVRIKRGIYRGDLALVD
                     QISENNLDVMLKIVPRLDYGKFDEIDPVTNQRKSKRATYAHRAPAQLFNPTMALRLDQ
                     ANLYKRDDHHFTYKNEDYIDGYLYKSFRIQYVETKNIQPTVEELAKFGSKDGAVDLTT
                     ISQTIKKAQAARVTFQPGDRVEILSGEQRGSKGIVVGTTTDIATVKLPSYPLKPLEFP
                     VLSLRKIFEPGDHVTIINGEHQGDAGLVLMVDQGQVTFMSNQNREEVTITANNLSKSI
                     DSTPTSSEYSLHDIIELSAKNVACIIQAGHDIFKVIDETGKVSTITKGTILGKVNTAR
                     SRVTTVDGNGNEIKIGDSIVEKLGARREGQVLYIQTQQIFVVSKKIAENAGVFVVNPA
                     NVETVSAKENLLNNKLDLNKMNPDIISQMGPPGSSSPNTTFQKPQMRTGREVALGKTV
                     RIRLAGYKGQLGIVKDVNGDKATVELHSKNKHITVDKTKLLYYNREGGEGITYEELVN
                     RRGRVPQARLGPSYVSAPRHMNSMSQVGQVGAPLSGGMTPGWSSFDGGKTPAVGAHGS
                     SSSVGSTSTWGGASTWAGQGAAGAASTWGGGGASAWGGQGGNTSTWGGQGGATSTWGG
                     ASAWGNKSSYGGVSTWASGGEANGAASTWGGASKHANAGGASTWAANNEGGTSTWGGA
                     SKHAGNSSTWGGNTDNSQQH"
     gene            complement(<199408..>199617)
                     /gene="NDAI0C01020"
                     /locus_tag="NDAI_0C01020"
                     /db_xref="GeneID:11496378"
     mRNA            complement(<199408..>199617)
                     /gene="NDAI0C01020"
                     /locus_tag="NDAI_0C01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668958.1"
                     /db_xref="GeneID:11496378"
     CDS             complement(199408..199617)
                     /gene="NDAI0C01020"
                     /locus_tag="NDAI_0C01020"
                     /inference="similar to DNA sequence:INSDC:YML009C"
                     /note="similar to Saccharomyces cerevisiae MRPL39
                     (YML009C); ancestral locus Anc_5.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669006.1"
                     /db_xref="GeneID:11496378"
                     /db_xref="GOA:G0W7K2"
                     /db_xref="InterPro:IPR001705"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G0W7K2"
                     /translation="MAKAKIKNSVIKLISTAATGYSRYISVKKGAPLVHQVRYDPVAQ
                     RHVLFKEAKKRKIAERKPLTFARGG"
     gene            <199929..>200780
                     /gene="NDAI0C01030"
                     /locus_tag="NDAI_0C01030"
                     /db_xref="GeneID:11496379"
     mRNA            <199929..>200780
                     /gene="NDAI0C01030"
                     /locus_tag="NDAI_0C01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668959.1"
                     /db_xref="GeneID:11496379"
     CDS             199929..200780
                     /gene="NDAI0C01030"
                     /locus_tag="NDAI_0C01030"
                     /inference="similar to DNA sequence:INSDC:YDR429C"
                     /note="similar to Saccharomyces cerevisiae TIF35
                     (YDR429C); ancestral locus Anc_5.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669007.1"
                     /db_xref="GeneID:11496379"
                     /db_xref="GOA:G0W7K3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="UniProtKB/TrEMBL:G0W7K3"
                     /translation="MSTEVAVSIQPEIIENPDGSKSIITYKIENGEKYKITQRVKEIK
                     VVEKVHKSVAERRNWPKYGLEKGSPAGPQTSTTTLSDEVELRLSRNWRQVEEERQQKE
                     KGTTVKSISCRLCGNDHYTMNCPFKSILNEISALEDPAAGVELNEEGAGEISAGVGAE
                     EAGAEGGHRYVPPSRRAGAKDPSSDAYRDSRERDDMCTLKIMQLNENADENNLREELL
                     FPFAPIQKCVVVRNRDTGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLILRVEWSKP
                     KSEVKKI"
     gene            complement(<201166..>203532)
                     /gene="NDAI0C01040"
                     /locus_tag="NDAI_0C01040"
                     /db_xref="GeneID:11496380"
     mRNA            complement(<201166..>203532)
                     /gene="NDAI0C01040"
                     /locus_tag="NDAI_0C01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668960.1"
                     /db_xref="GeneID:11496380"
     CDS             complement(201166..203532)
                     /gene="NDAI0C01040"
                     /locus_tag="NDAI_0C01040"
                     /inference="similar to DNA sequence:INSDC:YDR425W"
                     /note="similar to Saccharomyces cerevisiae SNX41
                     (YDR425W); ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669008.1"
                     /db_xref="GeneID:11496380"
                     /db_xref="GOA:G0W7K4"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G0W7K4"
                     /translation="MNIFDTLKDIESSDDREEQEPVVDPINTDKDTSTLKLSQNLFID
                     NKDNWTQNKRDKKKKKKNENKQRQQLHLLPQSQPEVLYHPDSTSFQSLMIDEEDNNPF
                     VGTNHLYASGINTTPPSNSPSSFSPSSISSSSSPSRSIANNEHHIKASNSINSLVSSR
                     HISSTEEHSQGNVEEGPTSNNKNALDDELSYHINLSDNNNNPESPIHDIATNNESKND
                     PQNFISALSDGSSNEEPFETLSMSLSLAKIKKQNTKIYNQTSHFNDQDENDQDYSNDD
                     DDDDEIQVIDTGDYKDPWGKHAIGYVIQYNGSKVTRRYSEFDTLYQVLKKLLPTIVVP
                     PIPSKHPLINYFINPIHVQNDLKIIEKRKRKFISFLNNCNKIDEIRNLSVFQKFLNPE
                     YSWKDVLNSPPIVILPLNNLLAPPLNPTKPSPLHILLPSPASITRLDYSIINDSNESL
                     HLINNKFIKFEKLLKDYKIHLLPIYHTVKSNKSNLIQLSNTIAKLGAYYNAFSLENNV
                     ISNDNNLQIIKTLSVGIEKIGTSFDINYVLLENLIDNINSNLEESVEEMIKSLDNSFK
                     VLHFRKLKLLQYQIIETTIKKREFRIKSLKESAIQLQKLNETLGNNSLNSPTINKTIL
                     YSEDNENNNNLQDSESPIEISTDPESSTNNSASNPRPTSKTAPIDNNRMLLKTQLERR
                     RRKENSKKIHGFYEIDPYLLTDLERKEELKKLNKEVEKLKECFNLITKDINDVNESME
                     NNLNHLVSYLNMKWEKSLKYISKDIIYFLQECLKSWKNAKAKIHAIVI"
     gene            complement(<203987..>205114)
                     /gene="NDAI0C01050"
                     /locus_tag="NDAI_0C01050"
                     /db_xref="GeneID:11496381"
     mRNA            complement(<203987..>205114)
                     /gene="NDAI0C01050"
                     /locus_tag="NDAI_0C01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668961.1"
                     /db_xref="GeneID:11496381"
     CDS             complement(203987..205114)
                     /gene="NDAI0C01050"
                     /locus_tag="NDAI_0C01050"
                     /inference="similar to DNA sequence:INSDC:YML008C"
                     /note="similar to Saccharomyces cerevisiae ERG6 (YML008C);
                     ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669009.1"
                     /db_xref="GeneID:11496381"
                     /db_xref="GOA:G0W7K5"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W7K5"
                     /translation="MTTELRQRQAEFTKQLHGEEIGPKVGLSALLSKDKKSQKLAVSQ
                     YLDNWKGGVYDQDQEQERLENYNETTHSYYNIVTDFYEYGWGSSFHFSRFYKGESFQA
                     SIARHEHYLAYMAGIKKQDLVLDVGCGVGGPAREIANFTGCHIVGLNNNDYQIAKAKW
                     GAKKAGLDKNLEFIKGDFMDLNGTFEENTFDKVYAIEATCHAPNLEKCYKEIYKVLKP
                     GGVFAVYEWVMTDKFDENNEEHQKIRYEIELGDGIPKMFSVDVARDALKNCGFDVLVD
                     KDLADNNDEVPWYYPLTGEWKYVQSINDLATFFRTSYLGRKFTNTMVSVMEKVGIAPE
                     GSVKVTEALENAAVGLVAGGRSKLFTPMMLFVAKKPEEPSA"
     gene            <206067..>207980
                     /gene="NDAI0C01060"
                     /locus_tag="NDAI_0C01060"
                     /db_xref="GeneID:11496382"
     mRNA            <206067..>207980
                     /gene="NDAI0C01060"
                     /locus_tag="NDAI_0C01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668962.1"
                     /db_xref="GeneID:11496382"
     CDS             206067..207980
                     /gene="NDAI0C01060"
                     /locus_tag="NDAI_0C01060"
                     /inference="similar to DNA sequence:INSDC:YML007W,YDR423C"
                     /note="similar to Saccharomyces cerevisiae YAP1 (YML007W)
                     and CAD1 (YDR423C); ancestral locus Anc_5.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669010.1"
                     /db_xref="GeneID:11496382"
                     /db_xref="GOA:G0W7K6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:G0W7K6"
                     /translation="MTTVGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENAT
                     TNPMKKQDLDNKTNTEQSNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKEL
                     EEKVANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKVLNYISNSNSNSNP
                     DLNLNSKFSPMESDASAMKRSTGSVSSGDSNSRTMTSMDAPSMSTTTSVQSNPLNLKP
                     HNNMTLNDILPPATTVASTSTLDANPSSTLFDSLLANDDLFTQQLMSFANNANNNNNN
                     NDSVTTLDNSNTQQQNLQQPQITPPIEDSNLISNSFDFNDKFDEQVSDFCGKMSMACG
                     TRSNPIPKSKSNVSTPQSIMNSNNKSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAI
                     NSNLTNTWGIPSASPNSNDSSPNNIVPTQDNSNVNMNFGQLGFMMDSPQFQNIDLSLP
                     IENDKFSASNFKKPSLPFINPTLAFPNDDLFNKNNSNNDNNNNTTTTHDESDLLSQFL
                     ANDYSNTISTNNLMNSDDDEDEDDDDYEKKLVANNLINEEPSSTNKNNNLTSTSKEQE
                     NNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVN
                     AEDVQMALTKHMS"
     gene            complement(<209024..>211297)
                     /gene="NDAI0C01070"
                     /locus_tag="NDAI_0C01070"
                     /db_xref="GeneID:11496383"
     mRNA            complement(<209024..>211297)
                     /gene="NDAI0C01070"
                     /locus_tag="NDAI_0C01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668963.1"
                     /db_xref="GeneID:11496383"
     CDS             complement(209024..211297)
                     /gene="NDAI0C01070"
                     /locus_tag="NDAI_0C01070"
                     /inference="similar to DNA sequence:INSDC:YML006C"
                     /note="similar to Saccharomyces cerevisiae GIS4 (YML006C);
                     ancestral locus Anc_5.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669011.1"
                     /db_xref="GeneID:11496383"
                     /db_xref="UniProtKB/TrEMBL:G0W7K7"
                     /translation="MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLL
                     KRFLNSHFYSNATTTDTAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFL
                     RDYFHLEDLENIQITKLTQSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLH
                     LNNLDSLQLQEQNDDEEEKQREEREEKQYIHKESRDPNEDSSIDNDTDEILITQPITT
                     TTSLSHNNQAYTPDENEQLNQTEKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQQ
                     EEPLANNQYYTPPQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEESSTQLEEDEL
                     GAKNLSNTALGLNNNDNHMDDQSSGLEPSYENSEISIQNSGFDSYSNQLQRFDDDTNE
                     EIKKPVECVRSIDEDDESDYNIIQGTRNMHVGDQNDSDEGDDEEEVHGDDDDDDDDLD
                     DLSSDYSVLSILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHI
                     TDDWLLYDSKFAMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSPPINDDQHNYNG
                     MTALNSEYLSNKLESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMIADVPEQFFP
                     GPPSDDENGKGEDYDDDYDDESLMEQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWA
                     FNRMNSNTTSNNMNVDDENKDPDYMEDTSNDKYETSRTNDVHINIDEKDLNLNQAKLK
                     NKSDYKSKETNGKHKLI"
     gene            complement(<214531..>215346)
                     /gene="NDAI0C01080"
                     /locus_tag="NDAI_0C01080"
                     /db_xref="GeneID:11496384"
     mRNA            complement(<214531..>215346)
                     /gene="NDAI0C01080"
                     /locus_tag="NDAI_0C01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668964.1"
                     /db_xref="GeneID:11496384"
     CDS             complement(214531..215346)
                     /gene="NDAI0C01080"
                     /locus_tag="NDAI_0C01080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669012.1"
                     /db_xref="GeneID:11496384"
                     /db_xref="UniProtKB/TrEMBL:G0W7K8"
                     /translation="MKLLTAYSIAALLAAASLAGMLKGQEGKEPNPSVLTLEKRAFPY
                     YSYFMTSVRSVFAYFDASEPITVKVAWWEALIAGDGGLIDMVTDIENACKSCKAGHKD
                     PPGGSCEDDAKAAVKSVLQNSLVGFLGWHLPKSITFVRSLKGSDKDNVNSLVPPLGKC
                     AFMLCTYVLAGIKRIFGYFTGPLPVWVKVGWWVALVIADGIIFGPATQIENAYKSCVA
                     NYKDPPDGSCQDDILTVVHSGVEIMASAIVLRHLPELITLIRSQHRPSRSTVI"
     gene            complement(<216827..>217324)
                     /gene="NDAI0C01090"
                     /locus_tag="NDAI_0C01090"
                     /db_xref="GeneID:11496385"
     mRNA            complement(<216827..>217324)
                     /gene="NDAI0C01090"
                     /locus_tag="NDAI_0C01090"
                     /product="ribosomal protein L12"
                     /transcript_id="XM_003668965.1"
                     /db_xref="GeneID:11496385"
     CDS             complement(216827..217324)
                     /gene="NDAI0C01090"
                     /locus_tag="NDAI_0C01090"
                     /inference="similar to DNA sequence:INSDC:YDR418W,YEL054C"
                     /note="similar to Saccharomyces cerevisiae RPL12B
                     (YDR418W) and RPL12A (YEL054C); ancestral locus Anc_5.522"
                     /codon_start=1
                     /product="ribosomal protein L12"
                     /protein_id="XP_003669013.1"
                     /db_xref="GeneID:11496385"
                     /db_xref="GOA:G0W428"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:G0W428"
                     /translation="MPPKFDPTEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKDKNIKHSG
                     NLQLDDIIEIAKQMQEKSFGKNLASVTKEILGTAQSIGCRVDFKNPHDIIEGINAGEI
                     EIPEN"
     gene            complement(<218036..>220345)
                     /gene="NDAI0C01100"
                     /locus_tag="NDAI_0C01100"
                     /db_xref="GeneID:11496386"
     mRNA            complement(<218036..>220345)
                     /gene="NDAI0C01100"
                     /locus_tag="NDAI_0C01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668966.1"
                     /db_xref="GeneID:11496386"
     CDS             complement(218036..220345)
                     /gene="NDAI0C01100"
                     /locus_tag="NDAI_0C01100"
                     /inference="similar to DNA sequence:INSDC:YEL053C"
                     /note="similar to Saccharomyces cerevisiae MAK10
                     (YEL053C); ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669014.1"
                     /db_xref="GeneID:11496386"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:G0W7L0"
                     /translation="MVQEKLSSLTLQEPKDKYNEVDDSELIEVKDIFIQLANKLQTKT
                     IIKDPNFDLFEGTHSLEVNNPKLDSSLIKLTTEEYKFDCNIAYGSTEETQNDALNYVT
                     AITERLLRLVLCWLNNYQTLPTTILSCRYVENFLVKCSNETFNDIHVLKTNNVIYDKV
                     LNSCVIGICYFAKFAQDLLKSGVIFEEEDMNFNIMGLGSFVGLPDQQIILQLLENGLT
                     TLKEIKDGRTERLAKSIELTKCFVHMEDHVVHFSTDNQYLDEMIEIAKYLDTISTKLE
                     PPMGSFSMGIQKRLANQFPPKHLVDPDNVQFSGFVTLAEHVKIVIKVAKSENFIEILQ
                     FATYFNKLHQRHVIARAIFPLFLMREDRTVLGKYSLDGFLKSHVLDLPKNATEQNGDV
                     DTLIQPILQECLSVLFEWYQNSSQNTCRYRQGYNRQLLVWDSVQAQLENMHSQLLSNL
                     QLQVTNGQDNSQSLDYIMSIGAWAYSMKITSMIEFSLKGFDLEIYKPFESYSLFWYSH
                     YLCKHLTNALLLIISHIQKKKDSISAMNKKLKIESWEEKGKLRTQYHNALDIDLPQFE
                     MNIAFLNYLSKRNKINESLCLVEIIHFAILKSYGIIDEKFPAKSKFVDDTLLHNLRFK
                     PFSSIGSPPLPEIEMFQKSINSFMIKAPDFKRKLNELFKYVNKELSSTTEMIEEILTS
                     IQNGDLKAPLYTGTRLVEEEAVEYFTYLKASVKNLENNSNDIVNKLGDTPSEELKSKF
                     KVELEHMPGSSRYFPILCVKPNTPRNKKQ"
     gene            <220758..>222407
                     /gene="NDAI0C01110"
                     /locus_tag="NDAI_0C01110"
                     /db_xref="GeneID:11496387"
     mRNA            <220758..>222407
                     /gene="NDAI0C01110"
                     /locus_tag="NDAI_0C01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668967.1"
                     /db_xref="GeneID:11496387"
     CDS             220758..222407
                     /gene="NDAI0C01110"
                     /locus_tag="NDAI_0C01110"
                     /inference="similar to DNA sequence:INSDC:YEL052W"
                     /note="similar to Saccharomyces cerevisiae AFG1 (YEL052W);
                     ancestral locus Anc_5.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669015.1"
                     /db_xref="GeneID:11496387"
                     /db_xref="GOA:G0W7L1"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7L1"
                     /translation="MIVNKNIIRTNFIKNSIQYTLRYHFTARERTLPRIKNSTTILYT
                     SPTITGQRLFYSTKSNAATSTIEENGGGTTNAVADDDVRTPIEEYDRLVRINRLRDDP
                     HQRSIISSLSNLYESLKYYTPPSSSRSTSMSKLTDIKRKFLNIFNQNKATKVNETDVP
                     VGIYLYGDVGCGKTMLMDLFYSTIPSHLSKKRIHFHQFMQYVHKRSHEIIKEHHLDDK
                     KDVDSIPILANEISQISNILCFDEFQVTDVADAMILRRLLTLLLSPDKHGIVLFATSN
                     RSPDELYINGVQRESFIPCIELIKDRTKVILLDSEVDYRKIPRPMSSVYTYPTKESGL
                     KWDSKEFNEIKRAHIKEWYDYFAQDRRHQKRKDRRQKGDNNAEKFKDYSLTIWGREFK
                     VPLCSPPRVAQFTFKELCGQPLAAGDYLALANNFQAFIITDIPYLTIMMRDEVRRFIT
                     FLDAVYDNGCKLATTGANDFTSLFVEPEDILNDYELKDSHSDDVIDKIDGNNDELVLK
                     HGFSKEIAAKSHIFAKDEERFAFARALSRLSHMSSTDWVTK"
     gene            complement(<222642..>223814)
                     /gene="NDAI0C01120"
                     /locus_tag="NDAI_0C01120"
                     /db_xref="GeneID:11496388"
     mRNA            complement(<222642..>223814)
                     /gene="NDAI0C01120"
                     /locus_tag="NDAI_0C01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668968.1"
                     /db_xref="GeneID:11496388"
     CDS             complement(222642..223814)
                     /gene="NDAI0C01120"
                     /locus_tag="NDAI_0C01120"
                     /inference="similar to DNA sequence:INSDC:YEL050C"
                     /note="similar to Saccharomyces cerevisiae RML2 (YEL050C);
                     ancestral locus Anc_5.516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669016.1"
                     /db_xref="GeneID:11496388"
                     /db_xref="GOA:G0W7L2"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:G0W7L2"
                     /translation="MIIFSPISQKSSLLSRYTSVSLLFNTTKRSYSYSKTLLQQQQNA
                     TTTTTTPISAKILQIIPNNTDIATLEKQDELIKSRRKLLKQTIKIKSRKPISPGLRWF
                     KTPIYTHLFKGKPIKSLTIHKKVTAGRNNQGKITVRHRGGGHKRRIRTLDYFRWDSNP
                     QLVKRIEFDPNRSAHIALLESTNEKEKTLSYVVATDGLRKGDIIQSFRNGIPKDILLE
                     MNGKIDPALLSVKTAQRGNCLPISMIPIGSVIHNVGITPVGPAKFCRAAGTYARLISK
                     LNDKKKAIVRLQSGEHRYVSIDACATMGIVSNVDHQNRSLGKAGRSRNLGRRPHVRGV
                     AMNKCDHPHGGGRGKSKSNKLSMSPWGQLAKGYKTRRGKNQNQMKVKDRPRRNNKR"
     gene            <225315..>227513
                     /gene="NDAI0C01130"
                     /locus_tag="NDAI_0C01130"
                     /db_xref="GeneID:11496389"
     mRNA            <225315..>227513
                     /gene="NDAI0C01130"
                     /locus_tag="NDAI_0C01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668969.1"
                     /db_xref="GeneID:11496389"
     CDS             225315..227513
                     /gene="NDAI0C01130"
                     /locus_tag="NDAI_0C01130"
                     /inference="similar to DNA sequence:INSDC:YML042W"
                     /note="similar to Saccharomyces cerevisiae CAT2 (YML042W);
                     ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669017.1"
                     /db_xref="GeneID:11496389"
                     /db_xref="GOA:G0W7L3"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G0W7L3"
                     /translation="MRYYCNPTTVRLSMTKSLKNYNYTNKLSSSPAAITINRSFSNST
                     AKMTQDNEPSQQQPLLLQKFPMETNNGEHYWAQFDNNTHITNERKSSFKGLTFANQSK
                     LPSLPIPDLNSTISKYLNSIKPYCNNDTKSIKFQNQKLLCNDFIENMGPLLQDRLIEF
                     NNNGNNKRNWLSSFWDNTAYLEYNDPVIPYVSYFYVHKDLTMQNSRIQNDPLMKSTAI
                     ISTVIKFIESIKDQSLPPEIIKNNPFCMNSFQMMFNNSRLPDFNNNNELSNRDTNIFY
                     SIYENNFMIVMYKGNFYKVFTHCQKTKKPLSDNKIWNQLYSITASSSTKTTTSHDGVG
                     IGSLTSLPRDQWRKTYAELIKDPNSKESLETIHKASFILALDLDQKPITLEENTRSSW
                     HGDGINRFYDKPLQFFVTGNGSSGFLAEHSKMDGTPTLFLNTFVCQQLNKLNQDEFLS
                     QFSLNPSSSSSSSSSSSSSSSSSLPPPSPLPFLKTPQIQSDIKSAQEQFQNQINQHKL
                     RVWQYNKYGKNFIKSMKFSPDAYIQQIIQLALYKLLGKQLPTYEAASTRKFFKGRTET
                     GRSVSSSSYELVTNWSKPHITNEQRCKLLTNSIMDHSNYLKMASEGMAIDRHFFGLKK
                     MLKTNETIPPLFKDELFNYSSTWLVSTSQLSSEYFQGYGWSQVYDNGVGLAYMLNNDW
                     LHINIVNKPKIAGFDPDQLHYYLTQAADEIAQVLISQQQQQQQQQTKAKL"
     gene            complement(<227882..>229039)
                     /gene="NDAI0C01140"
                     /locus_tag="NDAI_0C01140"
                     /db_xref="GeneID:11496390"
     mRNA            complement(<227882..>229039)
                     /gene="NDAI0C01140"
                     /locus_tag="NDAI_0C01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668970.1"
                     /db_xref="GeneID:11496390"
     CDS             complement(227882..229039)
                     /gene="NDAI0C01140"
                     /locus_tag="NDAI_0C01140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669018.1"
                     /db_xref="GeneID:11496390"
                     /db_xref="GOA:G0W7L4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W7L4"
                     /translation="MTNIVTRKSITFINNQTPATITESSLDLDTCYKETEIVIEVYAA
                     ALNPVDLGFQKLTFAKISNSKPKGIGEDYSGVIIRKGVKVAPIWGIGDQINGLYTHFY
                     GEQGTLSNYLILDPSQHPAIGHIVSKSTPATINEEIDVDDDDDDGNGKKKNSEFVKNA
                     AWPVVFGTAYQSLFGQGQIWNKDSMVLVFGASTSVANCFVQIAKNQLHIGTVIGICSS
                     KSMEQNQQVGFDYTIPYDEGEGFIANLRDLMKTPEFIGKKFDLIFDSAGTSEFYPVMD
                     EFLKPRVENSYYVTAVGPRTPVEYTPKEILSLYSLSAPIRTYNPWRKFNYKGIFGTPN
                     KSYMDLAARMISLGRYVPKIDSVYQFEKFEEAFDKLRSGKAKGKIVIQIKE"
     gene            complement(<229501..>232275)
                     /gene="NDAI0C01150"
                     /locus_tag="NDAI_0C01150"
                     /db_xref="GeneID:11496391"
     mRNA            complement(<229501..>232275)
                     /gene="NDAI0C01150"
                     /locus_tag="NDAI_0C01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668971.1"
                     /db_xref="GeneID:11496391"
     CDS             complement(229501..232275)
                     /gene="NDAI0C01150"
                     /locus_tag="NDAI_0C01150"
                     /inference="similar to DNA sequence:INSDC:YDR409W,YOR156C"
                     /note="similar to Saccharomyces cerevisiae SIZ1 (YDR409W)
                     and NFI1 (YOR156C); ancestral locus Anc_5.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669019.1"
                     /db_xref="GeneID:11496391"
                     /db_xref="GOA:G0W7L5"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:G0W7L5"
                     /translation="MSAAVINSTSPSRPTGVGLYQEIDFAIKEMETLKVTELKTLCRS
                     LNLATNGRKAEIQSRIAGFIKESCSGTTIDPWRPKVLTVFINRIKNNQMLPVYNNLWS
                     AIKTGNYQYTIPSMNINNNTNSSNNKTTGQQQQQQQQQKKKPASNYDPDNDTFYFRKS
                     PFYKPIRLIEGTSIKLKRCTGRASVKALFKLNAKDWELLNSSENYKVLLYCGPTHLPS
                     QNNKKEPIMFPFPNEIVFNSIPIKDNVRGLKNKIGTAKPADLTPHLKKNSTTATNVLD
                     FIYAFQKTDFILFCYLVKVITPEEIVRDVVLKQNFKISKESTIAYIKRTLREEDESDF
                     VTTSMVMSLQCPISYTRMKYPTKSILCEHLQCFDAVWYLHSQLQVPTWECPVCQIHIP
                     LENLSISEYVDDILKNSKDDVEQIELTADGNWIAIDEDGEDTGNNNNNNGLPTTSENG
                     IKQESTTSTEIPEKSTSAIPHLHHSEEHVVISLDSDEDENEVQENEAQEDEEETDISP
                     PIIPPSERRHRHNTTLDDDEDEPLSAYGTQQSQNNQSQSQLQSQLHTAMQTPLHGQVQ
                     GQEQQQIRSQEQFVTPTTTTITTNVQAGINPFFPSITTRIQPPNVLISQQQQIPPNNN
                     NTRTSLPSITASTTQPQFVSNIPITTQSVPTTPAIRDELPLRSISYPYSTVIPNSQIH
                     NQHNYPFNFEPESLQRHNIPATNNNNNNNNNITSNLDSSSQPLPSLGNVHPGINSTSF
                     LGLSGSVSQPNSTTALPTPPVLATTKNNQPNLLGITGTPLYTNISSSSGTPITGANDH
                     QHHSNGTDTNNININRYPLGTTGNIPSMAPPSNAPVASTNKTTNVGVGVGGGRHSNKN
                     NISPFIPRKDYSKILPRKRKEPPPSSTTDDNSLGVTVDSNTPPPPVVNGGSGNNNQGA
                     DAEVIDLTSD"
     gene            <233265..>233969
                     /gene="NDAI0C01160"
                     /locus_tag="NDAI_0C01160"
                     /db_xref="GeneID:11496392"
     mRNA            <233265..>233969
                     /gene="NDAI0C01160"
                     /locus_tag="NDAI_0C01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668972.1"
                     /db_xref="GeneID:11496392"
     CDS             233265..233969
                     /gene="NDAI0C01160"
                     /locus_tag="NDAI_0C01160"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669020.1"
                     /db_xref="GeneID:11496392"
                     /db_xref="GOA:G0W7L6"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G0W7L6"
                     /translation="MVSIIEQYTRTCPQCQRNKHSRVLRPGIFQPLAVPYCPWSSIGI
                     DFVSGMKEAHNFDCVLVVIDRLTKMARFIPTKKTIDTSDCADLLINHIICHHGVPDEI
                     VSDRDRLFTGVKFGTVSDKDYEFTLNSPHRITQPPERTNDTMGKIIASYTNQHATDWP
                     MYWSVAAFAYNNTYQSSIKTTPFFPSYGFHPKLPGFTNPILDHSQNNNEQQTPGTSQS
                     NLDYHLQALQNIMVSI"
     gene            complement(<235314..>236105)
                     /gene="NDAI0C01170"
                     /locus_tag="NDAI_0C01170"
                     /db_xref="GeneID:11496393"
     mRNA            complement(<235314..>236105)
                     /gene="NDAI0C01170"
                     /locus_tag="NDAI_0C01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668973.1"
                     /db_xref="GeneID:11496393"
     CDS             complement(235314..236105)
                     /gene="NDAI0C01170"
                     /locus_tag="NDAI_0C01170"
                     /inference="similar to DNA sequence:INSDC:YOR157C"
                     /note="similar to Saccharomyces cerevisiae PUP1 (YOR157C);
                     ancestral locus Anc_5.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669021.1"
                     /db_xref="GeneID:11496393"
                     /db_xref="GOA:G0W7L7"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0W7L7"
                     /translation="MAGLSFDNYQRNTFLTSKTATQQPKATSTGTTIVGLKYRDGVVI
                     AADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSR
                     SPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYLSLGSG
                     SLAAMAVLESQWRPELSKEEAIELASQAIQAGIWNDLGSGSNVDVCVMEVGKDAEYLR
                     NYVTPNVREAKQQSYKFARGTTAVLKESIVNVCEIEEEEISLIAA"
     gene            <236579..>237532
                     /gene="NDAI0C01180"
                     /locus_tag="NDAI_0C01180"
                     /db_xref="GeneID:11496394"
     mRNA            <236579..>237532
                     /gene="NDAI0C01180"
                     /locus_tag="NDAI_0C01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668974.1"
                     /db_xref="GeneID:11496394"
     CDS             236579..237532
                     /gene="NDAI0C01180"
                     /locus_tag="NDAI_0C01180"
                     /inference="similar to DNA sequence:INSDC:YOR158W"
                     /note="similar to Saccharomyces cerevisiae PET123
                     (YOR158W); ancestral locus Anc_5.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669022.1"
                     /db_xref="GeneID:11496394"
                     /db_xref="UniProtKB/TrEMBL:G0W7L8"
                     /translation="MGKGAAKFGFKSGVLPVTRSILKNPTTKQTILISKVKAVKPKGV
                     EGVGYAKGVKHPKGSHRVPPLKKFIDVDTLISDTVRLPKLKDSQNVAESLSSEQLAKM
                     KRAEIRRNYLAEAFRNEEKRLVRRDELVQQRAKIIELEKQNLSEKVDSESKASDLTIP
                     TLDAVVNLKAPLIRWRTPLEKQILKLKRKYNRDLIEFESKNRKLLKLLNLYHVADEFI
                     VTEEKLLQKIDQVFSDNYRTNHNEFLDGIEYQTANKKKLNEDTLGDLLFGTVGGGNFI
                     GMPTIKEYLTGELDEFNELIKQKTIQNMENKENDMQNIIHD"
     gene            complement(<237699..>237983)
                     /gene="NDAI0C01190"
                     /locus_tag="NDAI_0C01190"
                     /db_xref="GeneID:11496395"
     mRNA            complement(<237699..>237983)
                     /gene="NDAI0C01190"
                     /locus_tag="NDAI_0C01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668975.1"
                     /db_xref="GeneID:11496395"
     CDS             complement(237699..237983)
                     /gene="NDAI0C01190"
                     /locus_tag="NDAI_0C01190"
                     /inference="similar to DNA sequence:INSDC:YOR159C"
                     /note="similar to Saccharomyces cerevisiae SME1 (YOR159C);
                     ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669023.1"
                     /db_xref="GeneID:11496395"
                     /db_xref="GOA:G0W7L9"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:G0W7L9"
                     /translation="MSSRTKSKAMVPPINCIFGYLQQQTPVTFWLYEQVGIRITGKIS
                     GFDEFMNVVIDDAIEIPVDPKTGVENKAKGTQLGRIMLKGDNITLITSNE"
     gene            <238283..>241267
                     /gene="NDAI0C01200"
                     /locus_tag="NDAI_0C01200"
                     /db_xref="GeneID:11496396"
     mRNA            <238283..>241267
                     /gene="NDAI0C01200"
                     /locus_tag="NDAI_0C01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668976.1"
                     /db_xref="GeneID:11496396"
     CDS             238283..241267
                     /gene="NDAI0C01200"
                     /locus_tag="NDAI_0C01200"
                     /inference="similar to DNA sequence:INSDC:YOR160W"
                     /note="similar to Saccharomyces cerevisiae MTR10
                     (YOR160W); ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669024.1"
                     /db_xref="GeneID:11496396"
                     /db_xref="GOA:G0W7M0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W7M0"
                     /translation="MSAANRLVDLQAALQCISSNATQDDKNKALHYLEQFQRSTEAWS
                     VCHDVLINTDAQLLELHIFAAQTLRNKITYDLSQLDNNLMDLKNSLLQLLTVHSQKLV
                     VTQLSIALARLAIQFLDWKDPVIEIINVLNPYPSVLLGFLRILPEETLDIGSTPLTQD
                     EFNSRIHELIDSIAEDVLKFLITCTTLLKQSTNSGISMELILRCLNSWSFEFPIEELL
                     TVEPLISLVFESLLNGAHDSSDIFDAAVDCLCVILRESRDAPNESLVMALYEQLMNIQ
                     RKLLPNILLNTTTDEDIDEDILDGLTRIFVEAGEAWIVFISKSPQVFNQMVTVLLMLA
                     CKNQDLDIVSYTFPFWFNLKQNLVLARYKESQIAYTPIFVQLINGIITHLQYPIDQFE
                     SKETEDKFKEFRYHMGDVLKDCTAVVGPKEALAQPLTRINMALKNTTNINSNWQQLEA
                     PLFSLRTMAQEVPLSESTQLPQIFKILCNLPEHPKIRYAATLVLGRYTEWTSKHPEML
                     EMQLQYIFNGFQVTSAPVSSAPSPSSSGTVSPSPIISNKANSDIITASSHALMYFCSD
                     CSKLLSGYIDQLIDFYFNVENVIDIESQFELCQGLSAVINSQPSDKIVEVFNKLSMRN
                     LNKLNELVIKWKQSPSPYNVQISDVIDLFYALFEELKPRFEYPQQGMEPLLPSIENVW
                     NNLKILLIDQGALQDEMIVERVTKFLRRLFEKFHVFCEPILGSVAEMLVQGYANTGYG
                     TFLWCSGSIIVVFGDDESFPVSKELKDAVWQFALSQCNTFILNFEKMDKSRLNDYYEL
                     IMDFFAMISDLVMFYPQDFILSGGLLLGNVVDVAVISVNKLENYDAYVSILRCLDDII
                     SWGFNTPPISTVSLEFVPNEWRQAIVDEVIIKRGSQIIDSLIIGLVTTFDSDSHSDAI
                     SCIVKCFKLATEANNGNANICNEWVCQAIDKLGQVTVKERDNLNNAIYTGLTQRDYRK
                     VREGVRAFVEWYLRKTVSSRME"
     gene            complement(<241458..>243131)
                     /gene="NDAI0C01210"
                     /locus_tag="NDAI_0C01210"
                     /db_xref="GeneID:11496397"
     mRNA            complement(<241458..>243131)
                     /gene="NDAI0C01210"
                     /locus_tag="NDAI_0C01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668977.1"
                     /db_xref="GeneID:11496397"
     CDS             complement(241458..243131)
                     /gene="NDAI0C01210"
                     /locus_tag="NDAI_0C01210"
                     /inference="similar to DNA sequence:INSDC:YOR161C"
                     /note="similar to Saccharomyces cerevisiae PNS1 (YOR161C);
                     ancestral locus Anc_5.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669025.1"
                     /db_xref="GeneID:11496397"
                     /db_xref="GOA:G0W7M1"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:G0W7M1"
                     /translation="MSQNNENENENENEKYHRPPQPPPTAYTKGSYDDQHNDGSMASS
                     APTATSNDPQQPGNQYHFRQDQYYNLNAKTAGAPIGSFAEAFPTENDNKPRWNDWPFT
                     ILFLLTVAGFIVIASLTLRGWSHTYSSTGSGIYNSVSATPDTNAAILLIFSCIIGLGF
                     ATLGIILVRLYPKFFIYAGMIFNIIAGLATAVMYLSLRYWSAGIVFLVFTVLTAWFYW
                     CMRSRIPLSITILKIVVDVMKKLPQTLIVSLLGTIVGSAFAFLFSVVIVATYIKYDPQ
                     DGNNPGCQVSGGSCSHSKLIGILVLVFFCGYYISEVIKNVVHVTISGIYGSWYYMFKS
                     DQGMPKWPASGAFKRAMTYSFGSISFGSLIVALLETLRETLNLVRQGVIGGGIQGQWG
                     QFGFMIIDWIMGFIQWLAQYFNHYAYSFIALYGKPYLRAAKETWYMIRQKGMDALIND
                     NLIGLALGFYSVFASYIAALFAFLYLRYTEPSYNSNGSYNAPLIAFSFVIALQICNIA
                     NETIRSGTATFFVALGNDPEVFQVSYPDKFDEIFRNYPQVLEKLSHQDV"
     gene            <246762..>251291
                     /gene="NDAI0C01220"
                     /locus_tag="NDAI_0C01220"
                     /db_xref="GeneID:11496398"
     mRNA            <246762..>251291
                     /gene="NDAI0C01220"
                     /locus_tag="NDAI_0C01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668978.1"
                     /db_xref="GeneID:11496398"
     CDS             246762..251291
                     /gene="NDAI0C01220"
                     /locus_tag="NDAI_0C01220"
                     /inference="similar to DNA sequence:INSDC:YOR153W,YDR406W"
                     /note="similar to Saccharomyces cerevisiae PDR5 (YOR153W)
                     and PDR15 (YDR406W); ancestral locus Anc_5.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669026.1"
                     /db_xref="GeneID:11496398"
                     /db_xref="GOA:G0W7M2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G0W7M2"
                     /translation="MSEKPDIAENSASIDDDASSSQSNLHEYHGFDYDAEQRVRDLAR
                     SLTHQSGNISTYSNQDAATESIFTPDMEGINPIFTNKEAEEYNEKLDPTSENFSSKAW
                     VQNMANVVTSDPEFYKPYSLGCVWKNLSASGESSDVAYQSTVLNMPYKLLNSAFRKAR
                     STKTEDRFQILKPMDGCLNPGELLVVLGRPGSGCTTLLKSISSNTHGFDVGEDSVLSY
                     AGFTPDDIKKHYRGEVVYNAEADIHLPHLTVYETLYTVSRLKTPQNRIKGVDRDTFAR
                     HLTEVAMATYGLSHTRNTKVGDDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGL
                     DSATALEFIRALKTQATIASSAATVAIYQCSQDAYDLFDKVCVLDGGYQIYFGPGNEA
                     KKYFEDMGYKCPDRQTTADFLTSVTSPAERIINPDFIKRGIAVPQTPKDMGEYWLKSQ
                     NYKDLMKEIDQKLNNDNIEESRTAVKEAHIAKQSKRARPSSPYTVSYMLQVKYLLTRN
                     FWRIRNNAGVSLFMIIGNSAMAFILGSMFYKVMKKGDTSTFYFRGAAMFFAVLFNAFS
                     SLLEIFTLYEARPITEKHRTYSLYHPSADALASVFSELPTKCIIAVCFNIIFYFLVDF
                     KRNGDTFFFYLLMNVLGVLSMSHLFRCVGSLTKTLSEAMVPASMLLLALSMFTGFAIP
                     KTKMLGWSEWIWYINPLSYLFESLMINEFHGRRFACAQFVPFGPAYANINGTNRICST
                     VGAVAGQDYVLGDDFVKESYGYEHKHKWRSLGIGLAYVIFFLFLYLVLCEFNGGAKQK
                     GEILVFPQGIIRKMKKQGKIQEKKAAGDIENAGGSNVSDKQLLNDTSEDSEDSNSGVG
                     ISKSEAIFHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLA
                     ERVTMGVITGEVSVNGRLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPSDV
                     SIEEKNKYVEEIIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLD
                     EPTSGLDSQTAWSICQLMKKLADHGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYF
                     GDLGKGCQTMIDYFERNGSHKCPPDANPAEWMLEVVGAAPGSHANQDYYEVWRNSAEY
                     KAVHEELEWMATELPKKSPETSADEQHEFATSILYQSKLVCRRLGEQYWRSPEYLWSK
                     FILTIFNQLFIGFTFFKADTSLQGLQNQMLAIFMFTVIFNPILQQYLPTFVQQRDLYE
                     ARERPSRTFSWLAFIISQIVVEIPWNLLAGTIAYFIYYYPIGFYRNASEAGQLHERGA
                     LFWLFSCAYYVYIGSMGLMCISFNEIAENAANTASLMFTMALSFCGVMTTPSNMPRFW
                     IFMYRVSPLTYLIDALLSVGVANVDAHCSDYELLRFAPANGMTCGEYMAPYIQSVGTG
                     YLKDSSATDECAFCTVSDTNSYLASVSSHYKNRWRNFGIFICFIAFNYMAGILFYYLA
                     RVPKKGNGLFSKFKK"
     gene            complement(<251556..>253091)
                     /gene="NDAI0C01230"
                     /locus_tag="NDAI_0C01230"
                     /db_xref="GeneID:11496399"
     mRNA            complement(<251556..>253091)
                     /gene="NDAI0C01230"
                     /locus_tag="NDAI_0C01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668979.1"
                     /db_xref="GeneID:11496399"
     CDS             complement(251556..253091)
                     /gene="NDAI0C01230"
                     /locus_tag="NDAI_0C01230"
                     /inference="similar to DNA sequence:INSDC:YOR155C"
                     /note="similar to Saccharomyces cerevisiae ISN1 (YOR155C);
                     ancestral locus Anc_5.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669027.1"
                     /db_xref="GeneID:11496399"
                     /db_xref="GOA:G0W7M3"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W7M3"
                     /translation="MSCPKPGRHNKIEKKEENNRYRQSTTATALIRNRKRSRENMSSR
                     YRVEYHLKSHRKDEFIDWIKGLLAAPFVLHAISNISSQDDNDDDLVTTQRVKSQYADI
                     FKDIERLIQNKIEFDQAFQNELENTNNDEEENANNDDSDAERGDVETKKTYAIMGKSR
                     LNLLVPSIGTFFTELPLEEAFLSDDYRKRISARRMVAPSFNDIRNILNTAQILHFIKQ
                     RKIKNGNRLKLVTFDGDVTLYEDGGSLFDTNPVIPYILKLLKCDIRVGIVTAAGYDDA
                     STYERRLKGLINALHNSESLTVKQKSNLTIMGGESNYLFRYYENEDQSDSFGFIAIEK
                     EEWMLPVMEDWSQKNIEMTLDFAERTLTNLKRRLNIPKEVPIIRKKRAVGIVPGRRYD
                     ERLQSNVPVKLAREQLEEIVLTLQNNLESFPPSNHIQFSCFDGGSDVWCDIGGKNLGI
                     TTLQHYYDPTNPIKPRETLHVGDQFAPMGSANDFKARLAGCTLWIASPQETVDILHRL
                     IES"
     gene            <254013..>254822
                     /gene="NDAI0C01240"
                     /locus_tag="NDAI_0C01240"
                     /db_xref="GeneID:11496400"
     mRNA            <254013..>254822
                     /gene="NDAI0C01240"
                     /locus_tag="NDAI_0C01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668980.1"
                     /db_xref="GeneID:11496400"
     CDS             254013..254822
                     /gene="NDAI0C01240"
                     /locus_tag="NDAI_0C01240"
                     /inference="similar to DNA sequence:INSDC:YOR152C"
                     /note="similar to Saccharomyces cerevisiae YOR152C;
                     ancestral locus Anc_5.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669028.1"
                     /db_xref="GeneID:11496400"
                     /db_xref="UniProtKB/TrEMBL:G0W7M4"
                     /translation="MFSYLFQFVIFICLTVIPFIITMETISSYETMKQPTIYFSDTNK
                     ETINVARQTNTSNLNTLLLKFWVLSIFFQIILPKTPIIKSIYSLIPLHLSIVSLISLT
                     LSYELICHFKDNAMIQKQKNTYLNKLYDKFNAPSVSSWDLISSLFYTQTSSLNNDFIF
                     GKLTEFIITVPELCKLSNPRIVSSCYNYLEYKIISKSSSLVARLFFFNNNKKRNNKMQ
                     STRHSNIIDISKLENIPLTNSYSRSHTNKNNANILQQERDEEEEYDLLEDL"
     gene            <257434..>261117
                     /gene="NDAI0C01250"
                     /locus_tag="NDAI_0C01250"
                     /db_xref="GeneID:11496401"
     mRNA            <257434..>261117
                     /gene="NDAI0C01250"
                     /locus_tag="NDAI_0C01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668981.1"
                     /db_xref="GeneID:11496401"
     CDS             257434..261117
                     /gene="NDAI0C01250"
                     /locus_tag="NDAI_0C01250"
                     /inference="similar to DNA sequence:INSDC:YOR151C"
                     /note="similar to Saccharomyces cerevisiae RPB2 (YOR151C);
                     ancestral locus Anc_5.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669029.1"
                     /db_xref="GeneID:11496401"
                     /db_xref="GOA:G0W7M5"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:G0W7M5"
                     /translation="MSNEQGQEEEYYDDEAYGFEDANAPITAEDSWAVISSFFREKGL
                     VSQQLDSFNQFVDYTLQDIISEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPM
                     VNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAVDVPGRELKYELIAEESEDD
                     SESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKECPFDMGGYFIINGSEKVLIAQER
                     SAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTVKATLPY
                     IKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDF
                     IGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALD
                     RKDQDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTKDIFRYMQRTVEEANDFNMKLAIN
                     AKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGK
                     LAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEP
                     LEDYVPHQSPDATRVFVNGVWHGVHRNPARLMDTLRTLRRKGDINPEVSMIRDIREKE
                     LKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHINKLMATEYQDIEGGFEDVEEYTW
                     TSLLNEGLVEYIDAEEEETILIAMQPEDLEPPAVNEDEPMVDDLDPAKRIRAVQHATT
                     FTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANI
                     LYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRS
                     LFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVI
                     IGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVR
                     TTKVPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLI
                     ECLLSKVAALSGNEGDASPFTDITVEGISRLLREHGYQSRGFEVMYNGHTGKKLMAQI
                     FFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGA
                     ASFLKERLMEASDAFRVHVCGNCGLMSVIAKLNHNQFECKGCDNKIDIYQIHIPYAAK
                     LLFQELMAMNITPRLYTDRSRDF"
     gene            complement(<261484..>261996)
                     /gene="NDAI0C01260"
                     /locus_tag="NDAI_0C01260"
                     /db_xref="GeneID:11496402"
     mRNA            complement(<261484..>261996)
                     /gene="NDAI0C01260"
                     /locus_tag="NDAI_0C01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668982.1"
                     /db_xref="GeneID:11496402"
     CDS             complement(261484..261996)
                     /gene="NDAI0C01260"
                     /locus_tag="NDAI_0C01260"
                     /inference="similar to DNA sequence:INSDC:YOR150W"
                     /note="similar to Saccharomyces cerevisiae MRPL23
                     (YOR150W); ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669030.1"
                     /db_xref="GeneID:11496402"
                     /db_xref="GOA:G0W7M6"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G0W7M6"
                     /translation="MSQKIGHTGLAFARIWHHVDLAQDKRTLGRVASAIAITLMGKHK
                     PVFHPSQDCGDYVVVTNCQKLRVTGKKMEQKTYWSHTSRPGSLKLKTMETIVANKGYG
                     EVLRKAVSGMLPKNKLRKPRLERLKVFDGSEHPYTNNILAFAYEQPPLVPSGKIAGSQ
                     TTQEKVQNSQ"
     gene            <262412..>264280
                     /gene="NDAI0C01270"
                     /locus_tag="NDAI_0C01270"
                     /db_xref="GeneID:11496403"
     mRNA            <262412..>264280
                     /gene="NDAI0C01270"
                     /locus_tag="NDAI_0C01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668983.1"
                     /db_xref="GeneID:11496403"
     CDS             262412..264280
                     /gene="NDAI0C01270"
                     /locus_tag="NDAI_0C01270"
                     /inference="similar to DNA sequence:INSDC:YOR147W"
                     /note="similar to Saccharomyces cerevisiae MDM32
                     (YOR147W); ancestral locus Anc_5.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669031.1"
                     /db_xref="GeneID:11496403"
                     /db_xref="GOA:G0W7M7"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:G0W7M7"
                     /translation="MQGILHVLSRNAYPQILIKPAILLPTLFLATKRRTYSSILRRKH
                     DIKSHSLPSAFSTALRSVRPIPSIRSIHNYSPIFQENLRDKKPISPQGLIDNKSQSSI
                     SKKMTSNNIKQTTAEGYLPTSSTKRKTSSMVSRLCWLIFGSITLFITLPYAMDTDTVK
                     SLINKTIHNAVFIQLRHLNNKINSSPHSADHKLRINLKFNKASICDWKQNLIKFDDVM
                     ITVAQEHGNDLNCKIYQVTISLSIKKWFNGNGLVNDVSIFGLESDLTSIDNSFDDNNN
                     GLIEQFIQCSNYEFGTVKINDSFLKLNEKKFSIFNLELNKLRLSKLLLDFLNATVITG
                     SINNSLFSLHKRQHKLTNLNDVRKDLSPSFQKITRIRLNTINVNDLGLSKTKSYNWIK
                     DGNVEIILDMMLPQNDDHTITTSTRNQNKYMIMDLKFKFKDLKAHLPARPPSLPTTNE
                     PIISLEELKPVIGYINLQRILVNTMKSHEPNIDTSSTYITLNSPMWNSPNVSIQRKKS
                     MLMNNNNSNKNNNHTNTSEKNNSTIIKNNDNKGITINNDNEIILNCKIVKNMVDFENK
                     ISFKQTGIYDQLTLELYDDLTRIVEEWEYKNKNDWINQWGTTFASQLLLFGFGAIV"
     gene            complement(<264512..>265192)
                     /gene="NDAI0C01280"
                     /locus_tag="NDAI_0C01280"
                     /db_xref="GeneID:11496404"
     mRNA            complement(<264512..>265192)
                     /gene="NDAI0C01280"
                     /locus_tag="NDAI_0C01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668984.1"
                     /db_xref="GeneID:11496404"
     CDS             complement(264512..265192)
                     /gene="NDAI0C01280"
                     /locus_tag="NDAI_0C01280"
                     /inference="similar to DNA sequence:INSDC:YOR148C"
                     /note="similar to Saccharomyces cerevisiae SPP2 (YOR148C);
                     ancestral locus Anc_5.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669032.1"
                     /db_xref="GeneID:11496404"
                     /db_xref="InterPro:IPR026822"
                     /db_xref="UniProtKB/TrEMBL:G0W7M8"
                     /translation="MEGFSISLQTNKKSKLNTKSKVKKKKNVKKSQGTDLFGTSHSND
                     DRHSTTSTQVIKLTHVDNEAEELEHAKKERAKKMIIVPGNVTKISDILNDSNEESLEA
                     DLTSLPNVPHEDQYIDVPVEEFGKALLRGMGWNSDEENEKEKRERLQRKKKQRLPHEL
                     QSHPDGLGIGAKPISSTTDKNKKNDSKSRTQERQMFMPIIKIDKLTGKPILDENKKLD
                     FIHSYYTY"
     gene            complement(<265811..>267352)
                     /gene="NDAI0C01290"
                     /locus_tag="NDAI_0C01290"
                     /db_xref="GeneID:11496405"
     mRNA            complement(<265811..>267352)
                     /gene="NDAI0C01290"
                     /locus_tag="NDAI_0C01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668985.1"
                     /db_xref="GeneID:11496405"
     CDS             complement(265811..267352)
                     /gene="NDAI0C01290"
                     /locus_tag="NDAI_0C01290"
                     /inference="similar to DNA sequence:INSDC:YOR149C"
                     /note="similar to Saccharomyces cerevisiae SMP3 (YOR149C);
                     ancestral locus Anc_5.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669033.1"
                     /db_xref="GeneID:11496405"
                     /db_xref="GOA:G0W7M9"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G0W7M9"
                     /translation="MLYRPLQYFLYLIGIIIALQPSYIHPDEHFQSLEILTIRFFNIK
                     GTIPWEFQSINPARSFVPLYLFYGPLFYFLKHAIDVHKNPLIILYSSRLYTYIIYIIT
                     LKFYLKNNNNTKKNRKLGFIIILSSYVTWTYQSHTFSNSTETIILLLVLSLYEKILSE
                     HHTTTNNTRLSILLGCLISIGTFNRMTFGSFILLPSLKLFIQFYSKKANWKYLLYLIT
                     SFTIVSFLSIQIDSILYHDNYTLTVDPTKWIITPLNNIKYNLNESNLSLHGLHSRYTH
                     LLINLPQIIGPLFLIFPYIIIKTWKSLSTLSIVSTLLILSSFKHQELRFLIPLTPLII
                     TSVIISIKDLHIIRSTKVKKLIVIQWIIFNLIMGIIVGIFHQSGIIPIMMENSRANST
                     SREIWWKTYSPPTWLYMNPNLQVINDKNNYHVSELDKTHDYVFDMKGCDVEILYDTIE
                     TILQDQNDADTVIKVIIPKGVENEFLTLNGTIYIEETNVYSWRHLDLDHGITFGLSVF
                     NVTRN"
     gap             267531..267550
                     /estimated_length=20
     gene            complement(<267687..>268163)
                     /gene="NDAI0C01300"
                     /locus_tag="NDAI_0C01300"
                     /db_xref="GeneID:11496688"
     mRNA            complement(<267687..>268163)
                     /gene="NDAI0C01300"
                     /locus_tag="NDAI_0C01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668986.1"
                     /db_xref="GeneID:11496688"
     CDS             complement(267687..268163)
                     /gene="NDAI0C01300"
                     /locus_tag="NDAI_0C01300"
                     /inference="similar to DNA sequence:INSDC:YDR397C"
                     /note="similar to Saccharomyces cerevisiae NCB2 (YDR397C);
                     ancestral locus Anc_5.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669034.1"
                     /db_xref="GeneID:11496688"
                     /db_xref="GOA:G0W7N0"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0W7N0"
                     /translation="MAMDSEDVTLPRATVQKMISEVLDSDLSFGKEGREIIIQSGVEF
                     IMILSSMASEMAENEAKKTIAPEHVIKALEELEFNEFIPFLEQVLVEFKGSQKVKEKR
                     DSKFKKSGLSEEELLRQQEELFRKSRSKLHQNSITSETAPPNGQQHSSSSSSSSSS"
     gene            complement(<268904..>269701)
                     /gene="NDAI0C01310"
                     /locus_tag="NDAI_0C01310"
                     /db_xref="GeneID:11496689"
     mRNA            complement(<268904..>269701)
                     /gene="NDAI0C01310"
                     /locus_tag="NDAI_0C01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668987.1"
                     /db_xref="GeneID:11496689"
     CDS             complement(268904..269701)
                     /gene="NDAI0C01310"
                     /locus_tag="NDAI_0C01310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669035.1"
                     /db_xref="GeneID:11496689"
                     /db_xref="UniProtKB/TrEMBL:G0W7N1"
                     /translation="MSSNSRNFHNTNEDRNLNRDDQTMQEDEEIKRMVEGLGKSSYRK
                     RYEQQYEDAIVECLKKENLSAISGIINQKFATLNNHYSYIKDYLERLVYMYADLTDRE
                     TAINSLRRFYEGEHKEPNLWTDYVFIIVFMGFFFGCQLGFLTLLNSREEEEEEAALIY
                     PSYFSFIFVNMIIFPDYKTAIKNQVISENKLLSLMSWIVCSMKVFLSFFLLPLVEYIF
                     YIISQQRERLYNIVNILLTFVINLGISSYQCFMSFIQILIVTVKGFH"
     gene            complement(<270535..>271320)
                     /gene="NDAI0C01320"
                     /locus_tag="NDAI_0C01320"
                     /db_xref="GeneID:11496690"
     mRNA            complement(<270535..>271320)
                     /gene="NDAI0C01320"
                     /locus_tag="NDAI_0C01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668988.1"
                     /db_xref="GeneID:11496690"
     CDS             complement(270535..271320)
                     /gene="NDAI0C01320"
                     /locus_tag="NDAI_0C01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669036.1"
                     /db_xref="GeneID:11496690"
                     /db_xref="UniProtKB/TrEMBL:G0W7N2"
                     /translation="MNNSRNFHNANDEKNSNRDDQTMQEDEQVKRMVEGLGKSSYRRR
                     YEQQYEDAIVECLKKENLSAISGIINQKFATLNNHYSYIKDYLERLVYMYADLTNRET
                     SIDSLRGFYETEHKEPNLWTDYVIIIVVMGFFFGCQFGLLMILKLDDEEVPLNFPSVF
                     TFIFATMMIFPDYKTAIKNQVISENKLLSLMSWIVCSIKVLFSLLLLPWIKYIFYIIL
                     AQRDRFYNIVSFLLTFVIDFGISSYQCFMSFIKIFIVGIKGFH"
     gene            <272773..>274755
                     /gene="NDAI0C01330"
                     /locus_tag="NDAI_0C01330"
                     /db_xref="GeneID:11496691"
     mRNA            <272773..>274755
                     /gene="NDAI0C01330"
                     /locus_tag="NDAI_0C01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668989.1"
                     /db_xref="GeneID:11496691"
     CDS             272773..274755
                     /gene="NDAI0C01330"
                     /locus_tag="NDAI_0C01330"
                     /inference="similar to DNA sequence:INSDC:YDR398W"
                     /note="similar to Saccharomyces cerevisiae UTP5 (YDR398W);
                     ancestral locus Anc_5.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669037.1"
                     /db_xref="GeneID:11496691"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G0W7N3"
                     /translation="MSVAASSTTILSEYDPSGQYLAYVTIALDKQRLTVQPIATNIIN
                     DTSLLLNDSNLKITCMKWWSTSTSSTTDTVTASILLGLNNGEIWIYSPVSNEIIYKLS
                     TDNNFNQIMDIDLQDDQQTLWCIDSTDTFYNFNLTDFKLKSSFKIDNAVQLNKLSIIN
                     DSQLLVASHQIFLIDINTRSIIFNSPGHISPVIIMEKIPSSNFFITGAQNDRFINIYE
                     LDATTITTKTVLVGQSNVLKLSTFNESIVAINTEDGRIELFKDPLSVSTTTASLSGSK
                     KRRNVNKKSKRSTTVLNVVPDSQMSIPLQILPFNITINNTLLNFVWFQNAIIPHFKTV
                     QWKELISNETASISVPITSSQSNLKAASSKLLHGIDRASTITYKESNAHISSGDNFKR
                     ITDLINTLNEQEQENEDDEEQETLADKILSLESKSKLKSIPTAATNKKSTTTTTTTTG
                     TVTVILSQALQSNDHSLLETVLNNRNEKIIKETIIRLNPKLAIILLEKLSEKISRNSN
                     RSLTLNHWIKWCIIIHGAYFTNVPNLNHVLNSLYVVLKRKAQLLPRLLALEIRLDATL
                     NKLNIDNGDNDITLDELEEQDEDDVDVEYNEELDDAGLIDDGEEDYYSSDEDEDEDED
                     EDENNEADAVGYAKIGKENHQDDEEDNDGNSDVEMV"
     gene            <275442..>277814
                     /gene="NDAI0C01340"
                     /locus_tag="NDAI_0C01340"
                     /db_xref="GeneID:11496692"
     mRNA            <275442..>277814
                     /gene="NDAI0C01340"
                     /locus_tag="NDAI_0C01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668990.1"
                     /db_xref="GeneID:11496692"
     CDS             275442..277814
                     /gene="NDAI0C01340"
                     /locus_tag="NDAI_0C01340"
                     /inference="similar to DNA sequence:INSDC:YOR144C"
                     /note="similar to Saccharomyces cerevisiae ELG1 (YOR144C);
                     ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669038.1"
                     /db_xref="GeneID:11496692"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7N4"
                     /translation="MMKRSNPLTALLNGNNRKKVKLNTSSIENKSMCPSEIENPVQNI
                     DEHPSSSELDIPFEDLSSSPLKLTEQQNCNLFSVSHISPIKEKLKNQSVQNFLMNRPT
                     EKKEPIIISIDDGDEEETAIHHNANAYKDTSATYVDDDMIITSSNTILNDLSKNVKKV
                     KLKDLFSNFKKSNNDADGADTEGALKRKNPISKLKEIDPPIRYRQSIEPEGTDYINHG
                     DVTLPLHEKRCTVDHNINITQQYTWTEQDYKTIRDVVDDTPTISTTYTFEYKKKLSSN
                     WPEFFKPKSVNEVMLEPALKTAFKEWIEKSFELLKKVTSRKKLQNIIEKDENSEFANF
                     IIHDNDEDEEDINDSNVVDFVPLAILHGYAVGKNTLVEVIMRDLDCQIFEVNSSENRS
                     RKDILDKLSEFATTHYVKGHGSKGVILFDDVDVLFKEHDKLFWQAVEKTLLTSRRPIV
                     LICRDLNFIPTNLIEVAEEENSLFEVKKISNKTCLMFVKRYCQTLKLTLDEDILSMTV
                     ERNKGDIRKCLVDLQFNFSSSGEFNCPKDNMNSFHGSLIDFSFNSELSSINNILEANT
                     EYKSSINQGTDKTLLTKNNEEVFNSNPDEEFRRKHDYMVDYRYHLQDSIQGALLPYEL
                     SIANYMKEMLDRRYGDLKLSKVFDNNAYKFPKMTKNSLAFLSGRVNPRKIQFETTLRK
                     TRNSRRIREILDRFDDNHNVDEYDNTAEFDFFKTNKRHIQTDLNAYVLELAKGEAYRK
                     EKNLELFSRVSKEYPEESEDNIVRQLGQDGLLKPVRFKSNPQTVIKSWNL"
     gene            <280753..>281739
                     /gene="NDAI0C01350"
                     /locus_tag="NDAI_0C01350"
                     /db_xref="GeneID:11496693"
     mRNA            <280753..>281739
                     /gene="NDAI0C01350"
                     /locus_tag="NDAI_0C01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668991.1"
                     /db_xref="GeneID:11496693"
     CDS             280753..281739
                     /gene="NDAI0C01350"
                     /locus_tag="NDAI_0C01350"
                     /inference="similar to DNA sequence:INSDC:YOR143C"
                     /note="similar to Saccharomyces cerevisiae THI80
                     (YOR143C); ancestral locus Anc_5.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669039.1"
                     /db_xref="GeneID:11496693"
                     /db_xref="GOA:G0W7N5"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:G0W7N5"
                     /translation="MVAEEEEEKCIENPERINIQVPENKFKTRINVENILKPMDPTHS
                     VLLILNQEIKLKDLFLEIWNTHHIRVCADGGANRLYEYFQDDEDEDEVERSLHLPDYI
                     IGDLDSLKMEVRKYYEDKGVVIIQQNTQYSTDFTKTVNLVSLHYFSTKFKDIIAVQNS
                     TAKNHGIGIECGIHDLYNELMKNGDSVMKFNKINLLALGGIGGRFDQSIHSITQLYIL
                     EQTDKYFELAYLTETDLIFLVPAGGTLLTYSENFRNECIGNCGLLPLGGMTKIIETQG
                     LKWDVTNWNTSVSSGKVSSSNRFVGIDGCFINCKDSIVLNIEIFKDKLIDFM"
     gene            complement(<281946..>282935)
                     /gene="NDAI0C01360"
                     /locus_tag="NDAI_0C01360"
                     /db_xref="GeneID:11496694"
     mRNA            complement(<281946..>282935)
                     /gene="NDAI0C01360"
                     /locus_tag="NDAI_0C01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668992.1"
                     /db_xref="GeneID:11496694"
     CDS             complement(281946..282935)
                     /gene="NDAI0C01360"
                     /locus_tag="NDAI_0C01360"
                     /inference="similar to DNA sequence:INSDC:YOR142W"
                     /note="similar to Saccharomyces cerevisiae LSC1 (YOR142W);
                     ancestral locus Anc_5.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669040.1"
                     /db_xref="GeneID:11496694"
                     /db_xref="GOA:G0W7N6"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:G0W7N6"
                     /translation="MIRNTLTKNVSTATRRQFHRQSHPYDQTIKNLLLPKETKVIFQG
                     FTGKQGSFHAKISQEYGTNVVGGTNPKKAGQLHQGKPVFSTVSEAIKETGATASAIFI
                     PPPFAAAAIKEAIEAELPLAVCITEGIPQRDMLYINEMLQNQNKTRLVGPNCPGIINP
                     STRVRIGIQPPKIFKSGKIGIISRSGTLTYEAVQQTTNTGLGQSLVIGMGGDAFPGTD
                     FIDALQLFLNDGVTEGIILLGEIGGKAEIEAAQYLKEFNNSKSNPLPVASFIAGTVAG
                     QMKGVRMGHSGAIVEGSGTDAESKKKALREVGIEVVESPGFLGEALLKQFERL"
     gene            <283773..>286697
                     /gene="NDAI0C01370"
                     /locus_tag="NDAI_0C01370"
                     /db_xref="GeneID:11496695"
     mRNA            <283773..>286697
                     /gene="NDAI0C01370"
                     /locus_tag="NDAI_0C01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668993.1"
                     /db_xref="GeneID:11496695"
     CDS             283773..286697
                     /gene="NDAI0C01370"
                     /locus_tag="NDAI_0C01370"
                     /inference="similar to DNA sequence:INSDC:YOR141C"
                     /note="similar to Saccharomyces cerevisiae ARP8 (YOR141C);
                     ancestral locus Anc_5.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669041.1"
                     /db_xref="GeneID:11496695"
                     /db_xref="GOA:G0W7N7"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:G0W7N7"
                     /translation="MSQETPESSVIYEEPIDIPIEDDDEDDDVDEEDVKAESLTSTDK
                     QQNHIPAEDNVDYDNDNDNDNDTNTKKMDPPTISRSVTATPIDQSLSTKHPRDSERED
                     NDDNDNQENENENEDELPSSSGANTPKASTPPLTPTPTTASTNKKLKSKEEAYKKYPK
                     MDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQPLN
                     LINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDNIVESVATGINNKSTGD
                     QLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTRNINTKDSIP
                     TPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFNKISKPEI
                     LPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKTRKPFSNNGSFNIASTDYISLQD
                     LLSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITLLLTHLKFQA
                     VAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYGGNDITNI
                     FATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLPGMDTI
                     EKYDFKVFDDVMLAPLTLFFPKILKLMKEQQPQNRNKFLQSQLPDSRDIYTTKINDWR
                     SITQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKNDKLNYTPLDVAII
                     QSIMNASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNF
                     YKELSKDIKDLQNHYLKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQVPSGTN
                     ISNNLNSTKIDNTPGAETNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGN
                     DHYLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIF
                     PY"
     gene            complement(<287185..>289488)
                     /gene="NDAI0C01380"
                     /locus_tag="NDAI_0C01380"
                     /db_xref="GeneID:11496696"
     mRNA            complement(<287185..>289488)
                     /gene="NDAI0C01380"
                     /locus_tag="NDAI_0C01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668994.1"
                     /db_xref="GeneID:11496696"
     CDS             complement(287185..289488)
                     /gene="NDAI0C01380"
                     /locus_tag="NDAI_0C01380"
                     /inference="similar to DNA sequence:INSDC:YOR140W"
                     /note="similar to Saccharomyces cerevisiae SFL1 (YOR140W);
                     ancestral locus Anc_5.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669042.1"
                     /db_xref="GeneID:11496696"
                     /db_xref="GOA:G0W7N8"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G0W7N8"
                     /translation="MKEENITNEQTRDHDTTTMQISSVTPKSIETPSNTAEGKQQLTN
                     EQPIINTIVPTVAKGLQPQQQASQPSQAPKSSNTIFIHKLYNILEDKDLEDLIWWSND
                     GKSFLIRPTERFSKALATYFKHTNITSFVRQLNIYGFHKVSNDHQYINNKTEDDTTTN
                     VTNHANTDVNNNITDNEQVKIWEFKHSAGIFRKGDVESLKLIKRRSSSRNISSMNSRK
                     ASNATPSRGSSSNYNYNNNTNMNILNMPSNLNTNASSYGQVLQPGNIESTVTDQNAKF
                     VPSQLSQYPNIVEGNINVKSNPSFYKLGINQQKQHQLMQAQDVPFTPYPSTESIPMIQ
                     QYRQVQPQQYTNTDQGYEQPDPQYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNT
                     NGIISEPSIGTSLKDNEMKQQWDEFQSEITNFKRSILSRLQINAMYEQSSQNKTQQLQ
                     QQTHQGQQHLTPNDTNSMNRHSYPIIMKPQSIYSQQTATEHVNTSNNNQTPGNINMIQ
                     QAIPLRPHTAPLSVIQSVPQSSDSNGNNQIPIDTYNSAISSNGSTGKYQMMQNPFNSN
                     ASSRYSSKRHRSVLLDPLTPVSSLNSSSRPSLSGQNNRKPSSTAIPIHSVLDQNSSTI
                     FSPRASISTRQSLTDDQTIVKRNSQSSLPTSIMAPPRPTSRSPINKDALRFSRSANSL
                     PNIIAPTILNKTVSTTNSSPVYSLLNNANVNANSTKDIHNISKEVPMGSDTTNMNING
                     NRESISSNNEMDIIEEEEHSCKKVKYT"
     gene            <290301..>292430
                     /gene="NDAI0C01390"
                     /locus_tag="NDAI_0C01390"
                     /db_xref="GeneID:11496697"
     mRNA            <290301..>292430
                     /gene="NDAI0C01390"
                     /locus_tag="NDAI_0C01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668995.1"
                     /db_xref="GeneID:11496697"
     CDS             290301..292430
                     /gene="NDAI0C01390"
                     /locus_tag="NDAI_0C01390"
                     /inference="similar to DNA sequence:INSDC:YOR138C"
                     /note="similar to Saccharomyces cerevisiae RUP1 (YOR138C);
                     ancestral locus Anc_5.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669043.1"
                     /db_xref="GeneID:11496697"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:G0W7N9"
                     /translation="MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP
                     PENNETSTVANDNDTGQQEPSQLPPRSEASGADPYQTHSPTPEHYYMKDERNAPSSQS
                     YEQQEYIPTSNQENVTSQHGEDRDDDGDNIQENDESTFSSSSTSSQSPAPSPPNYNVV
                     TYTQLKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYENDWY
                     KGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQK
                     LISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVA
                     IFGSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTL
                     SFSPEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDS
                     TTDEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSF
                     QGKDITMFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGP
                     LNVSHPEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEF
                     QITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSK
                     DDQIALDVLRQQIFSSDDIQDVQEERK"
     gene            <292788..>294905
                     /gene="NDAI0C01400"
                     /locus_tag="NDAI_0C01400"
                     /db_xref="GeneID:11496698"
     mRNA            <292788..>294905
                     /gene="NDAI0C01400"
                     /locus_tag="NDAI_0C01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668996.1"
                     /db_xref="GeneID:11496698"
     CDS             292788..294905
                     /gene="NDAI0C01400"
                     /locus_tag="NDAI_0C01400"
                     /inference="similar to DNA sequence:INSDC:YOR137C"
                     /note="similar to Saccharomyces cerevisiae SIA1 (YOR137C);
                     ancestral locus Anc_5.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669044.1"
                     /db_xref="GeneID:11496698"
                     /db_xref="GOA:G0W7P0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G0W7P0"
                     /translation="MGNLSNITQFLERTLSTVEQIRFFVFIQLQNWKVGEGKKSPFGC
                     CCLFLKLNWKKVKIKVKINELMRKPRFGLKTRRIFKTIKQLLLLIIFLTIITSWSSIK
                     GHLQNISLFSTRDSTIHPEYEEGPILDIQRLRCYHWYSTCNVLWHDGILWQRIKKDLS
                     DEKLYALESTQYYDSYIYVKTLSANMDTLSPNIPNGSPHTLKRISEIAMSRDPTIIPM
                     QVIRDVNKLFKSSDSSMFHTHVFHQSGDEHDPVYSDNHAHNKNKDIDVHDDNSHMNGY
                     QFLQQIWSWLLAISDSHDDDLSLMGEDWKYRGSGIWCKYENGVEMEPMIVNKLEIYLG
                     SSFQEFRHNWKEIIHEYKTERDERDVSLPISITRQIGRGTKTDPDKIILIEKETEKKF
                     GLMTAFGFKILQVSDLHYKCSDESISNLKEFQTNNFIKKVILREFPNLIVITGDILDG
                     TNCVDYQTCIMKLVQPFINFEIPYLIMLGTSDYSRYASRESILQFIRTLPYCINKLSQ
                     NVNDTNVMIPIYNKYNDDDKVNDPYIMIYGVDSFNPIDNTKMKNEGSVKWDYGLAFRS
                     LPIPEYRPEGMFPIVGQYNEKSSLTFEEFANNDDSVDADDGGDGRWIGANKLQDFLIS
                     ENVQVLSCGHEHSNDCCLQSKNKMWLCYDGSSGMDVARLENIHASVRLFEVDTNAGEI
                     TSWKRNSNSIDNVYDYQYIYKKN"
     gene            complement(<295178..>296287)
                     /gene="NDAI0C01410"
                     /locus_tag="NDAI_0C01410"
                     /db_xref="GeneID:11496699"
     mRNA            complement(<295178..>296287)
                     /gene="NDAI0C01410"
                     /locus_tag="NDAI_0C01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668997.1"
                     /db_xref="GeneID:11496699"
     CDS             complement(295178..296287)
                     /gene="NDAI0C01410"
                     /locus_tag="NDAI_0C01410"
                     /inference="similar to DNA sequence:INSDC:YOR136W"
                     /note="similar to Saccharomyces cerevisiae IDH2 (YOR136W);
                     ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669045.1"
                     /db_xref="GeneID:11496699"
                     /db_xref="GOA:G0W7P1"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G0W7P1"
                     /translation="MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEG
                     DGIGPEISQSVKQIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGP
                     LATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGI
                     EHVVTPGVVQSIKLITRDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDV
                     AKELSQEYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGS
                     LGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIE
                     KAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL"
     gene            complement(<296940..>298784)
                     /gene="NDAI0C01420"
                     /locus_tag="NDAI_0C01420"
                     /db_xref="GeneID:11496700"
     mRNA            complement(<296940..>298784)
                     /gene="NDAI0C01420"
                     /locus_tag="NDAI_0C01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668998.1"
                     /db_xref="GeneID:11496700"
     CDS             complement(296940..298784)
                     /gene="NDAI0C01420"
                     /locus_tag="NDAI_0C01420"
                     /inference="similar to DNA sequence:INSDC:YDR389W,YOR134W"
                     /note="similar to Saccharomyces cerevisiae SAC7 (YDR389W)
                     and BAG7 (YOR134W); ancestral locus Anc_5.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669046.1"
                     /db_xref="GeneID:11496700"
                     /db_xref="GOA:G0W7P2"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G0W7P2"
                     /translation="MPDSKLQIPSIKIQNPQSNTITSSSTENKEMMTTTSPQSPILSP
                     SEFKNYRDTFITTQNDFKGKIFGTSLHESLKLAHAQVILQDELISFGSIPIVVAKCGS
                     YLKTNGLKTSGIFRIGGNNKRVRELQNIFCDPSQDFGLKFDEWDHYSIHDVATLLKRY
                     LNNLDEPLISLNLYEGFREPLRKRQDIIDYLNAKETEKQDIEEQIPTDDNIEEEEQFE
                     MTRYKKKLARDIREAIAEYEDLFTKLPNERKQLTIYLLDLLNLFVRQSDVNLMTAKNL
                     SAIFQPSILSHPNHDMDPVEYELSRSVVEFLIVHSYKLLPHLVKDTKKSQKQDNATRQ
                     QSKDEKSSPNTFGEQVNSPILIPSKTSSNDTNPSPILKGDNLLLSPIASPKVTITTTP
                     THSKFPKLNIFSTSPVSNSSKRSPQRSIDSSLLTPVTSPVIGMMNAKELTIPRGEPNK
                     NRRKSSGGSSSNNGTTHRHSSGGLKFFSWIQGKSKETNERPNIVIPEDALTDGDDDDE
                     EERQINDDDNDNTINKLEHLSSSFSYNPGAERPSRPQISFSDPHITTIQNAAASSGTI
                     FLEPSLSPPTHPYHERRRGSWLQRLNKKTLTPQVLIKIDSDMKININV"
     gene            complement(<301396..>303015)
                     /gene="NDAI0C01430"
                     /locus_tag="NDAI_0C01430"
                     /db_xref="GeneID:11496701"
     mRNA            complement(<301396..>303015)
                     /gene="NDAI0C01430"
                     /locus_tag="NDAI_0C01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003668999.1"
                     /db_xref="GeneID:11496701"
     CDS             complement(301396..303015)
                     /gene="NDAI0C01430"
                     /locus_tag="NDAI_0C01430"
                     /inference="similar to DNA sequence:INSDC:YDR385W,YOR133W"
                     /note="similar to Saccharomyces cerevisiae EFT2 (YDR385W)
                     and EFT1 (YOR133W); ancestral locus Anc_5.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669047.1"
                     /db_xref="GeneID:11496701"
                     /db_xref="GOA:G0W7P3"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7P3"
                     /translation="MVAFTVDQMRGLMDTVTNVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLYSEMPEEDVKDINQKTEGNSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVCINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPSKGTVAFGSGLHGW
                     AFTIRQFAARYAKKFGVDKVKMMERLWGDSYFNPKTKKWTNKDTDADGKPLERAFNIV
                     VLDPIFRIFAAVMNFKKDEIPVLLEKLEINLKGDEKDLEGKALLKTVMKKFLPAADAL
                     MEMIVMNLPSPVTAQAYRAEQLYEGPSDDANCMAIKKCDPKADLMLYVSKMVPTSDKG
                     RFXXXXXXXXXXTMRRATYVRFLLAEPKIPRTSFLVEIQCPEQAVGGIYSVLNKKRGQ
                     VISEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWATLGSDPLDP
                     TTKAGEIVLAARKRHGMKEEVPGWQEYYDKL"
     gap             301805..301833
                     /estimated_length=29
     gene            complement(<303600..>305219)
                     /gene="NDAI0C01440"
                     /locus_tag="NDAI_0C01440"
                     /db_xref="GeneID:11496702"
     mRNA            complement(<303600..>305219)
                     /gene="NDAI0C01440"
                     /locus_tag="NDAI_0C01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669000.1"
                     /db_xref="GeneID:11496702"
     CDS             complement(303600..305219)
                     /gene="NDAI0C01440"
                     /locus_tag="NDAI_0C01440"
                     /inference="similar to DNA sequence:INSDC:YOR132W"
                     /note="similar to Saccharomyces cerevisiae VPS17
                     (YOR132W); ancestral locus Anc_5.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669048.1"
                     /db_xref="GeneID:11496702"
                     /db_xref="GOA:G0W7P4"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:G0W7P4"
                     /translation="MTSTVPYDEFDSPDNNPFAEPPLEHTDTEQPHESNVASTPATTA
                     EQEVVASTQVSPPSASTLAEETSTQPHDNQHENKETNILPERSDNKLHAIIKVLNVER
                     KGALMEKKENPIIIFDITTNVPTFRKTSYKNIKKTYQEFTELFKYLNGSLPECFIPSL
                     PLSYTNYGIQNKEDQVQLLKCFQNWFNRITMDPFVLRNNEFAFFIECDTGSYLPLNKN
                     NISQTTGLKRKTLKQLAPPYDEVMELAEFRPMVKSIYLLVQGIQEKLLKCSKLRKLMV
                     QEENAVGQGFVKLGDLNTSRGSKLYKRFGKILNAIGDVDSIIATMDMGTLYDGLSWIV
                     RDSYVVKETLTDRHLVMRELSQAQQNSKVKQEQARRLRSKRDSNPLKVDDALRSLKQA
                     TRTEQELTLKLQKITANMLIEQKEWLEWYESWLITSIKEYTIRRIEYERKKLTLLERV
                     RQDVRKADVKGGLSRLGREMTSSNGQDVSQSIEGDSWTGENRHRTSGEIDFLSHTEFD
                     HTLGLDIQEEANDGSSDEEEKLKLRLIDLNC"
     gene            <305642..>306325
                     /gene="NDAI0C01450"
                     /locus_tag="NDAI_0C01450"
                     /db_xref="GeneID:11496703"
     mRNA            <305642..>306325
                     /gene="NDAI0C01450"
                     /locus_tag="NDAI_0C01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669001.1"
                     /db_xref="GeneID:11496703"
     CDS             305642..306325
                     /gene="NDAI0C01450"
                     /locus_tag="NDAI_0C01450"
                     /inference="similar to DNA sequence:INSDC:YOR131C"
                     /note="similar to Saccharomyces cerevisiae YOR131C;
                     ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669049.1"
                     /db_xref="GeneID:11496703"
                     /db_xref="GOA:G0W7P5"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W7P5"
                     /translation="MGRLNNFSRMNNRVIKAVVFDMDGTMCIPQPWMFPAMRSAVGLN
                     DKSIDILTYIDELPTEAARTEANLRIEEVEEKAMREMLPQPGLVELLEFLTVNNISKN
                     ICTRNVIKPVDYLLTRFIPKDYSKFEHIITRDFRPTKPNPDPLLHIAKKLNIESNEMM
                     MIGDSFDDMKSGRSAGCVTVLLKNHVNGNVLTEHDKLVDTAVNSLSDVIKIVETLNGH
                     QTEIHSYQH"
     gene            complement(<306586..>306921)
                     /gene="NDAI0C01460"
                     /locus_tag="NDAI_0C01460"
                     /db_xref="GeneID:11496704"
     mRNA            complement(<306586..>306921)
                     /gene="NDAI0C01460"
                     /locus_tag="NDAI_0C01460"
                     /product="ribosomal protein P2"
                     /transcript_id="XM_003669002.1"
                     /db_xref="GeneID:11496704"
     CDS             complement(306586..306921)
                     /gene="NDAI0C01460"
                     /locus_tag="NDAI_0C01460"
                     /inference="similar to DNA sequence:INSDC:YDR382W"
                     /note="similar to Saccharomyces cerevisiae RPP2B
                     (YDR382W); ancestral locus Anc_5.462"
                     /codon_start=1
                     /product="ribosomal protein P2"
                     /protein_id="XP_003669050.1"
                     /db_xref="GeneID:11496704"
                     /db_xref="GOA:G0W7P6"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G0W7P6"
                     /translation="MKYLAAYLLLVQGGNASPSAADIKQVIESVGVEAEDSRINELLT
                     SLEGKGSLDEIIAEGSKKFASVPAGGAAVGGSSAAAAAGASGEAAAEEKEEEAKEESD
                     DDMGFGLFD"
     gene            <309948..>310916
                     /gene="NDAI0C01470"
                     /locus_tag="NDAI_0C01470"
                     /db_xref="GeneID:11496705"
     mRNA            <309948..>310916
                     /gene="NDAI0C01470"
                     /locus_tag="NDAI_0C01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669003.1"
                     /db_xref="GeneID:11496705"
     CDS             309948..310916
                     /gene="NDAI0C01470"
                     /locus_tag="NDAI_0C01470"
                     /inference="similar to DNA sequence:INSDC:YOR130C"
                     /note="similar to Saccharomyces cerevisiae ORT1 (YOR130C);
                     ancestral locus Anc_5.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669051.1"
                     /db_xref="GeneID:11496705"
                     /db_xref="GOA:G0W7P7"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G0W7P7"
                     /translation="MRSFTIEHQMKIQLFTIFFYITTLPSIQLFLNLDQMDTINNGGG
                     FSSAIRDIVTGSIAGAIGKLIEYPFDTIKVRLQTQESYMFPDTWSCIKYTYKNEGILH
                     GFFQGIESPLIGAALENAILFLSYNQCASFLAHFTTFSSFVVILISATFAGSCASFVL
                     TPIELIKCKLQISNLQMDLSDEERHTSIIPTIKHIVKERGILGLWQGQSSTFIRESIG
                     SMIWFATYELMKRSLRMEKDSNDTWELLISGAIAGLAFNGTVFPADTVKSIMQTEHTN
                     LKETVQNILDRYGVAGFYRGLGITLIRAIPSNAAIFFTYEKLTKLI"
     gene            <312131..>313162
                     /gene="NDAI0C01480"
                     /locus_tag="NDAI_0C01480"
                     /db_xref="GeneID:11496706"
     mRNA            <312131..>313162
                     /gene="NDAI0C01480"
                     /locus_tag="NDAI_0C01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669004.1"
                     /db_xref="GeneID:11496706"
     CDS             312131..313162
                     /gene="NDAI0C01480"
                     /locus_tag="NDAI_0C01480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669052.1"
                     /db_xref="GeneID:11496706"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0W7P8"
                     /translation="MGLVKQVRLGQSGLKISPILIGCMSYGSKKWADWVIEDKEKIFS
                     ILKHCYDNGLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDL
                     HHGNSTNERNALDLVNQNGLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPKEEIM
                     RALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDEREL
                     IPFCKKHGVGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIVRRV
                     EHLAAKKNISMAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYLEET
                     YKPQNVLGF"
     gene            <314340..>317186
                     /gene="NDAI0C01490"
                     /locus_tag="NDAI_0C01490"
                     /db_xref="GeneID:11496707"
     mRNA            <314340..>317186
                     /gene="NDAI0C01490"
                     /locus_tag="NDAI_0C01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669005.1"
                     /db_xref="GeneID:11496707"
     CDS             314340..317186
                     /gene="NDAI0C01490"
                     /locus_tag="NDAI_0C01490"
                     /inference="similar to DNA sequence:INSDC:YOR129C"
                     /note="similar to Saccharomyces cerevisiae YOR129C;
                     ancestral locus Anc_5.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669053.1"
                     /db_xref="GeneID:11496707"
                     /db_xref="InterPro:IPR012860"
                     /db_xref="UniProtKB/TrEMBL:G0W7P9"
                     /translation="MLQQAQTIKSTSFPPHSTLNNINNDNTTLRKNIEFILSAVFDNR
                     LGPTIKYQYPKSIPGFKYPSSSSLLSPGSPNNSSNPDEPLNLANLMLPNNVEKTPGKA
                     DFTVFILYHNKITQTYQLFPPSSKKIKNAVVHSSANNTPKYDKLKRYSILVEDDETAD
                     KVDALKTTAEAPLFFINVVNTVLDETNDRGAIIKSLAVGTTLKNFNIFKPLLLMTLHF
                     YMLNPRYSTAQTLIDCFNMLNSLDLSIVQNLHSKDQLQYMFNSIMDQSVLQTLFDPNK
                     GNFKKILKCKIIPHSDEFGNKILFHNETIHYYFDLFKPTILPKHFSKIPLQVSLIKSD
                     PINISLNYSSYVLNFLNQFIPFLQKLDFSKGIKPWKLLVTSTNETKSTLSDFIIALSN
                     LVSCFTGKQNNYFMNKHILIFPYMDISIIDALRKFLEPTSEFHDSFTIVGTGNPIFQF
                     QTDIWDYYYDMDSEILYDASNHSNINSNSLEKLTLQQELRNSSTSLKKLFAKPYTVTT
                     ISSNNSSNHDNLTSSNNSINIINHGLQRNKSHSVLNPSSHSRIGLLQKFIPYLIQEQH
                     DNQTVIALFKRVNMLQLIFLLNSPTNKNINVPNEMSLQDEYLWVYKDFIIFAEFFTYS
                     ELHIIRILITFENNLQLLVKTKAEKNISNDKLYTQLTTLLETTQELLSFVTLNKSNLE
                     RFINVLQDYPTLRICHEYDLIKHDFNNTSLSKLVRPANKNASLVESFIENLGFNLLTS
                     FLISFDTKEQSKTTTGLNRSQSLFKDFAPSRKNKNNLMRSSSVKRLLRIHNHSSSSDV
                     AENTPQVLILRHKADTFPSVSSSSGSSDRTDTKEINLQSTIEKRILSIKHNLVRIIYK
                     IERHPVGQVLVKRYIKDDIREVYDFLKIEFSSPLSPTETAASIPTVPEGIPMSPQSFS
                     SSRKDLVKELNMIEEQQVQLKIASAKTSQDNSVV"
     gene            <317832..>319526
                     /gene="NDAI0C01500"
                     /locus_tag="NDAI_0C01500"
                     /db_xref="GeneID:11496708"
     mRNA            <317832..>319526
                     /gene="NDAI0C01500"
                     /locus_tag="NDAI_0C01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669006.1"
                     /db_xref="GeneID:11496708"
     CDS             317832..319526
                     /gene="NDAI0C01500"
                     /locus_tag="NDAI_0C01500"
                     /inference="similar to DNA sequence:INSDC:YOR128C"
                     /note="similar to Saccharomyces cerevisiae ADE2 (YOR128C);
                     ancestral locus Anc_5.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669054.1"
                     /db_xref="GeneID:11496708"
                     /db_xref="GOA:G0W7Q0"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q0"
                     /translation="MDTRTVGILGGGQLGRMLVEAANRLNVKTIILDEAVDSPAKQIS
                     NSKDHIIGSFNDPHAIEELASKCDVLTIEIEHVNIEALKNVQTKYPKLKIYPTIETIS
                     LIKDKFLQKGHLTKNSIAAVKSIPIPENTVDNLKQIGNELGYPFVLKSRTFAYDGRGN
                     FVIKSQDDIVQGLVTLKDRPLYAEKWAPFIKELAVMVIRSIDGKIFSYPVVETVHQDN
                     ICHLCYAPARVPDSIQETAKLLAENAVQSFRDCGIFGVEMFLMEDGELFVNEIAPRPH
                     NSGHYTIDSCVTSQFEAHLRSILSLPLPKNFTQFATSNTNAIMLNVLGGNTANSELEF
                     CKKALETAGCSVYLYGKESRPKRKVGHINIISSSMKDCERKLDSILGVSSTITPQSDR
                     KSPLVGIIMGSDSDLPVMSAGCKILEQFGVPFEVTIVSAHRTPHRMSKYAIEASQRGL
                     KAIIAGAGGAAHLPGMVAAMTSLPVIGVPVKGSCLDGVDSLHSIVQMPRGVPVATVAI
                     NNSTNAALLAVRILGSYDNKYFKLMNDFLLKQENEVLLKAETLEMLGYEDYLTKAK"
     gene            complement(<319730..>323275)
                     /gene="NDAI0C01510"
                     /locus_tag="NDAI_0C01510"
                     /db_xref="GeneID:11496709"
     mRNA            complement(<319730..>323275)
                     /gene="NDAI0C01510"
                     /locus_tag="NDAI_0C01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669007.1"
                     /db_xref="GeneID:11496709"
     CDS             complement(319730..323275)
                     /gene="NDAI0C01510"
                     /locus_tag="NDAI_0C01510"
                     /inference="similar to DNA sequence:INSDC:YDR379W,YOR127W"
                     /note="similar to Saccharomyces cerevisiae RGA2 (YDR379W)
                     and RGA1 (YOR127W); ancestral locus Anc_5.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669055.1"
                     /db_xref="GeneID:11496709"
                     /db_xref="GOA:G0W7Q1"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q1"
                     /translation="MNETEPNLPSKPSPLLPTCVRCKDSITTGHAYELGDDKWHTHCF
                     SCYKCDKLLSCDSDFLVLGTGALICFDCSDSCKNCGKKIDDLAIILSSSNEAYCSDCF
                     KCCKCGENITDLRYAKTKRGLFCLNCHEKLLAKRKKYEESKRLERKSLPNIPQVENNN
                     SAKSSSKDTKLLSTQQQTQTQTQTQTPITLSAFAIPERASNRPISPSRTPNSRSHSRN
                     NSTSRSRNDNSRSQSQALNQTISLPESNDISTLLKSTSESIVAQYLENEEDDASSIDD
                     ERNPQSSNEKNNATNTNYTTSKHARNISIDDILNSTLENDEYIDDGDTGSIENNNNIN
                     LPVHLELNDNTKNNKEINNQKQSLNRTPLRNKSNEIGLLKSPKSYRRGMILSDNEDED
                     ESENENRDNESTTEKDTDFNVSESTLPTSKSFKDSKELHSSSTLDAPIIFSKTNPNNS
                     PLPTNKGLALNLNPSPRASIPSNIERVSNDSYSLDKSKITDQQISSSTKGNGITSQQS
                     QSTRNNKEYHHKSSLGRSLSLKSKSLVQNLKSKTSTSKHSSPGPFSLHHSQSTNSSFP
                     QVSNKGNSMVSSETHTGWGINSRSNTNNNSNSTPRRKTSRGYSDTSTYSSIQKQSILE
                     VNDDIPPESTYSYSTTSNRSLSHKRTKSGTTPTPIHFSPMGNLKNNPGAVSVYTTPPL
                     DNDAPTFRKLDDQSSALLTHRKTLSWQLQNQRNPQNLPISLGNNNDDISKSKLISLSP
                     NYDVNDIVGDINMTREDNLEQEVATSIVPTEIDDLITGSEFLLRKLKLDIKELELKKQ
                     KLITEIDSMQATKNDLAETIESLRKEKNELGSTESLDRPSMKLKTTESLSDLGSPSKQ
                     VATVNVVKPVSKPRFWKFFSSSSSSASTPSNQSSKQQIPSSASSNQLFNINMGPTTTL
                     SYNNDNNSGNGHIEISPPFLRNANEISDMNLIPLNSDTRGKSNQSTVESEPPSSLYGS
                     TLVDRCQYEQKQFPFVITTCLAEIESTEENLKTEGLYRKSGSQLVIEEIENEFANGTF
                     HSFDLTTYDIHVVTSILKRYLRKLYNPLLTFEIYESLIALVRDNQLVTTLPLSDAEHI
                     ETQQLFEKVLEVLGNILKTLPKQHLDLLKLLSRHVNLITHFSEWNLMNMNNLALVFAP
                     GLIRDLTGEKDISDIKERNYIVGFIFNNYKELLRH"
     gene            <324139..>324828
                     /gene="NDAI0C01520"
                     /locus_tag="NDAI_0C01520"
                     /db_xref="GeneID:11496710"
     mRNA            <324139..>324828
                     /gene="NDAI0C01520"
                     /locus_tag="NDAI_0C01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669008.1"
                     /db_xref="GeneID:11496710"
     CDS             324139..324828
                     /gene="NDAI0C01520"
                     /locus_tag="NDAI_0C01520"
                     /inference="similar to DNA sequence:INSDC:YOR126C"
                     /note="similar to Saccharomyces cerevisiae IAH1 (YOR126C);
                     ancestral locus Anc_5.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669056.1"
                     /db_xref="GeneID:11496710"
                     /db_xref="GOA:G0W7Q2"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q2"
                     /translation="MRQKLLFFGDSITEFAYQPDQFTTGSALNAIYSRKLDIIHRGYA
                     GYNSRWGLKILPKILEQDGEGVVLSTLFFGANDSCIAGPQRVPIDEFKENTLAMLKLF
                     QEKNIKVVVVGPALLDRPRWESNRPEETKMGYLRTEEEFQKYGQVLKACAHLTNSAFV
                     DLNKAFIEKGGDDWRELLTDGLHFSGKGYEIFFDELMQVIKDKFPQYSPENLPSDYPY
                     WKDVKADMSNL"
     gene            <325097..>326557
                     /gene="NDAI0C01530"
                     /locus_tag="NDAI_0C01530"
                     /db_xref="GeneID:11496711"
     mRNA            <325097..>326557
                     /gene="NDAI0C01530"
                     /locus_tag="NDAI_0C01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669009.1"
                     /db_xref="GeneID:11496711"
     CDS             325097..326557
                     /gene="NDAI0C01530"
                     /locus_tag="NDAI_0C01530"
                     /inference="similar to DNA sequence:INSDC:YDR375C"
                     /note="similar to Saccharomyces cerevisiae BCS1 (YDR375C);
                     ancestral locus Anc_5.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669057.1"
                     /db_xref="GeneID:11496711"
                     /db_xref="GOA:G0W7Q3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q3"
                     /translation="MSLPGSSSSSSSSSSSDGNNSNIPNATPIKATPTAETITPPINN
                     EFSFNIKSLISNAMENNPIFAAGGGLMILGSGLALARSSAIKLSRLLYKQMIIDLEIP
                     SKDKSYSWILTWISKQPKRVSRHLSVRTSYVQHDNGSINTKFSMVPGPGNHWIRYKGA
                     FIMIKRERSGKMVDLINSAPYETVTLVTLYRDRGLFKDILDEAKQIAMKDTEGKTVIY
                     TSFGPEWRRFGQPKGKRTLASVVLDKGIKENIVKDVEEFRNNGKWYSDRGIPYRRGYL
                     LYGPPGSGKTSFIQALAGELDYNICILNLSENNLTDDRLNHLMNNMPERSILLLEDID
                     AAFDKRSQTIEGGYQSHVTFSGLLNALDGVTSSEETITFMTTNHREKLDPAILRPGRI
                     DYQVLVGDATLYQIKHMFLKFYPGETKLCERFVQSVSKEFPSIAANETGEVNPNARTP
                     GLSTALLQGLFVVHKDKPRDAIAAVPALREKIAVVN"
     gene            <326727..>327458
                     /gene="NDAI0C01540"
                     /locus_tag="NDAI_0C01540"
                     /db_xref="GeneID:11496712"
     mRNA            <326727..>327458
                     /gene="NDAI0C01540"
                     /locus_tag="NDAI_0C01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669010.1"
                     /db_xref="GeneID:11496712"
     CDS             326727..327458
                     /gene="NDAI0C01540"
                     /locus_tag="NDAI_0C01540"
                     /inference="similar to DNA sequence:INSDC:YOR125C"
                     /note="similar to Saccharomyces cerevisiae CAT5 (YOR125C);
                     ancestral locus Anc_5.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669058.1"
                     /db_xref="GeneID:11496712"
                     /db_xref="GOA:G0W7Q4"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q4"
                     /translation="MLRTQLPGIRSSTYRTFSILSTLKQNASSSSPAKPKSNKQPSLT
                     QIDQFENLSDAQIAYLDRVIRVDQAGELGANYIYQGQQFILSEKYPHLRPILRHMWLQ
                     EVHHHNTFNELQIRKRVRPSLLTPLWKVGAIAMGAGTALISPRAAMACTEAVETVIGR
                     HYNEQLRCLTNQFQLAKVNEKGETGMSPEVKDIVEKIRQFRDDELEHLDTAIENDSKL
                     AVPYKVITEGVKTVCRIAVWTAERI"
     gene            <327953..>331840
                     /gene="NDAI0C01550"
                     /locus_tag="NDAI_0C01550"
                     /db_xref="GeneID:11496713"
     mRNA            <327953..>331840
                     /gene="NDAI0C01550"
                     /locus_tag="NDAI_0C01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669011.1"
                     /db_xref="GeneID:11496713"
     CDS             327953..331840
                     /gene="NDAI0C01550"
                     /locus_tag="NDAI_0C01550"
                     /inference="similar to DNA sequence:INSDC:YOR124C"
                     /note="similar to Saccharomyces cerevisiae UBP2 (YOR124C);
                     ancestral locus Anc_5.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669059.1"
                     /db_xref="GeneID:11496713"
                     /db_xref="GOA:G0W7Q5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q5"
                     /translation="MTFLRPDEDSTKKESSNIDSLNSSFESVNMDQSSTNSDKPDLPS
                     KTNDDETNKSNPNSTGQGPTCDTPRVTTQDIDPGNTLLYPDLGTANFPMKTSNRIIDD
                     ILCDLSFINGPNLSFKNGILQESMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLT
                     CPANNKLEVQFGILMNLPSNITNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQY
                     HLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDTNRLILIEIFSTEFDSREERES
                     FQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSN
                     NPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDLISYVQGYKVRSLREKYI
                     RRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLNTTTSTNPLYQLLNDSKSNFL
                     ASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPPNIGTYFDALSYIA
                     NRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESIDDSLLLSIYKNESVKE
                     GADFVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSVDDDIIQTAYS
                     IKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYDYRQALGIL
                     QVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNFLMNGVI
                     DPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAK
                     TIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPSNVEV
                     EFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERTEASPTEDIYMTDDDMLG
                     AAKATDGINKEDESTENGIDILPSTKVAKISSDQLENALEMGRQQDVTECIGNVLYQL
                     ESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGETRPKLERFLSLLVNVGDH
                     PRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQVQIQRVYYDRERFMPFKSI
                     EPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQELLSRNEVGLSRKE
                     AYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELSTIYNQITQLEETISH
                     QFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFN
                     FTEGNTATPYFLVYVKEGSEKDIEPLKRIIEES"
     gap             332798..332817
                     /estimated_length=20
     gene            complement(332850..332921)
                     /gene="NDAI0Ctrna3Q"
                     /locus_tag="NDAI_0Ctrna3Q"
                     /db_xref="GeneID:11496714"
     tRNA            complement(332850..332921)
                     /gene="NDAI0Ctrna3Q"
                     /locus_tag="NDAI_0Ctrna3Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11496714"
     gene            <333417..>334379
                     /gene="NDAI0C01560"
                     /locus_tag="NDAI_0C01560"
                     /db_xref="GeneID:11496754"
     mRNA            <333417..>334379
                     /gene="NDAI0C01560"
                     /locus_tag="NDAI_0C01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669012.1"
                     /db_xref="GeneID:11496754"
     CDS             333417..334379
                     /gene="NDAI0C01560"
                     /locus_tag="NDAI_0C01560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669060.1"
                     /db_xref="GeneID:11496754"
                     /db_xref="GOA:G0W7Q6"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q6"
                     /translation="MNNNQDVHNNLSEDVVMSDDVPNAFTTSGSAVSEIPGNVPNNKD
                     FQFNGQPEANRNIKLFLGKLKNHFLLKGVREDRRKIAFLVECLTDQALIWFDQAEKDQ
                     DLYALSYEEFVRIFTDHFTKEVDAFETFSELWNLGHCANATEHAQKFKSLVSGLKPGF
                     ASDELLCNIYVMQCQPDMRIQLMLNKPWPSLEHCMLRETTLEASINSIRRSINIPRED
                     PLLVSNVQMNRGNYYNSTRRYNNGRGNRNNNNYNNNNNGYRPALRSSNDSRKRIGGTK
                     RRSDKSNSGPVDWNRICKENDLCRNCHEYGHYKKQCKKPNARPM"
     gene            <334303..>338046
                     /gene="NDAI0C01570"
                     /locus_tag="NDAI_0C01570"
                     /db_xref="GeneID:11496715"
     mRNA            <334303..>338046
                     /gene="NDAI0C01570"
                     /locus_tag="NDAI_0C01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669013.1"
                     /db_xref="GeneID:11496715"
     CDS             334303..338046
                     /gene="NDAI0C01570"
                     /locus_tag="NDAI_0C01570"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669061.1"
                     /db_xref="GeneID:11496715"
                     /db_xref="GOA:G0W7Q7"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024650"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q7"
                     /translation="MTFVETVMNMVIIRNNARNPMRGLCKANEELEATVAIPECSSND
                     DLLVCNLESHTREDPLLTCNLESHEKEDPRVTTTKINPPVEDVCIVNIGTKSRTLEAL
                     IDTGSPTHFIRSDVVTKLDLKTSQVPFRRVKGLVSDAITTCNTACRLDFRLENREFDI
                     CAYVTDIIKNDVLIGYPFVKRHPSLMESIHKNIDNVKFNNRPVSDPGRMNYEDVTYGK
                     DPIDDICNIETDENWIDIQRDASDVIIVEVTEVTNKDESKFDTIPEELQVKYRGIVRN
                     DLPPRQRDHKHVSHSIELKEGSRLPRRSPYRLTPKKQKEVDEIIKDLLDKGFIVPSKS
                     SYSSPIVLVTKHDGSYRLCVDYRELNKVTVKDPFPLPHVDELLGKVGSASVFTTLDLH
                     SGYHQIPMNPTDMDKTAFVTPTGKYEYTVMPFGLVNAPSTFARYMADLFRDLEFVNVY
                     LDDILIFSNDLESHWKHIDVVLSRLDQEKLIAKKKKCHFAQSEVQFLGYIIGRNKIKP
                     VQEKCEAINRFPVPKTIKEAQRFVGMINYYRKFIKDCSRKVRPLVDFISRNVPWGDLQ
                     DDAFATLKRDLMSEPLLVPFKRDAEYRLTTDASMDGLGAVLEEVADNKVLGVVSYYSK
                     SLNETQRRYPPGELELMAIIEGLEHFKYMLHGKHFVLRTDHISLLSIQNQKEPARRVQ
                     RWLDTLSEFDFSLAYLPGPKNVVADAISRAKLENKEVSNEPVNDNKEILTVATADTLH
                     TLDPESWTTDWRTDPWGAAVLKSLDDKFDHEIPTEQVNEFTRYLKKFERTPEYLKHFK
                     WTNDVLYYEDRICVPHIRRPLVMETYHDHKWFGGHFGEHDTFKKISEIYFWPNCYKTV
                     QDYVKSCIQCQVMKAHRPRSQGLHKPLSVPSGRWLDISMDFLTGIPTTLAGWDMIMVV
                     IDRFTKRAHFVACKKVNGSTGVFDALFRFVFSLHGFPRTIVSDRDIRFTSNAYRELTD
                     RLGIKLLMSTSNHPQTDGQTERVNRTLNQLLRMYCSNDQSCWDKLLPHVEYVYNSTYQ
                     RVLCMSPFEADLGYKPNEPRMNRDYIINARHLTSAEYARDIDALTLRIKDQLEENQLR
                     QEYDANKNRTPVNYKIGDYVLLHRDAYFTGGQYRKIQAIYLGPFQVVGVGTNCCELDL
                     PSMRKLHRMINVTWLKPYVERTNMYPKWKPRAKIERLQRLEEITSIIGYSLNGKIYYC
                     KMKDVDPRLTVEYPEEELRNLSKPRLDSLLRNFNQLEYRRGKT"
     gene            338672..338772
                     /gene="NDAI0Ctrna4S"
                     /locus_tag="NDAI_0Ctrna4S"
                     /db_xref="GeneID:11496505"
     tRNA            join(338672..338709,338727..338772)
                     /gene="NDAI0Ctrna4S"
                     /locus_tag="NDAI_0Ctrna4S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11496505"
     gene            complement(<339182..>339689)
                     /gene="NDAI0C01580"
                     /locus_tag="NDAI_0C01580"
                     /db_xref="GeneID:11496761"
     mRNA            complement(join(<339182..339549,339677..>339689))
                     /gene="NDAI0C01580"
                     /locus_tag="NDAI_0C01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669014.1"
                     /db_xref="GeneID:11496761"
     CDS             complement(join(339182..339549,339677..339689))
                     /gene="NDAI0C01580"
                     /locus_tag="NDAI_0C01580"
                     /inference="similar to DNA sequence:INSDC:YOR122C"
                     /note="similar to Saccharomyces cerevisiae PFY1 (YOR122C);
                     ancestral locus Anc_5.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669062.1"
                     /db_xref="GeneID:11496761"
                     /db_xref="GOA:G0W7Q8"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q8"
                     /translation="MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEIS
                     EICQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYP
                     PTVQAGEATKIVEQLADYLISVQY"
     gene            complement(<340050..>341462)
                     /gene="NDAI0C01590"
                     /locus_tag="NDAI_0C01590"
                     /db_xref="GeneID:11496717"
     mRNA            complement(<340050..>341462)
                     /gene="NDAI0C01590"
                     /locus_tag="NDAI_0C01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669015.1"
                     /db_xref="GeneID:11496717"
     CDS             complement(340050..341462)
                     /gene="NDAI0C01590"
                     /locus_tag="NDAI_0C01590"
                     /inference="similar to DNA sequence:INSDC:YOR123C"
                     /note="similar to Saccharomyces cerevisiae LEO1 (YOR123C);
                     ancestral locus Anc_5.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669063.1"
                     /db_xref="GeneID:11496717"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:G0W7Q9"
                     /translation="MSEERNGSQPAESNTDIDVKTPSLSVEATGVTENIGNDDINVED
                     EKVGEPDEEKEAEKEGEEGEEEEEEEEQEGMDDLFGDDEDEDKEQRGSDDEEEGFIVE
                     EDDESAQRRPEDMDDEEAMYTRKFYGDTDKYSDNEEDAHDFKEANVEIIRHMVPYKTS
                     SDQADTTIYYAKVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIR
                     WRYSRDQNQRVFKESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELM
                     QCYNGGEITKTMMFIPTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKEL
                     EKKQGQILRERRKRQLKEREIQESPDTTFDVRGSASSKNRSPAPSSYRGSRQDEYEED
                     DFLVDDDEEEEFVGDEDEEEEEEEEEEEEDEDDRKAKRLKEIKKGGAQEYADREESDM
                     EEGSSKRRKVAVLSDDEEDE"
     gene            complement(<342011..>342952)
                     /gene="NDAI0C01600"
                     /locus_tag="NDAI_0C01600"
                     /db_xref="GeneID:11496718"
     mRNA            complement(<342011..>342952)
                     /gene="NDAI0C01600"
                     /locus_tag="NDAI_0C01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669016.1"
                     /db_xref="GeneID:11496718"
     CDS             complement(342011..342952)
                     /gene="NDAI0C01600"
                     /locus_tag="NDAI_0C01600"
                     /inference="similar to DNA sequence:INSDC:YDR368W,YOR120W"
                     /note="similar to Saccharomyces cerevisiae YPR1 (YDR368W)
                     and GCY1 (YOR120W); ancestral locus Anc_5.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669064.1"
                     /db_xref="GeneID:11496718"
                     /db_xref="GOA:G0W7R0"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G0W7R0"
                     /translation="MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNAL
                     KAGYRHIDTAAIYKNEDQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERL
                     GLDYVDLYLMHWPVAFKPDSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPK
                     TGKTRAVGVSNFSINNLKALLSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILE
                     AYSPLGSTNAPILTEPKIIEIAKKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANF
                     QTFELSKDEMDSLNNLSKEKGERRIVQPNWAPFVPFV"
     gene            complement(<343850..>345604)
                     /gene="NDAI0C01610"
                     /locus_tag="NDAI_0C01610"
                     /db_xref="GeneID:11496719"
     mRNA            complement(<343850..>345604)
                     /gene="NDAI0C01610"
                     /locus_tag="NDAI_0C01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669017.1"
                     /db_xref="GeneID:11496719"
     CDS             complement(343850..345604)
                     /gene="NDAI0C01610"
                     /locus_tag="NDAI_0C01610"
                     /inference="similar to DNA sequence:INSDC:YOR118W"
                     /note="similar to Saccharomyces cerevisiae YOR118W;
                     ancestral locus Anc_5.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669065.1"
                     /db_xref="GeneID:11496719"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:G0W7R1"
                     /translation="MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPL
                     ELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIW
                     DITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLR
                     EKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPT
                     ANCKILPNETIYNSWNEYQKASLNILRSMDSSIVSNLDDYRISFTQFENVFTSVVPNF
                     THPLENIMNHLLYMDKDLINHPVMEIPKSKLMSESLLAQLSTTLPKELFISKLQKLYI
                     GRQSGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEYNNPRFKRFLQEFPKLNDNEQS
                     LEPCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFN
                     TIGCGIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLT
                     KRGTEEESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQVNLKSISEDR
                     ALLEMVGLVGQHQSGGSM"
     STS             344637..346256
                     /standard_name="D1S3697"
                     /db_xref="UniSTS:474275"
     gene            <346478..>350860
                     /gene="NDAI0C01620"
                     /locus_tag="NDAI_0C01620"
                     /db_xref="GeneID:11496720"
     mRNA            <346478..>350860
                     /gene="NDAI0C01620"
                     /locus_tag="NDAI_0C01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669018.1"
                     /db_xref="GeneID:11496720"
     CDS             346478..350860
                     /gene="NDAI0C01620"
                     /locus_tag="NDAI_0C01620"
                     /inference="similar to DNA sequence:INSDC:YOR116C"
                     /note="similar to Saccharomyces cerevisiae RPO31
                     (YOR116C); ancestral locus Anc_5.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669066.1"
                     /db_xref="GeneID:11496720"
                     /db_xref="GOA:G0W7R2"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:G0W7R2"
                     /translation="MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEK
                     GREPKTGGALDKRMGVSSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQI
                     LQGICKTCSAILLSDKDRRQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGAL
                     NGVVKKAAAGAGSASLKIIHDNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRC
                     SDDLNPLKTLNLFKQIKPEDCELLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQD
                     SPASNEDDLTVKLTEIVWTSSLIKAGLEKGISINNMMEHWDYLQLTVAMYINSDSVNP
                     AMLPGASSGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEV
                     AVPDRVAKVLTFPEKVTRYNRQKLQQLIINGPNVHPGANYLLKNNEDARRNLRYGDRV
                     KLAKNLQFGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPY
                     NADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISH
                     KDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKPHYLWTGKQLFSLLIKPNKDSPVVI
                     NLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQILSGVMDKSVLGDGKKHSVFYTIL
                     RDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPADDLKQKKEELVEIAYAKCDE
                     LIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCG
                     SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKTPQSKGFVRNSFFSGL
                     TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQF
                     TYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIMETTNAILKPLED
                     RLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLGSVRKSRGMLP
                     MVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRKARVEPGTA
                     VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV
                     NENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLELTIED
                     IAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRMQH
                     LRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL
                     EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSK
                     MRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEI
                     AKESLKPKPTLFENLTSSRSIKMN"
     gene            complement(352414..352486)
                     /gene="NDAI0Ctrna3K"
                     /locus_tag="NDAI_0Ctrna3K"
                     /db_xref="GeneID:11496721"
     tRNA            complement(352414..352486)
                     /gene="NDAI0Ctrna3K"
                     /locus_tag="NDAI_0Ctrna3K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11496721"
     gene            complement(<352892..>354394)
                     /gene="NDAI0C01630"
                     /locus_tag="NDAI_0C01630"
                     /db_xref="GeneID:11496752"
     mRNA            complement(<352892..>354394)
                     /gene="NDAI0C01630"
                     /locus_tag="NDAI_0C01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669019.1"
                     /db_xref="GeneID:11496752"
     CDS             complement(352892..354394)
                     /gene="NDAI0C01630"
                     /locus_tag="NDAI_0C01630"
                     /inference="similar to DNA sequence:INSDC:YHR113W"
                     /note="similar to Saccharomyces cerevisiae YHR113W;
                     ancestral locus Anc_5.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669067.1"
                     /db_xref="GeneID:11496752"
                     /db_xref="GOA:G0W7R3"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:G0W7R3"
                     /translation="MLRNCLRKMSTTVQTINYPQEFVKFLNESHSPYHAVDNIKTHFK
                     NNGFKELIERESWDDKVLKRGKYFVTRNNSSIIAFVVGGKWAPGNPIAITGAHTDSPT
                     LRIKPISKRTNEKYLQIGVECYGGGIWHSWFDSDLSIAGRVLVFDKKSDKVVSKLIDL
                     NKPLLKIPTLAIHLDRDVNQKFEFNKESQLLPIAGLTIDSEKKGENNDKEDIHNHDDK
                     LSNEEFSSIKSIIERHHEQLLDLIAEELSLESVSDIEDFELVLYDNNKSTLGGINDEF
                     VFSGRLDNLISCFTSMYALSLATETRIEEETGIRLMATFDHEEIGSSSAQGADSNFLP
                     NILERLNFLKCDGTDSSAPLLKSLILESSAKSFFLSSDVAHAVHPNYASKYESQHKPY
                     VGAGPVIKINANQRYMTNSPGLVLIKRMADKVKVPLQLFVVANDSSCGSTIGPILASK
                     TGIRTLDIGNPILSMHSIRETGGAADLELQIKLFREFFEAYSFTESNVVV"
     gene            complement(<354966..>355604)
                     /gene="NDAI0C01640"
                     /locus_tag="NDAI_0C01640"
                     /db_xref="GeneID:11496722"
     mRNA            complement(<354966..>355604)
                     /gene="NDAI0C01640"
                     /locus_tag="NDAI_0C01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669020.1"
                     /db_xref="GeneID:11496722"
     CDS             complement(354966..355604)
                     /gene="NDAI0C01640"
                     /locus_tag="NDAI_0C01640"
                     /inference="similar to DNA sequence:INSDC:YHR110W"
                     /note="similar to Saccharomyces cerevisiae ERP5 (YHR110W);
                     ancestral locus Anc_5.420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669068.1"
                     /db_xref="GeneID:11496722"
                     /db_xref="GOA:G0W7R4"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G0W7R4"
                     /translation="MLLQQLRVFTLLLSLASFGSCIYFYANSGEVRCFYENLSSGQLL
                     IADIDTSVEKNGIYEEDQDVTVSISVDETFDNNHRVLNQKNSHTGDFAFTALDDGEHR
                     VCFTPYFADTKSKIRVFVELEIDHVSSLDSQRKEDVESMKRRTSQLIGRLNKIRQEQK
                     EIRENEAIFRDESEAANSKIRFWSILQVIVLIVICWFQLGYLRNFFIKQKVL"
     gene            complement(<355948..>357642)
                     /gene="NDAI0C01650"
                     /locus_tag="NDAI_0C01650"
                     /db_xref="GeneID:11496723"
     mRNA            complement(<355948..>357642)
                     /gene="NDAI0C01650"
                     /locus_tag="NDAI_0C01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669021.1"
                     /db_xref="GeneID:11496723"
     CDS             complement(355948..357642)
                     /gene="NDAI0C01650"
                     /locus_tag="NDAI_0C01650"
                     /inference="similar to DNA sequence:INSDC:YHR109W"
                     /note="similar to Saccharomyces cerevisiae CTM1 (YHR109W);
                     ancestral locus Anc_5.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669069.1"
                     /db_xref="GeneID:11496723"
                     /db_xref="UniProtKB/TrEMBL:G0W7R5"
                     /translation="MEEVLTFFQENANVKVHPAVHLKLDNGADGRKGYGLNINLQKVQ
                     GLSHKNDDLILLRIPHNSTFNIETTLRLVRDSSQFTSTKAFEKTDKIRQEMFKKFKEE
                     LVRKSFQYSETIFMTFYFILFDCLKTMYDLPKILTYYLNTVLLPTRINNISLFDKYLL
                     STYYQYSIPTVTEETIEKLYSFFADNFPNQIVSMGSIRQIYGAIISRCLEIPQEINRE
                     LDDCTVMTTLVPILDFVNHDINLKNAHYDIDRETNDVILILERSALEKYKRTNVRDIE
                     IFIDYGQTENVLPFALTYGFFPSLKTSQYEVWNISFDRDFLKNSKGSLQNGNLRLFYK
                     WFGINPVIQLVRIKEKSVYSQWYINDSSHNFIDLLLPFLPSFEGNSGSCWKYDPETDS
                     TFTYFCCHNDTSKVKSNSEEDSIVTAFKKAIENKEQDGNDIMNMPPLAWSFSFYSKDH
                     NKICQEVVSKNEAIGILQDCLEDDMYLQAISSFLNFLKDYIIWRIGKLEEGILAQNSI
                     PGAESVSFQLHNYELSILRETQFALSSNSENFTSDCNIELTGAIDRYPPPLKSSPH"
     gene            <358256..>359446
                     /gene="NDAI0C01660"
                     /locus_tag="NDAI_0C01660"
                     /db_xref="GeneID:11496724"
     mRNA            <358256..>359446
                     /gene="NDAI0C01660"
                     /locus_tag="NDAI_0C01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669022.1"
                     /db_xref="GeneID:11496724"
     CDS             358256..359446
                     /gene="NDAI0C01660"
                     /locus_tag="NDAI_0C01660"
                     /inference="similar to DNA sequence:INSDC:YHR107C"
                     /note="similar to Saccharomyces cerevisiae CDC12
                     (YHR107C); ancestral locus Anc_5.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669070.1"
                     /db_xref="GeneID:11496724"
                     /db_xref="GOA:G0W7R6"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7R6"
                     /translation="MSAAATATTTAQPPVGVSNLPNQRYKIANERGGSFTLMVCGESG
                     LGKTTFINTLFQTTLKHQDAQQRRYTPIKKTVDIDIIRAILEEKNFSLRVNVIDTPGF
                     GDNVNNNKAWQPLIDFIDDQHDSYMRQEQQPYRKVKFDLRVHAVLYFIKPTGHGLKPL
                     DIETMKRLSTRANLIPVIAKSDTLTAQELQVFKSRIRQVIEAQEIRIFTPPLETGSVK
                     DDESPDSPAMEHARQLIESMPFAVVGSENKYDNGQGTPVVARQYPWGLVEIENDSHCD
                     FRKLRGLLLRTYLLDLILTTEELHYETYRRLRLEGGNSEDPNLPVKAPARKLSHNPKY
                     KEEENALKKYFTDQVKAEEQRFRQWEQNIVNERIRLNGDLEDIQSKVKKLEEQVRNLQ
                     LKKR"
     gene            complement(<360043..>361104)
                     /gene="NDAI0C01670"
                     /locus_tag="NDAI_0C01670"
                     /db_xref="GeneID:11496725"
     mRNA            complement(<360043..>361104)
                     /gene="NDAI0C01670"
                     /locus_tag="NDAI_0C01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669023.1"
                     /db_xref="GeneID:11496725"
     CDS             complement(360043..361104)
                     /gene="NDAI0C01670"
                     /locus_tag="NDAI_0C01670"
                     /inference="similar to DNA sequence:INSDC:YDR353W,YHR106W"
                     /note="similar to Saccharomyces cerevisiae TRR1 (YDR353W)
                     and TRR2 (YHR106W); ancestral locus Anc_5.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669071.1"
                     /db_xref="GeneID:11496725"
                     /db_xref="GOA:G0W7R7"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G0W7R7"
                     /translation="MNIIIKQKNKLLNLQTTKLKLLPTFFNTPTITTRMVHNKVTIIG
                     SGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPEGLTGSELM
                     DRMREQSVKFGTTIITETVAKVDLSSRPFKLWTEFNEDQEPITTDAIILATGASAKRL
                     HLPGEETYWQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVYLIV
                     RKDHLRASTIMQKRAMTNPKIEVLFNTVTLEAKGDGKFLNSLRIKNVQTNQESDLEAN
                     GLFYAIGHNPATSIVAGQVDTDAAGYIKTVPGSSLTSVPGFFAAGDVQDSRYRQAITS
                     AGSGCMAGLDAEKYLTELE"
     gene            complement(<362243..>362794)
                     /gene="NDAI0C01680"
                     /locus_tag="NDAI_0C01680"
                     /db_xref="GeneID:11496726"
     mRNA            complement(<362243..>362794)
                     /gene="NDAI0C01680"
                     /locus_tag="NDAI_0C01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669024.1"
                     /db_xref="GeneID:11496726"
     CDS             complement(362243..362794)
                     /gene="NDAI0C01680"
                     /locus_tag="NDAI_0C01680"
                     /inference="similar to DNA sequence:INSDC:YHR105W"
                     /note="similar to Saccharomyces cerevisiae YPT35
                     (YHR105W); ancestral locus Anc_5.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669072.1"
                     /db_xref="GeneID:11496726"
                     /db_xref="GOA:G0W7R8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G0W7R8"
                     /translation="MTDKVNFLPPEPIKLIDEDTESDELTRPFISNESNNFDTISNIS
                     MSNIGIKKIIISDCTIVTGDNGTKFAVWKMTLILKSDPTSTMNGGPPLIQLYKRYSDF
                     ERFRSKLLIKIREVRPDLRNLVPELPPVIPWYKSWDYDHLNFDKKWLAKRRIGLERFM
                     SQVVSNSQITELASDELKKFLET"
     gene            complement(<363638..>366088)
                     /gene="NDAI0C01690"
                     /locus_tag="NDAI_0C01690"
                     /db_xref="GeneID:11496727"
     mRNA            complement(<363638..>366088)
                     /gene="NDAI0C01690"
                     /locus_tag="NDAI_0C01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669025.1"
                     /db_xref="GeneID:11496727"
     CDS             complement(363638..366088)
                     /gene="NDAI0C01690"
                     /locus_tag="NDAI_0C01690"
                     /inference="similar to DNA sequence:INSDC:YDR351W,YHR103W"
                     /note="similar to Saccharomyces cerevisiae SBE2 (YDR351W)
                     and SBE22 (YHR103W); ancestral locus Anc_5.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669073.1"
                     /db_xref="GeneID:11496727"
                     /db_xref="UniProtKB/TrEMBL:G0W7R9"
                     /translation="MAMVEESSVITEVGLNRPPFSRKTSPLKQVLSSPKGSLNVSSSK
                     ASGLGLRRPSDNILRTLTNEENIGFNPGDFTPPRKELMTKNERPVSNDSIATKSTEIF
                     SSTSSDLNSRSSSIDNEIGATDIGDNDESIDSIDVDSTIDHSYMVKKKHNLISLQNTS
                     TIDEESMAVHHNPTRLFSNGMRAQSQISVSHINNTYNNNNNNYNNNNNIHETRFGLAY
                     ANNKAQQNNMTDGPKRLPNQRGGLYGHSNSTSAILANKVPLTPSQRYRLRREQHEVSI
                     RKAIKKKEKYYDEQDEVLELKEGEIDDSLIWNIPMASFLTTSFLSKTPHSTPLASTRN
                     SPVHKQTIPDLHHEQRSHNYHHTDDNKEGKHHSSDRNASVLAFYEMPTSPIPGINRVS
                     DFQYIQQTSKNLSSVYLHSSEKLSKSKLSERTQSASCLPIEFKDASQKGMEDLLLVSN
                     DKLHLVSQARPSWLPPKDIYEKKMHDKEITKKMSMASIEQLDKNKERDERILRDETNK
                     QKYILLLERDVTRNSSLQSCKKMVWETAFSNETRYSMYSQLLQSKIGLITKNYIEPYK
                     YVTELLGKMDFPKGKEVEIEKIISKGIKAKVSSSKIIKSSDLMLLLKLKSISHQGLLP
                     GDELLFHHFLISESFQSLEQVWEIVNLLQLTCFNDVCREKYDLNILNSRGVVAHYLMK
                     DEGFKQEYTSACLNYNTWWNILERIDHSLFMWIIDIIVVANNQCFNKHPVKVESFKDK
                     DWEYYRSKKVVVNYKILLSFALNVLLNYHFGFNDLAQLSSLEDKKFCIPMPLDELLDT
                     SAINNMFVNKWQHYYKKF"
     gene            complement(<367077..>370139)
                     /gene="NDAI0C01700"
                     /locus_tag="NDAI_0C01700"
                     /db_xref="GeneID:11496766"
     mRNA            complement(<367077..>370139)
                     /gene="NDAI0C01700"
                     /locus_tag="NDAI_0C01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669026.1"
                     /db_xref="GeneID:11496766"
     CDS             complement(367077..370139)
                     /gene="NDAI0C01700"
                     /locus_tag="NDAI_0C01700"
                     /inference="similar to DNA sequence:INSDC:YHR102W"
                     /note="similar to Saccharomyces cerevisiae KIC1 (YHR102W);
                     ancestral locus Anc_5.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669074.1"
                     /db_xref="GeneID:11496766"
                     /db_xref="GOA:G0W7S0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W7S0"
                     /translation="MRKASFTSSSGTPIQNGVSKQQQQTLPSHARLPADKDINSVFRR
                     TEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDSDEDEVEDVQREIQFLASLKQLPNIT
                     RYYGSYLKDTSLWIIMEYCAGGSLRTLLRPGKIDEKYIGVITREILIALKYIHKDNII
                     HRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMAGTPYWMAPEVIMEGVYYDT
                     KVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLKEFVALCL
                     DEDPKERMSAEDLLKTKFIKAHKLTPVSILKELISRYLLFRDRNKTLKEEGALPEEEK
                     ADNKKSRKETSDNTDNTVTENKSIDKNIDEEENVDVKWDFDSLSSSEYIIENNINIDA
                     IPEEATVDWSADGQQEHFNYAYPDEEQYYYHPTNKNGKSFYQSTTIGKHQPGTVHHNS
                     TLNAPLTQLNTTENIRTRPMGGTHTTNNNMTHNTEFATGKKVETKTPKQLLELFEENE
                     PISDDNAVETDINRINSNLSAMKLNGISAAPIEGRQLSSGMDAANTSRPHQNFTNGNA
                     FYSQSTSALPILQTKFTGNNKGPTSAITTAPTSIEIEIPEELPSSIATSLTPLENEPN
                     NLLPTKPRASTVSITAQGSQHQKQPVLSRRVTLSESTNRADSVPKPADANLRSDGRGQ
                     GTVGAVTTTSTSASILPAPNNNFSTSNNKLSHRTPSPTRMLVNKMTTPGKKTTGSPTG
                     PSSSKPHASNLTNLGPPPIMKPIIANDDNKDLLLQPLNSKTNNNMYSLPIKEKETTSR
                     VNGDFKRNNPNLKLQMPLPTSVLRNKLLDSSQAPASASATVTSNLTSQIHDNINQFGF
                     NTSSASNVPVSMTPISEKNLDLGARLRRSQSTSTRKPSNSNEHSTVLGSTSVLLNNAS
                     TGQSNLLSAASSSSLNTSLTSNSGNVNNTVTSTNTVMQCPPNSLNMQIFQDTEFSSSG
                     ISRRIDRKPQMLDELRTLLQMFDESLPLIEHALEKQLPATHTTENGDH"
     gene            <370747..>371772
                     /gene="NDAI0C01710"
                     /locus_tag="NDAI_0C01710"
                     /db_xref="GeneID:11496767"
     mRNA            <370747..>371772
                     /gene="NDAI0C01710"
                     /locus_tag="NDAI_0C01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669027.1"
                     /db_xref="GeneID:11496767"
     CDS             370747..371772
                     /gene="NDAI0C01710"
                     /locus_tag="NDAI_0C01710"
                     /inference="similar to DNA sequence:INSDC:YHR101C"
                     /note="similar to Saccharomyces cerevisiae BIG1 (YHR101C);
                     ancestral locus Anc_5.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669075.1"
                     /db_xref="GeneID:11496767"
                     /db_xref="InterPro:IPR024722"
                     /db_xref="UniProtKB/TrEMBL:G0W7S1"
                     /translation="MWSVIYFTFCSLLFFVNGRAKELQNQTNVPAILFSYKRSPGISD
                     HQKNYDLALNLPVSDFMNTSEELLDHCNSNAYVFINQPGLRKLDFLDFKKHFIFLQKY
                     IYQSSNALKFEKVDILPNDTFHKLMEHVKDKCDIKKTIKIKGNVTEDFEPYYDVDRRV
                     IRIDYPPLPLEREERQHAIESYDLFLRFVLAQLPSPELTVIYTSLEPGEVDPLESIIP
                     VEIFPEIFKNKIDEEKNDRIKEPEPVFNEFRPRFLGMTSKYISIFDPDFIKENIVLLQ
                     GIVTSVVGFIMVQVFLYLRKDTEQVKIDSKNVVEKEPRMNELKTKTRSTAENNNEEVV
                     TRKKYEQ"
     gene            <372067..>372624
                     /gene="NDAI0C01720"
                     /locus_tag="NDAI_0C01720"
                     /db_xref="GeneID:11496768"
     mRNA            <372067..>372624
                     /gene="NDAI0C01720"
                     /locus_tag="NDAI_0C01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669028.1"
                     /db_xref="GeneID:11496768"
     CDS             372067..372624
                     /gene="NDAI0C01720"
                     /locus_tag="NDAI_0C01720"
                     /inference="similar to DNA sequence:INSDC:YHR100C"
                     /note="similar to Saccharomyces cerevisiae YHR100C;
                     ancestral locus Anc_5.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669076.1"
                     /db_xref="GeneID:11496768"
                     /db_xref="InterPro:IPR010021"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027706"
                     /db_xref="UniProtKB/TrEMBL:G0W7S2"
                     /translation="MNASATLNVFKLLYNPRLCMPQLTVPTFNQLPIPLAPAIKAIVI
                     DKDNCISYPHDDKIWPQYNTKWEQLKTQYPGKALLIVSNSAGSSDDIAHKEAKILEDR
                     TGVTVLRHSTKKPGCKDEILAHFIDNKIIEHPNEVAVIGDRLFTDIMMSNMMNSYGVW
                     IKDGVVPSNGPISKIEKMLYTFMNK"
     gene            complement(373095..373167)
                     /gene="NDAI0Ctrna1M"
                     /locus_tag="NDAI_0Ctrna1M"
                     /db_xref="GeneID:11496769"
     tRNA            complement(373095..373167)
                     /gene="NDAI0Ctrna1M"
                     /locus_tag="NDAI_0Ctrna1M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11496769"
     gene            <374122..>376866
                     /gene="NDAI0C01730"
                     /locus_tag="NDAI_0C01730"
                     /db_xref="GeneID:11496740"
     mRNA            <374122..>376866
                     /gene="NDAI0C01730"
                     /locus_tag="NDAI_0C01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669029.1"
                     /db_xref="GeneID:11496740"
     CDS             374122..376866
                     /gene="NDAI0C01730"
                     /locus_tag="NDAI_0C01730"
                     /inference="similar to DNA sequence:INSDC:YHR098C"
                     /note="similar to Saccharomyces cerevisiae SFB3 (YHR098C);
                     ancestral locus Anc_5.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669077.1"
                     /db_xref="GeneID:11496740"
                     /db_xref="GOA:G0W7S3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G0W7S3"
                     /translation="MSQYNIASNMSSLSLDPSVGTPTTKKHKRPTRAFHNFGLPGSAA
                     ESPTATPTLNHQESFTGTPQIGTFAPRHFSVSETVAGATDQYTVSSPYLASNPELSPP
                     NATSHFVPMQRLEEQIKYLSCVFETTKNSVPPLPTTQFYCADQGSCDPRLMNLSMYNI
                     PEDNHLRSATKLPLGLTVQPFAKLIPDEPIPLVGNASSSEIPPLRCKRCRAYANPGFH
                     FQYDSKVVCNICKVEMQIPNEHILNAEGLRVDFNTSIELARGAVDFLAPKSYNATDAA
                     PLPLHYAFLIDVSTHANENGSSLAVLEAVRETIEYIRENQTECKIGIIAYDNKLRFYN
                     LRSELQLAQEYIVTELDDCFLPFYEGLFVKPENSMTVINDTLAKIGDFIRNDKYNHSP
                     YNCYGSALQAAQLALNIVTGRQGGKIIASLNSLPNIGNGNLYIRKDDATKRTLKCDNE
                     FYVKLSEKLLRSYISVDLFVTSSAFVEMVSVGRPVLVTNGILKYYPQFRGDAYSTAVA
                     ADMVQNVSNIIGYQALMKVRCSAGLSVNQYYSESVDYTDRDPMIPVLTRDTTIDVLLK
                     YDEKLKVGTDMSFQTAVLYTDLNGIRKIRSINCTGGVSNNIREVFKFIDQNSVMRIMI
                     NDILRTLGDCDFPKIRQIIDDKIVDILTQYRGLVNGNSASQLVLPDSLKTLPTYMLCF
                     EKSELMKPNNQSTRGNNRINDLMKYSTLNSAQLSFKLYPQIIPFHVLLEETDLTFYDA
                     NDKLLQIQPTSKDSLSVLDGFGNLLDGGCYFIFDGETVYLWFNHNTNKMLLEDLLGVD
                     PTLNINQITLFGGCLPETGTEINQKAFNVIKNWCQIVGKTSLPLVLLRPGVDNYCSEV
                     LGHVLVEDKTVNMVDSTSNYFITLHSKIQAKLNKQDFIKISTPTTRTTDTLHQDFVQF
                     "
     gene            <378218..>380041
                     /gene="NDAI0C01740"
                     /locus_tag="NDAI_0C01740"
                     /db_xref="GeneID:11496770"
     mRNA            <378218..>380041
                     /gene="NDAI0C01740"
                     /locus_tag="NDAI_0C01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669030.1"
                     /db_xref="GeneID:11496770"
     CDS             378218..380041
                     /gene="NDAI0C01740"
                     /locus_tag="NDAI_0C01740"
                     /inference="similar to DNA sequence:INSDC:YHR096C,YDR345C"
                     /note="similar to Saccharomyces cerevisiae HXT5 (YHR096C)
                     and HXT3 (YDR345C); ancestral locus Anc_5.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669078.1"
                     /db_xref="GeneID:11496770"
                     /db_xref="GOA:G0W7S4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W7S4"
                     /translation="MSKANPENVAALNSEQRATMNSISSNEKSENQTMPTTGRDSGYG
                     TSAVNPKESLDQDNEDLKTLQKEADEQLESKSKKDLIFVSICCLMVSFGGFIFGWDTG
                     TISGFVNQTDYVRRFGQTRSNGSHYLSNVRMGLLVSIFNVGAAIGGVMLARTGDMWGR
                     RLGLITVVSIYTVGIVIQIASIDKWFQYFIGRIISGLGVGGIAVLAPMLISEVAPKQL
                     RGTLVSCYQLMITLGIFLGYCSNFGTKNYSNSVQWRVPLGLSFAWALFMIGGMLMVPE
                     SPRYLVEVGRLEDAKRSLSKTNKVEVNSPFVTLEMEKFEASVEAERLAGTANWNELVT
                     GRPAMFKRTVMGMMIQSLQQLTGANYFFYYGTTIFRAVGLEDSFETSIVLGVVNFVST
                     FFALYFVDHYGRRTCLLWGCVGMICCYVVYASVGVTRLWPNGQSQPSSKGAGNCMIVF
                     ACFFIFCFATTWAPIAYVVTSEIYPLRVRGKAISVATACNCMWGFLISFFTPFITGAI
                     NFYYGYVFMGCMVFAYFFVFFLVPETKGLTLEEVNEMYEEGVLPWKSASWVPPSRRDV
                     DYNVEELKTDDRPAYKKIFSKNQSGNEGKPAFYKNIFSRNK"
     gene            <382042..>383772
                     /gene="NDAI0C01750"
                     /locus_tag="NDAI_0C01750"
                     /db_xref="GeneID:11496771"
     mRNA            <382042..>383772
                     /gene="NDAI0C01750"
                     /locus_tag="NDAI_0C01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669031.1"
                     /db_xref="GeneID:11496771"
     CDS             382042..383772
                     /gene="NDAI0C01750"
                     /locus_tag="NDAI_0C01750"
                     /inference="similar to DNA sequence:INSDC:YDR343C,YHR094C"
                     /note="similar to Saccharomyces cerevisiae HXT6 (YDR343C)
                     and HXT1 (YHR094C); ancestral locus Anc_5.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669079.1"
                     /db_xref="GeneID:11496771"
                     /db_xref="GOA:G0W7S5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W7S5"
                     /translation="MSEAVEHQVDSVAENTPVDVMSPVQSATPSGLSTPSNKADRDDG
                     KEYGEDGEEFEAVAEIPKKPASAYITVSIMCIMIAFGGFVFGWDTGTISGFVAQTDFL
                     RRFGQKHHDGSHYLSKVRMGLVVSIFNIGCAIGGIILSKAGDMYGRKMGLIIVVVIYV
                     VGIIIQIASVKAWYQYFIGRIISGMGVGGIAVLSPMLISEVSPKHLRGTLVSCYQLMI
                     TLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMIGGMTKVPESPRYLIEKGLVE
                     EAKRSIALSNKVGVDDPAVMTEVENLQSGVEAERLAGNASWGELFSTNTKIFQRLIMG
                     CMLQSLQQLTGDNYFFYYGTTVFKAVGMEDSFETSIVLGIVNFASTFVGIFLVERYGR
                     RTCLLWGAATMTACMVVFASVGVTRLWPNGKDNGSSKGAGNCMICFTCFYLFCFATTW
                     APIPFVVNSETFPLRVKSKCMSVAQACNWLWGFLIGFFTPFISGAIDFYYGYVFMGCL
                     CFSYFYVFLFIPETKGLSLEEVNTMWEEGVLPWKSAEWVPPSRRGAEYNAEDMAKDDK
                     PLFKRMFGRK"
     gene            <384545..>386515
                     /gene="NDAI0C01760"
                     /locus_tag="NDAI_0C01760"
                     /db_xref="GeneID:11496772"
     mRNA            <384545..>386515
                     /gene="NDAI0C01760"
                     /locus_tag="NDAI_0C01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669032.1"
                     /db_xref="GeneID:11496772"
     CDS             384545..386515
                     /gene="NDAI0C01760"
                     /locus_tag="NDAI_0C01760"
                     /inference="similar to DNA sequence:INSDC:YDR341C,YHR091C"
                     /note="similar to Saccharomyces cerevisiae YDR341C and
                     MSR1 (YHR091C); ancestral locus Anc_5.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669080.1"
                     /db_xref="GeneID:11496772"
                     /db_xref="GOA:G0W7S6"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0W7S6"
                     /translation="MLFSMFFRPLSLSLSISSRLSTFLTRCQHFNKYHLLHRRTILSI
                     RQQGRTMSTKNITAQLQKLAIKEPKAIEGSHPDVNVVDLMRNYISQELSKISGVDEAL
                     IFPALEWTNTLERGDLLIPVPRLRVKGAKPNDLAAEWAEKFPCGEFLDRVEANKAFLQ
                     FFFKPQFLFNVVIPDVLNRKDEYGSCNLGDNKKVIIEFSSPNIAKPFHAGHLRSTIIG
                     GFLANLYEKLGWDVIRMNYLGDWGKQFGLLAIGFERYGSEEALAKDPIHHLFEVYVRI
                     NKDIEEEGDSLPLEESTNGKAREYFKRMEDGDEAALKIWKRFRELSIEKYIDTYARLN
                     IQYDVYSGESQVSKESMEKALQIFKEKGLTHEDKGAVLIDLTKFQKKLGKVIVQKSDG
                     TTLYLTRDVGAAMDRYEKYHFDKMIYVIASQQDLHAAQFFEILKQMGFEWANRLQHVN
                     FGMVQGMSTRKGTVVFLDNILEETKEKMHDVMKKNEVKYSQIENPEEVADLVGISAVM
                     IQDMQSKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNASEITPEKWLKADFS
                     LLTEPAALLLVRLLGQYPDVLRNAIKTNEPTTVVTYLFKLTHQVSSCYDVLWVAGQTE
                     ELATARLALYAAARQVLYNGMRLLGLTPVDRM"
     gene            387493..387593
                     /gene="NDAI0Ctrna5S"
                     /locus_tag="NDAI_0Ctrna5S"
                     /db_xref="GeneID:11496716"
     tRNA            join(387493..387530,387548..387593)
                     /gene="NDAI0Ctrna5S"
                     /locus_tag="NDAI_0Ctrna5S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11496716"
     gene            <387749..>388576
                     /gene="NDAI0C01770"
                     /locus_tag="NDAI_0C01770"
                     /db_xref="GeneID:11496763"
     mRNA            <387749..>388576
                     /gene="NDAI0C01770"
                     /locus_tag="NDAI_0C01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669033.1"
                     /db_xref="GeneID:11496763"
     CDS             387749..388576
                     /gene="NDAI0C01770"
                     /locus_tag="NDAI_0C01770"
                     /inference="similar to DNA sequence:INSDC:YHR090C"
                     /note="similar to Saccharomyces cerevisiae YNG2 (YHR090C);
                     ancestral locus Anc_5.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669081.1"
                     /db_xref="GeneID:11496763"
                     /db_xref="GOA:G0W7S7"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:G0W7S7"
                     /translation="MDPSLVLEQTIQDVSNLQAEFRFIYEEISSADSKALEEKKKYMQ
                     KDSQIHKFIKQHGSTTVQPDEDKLYKEINEGMKACEELQNEKSIFANTALFLVARHLS
                     KLEKNIALLEEDGVLAPLENEIESGVELSRESSVVSTTPGERKRRGTSSSETGPSLKK
                     KKQSRTASVQRGQKETELIKASETPKTMISTNVEIPKYNDDLFANSNDNEDEDKTLYC
                     FCQNVSYGEMVACDGPNCKYEWFHYGCVNLKEPPKGTWYCPDCRQEMAKNKLKKKKV"
     gene            <389115..>389750
                     /gene="NDAI0C01780"
                     /locus_tag="NDAI_0C01780"
                     /db_xref="GeneID:11496774"
     mRNA            <389115..>389750
                     /gene="NDAI0C01780"
                     /locus_tag="NDAI_0C01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669034.1"
                     /db_xref="GeneID:11496774"
     CDS             389115..389750
                     /gene="NDAI0C01780"
                     /locus_tag="NDAI_0C01780"
                     /inference="similar to DNA sequence:INSDC:YHR089C"
                     /note="similar to Saccharomyces cerevisiae GAR1 (YHR089C);
                     ancestral locus Anc_5.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669082.1"
                     /db_xref="GeneID:11496774"
                     /db_xref="GOA:G0W7S8"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /db_xref="UniProtKB/TrEMBL:G0W7S8"
                     /translation="MSFRGGNRGGRGGFRGGRGGGRMGGRPIQQGPPDSVLEMGSFLH
                     ECENDIVCRSINTKIPYFNAPIYLENKTQIGKVDEILGPLNEVYFTIKCSEGVQAKSF
                     KEGDKFYIGPDKLLPIERFLPKPKVVGPPKPKSKKKKGTGAPAGRGGSRGGFSRGGRG
                     GSRGGFSARGGSRGGFGGRGGSRGGFGGRGGSRGGFGGSRGGSRGGFGGRR"
     gap             390005..390024
                     /estimated_length=20
     gene            complement(<390119..>393796)
                     /gene="NDAI0C01790"
                     /locus_tag="NDAI_0C01790"
                     /db_xref="GeneID:11496775"
     mRNA            complement(<390119..>393796)
                     /gene="NDAI0C01790"
                     /locus_tag="NDAI_0C01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669035.1"
                     /db_xref="GeneID:11496775"
     CDS             complement(390119..393796)
                     /gene="NDAI0C01790"
                     /locus_tag="NDAI_0C01790"
                     /inference="similar to DNA sequence:INSDC:YDR335W"
                     /note="similar to Saccharomyces cerevisiae MSN5 (YDR335W);
                     ancestral locus Anc_5.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669083.1"
                     /db_xref="GeneID:11496775"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W7S9"
                     /translation="MEFLGANQIISVLETIYSPTASNEERLESQKFLDQVKLQDESPF
                     WGFQLAMNNPHNYIVIHYGLGLLGNSLKKDWDKYDQVKRVTLRNWIKDLCFKVTAEYP
                     RYIKEKLALLWVEVAKRTWGELLRGGDEQITETVMETSWCNMDHDLSDLWSMSEASRE
                     LSLIIFRILFEDVFLLEDMVMLKRMTILQPLCVMLVSPIDVFAKKYKFTEKWMLFKWG
                     QTGWFQLWVKELNEALNGSNSEYVIRLLETLKTCLNWPLSDVIIDSDILSSLFGCFMS
                     GIPKAQSMALDSMHILLTRPYNNEEHNLHVINKVFDNMDILSTVYDSLQFDPNEGIDE
                     DKYPIIKKFVDMISCLYVCILKVKNDNGQINKYLRLVLKATAHPSLIVSGLTLDLWCS
                     CLRNDDVLPMLTDFVIPQLLNFSADALVYYEQIDNHVSKLFSDVDFQSKTEFQTFCST
                     YRKRIRDIIRLISCVKLDFTYTWLTSRLNDYFSSIYGQQVLSSTFLDRKSEPYLSALS
                     QFMIIECFINGCIRWKIWYPNGSDYDEKLNEILYKLELLSNQLIALNIREPLLLKKEI
                     QNFALFLTMLKDNVLFTLLEKIITTATMDYPGLNLEERNDESDAVRDLRYACGIELNR
                     MALLMPESLKEIFPDIENVVAKILPNLSYHEKISFKSFLLTIILKSSLDHKEERFAAI
                     VDPELSAWSDKDTVVGLTDLPWFMERLGIVQIAEYFQNRGIDESRDLLSIDIDEEGKK
                     LKSELTKRWQTLFPVRATRMFIHYSMQSVKKDEDLKILQKMWRPRIVPILPYIMRLLY
                     QLQSYHDPENWKQLPSIVQSFVKYSTIERFWEAGASNKSKDEFIDEHMKAMQTLRDFA
                     DSVGHIVRYTREYTLLVLGAISSLGNVFYEVEEAPQLLLDSIAIYKPDTGMISPGVST
                     HGWKHIMNIAVRPILKNCPEECAPKFMAAFLPKLFETLDLLLCQKWEPYMVDNDVMQA
                     ARDDEEMTEEILEENLLRQFTTVVVLILIDSFGQHGHSSKTKPNPHQLLLRNIVFNDI
                     NILAPFLTLLNHLIGFKDTKCSFNAILILKSCLSEVLIKDPNVDHFFTVEVMQTLIKR
                     FLVDNGQKDAFYELLYVFTTLFLTLCKEYKSTRDFLYNVSRGYDIDALYNNLKEVDDY
                     KAQRLLMYDFFDWIRTVNGKNDVNDDESLALHEKKRLERRDAVLKRAAERLVKKNKPN
                     ADVLDDPSTEDGAIGTLFENT"
     gene            complement(<394480..>395364)
                     /gene="NDAI0C01800"
                     /locus_tag="NDAI_0C01800"
                     /db_xref="GeneID:11496776"
     mRNA            complement(<394480..>395364)
                     /gene="NDAI0C01800"
                     /locus_tag="NDAI_0C01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669036.1"
                     /db_xref="GeneID:11496776"
     CDS             complement(394480..395364)
                     /gene="NDAI0C01800"
                     /locus_tag="NDAI_0C01800"
                     /inference="similar to DNA sequence:INSDC:YHR088W"
                     /note="similar to Saccharomyces cerevisiae RPF1 (YHR088W);
                     ancestral locus Anc_5.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669084.1"
                     /db_xref="GeneID:11496776"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G0W7T0"
                     /translation="MAAEEINIRNKQKRQQLFAELKDQKNKERHTMRRQRAKEERENP
                     ELKEKRLKENVTKTIDNMRVFDETINQPIEGDEDDLLQFFNNNNSEPPKIFLTTNVNA
                     RKCAYEFANVLIEVLPNVTFVKRKYGYKMKEIVDICNKRNFTDMVIINEDKKKVTGLT
                     FIHLPEGPSFYFKLSSYVEVKKIVGHGRPTSHIPELILNNFQTRLGKTVGKLFQSIFP
                     NDPEFEGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTLKLKRLQRGIKEE
                     TEWEHKPEMDKEKKKFYL"
     gene            complement(<396364..>396756)
                     /gene="NDAI0C01810"
                     /locus_tag="NDAI_0C01810"
                     /db_xref="GeneID:11496777"
     mRNA            complement(<396364..>396756)
                     /gene="NDAI0C01810"
                     /locus_tag="NDAI_0C01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669037.1"
                     /db_xref="GeneID:11496777"
     CDS             complement(396364..396756)
                     /gene="NDAI0C01810"
                     /locus_tag="NDAI_0C01810"
                     /inference="similar to DNA sequence:INSDC:YHR087W"
                     /note="similar to Saccharomyces cerevisiae YHR087W;
                     ancestral locus Anc_5.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669085.1"
                     /db_xref="GeneID:11496777"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:G0W7T1"
                     /translation="MQLPFESAPTKSKTKIVKTQQDQRPPTKYAYRGERTDFIIFVRS
                     EDAVKQYLEKPDISDLSKVVEVFQIFVNREAKGTTGELGEASSAQLQNEFGDYKKEEE
                     VIDLILKKGESLGPENKLRGNYRNDTRS"
     gene            complement(<398027..>399523)
                     /gene="NDAI0C01820"
                     /locus_tag="NDAI_0C01820"
                     /db_xref="GeneID:11496778"
     mRNA            complement(<398027..>399523)
                     /gene="NDAI0C01820"
                     /locus_tag="NDAI_0C01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669038.1"
                     /db_xref="GeneID:11496778"
     CDS             complement(398027..399523)
                     /gene="NDAI0C01820"
                     /locus_tag="NDAI_0C01820"
                     /inference="similar to DNA sequence:INSDC:YHR086W"
                     /note="similar to Saccharomyces cerevisiae NAM8 (YHR086W);
                     ancestral locus Anc_5.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669086.1"
                     /db_xref="GeneID:11496778"
                     /db_xref="GOA:G0W7T2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W7T2"
                     /translation="MSFNQYQNYSRNVRPENSTYGETNYQRSNASYDYTRQQLQLQQQ
                     QPSVITSSPYVSSSSSSSSDPRNKKTQIYMGELDPTWTEATIKSIWKSLGEELINVKL
                     IWNKNLGLNQGYCFIEFPSEQHASNALLKNGINIPEFPRKKVKLNWTSSSSASLQGSS
                     NSGQVPSTSTNYSVFVGDLAANVTEGQLFDLFISRFQSTCHAKIVHDPVTRASKCYGF
                     VKFNDLRDQQRALVEMQGIFLNGRAIKIGTTTGGSAHTNTDNNALAPNIANSGGKSRF
                     QGTTTNSPSSPANIGRGNTSNYRLTSLSSQFIFPVQQQPPLNHFTDPNNTTVFVGGLS
                     SMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQGFPIGNSRIR
                     LSWGRSSRQQGQALAQPVLQEPIYGYVPNPDVPNTFNSTNTSNIDRNNYLPGFQELRY
                     SNLPTNDTISNHNNSIIDNNVTTQNDISKNGISAYDRLERGSNGFTFI"
     gene            complement(<400269..>402434)
                     /gene="NDAI0C01830"
                     /locus_tag="NDAI_0C01830"
                     /db_xref="GeneID:11496779"
     mRNA            complement(<400269..>402434)
                     /gene="NDAI0C01830"
                     /locus_tag="NDAI_0C01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669039.1"
                     /db_xref="GeneID:11496779"
     CDS             complement(400269..402434)
                     /gene="NDAI0C01830"
                     /locus_tag="NDAI_0C01830"
                     /inference="similar to DNA sequence:INSDC:YHR084W"
                     /note="similar to Saccharomyces cerevisiae STE12
                     (YHR084W); ancestral locus Anc_5.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669087.1"
                     /db_xref="GeneID:11496779"
                     /db_xref="GOA:G0W7T3"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:G0W7T3"
                     /translation="MISGLYHVSFGIISIMLQELILLNVAFIECKNLVEKLFKREKFE
                     EGIFSDLRNLKCGIDAILEQPKSAFLQFLFKNICLKTQKKQKVFFWFSVPHDKLFADA
                     LERDLKRETLRQKSTTRSVMEPALSFNFNLLSDKTLYEQLIEYMDSQRRQPTSTNDTI
                     SDNNNNKNDRHNNYFPPHITMEGHHPSIYKTQTQSMTSLNDIIPLPLNDHNNEPLDNG
                     ISNIPPSSVTRSNEMISQPMNIPIPHDKDENGNNKSGTSSEDINIHLFDDVDDGDDGD
                     DDDNNNEGEQKDVATNDEGVILHNDDEAFPLDYFPISVEYPNEVVEPFIDPFQQHQQQ
                     QRQIQHGIMSPNSATTSRSQQLPLMVQPSSFNYSNQDSLPPSSVFMNDLQQPQSASYL
                     STLVSPTLGSLSATRPHFMTNGEYYESLQNQQPLQLNTDEVTTIDEHLNNQEQEKNSD
                     NNSKRLPYASDQQLYQQQQMAMYQMQPYANPYYPSIPARSITNTTVQEFPNKYLEPNG
                     ISTFGSYEFSPIQENFNTGFPLPQDHSVWGFVPQQAMQPPKSATLAHNQQFLPQQSST
                     TASGQIPPQLSFAYRTTPTTTIMNTQIATKPTDHQEVVELSKSRKSPYTSVKILQKLG
                     KSNISLSSPTIPTFVSMKHNGRINKPLHIKPSSYQKQLSKISRHASNLSDKRELDKDA
                     SNHEGSADDDDDDDDNDENNDANDEFHKIVGDGSTGNNF"
     gene            complement(<404952..>406010)
                     /gene="NDAI0C01840"
                     /locus_tag="NDAI_0C01840"
                     /db_xref="GeneID:11496780"
     mRNA            complement(<404952..>406010)
                     /gene="NDAI0C01840"
                     /locus_tag="NDAI_0C01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669040.1"
                     /db_xref="GeneID:11496780"
     CDS             complement(404952..406010)
                     /gene="NDAI0C01840"
                     /locus_tag="NDAI_0C01840"
                     /inference="similar to DNA sequence:INSDC:YHR083W"
                     /note="similar to Saccharomyces cerevisiae SAM35
                     (YHR083W); ancestral locus Anc_5.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669088.1"
                     /db_xref="GeneID:11496780"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="UniProtKB/TrEMBL:G0W7T4"
                     /translation="MSPLTVPSPIKLLFDTFPLVTYPPINNQDTQRQNDIDSRTYPFT
                     TINVENNGMIDKSFSLAVYNVYKHPKKNAILCTDPICQYLQFALCLKNNLKLPSNNNL
                     SLIDKNPPSISISENNVITLSYLATPQRILPILIENKHNNVNDIAQESKTILTSVEYM
                     VSSNKAIKPKEKLLLNLVDTTIQDCWISQFLFNVPSEQFHETYHYREHDNIDNLSHLL
                     QQQKLSIANRNQFNLRNLELMNHLNSIVRTNSHKLQIDQLLQLLFERFKISMTQFENI
                     LKDKKQHSSSSSASSFLLSADHADKGKANISYLDLKLASYILCILNLHDKNILKKFVK
                     ESCPELIIHSEKVLSIFC"
     gene            <407978..>411712
                     /gene="NDAI0C01850"
                     /locus_tag="NDAI_0C01850"
                     /db_xref="GeneID:11496781"
     mRNA            <407978..>411712
                     /gene="NDAI0C01850"
                     /locus_tag="NDAI_0C01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669041.1"
                     /db_xref="GeneID:11496781"
     CDS             407978..411712
                     /gene="NDAI0C01850"
                     /locus_tag="NDAI_0C01850"
                     /inference="similar to DNA sequence:INSDC:YHR082C"
                     /note="similar to Saccharomyces cerevisiae KSP1 (YHR082C);
                     ancestral locus Anc_5.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669089.1"
                     /db_xref="GeneID:11496781"
                     /db_xref="GOA:G0W7T5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G0W7T5"
                     /translation="MSLDYEIYKEGGILNDRYQKIEDISEGSYGYVSLAKDTKEKKLV
                     AIKYIFKLDPDQRDEYDNDDCDRDHNDCSSLEKKQNYLDHKQSLISPNVRSRLTDDIC
                     LEAMYEVDIQTKIGRHKNIVALLDFFDSYIIMEYCSGGDLYEAIKDDILPRKTKPITH
                     IISQIMDAIEFVHNKGIYHRDIKPENILITGIDWTIKLTDWGLATTDKTSFDRSVGSE
                     RYMAPELFESNLDLDERKEPYSCDKVDLWAMGIVFLNIVFHKNPFSVANQSDKSFCYF
                     AANREALFDVFSTMTYDFFQVLRYSLTIDPTNRDLKKMRMELLNLSEYTLDDEYYNSI
                     EEGGYETEISDVTTTTSTPLPPIPPSSAPVGLPTPVSSTTKVPEFKNVFTPGEVKNNE
                     NNTSSNNFSTVESTSTAVGSNSTSNSKNTDYDDNNNNNNNDNNTNKLNSSSANKNEPN
                     FKKPFEIPQFNILHHKNDSTKSNNSSNSVYSKNSHYHNYHNYNNEYNTKFNPNRRESY
                     NVGYTSKERAKSTPKFKFQKRRRNSKKNYNNHSKANPIKIENRNRSKILKNSRKPLGI
                     PTPNTHINNFFHEYKASKQDSDHFNTRDFFTPPSIQNRYMEGIFNSKQYKQHRPYNNK
                     IWNKNFMTNNNTASITNSTTGNINNNGNSYKQPSGYGKFRRPSTTGSSYYANNNSKSP
                     MNRLSFSSHTPSGSYGRRGSATTMPSTVLQHSPGSYVPPSLRNNRFNGTTASTQFLSV
                     SPNIPTISSVLDESNSFVPKSTNTSSNVNYKQPQPQKYQQPNSLISSDLEDHDSDEVL
                     FTLDENENDFVQNMNNLTLDDDRDTHHVQNTTTHNNNNNNNHTIDEHSSINNGTNPLL
                     LQRSQQEPQHQNITHYQKSPRLSQSHNNNYVNSNDEELPDLLRSPMAQNAQLNSYTMP
                     SMYEQRRQQQQPSSSSMLNYNSNNNNTTTLNNPLLQPVHNRRTSSPLTHEVQINESEE
                     DGFINDIKRKTKMGVYVPPHHRRSFNNSEMKSGNILNQTDSMSKSLGTSNGATLSVSH
                     NTMMFSSGGDDRVSPRGSSIKYDNNNNRIGMLSSSFHKPFIPYHSRNAANDNSNNNNN
                     DNIGDKKKIEEEVKNINVDDGNTTAIQDDDVFANSYNDALIFEDDEDDFVEEYYKNNA
                     NERSMFGPYEIYNDNIQSMQDEDDEDEVEDQDEDDDGDNAVENDVHVRRDHKDLDTLS
                     NKSATTTAAGKRKSSILHEGVVGSLEQYKNNWLMLQQQQD"
     gene            complement(<411874..>412503)
                     /gene="NDAI0C01860"
                     /locus_tag="NDAI_0C01860"
                     /db_xref="GeneID:11496782"
     mRNA            complement(<411874..>412503)
                     /gene="NDAI0C01860"
                     /locus_tag="NDAI_0C01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669042.1"
                     /db_xref="GeneID:11496782"
     CDS             complement(411874..412503)
                     /gene="NDAI0C01860"
                     /locus_tag="NDAI_0C01860"
                     /inference="similar to DNA sequence:INSDC:YHR081W"
                     /note="similar to Saccharomyces cerevisiae LRP1 (YHR081W);
                     ancestral locus Anc_5.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669090.1"
                     /db_xref="GeneID:11496782"
                     /db_xref="UniProtKB/TrEMBL:G0W7T6"
                     /translation="MDQNLELQKIKPFLNNLQKQLNLLNPLLAKLTSKSLDDHLILIN
                     NEPERLELTNKFAYILTSLMFAYIKILNFKDLSNIQYELNRVKDYMQRANSLKNKLME
                     KNNSNEREKSNAKNLIISSLNRNDSAISNQNFQKGKHTKFNEQQSVTTTTNMTSVDNN
                     SIDREAIMNNIVENKKKNKNKNKNKPSSKKQARTEKRTAQKMKNKISKD"
     gene            <413490..>418064
                     /gene="NDAI0C01880"
                     /locus_tag="NDAI_0C01880"
                     /db_xref="GeneID:11496783"
     mRNA            <413490..>418064
                     /gene="NDAI0C01880"
                     /locus_tag="NDAI_0C01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669043.1"
                     /db_xref="GeneID:11496783"
     CDS             413490..418064
                     /gene="NDAI0C01880"
                     /locus_tag="NDAI_0C01880"
                     /inference="similar to DNA sequence:INSDC:YDR326C,YHR080C"
                     /note="similar to Saccharomyces cerevisiae YSP2 (YDR326C)
                     and YHR080C; ancestral locus Anc_5.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669091.1"
                     /db_xref="GeneID:11496783"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G0W7T7"
                     /translation="MSTDKYNKKKHASSSFSKKVLKNIFRPSKRKGKEGTDGYKQTSL
                     QHPNHTKDKLLNHSDRTFSAQVASNPKEKYENNENNLLRNNHISSKAPSSNNNNNNVP
                     IKQSNSKLLNSPFNIPISIDFHNHDHDHDHHRHTRRQKSMQTTQRKNVKKNANYTSSK
                     SRFNNTLKKYRNLSSLPSKINNNLDAGSSILSLPNNSSYNSNSDYNDNNNDEDEDDSD
                     NDTNLLLRTKSSNNNDMTNDWNSKYTVSNKSSTNIKNTTNSNNNGLFDNLWTLAKKKY
                     DNYKNTHVDTTTNTPPISTAVGATSTKKPTSADLMKNLDNVLSSSSRNIAKPRADTTA
                     STTLIHYDKNSQGIRSITSQSTLNGHSLKKTKNTHLHEGQPPTSKIIDTLGKGSLDLD
                     YFNPKILNNDIITEKLTKNADSNARDLLQSKSHDTSDPIISTISTPVYSIPKTNNINK
                     RNSTSSQLTIESSLNHIPSKVNPISKKFKLFSLSNNDVSTQSNKENVPGINNTDSNDL
                     NPKRRQRSKTVCFGATVPPRNSSSSITTVPAKLSSSYSTSNSKRNSHIVSSPHLEDSK
                     LKMQNTSANNLKNNYRNNGKNIMKLPSDSHSQSHSNSMTPINLNPVAMGMKVLPLPHS
                     ALKYSINKVRNSTDIATSLFTPLVLPPRLPSTPTTNNNNNDTNNTNTKTSLNLPSFKP
                     INSNNNSGIDENLDETGNNNNTTIFNDNNNVTSEPTQRLIRNSVMIPRGNDGIKLNDI
                     KFASDKKNSEFHNFFKDTDIQSNEKLITEFTCALSKDILLQGKLYISNKHLAFYSNIL
                     GWITTVVISFQEIIQIKKKTTMGIFPNAIVIDTLNSRYTFASFVQRDTIFKLVTNIWN
                     QYIISNRLQNTSQRHSNSIDDNTSMTDYITDDDEYADDDGDDDNFEYTSDTDVSSDYW
                     VKEDVTQLKGSMKQQLDSDTLGPLKHEPTSSNYSPVSDEKLICETNLNAPLSTIFNIL
                     FGNDTSYFESILQKAKNFDIQPSPLPKLLPSKKREYVYTKPLTSSIGPSKTKCIITET
                     LDNFDLNDYIQVTQLTSNPDVPSGNSFKTKTVFLLSWDSNNTTKFMAYVSIIWTAKSW
                     IKNAIEKGTVDGVTESTNSMISEIKDVILPRIMKRTRGQSTSISSSKPPMVIPSLPTI
                     GPQRHPETKLPTPLEAGTFVLQNGKINVPMGTTYKLLFGEDISFLKKILLKQNNINIS
                     NIPNKFVNEERSYTYIKKLNNSLGPKQTNCNVVESVQHYDLENYILVKQLTKTPDVPS
                     GSTFSVASLIYLTWDKEETSTDINVITNVIWSGKSFLKSAIEKGSIEGQKASMKILVD
                     ELNSIIKENQVEIAKLQSGRGKGKRRKSRARKLSTTNKEDVEETPRVKFDFIIEKFKP
                     IVEVINSLTSILGVSFEPASNKNIIIVASVGIFFLFTLFRILLFGGPNSNIMVQNHKS
                     FKLLPNDKIIIDGNEYIYIPRMKTLYSAYEDDLKGHGGNKENNSIDDIMKSSQQNLWH
                     WITDRGDKHGYPYFKKIKKLRGYSQLTRKV"
     gene            <419452..>423777
                     /gene="NDAI0C01890"
                     /locus_tag="NDAI_0C01890"
                     /db_xref="GeneID:11496784"
     mRNA            <419452..>423777
                     /gene="NDAI0C01890"
                     /locus_tag="NDAI_0C01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669044.1"
                     /db_xref="GeneID:11496784"
     CDS             419452..423777
                     /gene="NDAI0C01890"
                     /locus_tag="NDAI_0C01890"
                     /inference="similar to DNA sequence:INSDC:YHR079C"
                     /note="similar to Saccharomyces cerevisiae IRE1 (YHR079C);
                     ancestral locus Anc_5.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669092.1"
                     /db_xref="GeneID:11496784"
                     /db_xref="GOA:G0W7T8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006567"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR010513"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR018391"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:G0W7T8"
                     /translation="MNCLKRLILASLVLIFQYTHVVCAWKVPLWNKENTSISLPSEEL
                     ISEVTRTSSPKRLTTQTQSPSLDMRFVSYTVRYKQGTKILTSLEPGLYKTHHITRITT
                     VDANYWRTRVLKEGEELLTDESTVSSDEELTTVAEKISPISEVREKNQRQTEDPVPSL
                     IPTSTRTTHRQKGRTRTVKYRGQTLTAYQSEGEDDKAFAARLIKARKIKKIANNRPQS
                     KISEVVVVNTSKTGTPSNKRMIDDYLESSLTKKRTESVILNIPTTKSAVTERSKSRKF
                     IRTPIRSTSKGKTKSTANALQGKLFSSRSSVSTTMEHALKSTSHLIKDLIREKKEHSL
                     RSSTIKSLTVPYMRARTLNDLTLSNILMRPDIEGGLHALDRENGQLLWSIEAEQFQPL
                     LDVVEPSRSTINETLIVEPYGDGNIYYFNVHQGLQKIPVTIRQLILTSPMHLKTNIVI
                     DDMGTIKEDEKIYTGSRKTIMYTIDARNGEIISAYGPGTANKVFRKDKRASCVDEHGE
                     KTSTNKYCKNVIVIGKTIYQLGIHSLDGTEYNITYASWQANSLDVHLNSENKLSKDGI
                     FIAPFRDKSLLAVDADFNIARWISPNFPGIIVGIFDVFVDDQLGENVLVPHPFNSFED
                     TDFNATEKLYLDQTKNHSWFALSYEHFPSLVRAAPISKYETSPKWRVSSIFANENLFK
                     TAIVGVHNLLSSNYEQFNERPVHMVEAQEPQTRKALQLDSSSNDIRIPPENKEPDTVL
                     SREELEEYRVRMQEEITKEIMDKYDFSLVFVVGRFIYRILESGLILLSSLFLLTILQK
                     LHLAPPLYDLLAKMGLLPTPTNEKIELIPSPVEEEIKEIVETKVNVGAPPDDHLNIAF
                     EPSTTSAEYSINSGEEGFEYVGKLASNNPTTEKKKRKRGSRGSKKNKRKGQSSNVEVE
                     RQQTAEEQQISQSQEIDIQGVASPVPQRLSSPILPRISSPIPSRVSSPIPPRASSPVP
                     GQIRSIDGINYEHVLNNLEVSNKILGYGSSGTVVFQGTFQNRPVAVKRMLIDFCDIAS
                     REIKLLTESDDHKNVVRYYCSETTDKFLYIALELCTSTLQDLIEMKNPTDELRRIQKL
                     LDPIDILSQIGAGVAHLHSLKIIHRDIKPQNILVAISKKAAAKNQKDTQQVRVMISDF
                     GLCKKLDAEQSSFRTSLNNPTGTSGWRAPELLEDTAGQILQTLDENNEFHLAHGSHHQ
                     NNSILSSDSFYDPLTKQRLTRAIDIFSMGCVFYYVLSKGNHPFGARYIREGNIIKGRY
                     DLHGLKSTLRDRALRVEAADLIEQMISNDPKRRPSAFAVLQHPVFWLSAKKLEFLLKV
                     SDRFEIERRDPPSPLLLKLESHARVVFPHGDWSHNFDKAFMDNLGKYRKYSASKLMDL
                     LRALRNKYHHFMDLPQDLAQIMGPIPNGFYKYFSRRFPKLLMEVYHLTKDELSDDLML
                     HEFFE"
     gene            complement(<424028..>425518)
                     /gene="NDAI0C01900"
                     /locus_tag="NDAI_0C01900"
                     /db_xref="GeneID:11496785"
     mRNA            complement(<424028..>425518)
                     /gene="NDAI0C01900"
                     /locus_tag="NDAI_0C01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669045.1"
                     /db_xref="GeneID:11496785"
     CDS             complement(424028..425518)
                     /gene="NDAI0C01900"
                     /locus_tag="NDAI_0C01900"
                     /inference="similar to DNA sequence:INSDC:YHR078W"
                     /note="similar to Saccharomyces cerevisiae YHR078W;
                     ancestral locus Anc_5.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669093.1"
                     /db_xref="GeneID:11496785"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:G0W7T9"
                     /translation="MYRTSNKTLVHNGAADSNTFLEKFYTEYCFSSNKIVKYIRVIFS
                     LAIVCYVLTVEIVLWQIKAATIENSSADFVTNFLWPMVSASLALVLILCQPFLILLSL
                     LNKFFNDRFDIDRLVIITTSIMLFLILILVFIDVGPFHYTRNILTKLSIAGVTLMAIL
                     SGIATVTTTYYTFLYVWRKYVIRNKNKSTLVPSVDDRINQRFVIWATDEDIKEKLKIY
                     LYSINENIGRIELLKNQTAIPTTNFERTQLMELVGYYQLEVGSLEALLRKPRNIRLLR
                     QIFEVGFIIYCVYKILNTFLLRIPYMITRRITNPLDPMSADYYDQKGSSDPLAVTFAN
                     ILDIFLFRFNYQHDLDSLTRQISLLLSTSLFICSLSTVNMTISYLLELLPIRLQVLAM
                     FAMQDNETVNELPTYKSKLVHKAPSIIKNLIVSELTGIYVIATTLMVRSNLPFDVSTK
                     LRELLGEKFTVPNVAIDDWFDEIFATSCVLTACFIIFVEKTLKSVK"
     gene            <426180..>429619
                     /gene="NDAI0C01910"
                     /locus_tag="NDAI_0C01910"
                     /db_xref="GeneID:11496786"
     mRNA            join(<426180..426185,426383..>429619)
                     /gene="NDAI0C01910"
                     /locus_tag="NDAI_0C01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669046.1"
                     /db_xref="GeneID:11496786"
     CDS             join(426180..426185,426383..429619)
                     /gene="NDAI0C01910"
                     /locus_tag="NDAI_0C01910"
                     /inference="similar to DNA sequence:INSDC:YHR077C"
                     /note="similar to Saccharomyces cerevisiae NMD2 (YHR077C);
                     ancestral locus Anc_5.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669094.1"
                     /db_xref="GeneID:11496786"
                     /db_xref="GOA:G0W7U0"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR007193"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W7U0"
                     /translation="MDNLRRKELHELNTRAWAGEEVYQLKSQKLDSSIKRNTGFIKKL
                     KKGFVKESTPSLLKELSELSLEKYLSEVIATVNEVLYSISNKNDDIISAVEIISALHQ
                     RFNQRFTCELFQLFLNNFENPTIEKSTEKEELLRITRLKAKTNILTELYLVGVFTSLE
                     NTNSKDALPAYLQRKVRRKEPIIFSVLKENLNYRFKLGYTTILATSFIKRYPMLIENE
                     DTPLDDIIYDTTLKASLQTLFKVFSEAVFTRTKDLNKQINKLTKAHQKCQIRTGKSTD
                     EYSEERDGLVPIFDRFKIASDTFAEFFKIEPLNLENVNDVNESLDEANTAPIVANAGS
                     SIAEKLWENEEVRKFYEVLPSIDEIVEQSKKENKIGTADQINSFFHSLDKIDTKEEID
                     QISIDYWTSGIDNKATRNRLLKFFIETQDWSKIKVYARFLATTNKYLPEVTEEFIKYL
                     DNGFRSQLHSNRINVKNIIFYSEMMKFMLIPSFMIFHKIRSLILNMLIPNNIEILTVF
                     LEHSGKFLINKPELKPQMEKMVQLIQEKKRDRQLNLNTKSALENIMALLYPPSMKSLN
                     VDKKEYTPEQQFFRILIRSELSNIDPRYAIKILRKAHWENPETTRTLFSLFTKPGKIN
                     YQNLPTMAKLLNGLFTYHREFIIKCIDQILENIEGGLETNLYAENRHRVANVKYLTEI
                     FNMEMIKSDVLLAKLYQILQFGHQNGQPNPFSLNELDPPDNYFRIQLTTTALLSLKRF
                     PSTLLKKLKIFLPFFDYYIFTKNQPLPKEVEFRIIESLDNLDTLGKIKFNRSGSLYES
                     AQKLGTLVRKVTPGTKNNKKETSVRGDSMVQVFKNARLQNMSEDKDTGESAGDSEEEE
                     EENDEGIEFPDDSDDEATLNINDDEDTERVRDLHGGSEGEESGENDSSSESNDTDDDN
                     DDSDDGSNEDESDKEEDFRDIDADRNAELKRMYGEYKKKLKAEEERKVEDELEKQFKQ
                     ILQESMETRKTEKSSGGKIPMIGNIPNKQDIIPIATKDNDIARQPAYVSEKPNKVKFT
                     FLARSGKKTQSRQLELPTNIKFVSDVLEEEERLKSEREKIRKIVLQRSFD"
     gene            complement(<429944..>431101)
                     /gene="NDAI0C01920"
                     /locus_tag="NDAI_0C01920"
                     /db_xref="GeneID:11496787"
     mRNA            complement(<429944..>431101)
                     /gene="NDAI0C01920"
                     /locus_tag="NDAI_0C01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669047.1"
                     /db_xref="GeneID:11496787"
     CDS             complement(429944..431101)
                     /gene="NDAI0C01920"
                     /locus_tag="NDAI_0C01920"
                     /inference="similar to DNA sequence:INSDC:YHR076W"
                     /note="similar to Saccharomyces cerevisiae PTC7 (YHR076W);
                     ancestral locus Anc_5.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669095.1"
                     /db_xref="GeneID:11496787"
                     /db_xref="GOA:G0W7U1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:G0W7U1"
                     /translation="MFVSSGLRSLRGASVFSSSMFTRFAIALLLLSLLAHWLLIQFPE
                     SPFHSTSTWKPLFPQLARRKSFFSTSSSSYYSHNNYSNSTNANGSEVSSSPLNYKTFV
                     AYQPKDRDDQIYKNLKDSLMSPTGEDNFFIASIDSNDVYAGVADGVGGWAERNYDSSA
                     ISRELCRAMDQLATATLVSSKNQKYSDVISPKDLMDVAFEKIQNDKIVEVGGTTSIVA
                     HFQKNGTLNVANLGDSWCGVFRNYKLVFQTKFQTVGFNAPYQLSIIPKHLLEEARLKG
                     TSYIRNTPADVDEYSFQLSQNDIVILATDGVTDNISTDDISLFLKDNSEKLSTSKELN
                     AMTKDFVSKVVNLSKDPDYPSVFSQEYSRLTGRLYKGGKEDDITVVLVKVE"
     gene            <431667..>432965
                     /gene="NDAI0C01930"
                     /locus_tag="NDAI_0C01930"
                     /db_xref="GeneID:11496788"
     mRNA            <431667..>432965
                     /gene="NDAI0C01930"
                     /locus_tag="NDAI_0C01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669048.1"
                     /db_xref="GeneID:11496788"
     CDS             431667..432965
                     /gene="NDAI0C01930"
                     /locus_tag="NDAI_0C01930"
                     /note="ancestral locus Anc_5.358a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669096.1"
                     /db_xref="GeneID:11496788"
                     /db_xref="UniProtKB/TrEMBL:G0W7U2"
                     /translation="MSHLPIYTHRAPASTSTSTKIKRLSATDISIREEAEPCELHDRL
                     FCAICQAANEEKMNQVLKRSISYNAVNNVKKRTSITNLHRTLSQTSCYSIGSLQSKQD
                     LTSEPFNEFLDYLVNDNYVSKANLVWENLPKETRDIFVAKAMAKNKHKDQARQIHPDI
                     IELLQSQKQNPHRKVHTSTWRNRKSDYMQLFSDHPKDIPNRRAQNITEILNQFCAYDL
                     TDSEREYIIHKLKARQQKPPEEEEGKRCTNTVEENIFLAHHQFKDKTKDTSVADPYLK
                     EITEKINQLNSIMQRLEKFSPATTPITADADLSLGSTPTSPMFSSGPSTTATTSDHIP
                     IPSSLTSPLQAQASTKVTQKSKLLSHPTRSLGTRTETSSKHHNNTEKKENFFDMLALK
                     SKRFMGRFKHKKPTKLDLYRKPNPDIRVFVNPSANKKQNS"
     gene            <433458..>434681
                     /gene="NDAI0C01940"
                     /locus_tag="NDAI_0C01940"
                     /db_xref="GeneID:11496789"
     mRNA            <433458..>434681
                     /gene="NDAI0C01940"
                     /locus_tag="NDAI_0C01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669049.1"
                     /db_xref="GeneID:11496789"
     CDS             433458..434681
                     /gene="NDAI0C01940"
                     /locus_tag="NDAI_0C01940"
                     /inference="similar to DNA sequence:INSDC:YHR075C"
                     /note="similar to Saccharomyces cerevisiae PPE1 (YHR075C);
                     ancestral locus Anc_5.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669097.1"
                     /db_xref="GeneID:11496789"
                     /db_xref="GOA:G0W7U3"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W7U3"
                     /translation="MSQDLRRKLILKQLDKLNNNEEIPNSNLDTLGQLPSFPKKSISK
                     EKQHTRNLKNDALQLPSWKDFFTKNEVVTLKDRNFQFNTYFTLPTSHKNNSVTYSENL
                     TTSSSTADCTIPIYIFHHGAGSSGLSFANLAKEVYERSSGKCGCFSFDARGHGKTVPI
                     DPTKPISYGREIFVQDFKSLITWFYQTQLIEIFSSKQNEKKHISLILVGHSLGGSICT
                     FVHPSLDKMIRSHVLGVAMFDIVEEAAILALEKVDHFLKNTPNAFNSYEDAIGWYMKH
                     KLSRTKTSAEIAVPSLFAPVEGDTSQVTRITNLKDFSPYWSTWFTDLSHSFVTLPTAK
                     LLILAGDDRLDKELIIGQMQGKYQLVVFQDSGHFIQEDSPMKTALTLLEFWKRNDNTN
                     VIIKSNWGSSTNKNQ"
     gene            complement(<434898..>437042)
                     /gene="NDAI0C01950"
                     /locus_tag="NDAI_0C01950"
                     /db_xref="GeneID:11496790"
     mRNA            complement(<434898..>437042)
                     /gene="NDAI0C01950"
                     /locus_tag="NDAI_0C01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669050.1"
                     /db_xref="GeneID:11496790"
     CDS             complement(434898..437042)
                     /gene="NDAI0C01950"
                     /locus_tag="NDAI_0C01950"
                     /inference="similar to DNA sequence:INSDC:YHR074W"
                     /note="similar to Saccharomyces cerevisiae QNS1 (YHR074W);
                     ancestral locus Anc_5.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669098.1"
                     /db_xref="GeneID:11496790"
                     /db_xref="GOA:G0W7U4"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:G0W7U4"
                     /translation="MSHLITLATCNLNQWALDFEGNRDRILESIRIAKERGARLRVGP
                     ELEITGYGCLDHFLENDLCLHSWEMYAQIIKDPKTHDILLDIGMPVLHKNVRYNCRLL
                     SMDGKILFIRPKIWLANDGNYREMRFFTPWLKPGVVEDFVLPPEIQKVTGQKSVSFGD
                     AVIETLDTCIGAETCEELFTPQSPNIAMSLDGVEIITNSSGSHHELRKLNKRLDLILN
                     ATSRCGGVYLYANQRGCDGDRLYYDGCALIAVNGKVVAQGSQFSLKDVEVVTATVDLE
                     SVRSYRASIMSRGLQASSSELKFKRIDLPVELSPMTSRFNPSLTPTKSRDIFYHIPEE
                     EIALGPACWLWDYLRRCNGTGYFLPLSGGIDSCATAMIVHSMCRLVVKEVSEGNQQVI
                     YDVRKLTRSSDDWIPTDPQELASKFFHTCFMGTENSSIETRTRSKELSRHIGSYHVDL
                     NMDSLVTSVVSLFEVATGKKPIYKIFGGSQTENLALQNIQARLRMVLAYLFAQLLPWV
                     RGIKNAGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIAYASKEYE
                     MPLLQEFLDATPTAELEPTTKDYVQSDEKDMGMTYEELSLFGYLRKVEKCGPYSMFLK
                     LLHEWTPKLTPTQVAEKVKRFFFFYAINRHKQTVITPSYHAEQYSPDDNRFDLRPFLI
                     NPRFTWASKKIDEVVKQCEANNSKELDIMSID"
     gene            complement(<437444..>440368)
                     /gene="NDAI0C01960"
                     /locus_tag="NDAI_0C01960"
                     /db_xref="GeneID:11496791"
     mRNA            complement(<437444..>440368)
                     /gene="NDAI0C01960"
                     /locus_tag="NDAI_0C01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669051.1"
                     /db_xref="GeneID:11496791"
     CDS             complement(437444..440368)
                     /gene="NDAI0C01960"
                     /locus_tag="NDAI_0C01960"
                     /inference="similar to DNA sequence:INSDC:YHR073W"
                     /note="similar to Saccharomyces cerevisiae OSH3 (YHR073W);
                     ancestral locus Anc_5.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669099.1"
                     /db_xref="GeneID:11496791"
                     /db_xref="GOA:G0W7U5"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G0W7U5"
                     /translation="METIDIQNRSFVVRWVKCSKGDVINYQLKPLKKSIELGIYKKHK
                     SNVDSQPAAVHIAQDTKALLDYTNKTLQHRRYSSGFENEHNLNSSHSSLSISNIQQQS
                     QEIPLRDRLAASGFTLVKWVGHIQGNNMMQNVLDVKDNDFYYAFILDNTSSKNVKKKV
                     LFKAGVINDDNQSIISTRSSPILTRPSSNVRMTPTSASSHVKDTLLRVDQGRYLQGYL
                     LKKRRKKLQGFKKRFFTLDFKYGTLSYYLNDHNQTCRGEIVISLSTVSANKKDRLIII
                     DSGMEVWALKATDTKNWQNWVDALQSCFESQKLLDKELERKLCEDDEKMGDKEIEKTA
                     TTQNINASLTENDTFSLSENVDIKTLIENYVPLPDKTYTTFTTNLKLIQQKLESCKND
                     SLSYTYTPSEKEELPLKPMVVRSSSSSSSMFTGNKVRAFEKFNSAMDSSESLISPLNK
                     ENQEISESHELYKRLSELESFVDQFVIQSELLLKDYKHITKHARETSRLSLTSGFSDN
                     DEYFDAIDHISQGVILLEDEEADEVELTTSMSASQMAKVSADMFNQFSKVEEGEEKEQ
                     EKETEENEMEITSNGGKVAQKHIKIVNDLYPLPFSKTVKRRNDVPICKTIPPSLLSFL
                     RKNVGKDLTSIALPVTSNEPITILQMISESFQYASLLTNVVSGPPEFPPITAVTLFAI
                     SFLSVHRDKTRALRKPFNPLLGETYELVQDELGFRLIAEKVSHKPQIFAFHAEHNDWE
                     CNYTVTPTQKFWGKSIELNNEGVFKLKLKATGELFEWEQPTTMLKNLIAGERYVEPIN
                     DFEVISSNGSKAKIDFERTGMFSGRSEAVNVSIMNKEKKEISQVVGKWSESLKDGKTK
                     KILWKPDPLLKDSKKKYGFTQFSANLNEITDIERDMLPPTDSRLRPDVRSYENGDVTK
                     AEALKLELEQKQRERRNKKQDAKPRYFKKDSLNNWKYIEGPNSYWEKRRRQSWEDIAP
                     LW"
     gap             441516..441535
                     /estimated_length=20
     gene            complement(<442137..>444332)
                     /gene="NDAI0C01970"
                     /locus_tag="NDAI_0C01970"
                     /db_xref="GeneID:11496792"
     mRNA            complement(<442137..>444332)
                     /gene="NDAI0C01970"
                     /locus_tag="NDAI_0C01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669052.1"
                     /db_xref="GeneID:11496792"
     CDS             complement(442137..444332)
                     /gene="NDAI0C01970"
                     /locus_tag="NDAI_0C01970"
                     /inference="similar to DNA sequence:INSDC:YHR072W"
                     /note="similar to Saccharomyces cerevisiae ERG7 (YHR072W);
                     ancestral locus Anc_5.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669100.1"
                     /db_xref="GeneID:11496792"
                     /db_xref="GOA:G0W7U6"
                     /db_xref="InterPro:IPR002365"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:G0W7U6"
                     /translation="MANKLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDP
                     QSNFTKWLLQLPDFPTPQYPDNIKDVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPM
                     FMTIGYVAVNYVADIKIPESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYI
                     ILRLLGLDANHPVCMKARDTLLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWL
                     LPYWMPIHPGRWWVHTRGVYLPISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSK
                     HRNTVCGVDLYYPHSKTLDFANSLIVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDY
                     LCIAPVNQAFCALVTLLEEGADSKAFERFQYRFKDALFLGPQGMTVMGTNGVQTWDCA
                     FAIQYLFVAGLAKRPEFYNTISNAYKFLCRSQFDTDCVTGSFRDKRDGAWGFSTKTQG
                     YTVSDCTAESIKAIIMVRNSVIFKDIHDEISDERLYKAVDILLDLQNTGSFEFGSFAT
                     YEKIKAPLFLEALNPAEVFGNIMVEYPYVECTDSSVLGLTSFHKHYNYRKDEISKRIN
                     IAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEALHSVGETYGNSFVVKKGCDFLVAR
                     QLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLALLLAQYPNKNIIDKGIALLKKR
                     QQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLYSQIYEHNANI"
     gene            444932..445024
                     /gene="NDAI0Ctrna2F"
                     /locus_tag="NDAI_0Ctrna2F"
                     /db_xref="GeneID:11496773"
     tRNA            join(444932..444969,444988..445024)
                     /gene="NDAI0Ctrna2F"
                     /locus_tag="NDAI_0Ctrna2F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11496773"
     gene            complement(<445212..>445892)
                     /gene="NDAI0C01980"
                     /locus_tag="NDAI_0C01980"
                     /db_xref="GeneID:11496742"
     mRNA            complement(<445212..>445892)
                     /gene="NDAI0C01980"
                     /locus_tag="NDAI_0C01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669053.1"
                     /db_xref="GeneID:11496742"
     CDS             complement(445212..445892)
                     /gene="NDAI0C01980"
                     /locus_tag="NDAI_0C01980"
                     /inference="similar to DNA sequence:INSDC:YHR071W"
                     /note="similar to Saccharomyces cerevisiae PCL5 (YHR071W);
                     ancestral locus Anc_5.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669101.1"
                     /db_xref="GeneID:11496742"
                     /db_xref="GOA:G0W7U7"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G0W7U7"
                     /translation="MLFFSTSQDNKRANYFAVMRKYLQKKENRDDTKALLDLSQNIKL
                     KPITILSNSKLEYNMSLVDTIAEFLSETVKYLSTKKVPNEKSSIKTYLMEILKRSQSS
                     RNNVIVASFYFQKLYNSVQLNQDPNPEFVHCSKRIFLSCLILSHKFLNDKTFSMKAWS
                     LISGISKRDLSILERWCLMRLNYHLVVDVTEINKWSFTNLKKWDNKKMVSNYSILYNS
                     SKVNKNIC"
     gene            complement(<446632..>448131)
                     /gene="NDAI0C01990"
                     /locus_tag="NDAI_0C01990"
                     /db_xref="GeneID:11496794"
     mRNA            complement(<446632..>448131)
                     /gene="NDAI0C01990"
                     /locus_tag="NDAI_0C01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669054.1"
                     /db_xref="GeneID:11496794"
     CDS             complement(446632..448131)
                     /gene="NDAI0C01990"
                     /locus_tag="NDAI_0C01990"
                     /inference="similar to DNA sequence:INSDC:YHR070W"
                     /note="similar to Saccharomyces cerevisiae TRM5 (YHR070W);
                     ancestral locus Anc_5.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669102.1"
                     /db_xref="GeneID:11496794"
                     /db_xref="GOA:G0W7U8"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR025792"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W7U8"
                     /translation="MFLVNILKKQSRNKLSFIPQLRKMSTGKYDPPINRQMTTLDRSF
                     FIKRIPLCAVKFPDLKNISIFSKKFKGYILRVPRIPHVVKLEQTKDISPDDGKTLACD
                     NGIITKGVLLTDSITKKDDVSSVLSPEAVEFLRETQAEILNYEYLLNYDYWRAEDILR
                     AVLPEDHLEEIPTGFTVTGHIAHLNLRAEFKPFDALIGQVILDKNHKIECVVDKVSSI
                     ATKFRTFPMKVIAGNVDNLIVEQKESNCTFKFDFSKVYWNSRLHTEHDRLVTKYFNMG
                     EVVCDVFAGVGPFAVPAGKKDVIVLANDLNPESFKYLKENITLNKVDQLVKPFNLDGG
                     EFIRESPTLLKRWIDNEENGKIHVNIKPTRKRHKKNEDGTSEPVKLYKEVVIPNEISH
                     FVMNLPDSAIDFLGSFIGLYSSDTTKNKMPWIHVHCFEKYDNDEDLTMEELHSRVYQR
                     ILNSLKTTTVVLPQEALSFHLVRKVSPTKPMFCVSFKLPASIAFASKST"
     gene            <448447..>449541
                     /gene="NDAI0C02000"
                     /locus_tag="NDAI_0C02000"
                     /db_xref="GeneID:11496795"
     mRNA            <448447..>449541
                     /gene="NDAI0C02000"
                     /locus_tag="NDAI_0C02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669055.1"
                     /db_xref="GeneID:11496795"
     CDS             448447..449541
                     /gene="NDAI0C02000"
                     /locus_tag="NDAI_0C02000"
                     /inference="similar to DNA sequence:INSDC:YHR069C"
                     /note="similar to Saccharomyces cerevisiae RRP4 (YHR069C);
                     ancestral locus Anc_5.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669103.1"
                     /db_xref="GeneID:11496795"
                     /db_xref="GOA:G0W7U9"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR025721"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:G0W7U9"
                     /translation="MSGVISVVKRHGDFQYSVDSTNIQNDEDEDISMSDVDIADRKLS
                     KDNDNESGLQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGAVSRVNRLLSVIPLK
                     SRYSPETGDHIVGRVAEVGNKRWRVDIGGKQHAILMLGSVNLPGGILRRKSESDELQM
                     RSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRSKNHTHNL
                     PGNITVVLGVNGFIWLRKTSQMDLVRDAPPGGSTGATSSQRSTAGPTGAVSLNPSITR
                     LEEESSWQIYSDENDPTISSNIRKTICRYANVIKALAFCEIGITQERVISAYEASMAY
                     PNVGSLIERETMESIGHDVLNVEKMRGNAN"
     gene            complement(<449827..>450990)
                     /gene="NDAI0C02010"
                     /locus_tag="NDAI_0C02010"
                     /db_xref="GeneID:11496796"
     mRNA            complement(<449827..>450990)
                     /gene="NDAI0C02010"
                     /locus_tag="NDAI_0C02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669056.1"
                     /db_xref="GeneID:11496796"
     CDS             complement(449827..450990)
                     /gene="NDAI0C02010"
                     /locus_tag="NDAI_0C02010"
                     /inference="similar to DNA sequence:INSDC:YHR068W"
                     /note="similar to Saccharomyces cerevisiae DYS1 (YHR068W);
                     ancestral locus Anc_5.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669104.1"
                     /db_xref="GeneID:11496796"
                     /db_xref="GOA:G0W7V0"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G0W7V0"
                     /translation="MSNINDKLPEILQDAVLKESVPVPDDFVKVEGIDYSKENATDMR
                     ASDLVEAMKRMGFQASSLGKACDIIDNMRSWRGKHIDELEDHDKKGSFDENGFQKTTI
                     FMGYTSNLISSGLRETLRYLVQHKMVDAIVTSAGGIEEDIIKCLAPTYMGEFSLKGSK
                     LRDQGMNRIGNLLVPNDNYCKFEEWIVPILDTMLEEQDAYVKEHGADCLEANQDLNTP
                     IWTPSKFINRIGKEINDETSVLYWAHKNNIPVFCPSLTDGSIGDMLFFHTFKASPKQL
                     RLDIVADIRKINSMSMEASKAGMLILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKVEAESVKVYADVTIVWPLIVAATFANGKPLKNNKD"
     gene            complement(<451272..>452147)
                     /gene="NDAI0C02020"
                     /locus_tag="NDAI_0C02020"
                     /db_xref="GeneID:11496797"
     mRNA            complement(<451272..>452147)
                     /gene="NDAI0C02020"
                     /locus_tag="NDAI_0C02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669057.1"
                     /db_xref="GeneID:11496797"
     CDS             complement(451272..452147)
                     /gene="NDAI0C02020"
                     /locus_tag="NDAI_0C02020"
                     /inference="similar to DNA sequence:INSDC:YHR067W"
                     /note="similar to Saccharomyces cerevisiae HTD2 (YHR067W);
                     ancestral locus Anc_5.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669105.1"
                     /db_xref="GeneID:11496797"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G0W7V1"
                     /translation="MLNTWLLKDKTSRSQIWKFLQLIRPQLPELDINISSLKIGDHLL
                     FFNSLQTTRLDRDGYFTHQTPSSLLNRSELLYTRRLWVQGHITNHNSSIPLDIDGQCI
                     ETIKFVKKKNKDTFVCINRNILMPSVSNKPFITELRTLLYTNTEPSDGKTRLISSNTP
                     SSSKKIGTFRFKREDIISYSYLTSNPHRIHLDSQYSQEIEGYKDIIVQGPFSLQVMLK
                     FADVYFKGTATSIRNVKYKHSSPIYPETKVDILLLDNAEGKYKLWMVPVDSLDKTYLS
                     AEIEVITNTSGPLLL"
     gene            complement(<452495..>454300)
                     /gene="NDAI0C02030"
                     /locus_tag="NDAI_0C02030"
                     /db_xref="GeneID:11496798"
     mRNA            complement(<452495..>454300)
                     /gene="NDAI0C02030"
                     /locus_tag="NDAI_0C02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669058.1"
                     /db_xref="GeneID:11496798"
     CDS             complement(452495..454300)
                     /gene="NDAI0C02030"
                     /locus_tag="NDAI_0C02030"
                     /inference="similar to DNA sequence:INSDC:YDR311W"
                     /note="similar to Saccharomyces cerevisiae TFB1 (YDR311W);
                     ancestral locus Anc_5.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669106.1"
                     /db_xref="GeneID:11496798"
                     /db_xref="GOA:G0W7V2"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="InterPro:IPR027079"
                     /db_xref="UniProtKB/TrEMBL:G0W7V2"
                     /translation="MSHSGAATFKKVSGIITINEDASPAELIWRSTDGDKTHTIILDG
                     IDKLQATPVTSEKMMLRLMSKVDENKKVKDNEGNEAPPKPQTHMFSFNNRTVMDNIKT
                     TLQLIISRYKDDELYEEKRKSDMANEKQISAPLINTAKLDDSLSKAKLLTNLKLQQSL
                     LKNNKNLMKTFQETVIHSGLLADEFWSTRIPLLRAFALSTSQKIGPYNVLSTIKPVAS
                     SENKVNVNLSREKIYSIFENYPIVKKAYDDNVPKNFKEPEFWARFFSSKLFRKLRGEK
                     IMQNDRGDVIIDRYLTLDQEYDRQDDIKLTHPVQKFIDIDGNKQDDPVKFGNKPDFTM
                     QPGVDINGNNDGTVDILKGMNRLSEKMVMALETEYSRSTLQQEDPEKEERENLEIHDL
                     NATYHADYALVHLKTRRDKETSSSTNDGDVVNKKGAFDSDAVKQEISTVLNSLINTLD
                     LSKMIPDDSTSSEISKRINSAVKTNAKQAKHNTVDSLMGAFVGNRTDEIEASSTIPPD
                     LLESCRILHSTCCEFLKHFYIHFQSGLAKRASTVKKLYNNLKDCMDKLKELFHDVRQG
                     DSQEMAETCEAYLNPILHSITTAIKKYDSLLEQAS"
     gene            complement(<454614..>455534)
                     /gene="NDAI0C02040"
                     /locus_tag="NDAI_0C02040"
                     /db_xref="GeneID:11496799"
     mRNA            complement(<454614..>455534)
                     /gene="NDAI0C02040"
                     /locus_tag="NDAI_0C02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669059.1"
                     /db_xref="GeneID:11496799"
     CDS             complement(454614..455534)
                     /gene="NDAI0C02040"
                     /locus_tag="NDAI_0C02040"
                     /inference="similar to DNA sequence:INSDC:YDR280W"
                     /note="similar to Saccharomyces cerevisiae RRP45
                     (YDR280W); ancestral locus Anc_5.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669107.1"
                     /db_xref="GeneID:11496799"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0W7V3"
                     /translation="MAKEIEISNSESKFLLEALRQNYRLDGRSFSQFRDVKIAFGDEY
                     GDVTIEMGKTKVHCRISCQITQPYEDRPFEGLFLISTENSPMAGPQFENGNNTNEDEV
                     LIARIIEKAVRRSGALDIEGLCIVAGSKCWAVRADVHFLNCDGGFIDASCIAVMAGLL
                     HFRKPDITVHGEQVIMHPVDEREPVPLGILHVPICVTFSFFNPMDTEENIKGDTNAEI
                     TIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALSLMECCRKAYAITEEIT
                     DKITYVLKKDEKRRNKFADLLTSENARETS"
     gene            complement(<455844..>456713)
                     /gene="NDAI0C02050"
                     /locus_tag="NDAI_0C02050"
                     /db_xref="GeneID:11496800"
     mRNA            complement(<455844..>456713)
                     /gene="NDAI0C02050"
                     /locus_tag="NDAI_0C02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669060.1"
                     /db_xref="GeneID:11496800"
     CDS             complement(455844..456713)
                     /gene="NDAI0C02050"
                     /locus_tag="NDAI_0C02050"
                     /inference="similar to DNA sequence:INSDC:YHR062C"
                     /note="similar to Saccharomyces cerevisiae RPP1 (YHR062C);
                     ancestral locus Anc_5.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669108.1"
                     /db_xref="GeneID:11496800"
                     /db_xref="GOA:G0W7V4"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:G0W7V4"
                     /translation="MLVDLNVEWPQKSFKESIKPEDLERLRATLSTLYTLGYTHTALN
                     FTVNHSDKFPNNVKDMNPMNIQELFGDFMKETGMKIYSRITLVIDDPSNGQSLSKISQ
                     AFDIIAALPISERGLTLATTNLEIDLLTFNYGQRLPTFLKHKSICSCVNRGVKVEVVY
                     SHALRDIQSRRQYVQNVRSVIRSSRSRGIVISSGAQNSLECRNILGVSSLIKLLGLES
                     DKCTKAMGQLASLVLLNGRLRNKSYKQTVAIGGGDSDVVNDLEGIDDNKNIKIVKRSL
                     SPAEDKSGKKRKL"
     gene            complement(<457476..>459974)
                     /gene="NDAI0C02060"
                     /locus_tag="NDAI_0C02060"
                     /db_xref="GeneID:11496801"
     mRNA            complement(<457476..>459974)
                     /gene="NDAI0C02060"
                     /locus_tag="NDAI_0C02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669061.1"
                     /db_xref="GeneID:11496801"
     CDS             complement(457476..459974)
                     /gene="NDAI0C02060"
                     /locus_tag="NDAI_0C02060"
                     /inference="similar to DNA sequence:INSDC:YDR310C"
                     /note="similar to Saccharomyces cerevisiae SUM1 (YDR310C);
                     ancestral locus Anc_5.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669109.1"
                     /db_xref="GeneID:11496801"
                     /db_xref="UniProtKB/TrEMBL:G0W7V5"
                     /translation="MVDASGTHAVETESKPNLSSMSNACGRNGISAVAMPIALADLPI
                     QSQMSVLNKKLDIISKRCDRIEGMIFTRDDTTLSSVNDLFTIVQTLLNTQAILEEEMN
                     NLQETKTKIDMRAIKRLEKIYTELPASNSEAKQNNQDNKQQYMDSNGEANEIDKRASN
                     TNANITMDANHTTESEISDESIEVLGEQSPLHSTIIPTTINLSENALTPGTKMLVGTN
                     CAQCLKAKTPSFISNGSDIFRNTTSANEGSERQGCSVPSENISESSPGTDNKTSTQSK
                     NTSPRSIKEVALSSNQQLYYEKLKEKWASNSKIERKVTQEAPSVSEKKANNVRGLDSI
                     NKQYKAPTSREHSNGIAGSQISNDSKTVPSVLTGCNNSTTTSTSTYSKVAENESIQAS
                     PVMGSVLKEDESAAFEGEEIMNLPTIAAQRASHLHDKEASSPKRTKELILTIPKVNKA
                     PLFEEKFGEETGKSPDKNVPTILTFNTNHLDGKNLTVKLQAKAKEINEEEKKILKNIN
                     FQQLKRITVKYKDETKVIIPINTTSKSRPSMKESSPTQYCPPLKEASPSRQSKSPSPL
                     SVKDKLVSPKKGLIPSQLPSYTEKPLITWRKQEVPPERELFTFDGRYYVDKESKKMVT
                     ASTFVDTHYTWLKKTAKPSTQKDKITTVPMSAMIRDESLDATHVLGKCIMDKHYLHTL
                     EFFFLEFIWEDRLIQLGLEVEDDPKTVNFHYLLFSTIVHWRDAARKERGLESYTILHA
                     VKELEHFRLALKKSVSWFYRNTILVEDLLNTYLEQPDVNWMYSDKQALPILNRDGLNE
                     NNINEALESALGITKANDRSKISKGKSSHPLLQT"
     gene            complement(<461938..>463077)
                     /gene="NDAI0C02070"
                     /locus_tag="NDAI_0C02070"
                     /db_xref="GeneID:11496802"
     mRNA            complement(<461938..>463077)
                     /gene="NDAI0C02070"
                     /locus_tag="NDAI_0C02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669062.1"
                     /db_xref="GeneID:11496802"
     CDS             complement(461938..463077)
                     /gene="NDAI0C02070"
                     /locus_tag="NDAI_0C02070"
                     /inference="similar to DNA sequence:INSDC:YHR063C"
                     /note="similar to Saccharomyces cerevisiae PAN5 (YHR063C);
                     ancestral locus Anc_5.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669110.1"
                     /db_xref="GeneID:11496802"
                     /db_xref="GOA:G0W7V6"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W7V6"
                     /translation="MTVAKRPIIHILGLGSMGTVLAVDLIRFTNALVIPLFRSKEKLD
                     KFQIEGHSKISIRKLYEEKKPLVECKVEEAQCPETFNSGIIENLVITTKTYQTKEALA
                     PYLKYINSHTNLILIQNGLGVLEVLKDEVFVNKSERPQLFQGVISHGVYQESGFTYAH
                     AGWAGMKVARLPWNDDEMIQTNSLVKRDYAENELVNLLMSQTFAKEFGMEHMSYQEML
                     LGQLFKFLVNCCMNPVTAIVDCVNGEMVDYCAPVFRSIIDECLTVLRVAYKPLFAYEN
                     QYKGNEDYVSLTVDSILNTEHMVKEVIRIGCDINERNSSSMRQDTLYLRDTEIDYING
                     YVVDLAKKYEMGAAAANVNKTISELVNLRLGLNRTRAQQGDWRQQ"
     gene            complement(<465066..>466694)
                     /gene="NDAI0C02080"
                     /locus_tag="NDAI_0C02080"
                     /db_xref="GeneID:11496803"
     mRNA            complement(<465066..>466694)
                     /gene="NDAI0C02080"
                     /locus_tag="NDAI_0C02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669063.1"
                     /db_xref="GeneID:11496803"
     CDS             complement(465066..466694)
                     /gene="NDAI0C02080"
                     /locus_tag="NDAI_0C02080"
                     /inference="similar to DNA sequence:INSDC:YHR064C"
                     /note="similar to Saccharomyces cerevisiae SSZ1 (YHR064C);
                     ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669111.1"
                     /db_xref="GeneID:11496803"
                     /db_xref="GOA:G0W7V7"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:G0W7V7"
                     /translation="MSSPVIGISFGNTSSSIAYINPKNDVDVIANPDGERAIPSVLSY
                     VGEDEYHGGQALQQLVRNPTNTIINFRDFIGLPFDQCDISRCANSAPAVEIDGKVGFV
                     IAKGEGKEEKLTVDEVVSRHLNRLKLAAEDYIGQKVNQAVLTVPTNFTTEQKDALSTA
                     ADKVGLKIVQFINEPSAALLAHIEQFPSEKDCNVVVADFGGVRSDAAVFAIRGGIFTI
                     LATAHDNTLGGDNLDAELIEYFAKDFQTKTKTNPRKNARSLAKLRINSIVTKKTLSNA
                     TTATISIDSLADGFDYHTSINRMRYELVASKVFGKFGEFINSTIKKANLDPLDIDAVL
                     LAGGVSFSPKLATNLEYTLPESVEILGPSNANASNYPNELAASGAALQARLVADYDED
                     ELKEALQPIIVNTLHLQKPIGLVDSEGNFVPILLAETSYPVQKKITLKKASGDLLIGV
                     YEGDSTIEERTVDPAEKKANEEADEDESEWSDEDDEPEVIREKKYTLSTKLMELGIKG
                     VKSGLELVFNINKDGKLTVSARDLKTNQVVKGEL"
     gene            <467994..>468728
                     /gene="NDAI0C02090"
                     /locus_tag="NDAI_0C02090"
                     /db_xref="GeneID:11496804"
     mRNA            <467994..>468728
                     /gene="NDAI0C02090"
                     /locus_tag="NDAI_0C02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669064.1"
                     /db_xref="GeneID:11496804"
     CDS             467994..468728
                     /gene="NDAI0C02090"
                     /locus_tag="NDAI_0C02090"
                     /inference="similar to DNA sequence:INSDC:YHR044C"
                     /note="similar to Saccharomyces cerevisiae DOG1 (YHR044C);
                     ancestral locus Anc_5.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669112.1"
                     /db_xref="GeneID:11496804"
                     /db_xref="GOA:G0W7V8"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W7V8"
                     /translation="MASFTVDFCLFDLDGTIVSTTVAAESAWKKLCAEYDVDPEKLFK
                     YSHGARSNEIMARFFPKLDNSDNKAVKELELSMAYDYLDTVQLIPGSKDLLISLDKET
                     GSAKEVGQRKWAIVTSGSPYLAYSWFDTILKEIGKPDTFITGFDVKNGKPDPEGYAKA
                     RDQLCETLKLDKEKARYVVFEDAPVGITAGKKIGAITVGITSTYDKEVLFDAGADFVV
                     EDLTHVTVNKNNSDGIIIEIFDPVRE"
     gene            <469403..>470152
                     /gene="NDAI0C02100"
                     /locus_tag="NDAI_0C02100"
                     /db_xref="GeneID:11496805"
     mRNA            <469403..>470152
                     /gene="NDAI0C02100"
                     /locus_tag="NDAI_0C02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669065.1"
                     /db_xref="GeneID:11496805"
     CDS             469403..470152
                     /gene="NDAI0C02100"
                     /locus_tag="NDAI_0C02100"
                     /inference="similar to DNA sequence:INSDC:YHR043C"
                     /note="similar to Saccharomyces cerevisiae DOG2 (YHR043C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669113.1"
                     /db_xref="GeneID:11496805"
                     /db_xref="GOA:G0W7V9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G0W7V9"
                     /translation="MTQDRNSNKVKVDFCLFDLDGTLVNTIKASEAVWRNLCKEYGVN
                     PEELFKHSHGSKTGEILEKFFPALDNTDNKAVRDLEISMGRDYLDSVFAVPGAKDLLQ
                     QLNIPSPDTTERKWAIVTSGSHYIAFGWFKSILGDIEKPDVFITAFDVKTGKPDPEGY
                     AKARDQLAEKTCLKTATDQIKTIVFEDAPVGILAGKAMGALTIGITTTFPKDVLFNAG
                     ADFVVEDLTHVKMLKNDQNGIVLEINDSLSR"
     gene            complement(<470438..>472552)
                     /gene="NDAI0C02110"
                     /locus_tag="NDAI_0C02110"
                     /db_xref="GeneID:11496625"
     mRNA            complement(<470438..>472552)
                     /gene="NDAI0C02110"
                     /locus_tag="NDAI_0C02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669066.1"
                     /db_xref="GeneID:11496625"
     CDS             complement(470438..472552)
                     /gene="NDAI0C02110"
                     /locus_tag="NDAI_0C02110"
                     /inference="similar to DNA sequence:INSDC:YHR042W"
                     /note="similar to Saccharomyces cerevisiae NCP1 (YHR042W);
                     ancestral locus Anc_5.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669114.1"
                     /db_xref="GeneID:11496625"
                     /db_xref="GOA:G0W7W0"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G0W7W0"
                     /translation="MDTIDVIVFLALLFGVALYLHRATIKDLFFSNDDELKAINSSGS
                     RDLLQVLKEMNKNYLVLYASQTGTAEDYAKKFSKELISKFGLKVMCADIESYDYDSLF
                     QLPSNIVISFFISTYGEGDFPDGSFSFEQFLTTQIDDEDNSLTNLQFTMFGLGNSTYE
                     FFNGAAKKAVKYLKGANANLLGPFGEADDGSGTTDEDYISWTESVLEALKTVLNLDEH
                     DQTFEPSFKYEILNEINDTVSLGEPSLQYLPINAGKQNGISFNEEGIQVGPFDQTHPY
                     IAPITFSKELIKQIGDSKLDRNCVHAEIDISGSNLKYSTGDHVAFWPSNAIEKVNQFL
                     SIFNLDGDLIFNLTPLDNTVKAPFLTPTTIRTAISHYLEITGPISRQFISQLVQFAPN
                     ESIKEKLITLSKDKLKFAQEITFKNYNIADALVYLSDDAKDVKWDSVPWNFLIETLPR
                     LQPRYYSISSSSLSERQTVHITAIVEDSINELTNERTLGVTTNLLRNIERVQNSNNAD
                     AELLPVHYDLDGPRNLYQHFKLPIHIRRSTFKLPSNPKTPVIMIGPGTGIAPFRGFIR
                     ERVKFMENNPDNIKLGKHLLFYGSRNENDFLYKEEWPQYASKLGDSFEMIVAHSRIGD
                     KKVYVQHKVKEYGEEIFKLLNDQSVGGAFIYVCGDAKGMAQDVQTTIVEILAHYQDIS
                     IVDALEIVKAMKTTGRYQEDVW"
     gene            <473150..>473869
                     /gene="NDAI0C02120"
                     /locus_tag="NDAI_0C02120"
                     /db_xref="GeneID:11496626"
     mRNA            <473150..>473869
                     /gene="NDAI0C02120"
                     /locus_tag="NDAI_0C02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669067.1"
                     /db_xref="GeneID:11496626"
     CDS             473150..473869
                     /gene="NDAI0C02120"
                     /locus_tag="NDAI_0C02120"
                     /inference="similar to DNA sequence:INSDC:YHR041C"
                     /note="similar to Saccharomyces cerevisiae SRB2 (YHR041C);
                     ancestral locus Anc_5.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669115.1"
                     /db_xref="GeneID:11496626"
                     /db_xref="GOA:G0W7W1"
                     /db_xref="InterPro:IPR013921"
                     /db_xref="UniProtKB/TrEMBL:G0W7W1"
                     /translation="MERATPATLTEFKDELSNTLLNILDTWSIDFKTYRSTTSGTSTA
                     IQESNSNSKLMYSITLSHQNNKTVLIKNDTKIAMIMAASKNEIPTELISNGCISDTNP
                     IPIDVLLNNKLSNLWTQRQSIKGTGGETFQTTNKLLIRVINLFSSTGFKGLLIECEDQ
                     STDGITNGSQVFHTNNKITFQEKIQTITNILTKLSTPTSVKAPTTTTTTDYKISMDSL
                     NLDHSDYLGDLGYQYVRVLEF"
     gene            <474067..>474572
                     /gene="NDAI0C02130"
                     /locus_tag="NDAI_0C02130"
                     /db_xref="GeneID:11496627"
     mRNA            join(<474067..474069,474222..>474572)
                     /gene="NDAI0C02130"
                     /locus_tag="NDAI_0C02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669068.1"
                     /db_xref="GeneID:11496627"
     CDS             join(474067..474069,474222..474572)
                     /gene="NDAI0C02130"
                     /locus_tag="NDAI_0C02130"
                     /inference="similar to DNA sequence:INSDC:YHR039C-A"
                     /note="similar to Saccharomyces cerevisiae VMA10
                     (YHR039C-A); ancestral locus Anc_5.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669116.1"
                     /db_xref="GeneID:11496627"
                     /db_xref="GOA:G0W7W2"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:G0W7W2"
                     /translation="MSQSTNGIATLLQAEREAHDIVSKARKYRQDKLKQAKADAATEI
                     NNYKLQKDNELKQFESQNEGGVDSLEKEASSKVQTELDEIKEIAFQKKQDVINLLIEA
                     VTKPSAEVHVNAAIA"
     gene            <475031..>477034
                     /gene="NDAI0C02140"
                     /locus_tag="NDAI_0C02140"
                     /db_xref="GeneID:11496628"
     mRNA            <475031..>477034
                     /gene="NDAI0C02140"
                     /locus_tag="NDAI_0C02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669069.1"
                     /db_xref="GeneID:11496628"
     CDS             475031..477034
                     /gene="NDAI0C02140"
                     /locus_tag="NDAI_0C02140"
                     /inference="similar to DNA sequence:INSDC:YHR039C"
                     /note="similar to Saccharomyces cerevisiae MSC7 (YHR039C);
                     ancestral locus Anc_5.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669117.1"
                     /db_xref="GeneID:11496628"
                     /db_xref="GOA:G0W7W3"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:G0W7W3"
                     /translation="MTNIYLNPDMLYHINSTVQYYITEWFKQQQLQFENDPRNSNYIY
                     RIVQYFSESSTTTLILTFVSLIFFYKWLFNQFTPNGKIKPARFTIPIPDAVRPNWKSK
                     RLLNPSITIEQDSTIIQSYCPATGQLLGQFKSMTKSQLDEQIEQAERAQIEFGNSSMD
                     RRFKILLTLHDFIINNQDLITKIACRDSGKTKLDASMGEILVTLEKISWLLKHSSRIL
                     SPSKRSGPTNFFMKWYKKAEIRYEPLGVVAGIVSWNYPFHNLLGPIIDSIVTGNAIIM
                     KCSEQVVWSSEIFIDLVKKALIACDEEPNLVQLFYCLPPSPNSNDDTANYFTSRPQFK
                     SLTFIGSQPIAKQILKCTADPITPVVVELGGKDSLIVLDSFASSDLQSLSSIIMRGTF
                     QSSGQNCIGIERIIVSAKHYEKLTQILSDRITFFPLRQGSDIDSQSSSSSSSSRPNPL
                     DIIDMGAMISNNRFKQLEELVQDAVSKGAKLIYGGTPYVHPNYPQGHYFKPTLLIDVT
                     PEMNIAQQEVFGPIMCVMKARDTNDCVSLANSAPFGLGGSVFGKDLDECNYVANQLKT
                     GNVAINDFATFYVCQLPFGGIHGSGYGKFGGEEGLLRLCNAKSVCYDRFSFIKTQIPP
                     PLDYPIKNDKKSWNFVKSFITGSYTTSKWQLIKSLLSLAKESK"
     gene            complement(<477215..>477931)
                     /gene="NDAI0C02150"
                     /locus_tag="NDAI_0C02150"
                     /db_xref="GeneID:11496629"
     mRNA            complement(<477215..>477931)
                     /gene="NDAI0C02150"
                     /locus_tag="NDAI_0C02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669070.1"
                     /db_xref="GeneID:11496629"
     CDS             complement(477215..477931)
                     /gene="NDAI0C02150"
                     /locus_tag="NDAI_0C02150"
                     /inference="similar to DNA sequence:INSDC:YHR038W"
                     /note="similar to Saccharomyces cerevisiae RRF1 (YHR038W);
                     ancestral locus Anc_5.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669118.1"
                     /db_xref="GeneID:11496629"
                     /db_xref="GOA:G0W7W4"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="UniProtKB/TrEMBL:G0W7W4"
                     /translation="MMILSRVIRLPVLKRATFLTRSFTVTPFYLKKHNNTSKGKSKLT
                     KDIGLNANSPTGTANDDIDLLEEAKTHFDKTLELHQKKINETRQGKSNSKIFDKLILP
                     NGSKFIDVATTSSKGSHSLLITVFDPKDTKNVISTILGSGLNLNPERIPNNDQQLKVL
                     LPPMTTETRELIIKEMKKNFEEYKSSSLKVSLGFIRNNILKKLKAIQKKNDSDRKLIA
                     DIEKLHKEYVVKLQEQFKNS"
     gap             478408..478427
                     /estimated_length=20
     gene            complement(<479239..>480252)
                     /gene="NDAI0C02160"
                     /locus_tag="NDAI_0C02160"
                     /db_xref="GeneID:11496630"
     mRNA            complement(<479239..>480252)
                     /gene="NDAI0C02160"
                     /locus_tag="NDAI_0C02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669071.1"
                     /db_xref="GeneID:11496630"
     CDS             complement(479239..480252)
                     /gene="NDAI0C02160"
                     /locus_tag="NDAI_0C02160"
                     /inference="similar to DNA sequence:INSDC:YDR297W"
                     /note="similar to Saccharomyces cerevisiae SUR2 (YDR297W);
                     ancestral locus Anc_5.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669119.1"
                     /db_xref="GeneID:11496630"
                     /db_xref="GOA:G0W7W5"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G0W7W5"
                     /translation="MSEYVSETVTGAVKDSVNDVIRETLPLISTTRDSIFASMSDDVL
                     ALISPVISYWTFSGMFFILDHMKSAQRFKIHSLEEAEKRNRATKTHVLTHVLFQHMLQ
                     TAFGYLLIVTMDSTGTHHISQRPFYIAYAISFIKLAIAFLIIDTWQYWLHRLMHYDKR
                     LYKNLHSVHHELYVPYAFGALFNSPLEGFLLDTLGTGIAMLITNLSAREQIILYNFAT
                     MKTVDDHCGYVLPWDPFQVLFKNNSIYHDIHHQPFGLKYNFAQPFFIFWDNLLDSNFK
                     DFNIQDPNIQIPDNEKSFLKNKLDINKYHYFLKNRKSLKNKSKEEIEIEQEIESANSK
                     KAN"
     gene            <481293..>483272
                     /gene="NDAI0C02170"
                     /locus_tag="NDAI_0C02170"
                     /db_xref="GeneID:11496631"
     mRNA            <481293..>483272
                     /gene="NDAI0C02170"
                     /locus_tag="NDAI_0C02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669072.1"
                     /db_xref="GeneID:11496631"
     CDS             481293..483272
                     /gene="NDAI0C02170"
                     /locus_tag="NDAI_0C02170"
                     /inference="similar to DNA sequence:INSDC:YHR035W"
                     /note="similar to Saccharomyces cerevisiae YHR035W;
                     ancestral locus Anc_5.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669120.1"
                     /db_xref="GeneID:11496631"
                     /db_xref="GOA:G0W7W6"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="UniProtKB/TrEMBL:G0W7W6"
                     /translation="MNISKTNSTTFHCLFKPFAEKLDFELEPNNDSIPISEKNNDSIN
                     PLKCDHCDAFFNQYSSIIQPSSLRCPFCEKITPIQSSFTKYATDTIHLSSYVLDKGII
                     PSSKSFLTVFVIDTICDKQELNALKENLIKNLENYSEKNGNNLNENMHLYALISTNSD
                     GTIKIHYSNKKDSIVFSMDSFKTKYYSERFNFRYFIDKITMNNQLCYFQNIRDLIKEL
                     NSLEITSSITTRTKRPKRSFGLALFLATVLVTKLQCSQDTDWNNSMIISFLTGPCTKG
                     PGKVLSRDYKINMRQFNNFNGNKNNSIISDLKSSKKFYDKLFRHSFGKVAHHLYISSL
                     DQVGFLEMSSLYKDSACVQQFDTFTGSRFMICLKKNFELMRNDNVIYNLQMKTLKVPH
                     ITKLKLFNDKLLTTTLIPSSLTIPLEIITRDVSSNTSSEEPIIQFQITFEKNNRRYLK
                     IVTIPLVMNNESKIQDNNNNNDDIGSLEIELYYFLKSLSFILLHSTNPLQLYKPNFLI
                     ENIHPAIVNQFNTLSFSSYYKYILNSPFFNSEGISPDERTFFINLCSNSNINMISKLL
                     KPKLYNIENQGTRMVELNFDKESLILCKNKNENILVDGGNFIGIIRNSTDKVNPYDSI
                     LDKIRNERFPTPRVIHFTDGLSGPQDRYLKCKLVL"
     gene            <483706..>485361
                     /gene="NDAI0C02180"
                     /locus_tag="NDAI_0C02180"
                     /db_xref="GeneID:11496632"
     mRNA            <483706..>485361
                     /gene="NDAI0C02180"
                     /locus_tag="NDAI_0C02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669073.1"
                     /db_xref="GeneID:11496632"
     CDS             483706..485361
                     /gene="NDAI0C02180"
                     /locus_tag="NDAI_0C02180"
                     /inference="similar to DNA sequence:INSDC:YHR036W"
                     /note="similar to Saccharomyces cerevisiae BRL1 (YHR036W);
                     ancestral locus Anc_5.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669121.1"
                     /db_xref="GeneID:11496632"
                     /db_xref="GOA:G0W7W7"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:G0W7W7"
                     /translation="MEVFSRLSLDDNDTNRTITNEDNNETTKELVGISNLSLNDSHMN
                     MNMNTHQDIHSDINSLPPSVIKTYLPHFPNYPSPLRNTFQFYDSMGDSYEMDIDDDIE
                     ENDAQETEQESRRINGTPVATTSSSSGVQFNGNNFKVPIKKKKASVHFVEPKRNFARR
                     NNETPHTDKENNDEEANDDDELSGAEEEEGEDEEKNNKLSNTTMLKALLSPTKLGVAA
                     ATKIDGITHLPIEEEKKRAEGDPNVSEAIEAIGNEPVPAHSSSSSMSSSFDIESTERL
                     KEELRLRQSNGQPINVSINNHNYYYPNGEAFPLTERYPPMKHGAMSAYYNNAKYYNAQ
                     GDDDNDATDDNKYILPHPWSNNSHPIWKVSYTIISYLQILLNFITTMIIISSLIIFIN
                     SIRNDLNSIWTTRKNELEIESKICKEKYFLNRCHLHSKLPALETQCATWSDCMNRNND
                     IFFRARSILTAKLVGDIINSFIDPIGWKPLFVILFGLAIWCFSSNFLLGFARAKIYYG
                     DPVKYYHHQKQQQQGQDQGQKSQEREHNQTRHSSDQPLVVRKM"
     gene            <485944..>487707
                     /gene="NDAI0C02190"
                     /locus_tag="NDAI_0C02190"
                     /db_xref="GeneID:11496633"
     mRNA            <485944..>487707
                     /gene="NDAI0C02190"
                     /locus_tag="NDAI_0C02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669074.1"
                     /db_xref="GeneID:11496633"
     CDS             485944..487707
                     /gene="NDAI0C02190"
                     /locus_tag="NDAI_0C02190"
                     /inference="similar to DNA sequence:INSDC:YHR037W"
                     /note="similar to Saccharomyces cerevisiae PUT2 (YHR037W);
                     ancestral locus Anc_5.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669122.1"
                     /db_xref="GeneID:11496633"
                     /db_xref="GOA:G0W7W8"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G0W7W8"
                     /translation="MLSLTKTARQTALMRSSVPSLRGSVRSLSQFGTVKPPVHIKNEP
                     VKPFGSNDTKDWDLLRASLMKFKSSSLEIPLIINGERIYYNNSKRSFYEQRNPADHKE
                     ILANVTQATDLDVKDAINAATLAKQKWYQLSFYDRAAIFLKAADLISTKYRYDMLAAT
                     MLGQGKNVYQAEIDCITELSDFFRFNVKYAHKLYKKQPIQSATGVWNKAEYRPLEGFV
                     YAVSPFNFTAIAANLIGAPALMGNTVVWKPSQSATLSNYLLLTVLEEAGLPKGVINFI
                     PGDPESITNEVLNDKNFGALHFTGSTNVFKQLYGKIQNGIMDGKYKDYPRIVGETGGK
                     NFHLVHQNCNLTNAIFSTIRGAFEYQGQKCSATSRLYLPSSKSEEFLNDFANILKQGN
                     MIPVNTAAGTISGGDLHGFMGPVIHEQSFNKLVKVIEDAKEDPDLEIVYGGQYDKSKG
                     WFVGPTVIKCKDPKHKYMTTEFFGPILTVYEYPDGEFSQVCDLVNETSIYGLTGSIFA
                     KDRDIINLADEKLKFAAGNFYINDKCTGAVVAQQWFGGARMSGTNDKSGGENILSRFV
                     SIRNTKENFLEINDFKYPSNY"
     gene            <488266..>489459
                     /gene="NDAI0C02200"
                     /locus_tag="NDAI_0C02200"
                     /db_xref="GeneID:11496634"
     mRNA            <488266..>489459
                     /gene="NDAI0C02200"
                     /locus_tag="NDAI_0C02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669075.1"
                     /db_xref="GeneID:11496634"
     CDS             488266..489459
                     /gene="NDAI0C02200"
                     /locus_tag="NDAI_0C02200"
                     /inference="similar to DNA sequence:INSDC:YHR034C"
                     /note="similar to Saccharomyces cerevisiae PIH1 (YHR034C);
                     ancestral locus Anc_5.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669123.1"
                     /db_xref="GeneID:11496634"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:G0W7W9"
                     /translation="MDFILRPVTTRTTSGSTKNGNTDCSDENKIISLKPVPKFVIKSK
                     ILSSSIDPVSKPFAVSNNKNKFIPNKKIFINVCYNDAIPKPSIDFSPNIVYPLIMSDK
                     WEIPILTSSCRLDCDKKKDTCYVWDCIINTECLKWCLDDLQLREILIEWCLESVEISD
                     NLSINRDTISLPKLKFKKNNLNVKTNEGDDDDGIPVMEVPWKELNKDFEKEIEKIIED
                     DKIDNPLKVLKLQRFHDIDDADHLNVNDQDENGLPPLFPNKMNESIGQDTKTKPLIEE
                     VEISKLKIDNDVSRSNKSDEIRLSKDIKEKVKPDFEVTMRRTKDTTKYKLRIEIKSEL
                     KSSLDIKIEYFKDDNELIVENLDLVEFKEEKIKIPLPNIFDIKNVMECKCFFIKRDRL
                     LVIYI"
     gene            complement(<489614..>491278)
                     /gene="NDAI0C02210"
                     /locus_tag="NDAI_0C02210"
                     /db_xref="GeneID:11496635"
     mRNA            complement(<489614..>491278)
                     /gene="NDAI0C02210"
                     /locus_tag="NDAI_0C02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669076.1"
                     /db_xref="GeneID:11496635"
     CDS             complement(489614..491278)
                     /gene="NDAI0C02210"
                     /locus_tag="NDAI_0C02210"
                     /inference="similar to DNA sequence:INSDC:YDR300C,YHR033W"
                     /note="similar to Saccharomyces cerevisiae PRO1 (YDR300C)
                     and YHR033W; ancestral locus Anc_5.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669124.1"
                     /db_xref="GeneID:11496635"
                     /db_xref="GOA:G0W7X0"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:G0W7X0"
                     /translation="MSGFIAGSNDTTTASTATPLSPASTLETQSYTIVIKIGSSSLVD
                     NVTREPKLSIMTKVVETVSCLKKLGHKVIIVSSGGIAIGLNSMNIINKPQVLSEIQAL
                     AAIGQGKLISMWEMLFRQYDQKVAQILLTRNDILNWNQFKNAQNTINALLNLNVVPIV
                     NENDTLSISEIKFGDNDNLSAITSVLINADYLFLFTDVDCLYTENPNQLQSHLHSQHS
                     STSLASLSSWASRISLNDQSPASTSMFNSQMNLQKLTSPDLQNYNPNIENDTINGPTP
                     ILTVFNTKQKNISKLLKNCSTLNKSGSNIGSGGMTTKIMAAELATNVGIHTIIMNSIQ
                     PLNVLKIINYIELEFDTKKNFKDFNYKEELNNIIKLNIPLHTKFIANKKARNNKNLKR
                     KKNKSTQNSYSYSYSYHDDIKDGNDELMESIDKNDYINKREFWILHGLISKGSIIIDN
                     ESYNDLISSTTKEYEGLLPKDIIDIEDNFHELECVEVKVGQKLPNGQLNYEIPLKLIG
                     RARCNYTSLEINKIKGLKNSNQIEDILGYADSKFIANKENLALLPR"
     gene            493793..493865
                     /gene="NDAI0Ctrna4K"
                     /locus_tag="NDAI_0Ctrna4K"
                     /db_xref="GeneID:11496636"
     tRNA            493793..493865
                     /gene="NDAI0Ctrna4K"
                     /locus_tag="NDAI_0Ctrna4K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11496636"
     gene            <494856..>495775
                     /gene="NDAI0C02220"
                     /locus_tag="NDAI_0C02220"
                     /db_xref="GeneID:11496759"
     mRNA            <494856..>495775
                     /gene="NDAI0C02220"
                     /locus_tag="NDAI_0C02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669077.2"
                     /db_xref="GeneID:11496759"
     CDS             494856..>495775
                     /gene="NDAI0C02220"
                     /locus_tag="NDAI_0C02220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669125.2"
                     /db_xref="GeneID:11496759"
                     /db_xref="GOA:G0W7X1"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:G0W7X1"
                     /translation="MNKIAAIGAANGVKKLIIGQNGLLSTPAASHIIRSYHEKVTGGI
                     ILTASHNPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTSYKIVKDLPKLNLSK
                     IGNDQKYGPLLVDIIDVTKAYVELLKEIFDFDLIKNFIQKQRETKNWKLLFDSLNGIT
                     GPYGHAIFVEEFGLPADEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDKEKIEFGAA
                     SDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRV
                     AAKHGLKCYEVPTGWKFFCALSMLRIIHLW"
     gap             495776..495795
                     /estimated_length=20
     gene            496405..496476
                     /gene="NDAI0Ctrna3D"
                     /locus_tag="NDAI_0Ctrna3D"
                     /db_xref="GeneID:11496637"
     tRNA            496405..496476
                     /gene="NDAI0Ctrna3D"
                     /locus_tag="NDAI_0Ctrna3D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11496637"
     gene            <496825..>502041
                     /gene="NDAI0C02230"
                     /locus_tag="NDAI_0C02230"
                     /db_xref="GeneID:11496750"
     mRNA            <496825..>502041
                     /gene="NDAI0C02230"
                     /locus_tag="NDAI_0C02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669078.1"
                     /db_xref="GeneID:11496750"
     CDS             496825..502041
                     /gene="NDAI0C02230"
                     /locus_tag="NDAI_0C02230"
                     /inference="similar to DNA sequence:INSDC:YJL039C"
                     /note="similar to Saccharomyces cerevisiae NUP192
                     (YJL039C); ancestral locus Anc_5.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669126.1"
                     /db_xref="GeneID:11496750"
                     /db_xref="GOA:G0W7X2"
                     /db_xref="InterPro:IPR021827"
                     /db_xref="UniProtKB/TrEMBL:G0W7X2"
                     /translation="MIWSTAPFQKLYDSIENDQFDYNLFKELLPDLQQLNLTNDKPKN
                     QKSRAQVESGKITLADNNIITNDDENDTNNNHNTITYNLKQQFIIATISLSDELNLDE
                     LIVAQLILSDLEKSNLLDSLDSLDNATTLIISGKRQFFFRRQFILQITAFLLNCLDTS
                     NPILQELVQDSLKNNILKSFESIHQQLEDIKQSINKAKILENNNDPIFIQNIKFKRDF
                     LLKEYDTLSQILTGLINKNFLLNYNDINNIINHIITSLNPNDYFIIYYLPALFNAFNK
                     LEDMPSNDVNLLYSNFIKDLKNNDSIYEQPIKVTLIFIFLTLFIDWCNSNPTVRTKDL
                     DFKTDIDYPMMLTVELGAIEQLLIIAADTSEFMNDQTLELIYDIRSLLETHIPRFRPI
                     QLLDDPVDYENASNNDNNNNNTQHPHSITNNFSYSDAINTKKGITPSENKNLKYSNIA
                     QSQYNNIRLSEQTQDFLVSSFHNVLQKVITNCAFLLTKIKDTEEDSLLSEADLTLDDI
                     AAKADLERFFITIYFFYASRPTYSNEFWKDKESNAYGFIEWSSKCTDSLMRSCFYLMI
                     SSLSFGQENSTNVFHYFGNNSIVSWSTIVQCLKEYNLRISNLPNVIHQRQNLEQDTDS
                     SSSSSSATATKEIDSLAIAFEEGLNEETTIFLSSLLTLVGSVAFDVQSDIKISLSGLF
                     MDPIFEFAKLETPLSGACFKTLSYLLPSSIDARLNYWQSLDSILFKNVSLTNTTDSYR
                     SAFGYTLKTFSEIVGFLSLFNNLLKINPQDINENGHLSFGKQNFPSKLGQVYRKMGIW
                     PYFDYILNEIFVPSKLILNDFDRRAIQTPILEIIETSLLSFDYSAILNSITLGINLDT
                     LVNTSDFFTYVQESPAPVVFNHLFAQNVHSTLFAIIDIGIDHISIDLEGGKDQMNLLT
                     RSIKIINLILDFQGTFTEELLPIIIKQENKSYYIPKNFGLHGFRSFYDTIFFNLPVVA
                     HLGLYVGLDDTSLVSESLKVLKKLSLNSPSNGTDLNSKNKLFTIFDAVDDSARIKDAF
                     ISQLEVPIENDGQLSLKIQLLNFINSNLSFTKPAVTVAHFLLGLQASNGISLGPELPT
                     FINSDVSLLNSIVSILESSLDIVTPEQIQYAPMRLASISLEIILKLCRNPLTSSLLLD
                     YLTNQHFFERIMEIDVHITKFTQWDGKSFDSLSIDSGFDFLQSESIGALLAFLSYRNY
                     LIQYLGLFIHRCSFMGTKRNILTYVNFLITNKIYSTRIFSFLDSLNYENLPIDEHLFK
                     NFKYLNALPLNLEKFTLNEKCAGNIYSLNDLNSLMSVAQKVVKPPLHATACTTDEVGE
                     AQKETLVKEIVMMKFCVSSYLSNKKFQELQLLILHSWVQLVQVIVTDGNLSPLSRSNF
                     ILEVFETIIPKINDYVEVNTLFSEELTSLAVFLNDLYQKDRMVVDNLRFVDSRLYNMF
                     KVCLHGINSPLSTPTLRSDFYVLANSYLVRRIKENTLVKEVIMDIRMHNEKLLEVICN
                     DAIYVQGTCKITGILLLDSLIQLGNINKANFVLDNLMKGTQLQRIAQTLKSTDLLLTS
                     TAEHITIDDLLYELTAFKTTASFLVRVAETRIGAQSLLQCKILQIIGDLSFLKIDPDL
                     GSELIFNESPSKNSDFIKVNINLTNSINGVASSNGVSLFEVITPIFRLLCSILLSLGS
                     TNKSVISNVKKLLMEFRKLLVGIFKKDVLKETQDTVQSTKSASEDWQELVKLAVVLCT
                     LTQYDGRESSML"
     gene            complement(<502165..>504162)
                     /gene="NDAI0C02240"
                     /locus_tag="NDAI_0C02240"
                     /db_xref="GeneID:11496638"
     mRNA            complement(<502165..>504162)
                     /gene="NDAI0C02240"
                     /locus_tag="NDAI_0C02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669079.1"
                     /db_xref="GeneID:11496638"
     CDS             complement(502165..504162)
                     /gene="NDAI0C02240"
                     /locus_tag="NDAI_0C02240"
                     /inference="similar to DNA sequence:INSDC:YJL041W"
                     /note="similar to Saccharomyces cerevisiae NSP1 (YJL041W);
                     ancestral locus Anc_5.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669127.1"
                     /db_xref="GeneID:11496638"
                     /db_xref="GOA:G0W7X3"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="InterPro:IPR026010"
                     /db_xref="UniProtKB/TrEMBL:G0W7X3"
                     /translation="MNTNQGSTPVSIFPTSNSQPALSGNNTIGQSKPGQGATSTAQFS
                     FGNTTSAATGATANKPFTFGTSENKAPLSFGFGNKPATTTPQSNDQTSSSGLFAMNAP
                     SASASFSSGFKFGTTQKDDQAKASAFSFAGTGNPTGKNPTSNKNDENKTTPAFSFGGI
                     SEDGSKKATPMFNLNTQADKTDNQVKDKTTEPKPAFSFGSLSSKKENTASTLGSKEAT
                     SNTPSFSFGSKADKPASLNLGQDSSGNIGMPSVKFAAEEKKGTTSPSFSFGASGNTVT
                     DVKKKEGSGKSDFQFGADVGGKKVETVNKPTFQFGGTPDGNKQEAPDKPMFSLDSKAG
                     DNKNPLDMKQPAFQFKSQPEAKKAEEATKPALQFGGKPEDSKKVEEVTKPSLLFGAGT
                     VAGKKDDDSKKQSFAFGTKTEDKNAVPKIGFAFGDKQEAKVNTESNKKPENKEPNREK
                     SVAKPISATQSLNSKTVEPKPVSLDNKTLDDLVTKWTNQLTDAATHFDNYSKKVNNWD
                     QMLVKGGEQVSQLYSDTLAAEQNQNKIDQSLQYIERQQDELDVFLDSYEKKADTLLSD
                     ILSNSSANIASNNDQKRQQAYRTAETLDENLDSLSLNLSSLITEINEVSANFNKATSI
                     NLNNKDENAQLIRLLNAHLDALKSLDNNSNLLEQKIKALSK"
     gene            complement(<504685..>506037)
                     /gene="NDAI0C02250"
                     /locus_tag="NDAI_0C02250"
                     /db_xref="GeneID:11496639"
     mRNA            complement(<504685..>506037)
                     /gene="NDAI0C02250"
                     /locus_tag="NDAI_0C02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669080.1"
                     /db_xref="GeneID:11496639"
     CDS             complement(504685..506037)
                     /gene="NDAI0C02250"
                     /locus_tag="NDAI_0C02250"
                     /inference="similar to DNA sequence:INSDC:YJL044C"
                     /note="similar to Saccharomyces cerevisiae GYP6 (YJL044C);
                     ancestral locus Anc_5.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669128.1"
                     /db_xref="GeneID:11496639"
                     /db_xref="GOA:G0W7X4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G0W7X4"
                     /translation="MEELIINKYTAKEELIQNGIWKGELYRAPDRLASSNFNRGWLWK
                     TLASSQYSESNETQEVTKDLLPVPLITEKHEEPSENKNVRDKIIDYKRIDKSFKSFKK
                     GIRRLTPKETTKDPLLNNQSIALESDGDLSLPETLEIIDLDLSRLMLDDIFQRPKVYA
                     QMRQILYNYLIISRNNTKGMNTTDFSSIQGKVFSYKQGYHELLGLIYLQLYHEMDLNK
                     GNRNALSSLDGGKENYHGNEDVTLMRNCLNIFVKLMNQVAPTFYNEKQLIKWDETQFS
                     QILKVCSPTLHALIYEKDQNGRKPHSNLIWLIRWTRLLLLRELPREKVLIIWDHLLTF
                     VYPIDTLMACLIITLLLSLYDRFLALYTNDSDHDDIIELMLHFKDTQPIVDLDTVQLC
                     QMAGNICELWYNGNLEDMQSICRSFIKLKTGLDETSPIDPHRLRLEDRLRKSVKKSLA
                     "
     gene            <506631..>510854
                     /gene="NDAI0C02260"
                     /locus_tag="NDAI_0C02260"
                     /db_xref="GeneID:11496640"
     mRNA            <506631..>510854
                     /gene="NDAI0C02260"
                     /locus_tag="NDAI_0C02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669081.1"
                     /db_xref="GeneID:11496640"
     CDS             506631..510854
                     /gene="NDAI0C02260"
                     /locus_tag="NDAI_0C02260"
                     /inference="similar to DNA sequence:INSDC:YJL042W"
                     /note="similar to Saccharomyces cerevisiae MHP1 (YJL042W);
                     ancestral locus Anc_5.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669129.1"
                     /db_xref="GeneID:11496640"
                     /db_xref="UniProtKB/TrEMBL:G0W7X5"
                     /translation="MNIKDTQKLFQEHQRPSLDVDWFIRSKRADTPHVSHHENETSIE
                     GTDPTSSTINVARANYQADSNRLRKRNSIATSTLLHPSESGNQQEHHHHHHHHHRNDD
                     DDQSVTSYGQLGHTRRKSVSNDSNGNKASLHDKMNSTSLPLRRSKSVSMGDSHSQKIR
                     NSLYQDHSSPPKKMGFFRSLFSKKPRQLPNSTATVPTTKLTRGISTNNDEPSNLLHDK
                     EGKSNRKNPPMFKENYSLNESKDNLNEDRTFLYKSKTQPEPTASPNSSNISMENDYDD
                     NSSGSDSYNEADNRLSEFIEYYKKNGYSVNTFKEKKEGTDYDMKSSHLPNASFTIDEA
                     TIQPTKKVDIRGRPLPPHPAIARLPSAFKKRTNFEEQGANVSEPVSLDKTYIPNNTGS
                     SKKFGAFLKRVTSYGTSNPSVNNKPTMNQSLLSVQSTDSTCTTSFDPSNTVTVPGLEG
                     IKPLKHVSFATNTYFNDPPQQICSKNPRKGEVEVKPNGSVIIHRLTPAERRKILESTS
                     SGIVVGGSGQLKLISDLEEQEKSSTDKITEKLRAEGKKPNETMLNKTSKDQLEDEQAQ
                     EEQEEDIKKNSKKRSIVLAAAEAAAEARAKETPNELRRTVTNNEEEVTVSSTASHLTI
                     DKPMISRRSNASLSSASLASQEVDDGEGEIFPSVNMKIPHDIVYTRCCHLREILPIPA
                     TLKQLKTGSTDPIPLLQLRNPRPSMVEIWSFSDFLSIAPVLCLSLDGVSLTVQMLRII
                     LSSLITKDNFEKLSLRNTPLDDEGWKLLCYFISKSKSLISLDLTMVPHIKTNVQKPSK
                     SSLKNNLSRMESNLENRTDRNWDLLTAAIAMKNGLEEIVIAGAKIPLFQFTNFIDVAC
                     VKTQRLGLAYNDLSKEQCENLAKWIIHSKVTGLDIGFNDLRGKLSTFTDAVWDKIQNK
                     RKANVLKYLSLNDTCLEVEEGATSETNDVLRLLSVLCYSENLKFLDLSNNPKCFPNCV
                     DTLIKCLPVFVNLVRLHLDYNDLTSTTIVMLAEALPLCSRLNHVSMLGNALDLASCKA
                     LTEAFRRSSSLLTLDIDYAYMPENIKEKITMYAMRNIQKELGTVDGSGKQTAMNGYPL
                     KNLQEELSGLLTENTGDENHQAENVDRFIKRSDKIRTTIEKVVEDLFNLRVQGQLSLE
                     GKETLIRLCFMDRTLEKGIRLLRSKHRRANTVGQIPEIKHVISTDSEQSTASDAVGNN
                     DIVQSVFTSTTFGKSGHSALLPFGTAEVEKPGKSSDDDDADETIAFKESDNGTTKIIS
                     PEILQKDAKNEGLKENTYLTVDRATLDKAVDTLDSDEIKNLLLKNDATEVVTVIDELH
                     NRGYHLHHIFKKHPEDKQKEASKDGDLKTTVLEINTGKTAGNSKEIIPTEAVPFNEFM
                     NNKEEEAIDAAYDQVLDNLQEVRDKQKKK"
     gene            <516144..>518420
                     /gene="NDAI0C02270"
                     /locus_tag="NDAI_0C02270"
                     /db_xref="GeneID:11496641"
     mRNA            <516144..>518420
                     /gene="NDAI0C02270"
                     /locus_tag="NDAI_0C02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669082.1"
                     /db_xref="GeneID:11496641"
     CDS             516144..518420
                     /gene="NDAI0C02270"
                     /locus_tag="NDAI_0C02270"
                     /inference="similar to DNA sequence:INSDC:YLL001W"
                     /note="similar to Saccharomyces cerevisiae DNM1 (YLL001W);
                     ancestral locus Anc_5.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669130.1"
                     /db_xref="GeneID:11496641"
                     /db_xref="GOA:G0W7X6"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7X6"
                     /translation="MASLEDLIPTVNKLQDVMYASGIDTVDLPILAVVGSQSSGKSSI
                     IETLVGRDFLPRGTGIVTRRPLILQLINIPEGSDHATDGSNSTFESKKEVNAVLTETV
                     PDANPLVESTEKQIFNEWGEFLHVPNRKFYDFNEIKREIENETARLAGKNKGISKSPI
                     NLKIFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPAN
                     VDLVNSESLKLAKEVDPHGKRTIGVVTKLDLMDSGTNALEILSGKMYPLKLGFVGIVN
                     RSQQDIQLNKSVKEALDNEEQYFRRHPIYRTISNRCGTRYLAKLLNRILMNHIKDKLP
                     DIKTKLNALVTQTEQELLGYGGGVRGTKENRSGLILELMNKFSTNFISSIEGNSSNIN
                     TKELCGGARIYYIYNNIFGKSLKSLDPTTNLTVQDIRTAIRNSTGPRATLFVPELAFD
                     LLVRPQVDLLLGPSQRCVDLVYEELMKILHSCGSSELARYPRLKSMLIDVVVELLKER
                     VDPTRQYVESLIAIHKAYINTNHPNFLKATDAFPDIVKTHRERKTRKEKIEKERFNSN
                     SNSNSKKRNNDPTADLDISSTDSSDEDESDDARGVKTTRDSKDSFLNYIFGKDLNNGT
                     SQDTLSRSFGANNNKPEIMFNNLQIDDYEDDSYNLESNLTDREELECELIRRLIISYF
                     DIIREMIQDQIPKAIMFFLVNYCKETVQNRLVTKLYKESMLEELLVEDQAIAQERANC
                     ERLLETYKNASSLVNNIL"
     gene            complement(<518725..>521313)
                     /gene="NDAI0C02280"
                     /locus_tag="NDAI_0C02280"
                     /db_xref="GeneID:11496642"
     mRNA            complement(<518725..>521313)
                     /gene="NDAI0C02280"
                     /locus_tag="NDAI_0C02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669083.1"
                     /db_xref="GeneID:11496642"
     CDS             complement(518725..521313)
                     /gene="NDAI0C02280"
                     /locus_tag="NDAI_0C02280"
                     /inference="similar to DNA sequence:INSDC:YLR001C"
                     /note="similar to Saccharomyces cerevisiae YLR001C;
                     ancestral locus Anc_5.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669131.1"
                     /db_xref="GeneID:11496642"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:G0W7X7"
                     /translation="MNPHWKSNLRFIILFLLTFVRTSNIDDDNKFPFETVVDILSNDV
                     QFSTFLRLVQRKGYVPYLNELQNFTLFAPVNSAFIVNDEGSILGENQFDLENYLLHNL
                     TLNLSVRKESMTIINQYVKFPFIIDSINKTHRTPTVNNIRITEPDLKPNFQNAYIQGI
                     SGLISTPPPIKALLTYLQENPKYNNEFTWIEKFASKFENLEDIVQNNTFLLPSNSNIR
                     KFYNQIEANYLIDNFSQKKGLDRKIQDKWDRDALNFLQSIILKDVTGGSNLHNTLRTN
                     LNNVTLVLENCDHSRKITVNHSSPSILTNEIFVNGIAHGFIDIDAIVDVVQFDAEKYL
                     HGLNNSKFVEEIYFRKLQHLIQDESSLENITIFVPEPSLNDDIGFTKSTILYHFVKEQ
                     LWLEENEALATSAFSSNANRYLIDSSFCSSNKRLGGKCQKLKISKTNEGYFINNKIKI
                     LNTKPYKIGSSLIYTISKDIALPGDFLLSLPPLYHCSRSIELLKQLDLLTLAPNYKGY
                     TIFLPCFDAWTEQDLIFNYLESNLTAANISMKNLIINGLYYTVNSLHGKQTTNLLGNE
                     VLISTEEDSYDSDIATEFMLSTMKDPISVEKNSDIIFDQGVIHPLRDINFPKDLFITL
                     KDLIKTAGVPEFLEFLENFQEFSSIFAYNESYSLLVPTQASLIREGINLNFTSLKEFL
                     KLHIVTGNSTVNLLGCKGKISTLSGYGLSCNEVSKNNLFLHVDSGSNKEVRILKKGCS
                     TVKNSSCVFLIDRPISLNWLQKERYYLKLPGVAIGIGVLLGALFTSLLCFILVLPINK
                     TKETSQIDDNSQYPPLPTNEQTLTSNYGSTHGTPSLSPRFDDSYSPNSKRKPIGVGSS
                     PHLNRC"
     gene            <521955..>523259
                     /gene="NDAI0C02290"
                     /locus_tag="NDAI_0C02290"
                     /db_xref="GeneID:11496643"
     mRNA            <521955..>523259
                     /gene="NDAI0C02290"
                     /locus_tag="NDAI_0C02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669084.1"
                     /db_xref="GeneID:11496643"
     CDS             521955..523259
                     /gene="NDAI0C02290"
                     /locus_tag="NDAI_0C02290"
                     /inference="similar to DNA sequence:INSDC:YJL036W"
                     /note="similar to Saccharomyces cerevisiae SNX4 (YJL036W);
                     ancestral locus Anc_5.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669132.1"
                     /db_xref="GeneID:11496643"
                     /db_xref="GOA:G0W7X8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G0W7X8"
                     /translation="MPKITTHDREHDTSTAGSTKHGREKEFSMDNNDGYTTQIIVSDP
                     QKHANDPNSSTAYVTYQISTKTNNPSYHKNHGSATTTDIIVVHRRYSDLVLLHDILSN
                     DNPTRIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLKRVSTHPILSKASIFEQF
                     LVSNEWEAYRRSLSGNLQTNKEEVSDTIMNAFKTVHNQSEEFIEIKEKSDKLDHTISK
                     LSKNFHKVVRKNDSIADDYSKLSQSLQDLNEVVSNEDEMLANKLRIFNEGIKQISYGL
                     SDLNKYLDYEYTVDLKDLEHYIDSLHQSLKLKDQKQIDYEQLSEFLTKSIKEKNNLIS
                     GTGGGNYFTTKLEALAGVNQEASRREKIVKLETKITTLTGELDNAKKVADGFEQETLK
                     EVDLFEKVKSKELKESLGSLADHHIQFYEKMVETWTKVDKSL"
     gene            complement(<523388..>524251)
                     /gene="NDAI0C02300"
                     /locus_tag="NDAI_0C02300"
                     /db_xref="GeneID:11496644"
     mRNA            complement(<523388..>524251)
                     /gene="NDAI0C02300"
                     /locus_tag="NDAI_0C02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669085.1"
                     /db_xref="GeneID:11496644"
     CDS             complement(523388..524251)
                     /gene="NDAI0C02300"
                     /locus_tag="NDAI_0C02300"
                     /inference="similar to DNA sequence:INSDC:YJL035C"
                     /note="similar to Saccharomyces cerevisiae TAD2 (YJL035C);
                     ancestral locus Anc_5.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669133.1"
                     /db_xref="GeneID:11496644"
                     /db_xref="GOA:G0W7X9"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G0W7X9"
                     /translation="MMTLDTPSSSSSSSSSLLISRKDAHIVMGYLHYERMKLAIKLAR
                     YALDHNETPVACIFIHEPTNSVIAYGLNATNHSLTGVAHAEFMGIEQIKNLVGPHHLM
                     DFFKDVVLYVTVEPCIMCASALKQLNIKKVVFGCANERFGGNGTVLHINKDKALLNAP
                     SLPKAESASYEAIPGILRKEAIMLLRYFYVRENKSAVTPRNKAERNLDKETFPDLIWS
                     TYIDRETFIQEFGSAQSIHYENNSDLMSFNDDIDWSLIETPWDDIVEDLNEKCQSFNM
                     IQRKKSKLETV"
     gene            <524786..>526843
                     /gene="NDAI0C02310"
                     /locus_tag="NDAI_0C02310"
                     /db_xref="GeneID:11496645"
     mRNA            <524786..>526843
                     /gene="NDAI0C02310"
                     /locus_tag="NDAI_0C02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669086.1"
                     /db_xref="GeneID:11496645"
     CDS             524786..526843
                     /gene="NDAI0C02310"
                     /locus_tag="NDAI_0C02310"
                     /inference="similar to DNA sequence:INSDC:YJL034W"
                     /note="similar to Saccharomyces cerevisiae KAR2 (YJL034W);
                     ancestral locus Anc_5.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669134.1"
                     /db_xref="GeneID:11496645"
                     /db_xref="GOA:G0W7Y0"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y0"
                     /translation="MILNRSNKWLVPLTAIIYTLFLVILPLHGSSKSSNILVRGGATD
                     EVENYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAK
                     NQIASNPTNTIFDIKRLIGLKYNDRSVQKDLKHLPFSVINKDGKPAVEVTVKGEAKTF
                     TPEEISGMILGKMKQIAEDYLGNKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRI
                     VNEPTAAAIAYGLDKDESEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGE
                     DFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRSLSSQMSTRIEIDSFVD
                     GIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLSKKDIDDIVLVGGSTRIPKVQ
                     QLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETSG
                     GVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIQVFEGERAMSKDNNLLGKFELTGIP
                     PAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLSQDDIERMVEEAE
                     KFASEDAAVKAKIESRNKLENYAHSIKNQVNGELGEKLEEDDKETLLDAANDTIEWLE
                     DNFDSATAEDFDEKFEALSKVAYPITSKLYGNPEGAGPSGDAYEEDEDEDEDDDYFEH
                     DEL"
     gene            <527244..>529538
                     /gene="NDAI0C02320"
                     /locus_tag="NDAI_0C02320"
                     /db_xref="GeneID:11496646"
     mRNA            <527244..>529538
                     /gene="NDAI0C02320"
                     /locus_tag="NDAI_0C02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669087.1"
                     /db_xref="GeneID:11496646"
     CDS             527244..529538
                     /gene="NDAI0C02320"
                     /locus_tag="NDAI_0C02320"
                     /inference="similar to DNA sequence:INSDC:YJL033W"
                     /note="similar to Saccharomyces cerevisiae HCA4 (YJL033W);
                     ancestral locus Anc_5.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669135.1"
                     /db_xref="GeneID:11496646"
                     /db_xref="GOA:G0W7Y1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y1"
                     /translation="MAKKQRLTTSQRKDLRKKEDEYLENLNKKIEEYDPNTSKTILFK
                     DLPLSPPTLKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEK
                     LYREKWTEFDGLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFESERL
                     SKINILIGTPGRILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPAS
                     RQTLLFSATQSQSLGDLARLSLTDYKTVGTMDPSKDKTDEGAATPKTLEQSYVETELA
                     DKLDILYSFIKSHLKHKMIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTE
                     TLDKFSRAQQVCLFATDVVARGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKGK
                     SLIMLTPQECEPFLKRLASKKIKLGKLTIKQAKKKSIKPQLQSLLFKDPELKYLGQKA
                     FISYVRSIYIQKDKEVFNFESLATEAFANSLGLPGAPKIKIKGMKAIDRAKELKNTPR
                     QLLALQQANDEGEIVKDKTKAVRTKYDKMFERKNQTILSEHYLNITQSQAAADEDEDF
                     MTVKRQDHQLNEEELPALTVPTSNRGQKKALSKKASLSTKGNATKLVFDDDGEAHPVY
                     ELEGEEDFQKKGSAEAQKKDFLSKESDVMAEVDTGDKQVAKEKRQEKKRKRLELMRRE
                     MEMSLEEEEASSGEDVANAYVGTGNLSDDMEDEEEGNNTRKRARFSTATEETTHESDA
                     GILELEEPETLEDLESLTSRLIQN"
     gene            <529822..>530421
                     /gene="NDAI0C02330"
                     /locus_tag="NDAI_0C02330"
                     /db_xref="GeneID:11496647"
     mRNA            <529822..>530421
                     /gene="NDAI0C02330"
                     /locus_tag="NDAI_0C02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669088.1"
                     /db_xref="GeneID:11496647"
     CDS             529822..530421
                     /gene="NDAI0C02330"
                     /locus_tag="NDAI_0C02330"
                     /inference="similar to DNA sequence:INSDC:YJL030W"
                     /note="similar to Saccharomyces cerevisiae MAD2 (YJL030W);
                     ancestral locus Anc_5.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669136.1"
                     /db_xref="GeneID:11496647"
                     /db_xref="GOA:G0W7Y2"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y2"
                     /translation="MSKAIPLKGSTRVITEFFEYSINSILYQRGVYPADDFSPAKKYG
                     LTLLKTHDDELKSYIRKILLQVHKWLLGGKCNKLVLCIVDKDEGEVVERWAFEISHLS
                     QTDDSEDIKDEANTKTETQNQIRGLIRQITASVTFLPELTKEGSYTFNVLAYTDAYAK
                     VPLEWADSESKEIVDGEIVQLKEFLTEDHKVSAQVSYKT"
     gene            complement(531046..531118)
                     /gene="NDAI0Ctrna2M"
                     /locus_tag="NDAI_0Ctrna2M"
                     /db_xref="GeneID:11496648"
     tRNA            complement(531046..531118)
                     /gene="NDAI0Ctrna2M"
                     /locus_tag="NDAI_0Ctrna2M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11496648"
     gap             531337..533040
                     /estimated_length=1704
     gene            <533251..>534414
                     /gene="NDAI0C02340"
                     /locus_tag="NDAI_0C02340"
                     /db_xref="GeneID:11496745"
     mRNA            <533251..>534414
                     /gene="NDAI0C02340"
                     /locus_tag="NDAI_0C02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669089.1"
                     /db_xref="GeneID:11496745"
     CDS             533251..534414
                     /gene="NDAI0C02340"
                     /locus_tag="NDAI_0C02340"
                     /inference="similar to DNA sequence:INSDC:YNL286W"
                     /note="similar to Saccharomyces cerevisiae CUS2 (YNL286W);
                     ancestral locus Anc_3.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669137.1"
                     /db_xref="GeneID:11496745"
                     /db_xref="GOA:G0W7Y3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y3"
                     /translation="MYEKTKNKTRILYLLPSFSSFRLKMAIVFLSVSSVSDLTDSFKS
                     QMHALYVFITTHNVKYIFQLKVNMISSLVLKYKHSKKSSIALKIAHRMEKEELDLKEA
                     LRLLKKQELERRKKKRDEKKSRIYEPPFTSIYISNLPKDITEDELIREFTHYGIIRKT
                     SEGEIRCKLYKDSDGKVKGDALIVYARIESVQLAIDMMDKTILRGSIINVQTAQFKSN
                     KRKIDDKNNAEEGDHVPLKRGKQLQKYAEDGTIQDDSAKEVSDWHITKLEGHSEADRT
                     IVLNNVLDVGAKYTEGELDEIKEDIVDECSTVKGIERFELDESNGRALVVYEDVPSAL
                     NCRSLLDGRFFDGREIIARTLTEEEGLLNKQDLSNFVTQERVEESEDDLVDES"
     gene            complement(534658..534729)
                     /gene="NDAI0Ctrna2G"
                     /locus_tag="NDAI_0Ctrna2G"
                     /db_xref="GeneID:11496649"
     tRNA            complement(534658..534729)
                     /gene="NDAI0Ctrna2G"
                     /locus_tag="NDAI_0Ctrna2G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:11496649"
     gene            complement(<535450..>535926)
                     /gene="NDAI0C02350"
                     /locus_tag="NDAI_0C02350"
                     /db_xref="GeneID:11496743"
     mRNA            complement(<535450..>535926)
                     /gene="NDAI0C02350"
                     /locus_tag="NDAI_0C02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669090.1"
                     /db_xref="GeneID:11496743"
     CDS             complement(535450..535926)
                     /gene="NDAI0C02350"
                     /locus_tag="NDAI_0C02350"
                     /inference="similar to DNA sequence:INSDC:YPR193C"
                     /note="similar to Saccharomyces cerevisiae HPA2 (YPR193C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669138.1"
                     /db_xref="GeneID:11496743"
                     /db_xref="GOA:G0W7Y4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y4"
                     /translation="MSEEASVVIRPIQETDKDDWLLLWKQYQKCYNRTMKEDIPLLTF
                     ERFLDPEVKMWAAFAINTTTNKPIGMVTYLHHFTTWNLDGKIFLHDLFVQEDQRVKGV
                     GRKLMEFVYDASDRMDVPFVYWTTDDFNHRAQLLYTKVGKKTSKVLYERGGYGIFS"
     gene            complement(<539028..>541019)
                     /gene="NDAI0C02360"
                     /locus_tag="NDAI_0C02360"
                     /db_xref="GeneID:11496650"
     mRNA            complement(<539028..>541019)
                     /gene="NDAI0C02360"
                     /locus_tag="NDAI_0C02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669091.1"
                     /db_xref="GeneID:11496650"
     CDS             complement(539028..541019)
                     /gene="NDAI0C02360"
                     /locus_tag="NDAI_0C02360"
                     /inference="similar to DNA sequence:INSDC:YLR002C"
                     /note="similar to Saccharomyces cerevisiae NOC3 (YLR002C);
                     ancestral locus Anc_5.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669139.1"
                     /db_xref="GeneID:11496650"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y5"
                     /translation="MARKKRSQEAILERTNKKRRQEDALLESGTFEDAGELSDSMIYE
                     STVAIPKKAWDDEEQDYELVPRKIKDVEEDMVEGLPIKINGKVERNLVKQTKKKDIHQ
                     QKETNLEINEQPDAELDESQSSDEEEDTEERIIELKEDIADLVEKIMEDPEENTMALT
                     RLCKMAGSRNPNTAKFSILALVPVFNSIIPGYRIRPLTDLEKKEKISKEVAKLRTFEQ
                     NLVQNYKSYVEILKNLSRVANNDTSIKVNLGVLATQAALRIISNASHFNFRADIFTLI
                     LRRICKPNLAADPIAHQAIETIEGLFNADDEGGISLDIVRILCKIMKVRNYNIEESVL
                     NMLLSLDVLHDYDPNTKDDDSLTPMKLKKKDRVHLSKKQRKMRKEMKEIEKEMEQAEQ
                     VVSAEEREKNQSQILKSVLALYLNILRNKSVKLIGPVLEGLAKFGNMANFDLLGDFLV
                     IMKEIINDTELDSLSPEEVRKVLLCIVSAFSIVSNNSNMKISIDLTTFADALYSILPY
                     VSLDADIELSYKSLRLADPLNNEIIKPSVNVSTKAELLLKALDHVFFRSKSGSKQRAA
                     AYTKRLYTCMQHTPEKTTIALLKFIDKLMNKYPELCGLYSTEDRIANGNFNMETDVVS
                     RSNPDAATLWEHTILTKHYCPTVVKGVRSLGTRSKEYSK"
     gene            complement(<541713..>543632)
                     /gene="NDAI0C02370"
                     /locus_tag="NDAI_0C02370"
                     /db_xref="GeneID:11496651"
     mRNA            complement(<541713..>543632)
                     /gene="NDAI0C02370"
                     /locus_tag="NDAI_0C02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669092.1"
                     /db_xref="GeneID:11496651"
     CDS             complement(541713..543632)
                     /gene="NDAI0C02370"
                     /locus_tag="NDAI_0C02370"
                     /inference="similar to DNA sequence:INSDC:YJR004C"
                     /note="similar to Saccharomyces cerevisiae SAG1 (YJR004C);
                     ancestral locus Anc_5.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669140.1"
                     /db_xref="GeneID:11496651"
                     /db_xref="GOA:G0W7Y6"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR011252"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y6"
                     /translation="MLQSAILLWLSILTLTSSKEISNIQYSNLEYSALSSVHYPNEGW
                     DAKFDFSIPDSSSIIKGDEFSISMPYVYRIKFSDNSKYYDVSLNDGTKAFQCTALQQA
                     SYDKEASILTCTASTDLSSYSSISGSIDIGLSFSSGDSAYQYELANAAYFKSGTMDVP
                     LMNDLSAPITFDAASFPLGSYSMARSTTKDSLENYYLAMKCPNGYLLGGTENINFDTN
                     GSGHDVDCSSVQVYKSSKFNDWFFPEDYEDASADVVCYGSNLMITMGQASPGEMLWVN
                     ALQSLEEGVNTIDQYIELTYSCSDTVASTIYTTEYSATTEYIIVDGYNSASALASSKT
                     NACHHHYHYYWLDWFFYYYLLYRYYIHYWYRQYFHSRGHHPCRNTKHQRCHHYYHYYW
                     LDWFFYYYLLYRHYIHYWYRQYFHSRGHHPCRNTKHQRCHHYYHYYWLDWSFTTTYST
                     DTTFTIGTGSISTPEVIIHVETPSPTTVFPNTIITKTYSNTTTSILTSCSGGCTETGN
                     TASFPSTNTVQSLSLSSTTSSNTPPLKETTVVTTVSNITPTESSPSSSPFNETTTITS
                     VPVASNSKVTTSSPSSMYMYSSTMSTPTSKPLQPFSLEVSTPLTISAFEGLASSLQSS
                     SLLTMFVTFISFFLL"
     gene            complement(<545301..>546176)
                     /gene="NDAI0C02380"
                     /locus_tag="NDAI_0C02380"
                     /db_xref="GeneID:11496652"
     mRNA            complement(<545301..>546176)
                     /gene="NDAI0C02380"
                     /locus_tag="NDAI_0C02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669093.1"
                     /db_xref="GeneID:11496652"
     CDS             complement(545301..546176)
                     /gene="NDAI0C02380"
                     /locus_tag="NDAI_0C02380"
                     /inference="similar to DNA sequence:INSDC:YLR003C"
                     /note="similar to Saccharomyces cerevisiae YLR003C;
                     ancestral locus Anc_5.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669141.1"
                     /db_xref="GeneID:11496652"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y7"
                     /translation="MSNPDDLDDGLLYDYEDKIELQDEEILNEKKRSLKAADESNLLS
                     SVRDREPSSQDVDNNVTDDGDDKHISKRQKKLKNSKLHQKKKEQVAYQIQQLKSLPLG
                     SSELIIEYFATLIREKNPDLSALELNDLYFKKTDFISTAKFDSMDRNLVNFPTFLAQF
                     SKSPKTVILSMSNLRVADVCRSVGGSKMAIKLFAKNKLKDDIETVENIFKDKKNKKNQ
                     NLKYFVATPTRMLNILEATEVLFQGKDKLDIIIDASYLDMKKNSILSNENTAVLCKVL
                     KLFLEKKSSVKILLY"
     gene            complement(546446..546518)
                     /gene="NDAI0Ctrna1T"
                     /locus_tag="NDAI_0Ctrna1T"
                     /db_xref="GeneID:11496653"
     tRNA            complement(546446..546518)
                     /gene="NDAI0Ctrna1T"
                     /locus_tag="NDAI_0Ctrna1T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11496653"
     gene            <549603..>550652
                     /gene="NDAI0C02390"
                     /locus_tag="NDAI_0C02390"
                     /db_xref="GeneID:11496741"
     mRNA            <549603..>550652
                     /gene="NDAI0C02390"
                     /locus_tag="NDAI_0C02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669094.1"
                     /db_xref="GeneID:11496741"
     CDS             549603..550652
                     /gene="NDAI0C02390"
                     /locus_tag="NDAI_0C02390"
                     /inference="similar to DNA sequence:INSDC:YLR007W"
                     /note="similar to Saccharomyces cerevisiae NSE1 (YLR007W);
                     ancestral locus Anc_5.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669142.1"
                     /db_xref="GeneID:11496741"
                     /db_xref="GOA:G0W7Y8"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y8"
                     /translation="MSVIEPQQVSVERASLTSDELSRYLLQYILSARGVCHENALVLA
                     LMRLKVDSNTIDPQWTISDWLTCLNDHVNKINVKLNPLSYKIIRINHGIGKNIVSNKN
                     RQNFGLFETATTMSNRSDVDQDENGNSHVILPESNRFYLYVNLTSSEQTKLATRFSQK
                     EIEFVKWALQKFCEEGNIVKDIGSLSTPSSNLIISEVHRIITGATGNNNLLRWSRYVS
                     FTVGSTQLLQYEHFTAIELESILIKLCEYKWFYRTSQGEYGMDLRCLAELEDYLVSTF
                     GLSKCQNCDKIAVQGVICGSQHCLPSDDRSQLGEVPTELRIWHIDCFQHYISHVSKEC
                     DVCRRSLLENGVYMV"
     gene            <551147..>551743
                     /gene="NDAI0C02400"
                     /locus_tag="NDAI_0C02400"
                     /db_xref="GeneID:11496654"
     mRNA            <551147..>551743
                     /gene="NDAI0C02400"
                     /locus_tag="NDAI_0C02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669095.1"
                     /db_xref="GeneID:11496654"
     CDS             551147..551743
                     /gene="NDAI0C02400"
                     /locus_tag="NDAI_0C02400"
                     /inference="similar to DNA sequence:INSDC:YLR009W"
                     /note="similar to Saccharomyces cerevisiae RLP24
                     (YLR009W); ancestral locus Anc_5.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669143.1"
                     /db_xref="GeneID:11496654"
                     /db_xref="GOA:G0W7Y9"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="InterPro:IPR024546"
                     /db_xref="UniProtKB/TrEMBL:G0W7Y9"
                     /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRR
                     NPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRVEEIRQK
                     RERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIANKLAKEQARAEMGSEEDE
                     EVSEEEMDIDSEEEEEEQLQKQKILLKNKKRNSKKIAF"
     gene            complement(<551956..>552432)
                     /gene="NDAI0C02410"
                     /locus_tag="NDAI_0C02410"
                     /db_xref="GeneID:11496655"
     mRNA            complement(<551956..>552432)
                     /gene="NDAI0C02410"
                     /locus_tag="NDAI_0C02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669096.1"
                     /db_xref="GeneID:11496655"
     CDS             complement(551956..552432)
                     /gene="NDAI0C02410"
                     /locus_tag="NDAI_0C02410"
                     /inference="similar to DNA sequence:INSDC:YLR010C"
                     /note="similar to Saccharomyces cerevisiae TEN1 (YLR010C);
                     ancestral locus Anc_5.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669144.1"
                     /db_xref="GeneID:11496655"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z0"
                     /translation="MSRLVVEISQLNENLDVINKETNPVNISRVTKIRCIVQLLEIEP
                     CQDEIGNNNICKLIVTNLPDFQTTSERTRAHIYVNERLFASTFIKKASNRSNASKRIP
                     QSGDALDLLVGIWNNGRGTNIFEAITIELLRLEEVTALRNFLPDPIGADFLKLSNP"
     gap             554199..554293
                     /estimated_length=95
     gene            complement(<555130..>555780)
                     /gene="NDAI0C02420"
                     /locus_tag="NDAI_0C02420"
                     /db_xref="GeneID:11496656"
     mRNA            complement(<555130..>555780)
                     /gene="NDAI0C02420"
                     /locus_tag="NDAI_0C02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669097.1"
                     /db_xref="GeneID:11496656"
     CDS             complement(555130..555780)
                     /gene="NDAI0C02420"
                     /locus_tag="NDAI_0C02420"
                     /inference="similar to DNA sequence:INSDC:YJL001W"
                     /note="similar to Saccharomyces cerevisiae PRE3 (YJL001W);
                     ancestral locus Anc_5.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669145.1"
                     /db_xref="GeneID:11496656"
                     /db_xref="GOA:G0W7Z1"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z1"
                     /translation="MNGIQVDMNRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAY
                     IANRVTDKLTKVHDKIWCCRSGSAADTQAVADIVQYHLDIYSTQFGTPSTKTAASVFK
                     TLCYENKDNLTAGIIVAGFDDATNKGEVYSVPLGGSIHKQKYAIAGSGSTFIYGYCDK
                     NFKDDMTKDETVHFIKHSLSQAIKWDGSSGGVIRMVVLTSEGVERLIFYPDEYENL"
     gene            complement(<556233..>559415)
                     /gene="NDAI0C02430"
                     /locus_tag="NDAI_0C02430"
                     /db_xref="GeneID:11496657"
     mRNA            complement(<556233..>559415)
                     /gene="NDAI0C02430"
                     /locus_tag="NDAI_0C02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669098.1"
                     /db_xref="GeneID:11496657"
     CDS             complement(556233..559415)
                     /gene="NDAI0C02430"
                     /locus_tag="NDAI_0C02430"
                     /inference="similar to DNA sequence:INSDC:YLL003W"
                     /note="similar to Saccharomyces cerevisiae SFI1 (YLL003W);
                     ancestral locus Anc_5.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669146.1"
                     /db_xref="GeneID:11496657"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="InterPro:IPR018907"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z2"
                     /translation="MMSGKGHEWNACMNTWNMQNDHNSMVDSSFPNDNVVDGISSDEN
                     EPSTLDLIRDVAFPNAAHATGRRRMSEPSHSHDSNHLTDNLLSNNIDPNGIEIWTPTS
                     TDALIHKPLNELLRAVHLSPRDEDPNLMEDRFYHTMLNENDAHYNRGDHVVSKVKFAD
                     HNTTNDFPSNIRRHSVTFDTNSALSKDYNNKDIYPNFASFINENGSPLQILYNKIQVF
                     LIRNKISLEFLKIFRNYIYLLEKNNENPENDQFVLRLQNELSRSYRLTSEMKEILSIF
                     ILNPSTLLTKLAHWEYNKDENIKRNFLKFWLQTVNKKLKLQYLEIRWNEYLKTKWFNF
                     WNFKYTQDIEMISKDAIKFDNERQLIKAWDLWERKIFLYKAQDSLANKYFLEHVFNRT
                     KRNFVRIKQLKEKSVNFHNKLLKKDVIRTWQLKRIQKTFDKKLNENRLNCMFRKIIKK
                     WDVIKIKKERATVTNIFFQRSHYLKIWTSNTEKSQIKINELVSLENRFIKQTKMNNLK
                     NIMKRKKQEYITKEKLDDILLCFIFNHIWRRRYTENVDCLTLLNINEKKLLKRTLTFW
                     KQNLHLRLKADEMFRKNNYLQYIKKWKIQSRLAHLESEKNRKLFIDKFGLWHKKLSVN
                     KQYRKYFKTVVLRRGLKKWTESIHRTKRLNSKAIAYNKNKLQLRYFRKWLQSKQGIIE
                     NDEKARLFHKLKIILKIKKCIQHIKNVKILSDKIGSSFVRNRCLQKYYSLWREKRYEN
                     YKARLISLGKRYENHLHSKIKSKYFTIWGQQYRLYTVECGIRGQESRNLFLKKFAMRL
                     IKEQMIEKENLSIMSLQYDISRLKIKVFLRWHNHLSYLVKLNEIANDKINEDNIHLLQ
                     DYTKNWSMKFMRIQKNEESVPTFRKRWDRATVRGIFMLWKNKLKNFERNLEAIPNGTP
                     NFKTPRKSIMGTSSTIPGSERMKDSKMKAMMNHYSKARRAIPSPLKTSSSLNLSARKK
                     IEGRSWEGRSPSPTIHMGNSNTNDQRVIRNNSISLGDIADIKPKTILQSRERTPVKDL
                     SSIDDTNDTRINPRLKGSPTRRNPRLTNTK"
     gene            <559647..>561083
                     /gene="NDAI0C02440"
                     /locus_tag="NDAI_0C02440"
                     /db_xref="GeneID:11496658"
     mRNA            <559647..>561083
                     /gene="NDAI0C02440"
                     /locus_tag="NDAI_0C02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669099.1"
                     /db_xref="GeneID:11496658"
     CDS             559647..561083
                     /gene="NDAI0C02440"
                     /locus_tag="NDAI_0C02440"
                     /inference="similar to DNA sequence:INSDC:YJL002C"
                     /note="similar to Saccharomyces cerevisiae OST1 (YJL002C);
                     ancestral locus Anc_5.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669147.1"
                     /db_xref="GeneID:11496658"
                     /db_xref="GOA:G0W7Z3"
                     /db_xref="InterPro:IPR007676"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z3"
                     /translation="MNASIFWWVFITFFIHMNSVLCIENFIPEQVWENIDYRRAIDVS
                     KSYLSERVEIRAKNVGPESVTEYYFALPRNSLGKVSMFTAVIQGTDTYLNCQLFPNVT
                     RLEETGEYVGYGVINFPSPIQPEQEFSFITALYYNVAGVPYPEYIAISDEQSLLLKTN
                     RFPISAYPTVESTLTIGGSSSFEELNAPDDAYLKGKTNVPPNEEAIFFGPWDDIKPFE
                     KEQDVEVVFNHNLPLNEVTLLKRDIWVSQWASTLEFKEYYELKNKGAKLDKGFSRINY
                     MRDQQQADMRKSHYLAIIEMLLPENPFGHYYNDLVGLVSTAKIQENHYFLKPRFPIFG
                     GWNYNFTIGWTNQLSDFLHKSNDDSDMYLLSVPLLNGPSDTVYDTVEYSVYVPEGAKI
                     ADIDTPIPFVNLSVKAEKSYLDLKKGHVRVKITFKNLVNEIAGAKILIKYQYTKNAFI
                     QKPLSIAIYIFIALMFIFLLKNINLNVK"
     gene            complement(<561281..>563218)
                     /gene="NDAI0C02450"
                     /locus_tag="NDAI_0C02450"
                     /db_xref="GeneID:11496659"
     mRNA            complement(<561281..>563218)
                     /gene="NDAI0C02450"
                     /locus_tag="NDAI_0C02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669100.1"
                     /db_xref="GeneID:11496659"
     CDS             complement(561281..563218)
                     /gene="NDAI0C02450"
                     /locus_tag="NDAI_0C02450"
                     /inference="similar to DNA sequence:INSDC:YLL004W"
                     /note="similar to Saccharomyces cerevisiae ORC3 (YLL004W);
                     ancestral locus Anc_5.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669148.1"
                     /db_xref="GeneID:11496659"
                     /db_xref="GOA:G0W7Z4"
                     /db_xref="InterPro:IPR020795"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z4"
                     /translation="MSVNAFADTQKGFYTIFPKIDPKVTAQAGDTIPFVKLLNGHESA
                     TIVARRWDLYNQLHSQFHDQVDGIVENIENDLKTEISNLVFDKNTDDDTCKRSQCFNS
                     VFLLGSDSTIKITAPPTEEDPSVLNAIIDMDKKECPNVRMMLRRAMFKLFSIGDTDKH
                     KTTGSKEDQLKQEDKEMNEDDGSDSDVEDLGHRAVDEVSYDLSLVANFKDIFHKNLNL
                     IFNIKELESINLSSLDSFLVLLKSTLKYPHVKITFIFNISSNLSNIEKNLKQSTIRLL
                     KKKYSALDISSNRGFKYANRIFQSFLDTVEGKLNLSDRFIKFILTKMANNSNHNLKLL
                     TKMLDYSLMSYFYQNPFSVFIDPINTEFLTDEHFKILRKCPTFMFFIEGLINNQAPRS
                     EILGLLSNQDSSLEEFFVEFLVRENPINGHVKFVANILENELNIKNYNLIELYYSLLT
                     GELDSYLERWPACEQFKRELKFEPIDTIFQELFTLDNNNGLLSQAIFPLYKSNMEDDL
                     LLWERVLPPPHSSLAEGEEMTERETIVSSLEKLVGPITGQLFKLYREANSTINIYDFY
                     RAFKSTMPEKEIMDFVIEYSKDDESLSRFIDTDESHLAFEKITLILFMQAIFDFDHIG
                     LIKEYKSKNYNFVEKCVWRGI"
     gene            <563500..>566217
                     /gene="NDAI0C02460"
                     /locus_tag="NDAI_0C02460"
                     /db_xref="GeneID:11496660"
     mRNA            <563500..>566217
                     /gene="NDAI0C02460"
                     /locus_tag="NDAI_0C02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669101.1"
                     /db_xref="GeneID:11496660"
     CDS             563500..566217
                     /gene="NDAI0C02460"
                     /locus_tag="NDAI_0C02460"
                     /inference="similar to DNA sequence:INSDC:YLL005C"
                     /note="similar to Saccharomyces cerevisiae SPO75
                     (YLL005C); ancestral locus Anc_5.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669149.1"
                     /db_xref="GeneID:11496660"
                     /db_xref="GOA:G0W7Z5"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z5"
                     /translation="MHYTKNRKMIKEGTYRGNRLNPHFDFNSNNSQLVINFNPIKNPS
                     SSSTKNFTSSIISRFLNNTRTGSAHRHVGITLQRFLSGILLSVIFLAFQILLFLFLRT
                     KLKSIYQANRVLKLHEKGQEDDYGKDDSGTPWGDNTTKTEKKTNWASQLFMASDEIYK
                     KKCGLDAYFLLRFLKFLIFFFFILSLVHIPILIPLHLFSNDQNMIYEDYDRKDDKLDQ
                     LKSHLLDKLNMSNIIPPAEPNILIIHLILGVFVISWFHIMLNSELSFTTGISTQEILK
                     DKYQTVLYVDNVPKDMGKIMEHFSLIGSIRDVQFLSRDTKKYYTIWKRMCSIQEKIET
                     IIMEIMLEKFFKSTRKPKGWKMYRFYWNKLIFFSKTSYRLFNFRIRLKWKDSSKIIAS
                     HYPSWEIEKQSFIENRYNKFQEVLAKYNKISEKWEKEYYQLETGHQNFITSNRHANPD
                     AYLEKVFIQFDTVETAHVFGQLLLFQHHKEWNNVVIGPNPNDIRWSNITRTNSYAIFL
                     RSVAANILSILTIIGWIIPVGLIGLISQIPYLRSPVKLPSVIINNTEFINDMLMSIFS
                     VMTLVFLTEVVPYIFRWFSLLKVCKTGVEIQIDIQRWFFIFLFVHIFLVVTISSGLSF
                     IIESLVNNPVSIPSLLAHDLPKSSNFLCSFVLMRGLAYAGGNIIRMKELLCELLYYKP
                     FIYTPHKRFERLKTSLSFQWGAIYPIFSVIGCIGIIYSVIAPVILPMCCVSFSLVYIS
                     FKYLFEFQYNNKNKSETFGKLYPQALMQLYAGIYCMEICLMGLFAISNGYKLSFCMLL
                     IFVSTIIIQYKISTKHLSQLNHLPLYYIKNSAKLDVRSREVEHLCNLKDYEIPLINAC
                     KKYDEIWILNDGNGIGEIEQDNLERNYDIVCNSERYFINSSGDIYLNDL"
     gene            complement(<566264..>567580)
                     /gene="NDAI0C02470"
                     /locus_tag="NDAI_0C02470"
                     /db_xref="GeneID:11496661"
     mRNA            complement(<566264..>567580)
                     /gene="NDAI0C02470"
                     /locus_tag="NDAI_0C02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669102.1"
                     /db_xref="GeneID:11496661"
     CDS             complement(566264..567580)
                     /gene="NDAI0C02470"
                     /locus_tag="NDAI_0C02470"
                     /inference="similar to DNA sequence:INSDC:YLL006W"
                     /note="similar to Saccharomyces cerevisiae MMM1 (YLL006W);
                     ancestral locus Anc_5.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669150.1"
                     /db_xref="GeneID:11496661"
                     /db_xref="GOA:G0W7Z6"
                     /db_xref="InterPro:IPR027537"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z6"
                     /translation="MSKYSVLGNDSQLRSSDVGNMLSLDEYINKTLPLHLKELLLDNL
                     KKQKLIPNNIAIDEDILLNPELLPIFNESLLSSSTAIHSPTLSIASPSWSFAQGFIIG
                     QISIIMLLIFFIKFFIFSDTQPKDRVLANTTSKLSILSIFKRGDNSNSIEQDGVVPYN
                     TERVNDSNDEQTTIISTILEKTYYDVTSHDPESLDWFNVLIAQIIEQFRNELWLEKEG
                     ILNSLNEYLNTRKELSEYLGPITITEIDIGSDFPIFSNCRVNIVSNSVGKKNLQARID
                     IDLNDRLAFGLETNLVLNFPRPSIATLPIKINVAIIRFQGCLNISLTTAEEFSSKECN
                     SQYNASTDKSTDRANESTGYYLVFSFSPEYTMEFDIHSMIGSRSKLENIPKISSLIEY
                     QIKKWFVERCVEPRFQFVKLPNLWPRSKNTREEKTSQMDAVNKENS"
     gene            <567896..>570082
                     /gene="NDAI0C02480"
                     /locus_tag="NDAI_0C02480"
                     /db_xref="GeneID:11496662"
     mRNA            <567896..>570082
                     /gene="NDAI0C02480"
                     /locus_tag="NDAI_0C02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669103.1"
                     /db_xref="GeneID:11496662"
     CDS             567896..570082
                     /gene="NDAI0C02480"
                     /locus_tag="NDAI_0C02480"
                     /inference="similar to DNA sequence:INSDC:YLL007C"
                     /note="similar to Saccharomyces cerevisiae YLL007C;
                     ancestral locus Anc_5.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669151.1"
                     /db_xref="GeneID:11496662"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z7"
                     /translation="MTTESKQRTLIETLRFLQEKSEAAESSCVLTHDEASQCYQATYS
                     SMPELQTNSEVLNDANNVLSTLIPMTSSYDLSKTVLTNPKFWSLFTYLIPTMDVQMFT
                     TNFRLVFEVLLNPSFKNHETSLVMICKFMQTKRIILDTLVANLSSLPLETSSQLIIDT
                     IICISLYLESLNALSKFDRHTAALVIPETCLHLVDCGWPNIVTALLLSKNRDVSQVII
                     ERFIRNKRQLCDFMSAFKLSDYGKTTLSDRLFNAVNNVLPTINNWMYEFNENANEEYI
                     DLLNLSFLQAYDIITFLENPSLSFKKSFSEQLLFGENPFPLYETLFRVSDELHTFFCR
                     NDKNLKVNPHIPCLLLNKEAFIYALMDNQLKLWIDSGSKSKEDINSLLTLLPVILEKV
                     NRILSSEKSPSSPQSHLTTAGSPSVSSTSLVAFSQSKSNLNKTLSIIQSLTYKTARQW
                     QLDELKSTHYKKWARHMSGFDKLLSNQVVDYVTHQRLLQLQKGAWVYAENPLDSNIKV
                     PKLYFLVVSDNHANLLIREFNTKQDELPIVEENKIWKNNEERSNIPIHSSYSSANRQE
                     NNPGKTTKMQDKDVPRRETIVIPLKHIVHFEKRELNRHISNDKIFEDEKSSKNLVNLV
                     HTTLYTEAKLSDKNRKHIFKFYLDSKEAAYIWLDGLQLISSSKHKADISGETKKQIET
                     LIDLRKNVQMIYLNIDDDLELSEVDTDDEEFDLETLKNLSTDFFYE"
     gene            complement(<570276..>572591)
                     /gene="NDAI0C02490"
                     /locus_tag="NDAI_0C02490"
                     /db_xref="GeneID:11496663"
     mRNA            complement(<570276..>572591)
                     /gene="NDAI0C02490"
                     /locus_tag="NDAI_0C02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669104.1"
                     /db_xref="GeneID:11496663"
     CDS             complement(570276..572591)
                     /gene="NDAI0C02490"
                     /locus_tag="NDAI_0C02490"
                     /inference="similar to DNA sequence:INSDC:YLL008W"
                     /note="similar to Saccharomyces cerevisiae DRS1 (YLL008W);
                     ancestral locus Anc_5.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669152.1"
                     /db_xref="GeneID:11496663"
                     /db_xref="GOA:G0W7Z8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z8"
                     /translation="MKRNFKNLDFVPTISDSEDDIPDLDDNSDVESQIEVKSKKSIQK
                     KNKKNIKKKQEKADSNNDNANEDVHDDLNENFQFNLDNDDEFAKNANLQSWDFMSNGD
                     NNGDEPIRKDVDLEKIIRRKGGLIKLARVEGDDEDDEEEEGEEIKDVDENSEKQPEYD
                     EDEGEDELAMDGFGMGAKKIKEDQYDEEDEDEDDNDDDQEERESSDEDNSIHNDEEEK
                     EEGEDEDTAEEVAKFYAPEAEGDDAKKQTHTSFNTLSLSRPVLKGLANLGYNKPSPIQ
                     SATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLFKPAKVSSTRVIVLTPTRELAI
                     QIADVAKKIGKFVNGLTFGLAVGGLNLRQQEQILKQRPDIVIATPGRFIDHVRNSASF
                     NVDSVEILVMDEADRMLEEGFQEELNEIMQLLPTKRQTMLFSATMNSKIKQLINLSLK
                     KPVRIMINPPKQAASKLTQEFVRIRTRDHLKPALLFNLIKKLDEYSQKRMVVFVARKE
                     TAHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVLICTDLASRGLDIPKI
                     EVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLVGESSNERSIVRDAIKSVEDVSKI
                     KNDGSRALGRQVNWNQVEEINKLVENMAGTVEDVLEEEKQEKEILRAEMQIRKGENLL
                     KHRAEIQARPRRTWFQSETEKKNAKIFGVLAKNKKEVNSKKRKRQEAMEDAPSNRMYK
                     KTQKDRVDDQERTFRKQKKSDGKKKFKKGKK"
     gene            <573246..>573479
                     /gene="NDAI0C02500"
                     /locus_tag="NDAI_0C02500"
                     /db_xref="GeneID:11496664"
     mRNA            <573246..>573479
                     /gene="NDAI0C02500"
                     /locus_tag="NDAI_0C02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669105.1"
                     /db_xref="GeneID:11496664"
     CDS             573246..573479
                     /gene="NDAI0C02500"
                     /locus_tag="NDAI_0C02500"
                     /inference="similar to DNA sequence:INSDC:YLL009C"
                     /note="similar to Saccharomyces cerevisiae COX17
                     (YLL009C); ancestral locus Anc_5.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669153.1"
                     /db_xref="GeneID:11496664"
                     /db_xref="GOA:G0W7Z9"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:G0W7Z9"
                     /translation="MSDLKTPAVDTTDTPVDNTKIAQQEEKPKPCCVCKPEKEERDKC
                     LLFNTDDSDSSLSSCEEYIQKYKACMKGYGFEV"
     gene            complement(<573717..>576260)
                     /gene="NDAI0C02510"
                     /locus_tag="NDAI_0C02510"
                     /db_xref="GeneID:11496247"
     mRNA            complement(<573717..>576260)
                     /gene="NDAI0C02510"
                     /locus_tag="NDAI_0C02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669106.1"
                     /db_xref="GeneID:11496247"
     CDS             complement(573717..576260)
                     /gene="NDAI0C02510"
                     /locus_tag="NDAI_0C02510"
                     /inference="similar to DNA sequence:INSDC:YHR028C"
                     /note="similar to Saccharomyces cerevisiae DAP2 (YHR028C);
                     ancestral locus Anc_5.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669154.1"
                     /db_xref="GeneID:11496247"
                     /db_xref="GOA:G0W800"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W800"
                     /translation="MSVNQDEREPLLQDDGGDGAAFARRKQFLDRTTKLGIILVLLIW
                     GTILLLKNIPKLTNDGNNDKKNQPPHRKFKLPNPNVTEDGLSKILYENIKNETFKPVF
                     HSLQWISNSDDSNSHDDKGLYVATINDSYVIKSVFDKDYSQTLLENKQFSYSGENLTV
                     DYFSASPDLKYLLIRTNSKKNWRHSSFGTFFIYDKDAEEEKKFHKLGDNIALAQWSPN
                     SIDIAYVQNNNIYLYSVAECKITATITDDGNSRIFNGKPDWVYEEEVLETDRALWWSP
                     KGDYLAFFKTDETKVEEFTIPYYVQNPDDIYPEMRPIKYPKSGTPNPTVDLWIYNLVD
                     QSSHPTDVNLQHMHAESPVLITEVKWINNESLIAKISDRSSDILKVLLIDADLKKTEM
                     VRENPSEGGWWEITHNTMPIPKDSSHNRSEHGYIDIFPINGFNHLVYYSPATSNEPIV
                     LTNGSWEVVSGPLAFDAELNRVYFIATIESSSTQRHLFYVELNNPQEIIQVSDVKNGG
                     VYSASFSSGSKFALLTYRGPRLPYQKIIDLRSKERDQEIEGNVIGETLYYLEKNEKLQ
                     EILSEYDIPQKKVKLLNLGKDDDGDNIIANAFEILPNGFNPDLQDYYPVFFYAYGGPN
                     SQQVQESFSVGFNEVVASQLGAIVVVVDGRGTGFKGKKFRSLVRDNLGEFEAIDQIAA
                     AKQYSAKSYVNSEKISLFGWSYGGYLTLKVLERDGGETFKYGMAVAPVTDWRLYDTVY
                     TERYMHTPQENIEGYIKSSVHDVLPFKEVKRFLVMHGTGDDNVHFQNTLKFLDLLTVN
                     EVRNFDVHVFADSDHAIKYHNANAAVFTRLLNWAADAFTGRFEYDNERR"
     gap             576538..576557
                     /estimated_length=20
     gene            complement(<577407..>578639)
                     /gene="NDAI0C02520"
                     /locus_tag="NDAI_0C02520"
                     /db_xref="GeneID:11496248"
     mRNA            complement(<577407..>578639)
                     /gene="NDAI0C02520"
                     /locus_tag="NDAI_0C02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669107.1"
                     /db_xref="GeneID:11496248"
     CDS             complement(577407..578639)
                     /gene="NDAI0C02520"
                     /locus_tag="NDAI_0C02520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669155.1"
                     /db_xref="GeneID:11496248"
                     /db_xref="GOA:G0W801"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:G0W801"
                     /translation="MSERLQSIKSHLLGGNDDSSLLTETRPDDIVIVSAYRSAIAKGF
                     KGSFKDVNTDYLLYQFLLELIKRLPDSLSNHLDLIDEITCGNVLNHGAGATEHRAACL
                     ASGIPYSVPFMALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTKNYMNINPLG
                     TVSDELKVNKDAKKCLIPMGITNENVSSNFKVGREQQDEFAARSYQKAEDAISKGKFK
                     NEIVPISLPDGKVVDTDEGPRANVTAESLGKIKPAFIKDKGTTHAGNSSQVSDGVSGV
                     LLTRRSVAKQLGLPIVGRYLAFQSVGVPPEIMGVGPAYAIPKVLKSINLKIESIDVFE
                     INEAFAAQALYCIKKLDIDLNKVNPNGGAIALGHPLGCTGTRQIATLLNEMEKGQVGV
                     VSMCIGTGMGAAAVFVKE"
     gene            <580884..>583934
                     /gene="NDAI0C02530"
                     /locus_tag="NDAI_0C02530"
                     /db_xref="GeneID:11496249"
     mRNA            <580884..>583934
                     /gene="NDAI0C02530"
                     /locus_tag="NDAI_0C02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669108.1"
                     /db_xref="GeneID:11496249"
     CDS             580884..583934
                     /gene="NDAI0C02530"
                     /locus_tag="NDAI_0C02530"
                     /inference="similar to DNA sequence:INSDC:YKL210W"
                     /note="similar to Saccharomyces cerevisiae UBA1 (YKL210W);
                     ancestral locus Anc_1.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669156.1"
                     /db_xref="GeneID:11496249"
                     /db_xref="GOA:G0W802"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:G0W802"
                     /translation="MTNKIGEVDESLYSRQLYVLGKEAMLKMQLSNVLIIGLKGLGIE
                     IAKNVTLAGVKSLTIYDPALVAIEDLSSQFFLTESDVGKPRDQASKAKLAELNSYVPI
                     NILQSIDNEESLKEFQVIVATDTVNLEDKVKLNEFCHPLGIKFISTETRGLFGNVFTD
                     FGDEFTILDPTGEEPRTGMVSDIESDGTVTMLDDNRHGLEDGNYVKFSEVQGLEKLND
                     GSLFKVEVLGPFAFKIGSVAEFGQYKKGGIFTEVKVPQKTSFKTLQQSLDDPEFVFAD
                     YAKFDRTPQLHLGFQALHQFAVRHQGQLPRPMNEEDANELVKLVTDLSAQEPSILGGA
                     DAEINDKLIKELAYQARGDIPGIIAFFGGLVAQEVLKACSGKFSPLKQFMYFDSLESL
                     PDPKEFPRTEETTKPLNSRYDNQIAVFGIDFQKKVANSKVFLVGSGAIGCEMLKNWAL
                     MGLGSGLEGHIVVTDNDSIEKSNLNRQFLFRPKDVGRNKSEVAADAVVAMNPDLLNKV
                     EPKIDKVGPETENIFNDSFWQNLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTLGT
                     KGNTQVVIPGLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFADSAE
                     NANVYLSQPNFIEQSMKQSGDVKGTLESIADSLNNRPSNFDDCIQWARLEFEKKFNHD
                     IKQLLYNFPKDAKTSNGEPFWSGAKRAPTPLEFDIDNDDHFHFVVGAANLRAFNYGLP
                     DEGTNPDVEHYKEVISSMIIPDFTPNANLKIQVNDEDPDPNANNDVGDELDMLASSLP
                     KPSTLTGFSMKPVEFEKDDDTNHHIEFITACSNCRAQNYFIEVADRQKTKFIAGRIIP
                     AIATTTSLVTGLVNLELYKVVYGCEDIEQYKNGFVNLALPFFGFSEPIASPKAKYNDV
                     TYDKIWDRFDIQGDIRLSDLIAHFEKKEGLEITMLSYGVSLLYASFFPPKKLKERLNL
                     PITELVKLITKADLPSHVRTMILEICADDKEGEDVEVPFITIHL"
     gap             587061..587168
                     /estimated_length=108
     gap             587815..588658
                     /estimated_length=844
     gene            <589154..>590338
                     /gene="NDAI0C02540"
                     /locus_tag="NDAI_0C02540"
                     /db_xref="GeneID:11496250"
     mRNA            <589154..>590338
                     /gene="NDAI0C02540"
                     /locus_tag="NDAI_0C02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669109.1"
                     /db_xref="GeneID:11496250"
     CDS             589154..590338
                     /gene="NDAI0C02540"
                     /locus_tag="NDAI_0C02540"
                     /inference="similar to DNA sequence:INSDC:YJR075W"
                     /note="similar to Saccharomyces cerevisiae HOC1 (YJR075W);
                     ancestral locus Anc_1.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669157.1"
                     /db_xref="GeneID:11496250"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G0W803"
                     /translation="MTKVRLSKTNNKWKRSLWILAAITLVSISLYTFFPQSKGNDLQY
                     TLRNLPNEITNAVTINNQQQKILGSEEIIRKFETLIEELNQENERQAKKFEKQHKTLE
                     KKINLLKPISKDSPLSARLATRFPYKPKSKFPAFIWQTSSASMASSSTPSKNSQKWID
                     KNPGFVYEIVNPSFAEKLIKYYFNNMPEIWETYMKFPKGSSNQMNFVKYLVLLVHGGT
                     YCDKDTIPQQPIPNWIPEATNPKDIGLLISIRDESLNLNDNDPIRKLQFENSIVHAKQ
                     HHPIIRDIIINIVYSTLNKENNSKSHTPRFNTHWEELGLWTDVIFKYFNHHLKKISGT
                     TDQVISWQSLKSLKTPRLIGDILIYPAISFNSPTDSNDRDPLYLASHAITKRQLLQDS
                     HH"
     gap             591878..592701
                     /estimated_length=824
     gene            <592834..>593607
                     /gene="NDAI0C02550"
                     /locus_tag="NDAI_0C02550"
                     /db_xref="GeneID:11496251"
     mRNA            <592834..>593607
                     /gene="NDAI0C02550"
                     /locus_tag="NDAI_0C02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669110.1"
                     /db_xref="GeneID:11496251"
     CDS             592834..593607
                     /gene="NDAI0C02550"
                     /locus_tag="NDAI_0C02550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669158.1"
                     /db_xref="GeneID:11496251"
                     /db_xref="UniProtKB/TrEMBL:G0W804"
                     /translation="MKSCGRYAYLYAPETVFISGQNKKLSSTFLACELESKQGRFRDL
                     KHFYIHELRFDGDIGWIGTLDYHGSKNSCFNSVHERTIELENGDLEKRYFHSEILEPF
                     SKLKHPEDISIFFQNVEKDQAILIRNLFLLYYIRLLNQKETPSALKLVNMFKNPPFDI
                     FVRPSDDGRDKFYRYYNVQNVTEDEEYYYEQYFISRMRYMTGIDTKEIKFEGSVLNPE
                     CYDVPSSKSSGTETDETCVVSDDYKSYGKSSDSDIFETL"
     gene            complement(<594150..>595439)
                     /gene="NDAI0C02560"
                     /locus_tag="NDAI_0C02560"
                     /db_xref="GeneID:11496252"
     mRNA            complement(<594150..>595439)
                     /gene="NDAI0C02560"
                     /locus_tag="NDAI_0C02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669111.1"
                     /db_xref="GeneID:11496252"
     CDS             complement(594150..595439)
                     /gene="NDAI0C02560"
                     /locus_tag="NDAI_0C02560"
                     /inference="similar to DNA sequence:INSDC:YJR076C"
                     /note="similar to Saccharomyces cerevisiae CDC11
                     (YJR076C); ancestral locus Anc_1.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669159.1"
                     /db_xref="GeneID:11496252"
                     /db_xref="GOA:G0W805"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W805"
                     /translation="MSGIIEASSALRKRKHLKRGINFTVMVVGQSGCGRSTFINTLCG
                     QQVVDVSTMVLLPTDTSTEIPLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPS
                     FEIISDYVRHRYDEILLEESRVRRNPRFKDGRVHCCLYLITPCGRGLKEIDVEFMKQL
                     GSLVNIIPVICKSDSLTPEELKLNKTLIMDDIDRFKLPIYNFPFDEEEVTQDDYETNM
                     YLRSLLPFSIIGSNEVYDMGNDLIIRGRKYPWGMLDVEDANISDFVILRNALLISHLH
                     DLKDYTHEILYERYRTEALSGESVLFGGNSKDVDQRLDDDNNNNNINATLTSPKVPTS
                     EMLNEKANGTNLNERVSNTQDTYLAREEQIRLEEERLKAFEERVQQELLLKRQELLDR
                     ERELREIEERLEKEAMLKRQEQEEQNLNEELSDLADN"
     gene            <595884..>597389
                     /gene="NDAI0C02570"
                     /locus_tag="NDAI_0C02570"
                     /db_xref="GeneID:11496253"
     mRNA            <595884..>597389
                     /gene="NDAI0C02570"
                     /locus_tag="NDAI_0C02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669112.1"
                     /db_xref="GeneID:11496253"
     CDS             595884..597389
                     /gene="NDAI0C02570"
                     /locus_tag="NDAI_0C02570"
                     /inference="similar to DNA sequence:INSDC:YKL211C"
                     /note="similar to Saccharomyces cerevisiae TRP3 (YKL211C);
                     ancestral locus Anc_1.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669160.1"
                     /db_xref="GeneID:11496253"
                     /db_xref="GOA:G0W806"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G0W806"
                     /translation="MPASTVAAAAVPKKNVVLIDNYDSFTWNVYEYLCQEGASVTVYR
                     NDEISLPELIKLAPEILIISPGPGHPKTDSGISRDCIRHFAGKIPVFGICMGQQCMID
                     VFGGEVTYAGEIVHGKTSPITHDNKGFFKDVPQGVAITRYHSLAGTEESLPDVLEVTA
                     TTESGVIMGVRHKEFTVEGVQFHPESILTEEGHLMIKNILNITGGTWKENEENLKRLG
                     NISKKESILNQIYKQRMIDVEEQSNIPGFTKKDLETNFKLNLAPKVQNFYQRLISGTT
                     NNNKKAAVLAEVKRASPSKGDIFPNAVAAEQALKYAQAGASAISVLTEPHWFKGSLED
                     LINVRKVLDKEYAQDETNRPCVLRKEFIFSKYQILEARLAGADTVLLIVKMLSQELLK
                     ELYDYATIEMGIEPLVEVNSKEELDIALKINARVIGVNNRDLHSFTVDLNTTSNLVDA
                     TPKDTLLIALSGITESKDADKYKEEGVHGFLVGEALMRSDDVKKFIDALCV"
     gene            complement(<597765..>599600)
                     /gene="NDAI0C02580"
                     /locus_tag="NDAI_0C02580"
                     /db_xref="GeneID:11496254"
     mRNA            complement(<597765..>599600)
                     /gene="NDAI0C02580"
                     /locus_tag="NDAI_0C02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669113.1"
                     /db_xref="GeneID:11496254"
     CDS             complement(597765..599600)
                     /gene="NDAI0C02580"
                     /locus_tag="NDAI_0C02580"
                     /inference="similar to DNA sequence:INSDC:YKL212W"
                     /note="similar to Saccharomyces cerevisiae SAC1 (YKL212W);
                     ancestral locus Anc_1.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669161.1"
                     /db_xref="GeneID:11496254"
                     /db_xref="GOA:G0W807"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:G0W807"
                     /translation="MSGPMLFAQTSEGLYFKRIDGDQENVVFLSSQDQSAKLISVDHF
                     PAASNSSAVVKNIASLIGFLKLKLNKYAIIANTVEETGNFQNNSIYKIASHSIVPCKI
                     TSNIDSDESEYLKLLELQLKTATLFFSYTYDLTNSLQRNNSSGPTPYDERFFWNHYLT
                     GELRSINATAFIQPVIYGYAKFIETIFQSSPITIGLITRRSRFRAGTRYFRRGIDQDG
                     NVGNFNETEQLLSVNNKDIYSFLQTRGSVPVQWAEINNLQYKPNLVLNADESSTVAAA
                     KKHFNQQIELYGDNYLVNLVNQSGHEKPVKDAYENVVKQIGNDKLHYIYFDFHHECRK
                     MKWHRVKLLINRLQELGLTNDDFFHMQINSDGGRKIVNLQKSTVRTNCMDCLDRTNVV
                     QSVLAHWVLQKEFETAGIVEKDKLWENDESLLFIFQNFWADNADAVSVSYSGTGALKT
                     DFTRTGKRTKLGAFNDFINSASRYYQNNFTDGPRQDSYDLFLGNFKPYIQSIKSPFPD
                     RRPVLIQIIPIVILVSLTIITSATFVPKDASFFSSKNLITFFLSLITFAGSFKYLIAN
                     GIQFVNWPKLVDVGFLVCKQTHNKERVFKGLKYIQNKHFIKPKKD"
     gene            complement(<600087..>601058)
                     /gene="NDAI0C02590"
                     /locus_tag="NDAI_0C02590"
                     /db_xref="GeneID:11496255"
     mRNA            complement(<600087..>601058)
                     /gene="NDAI0C02590"
                     /locus_tag="NDAI_0C02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669114.1"
                     /db_xref="GeneID:11496255"
     CDS             complement(600087..601058)
                     /gene="NDAI0C02590"
                     /locus_tag="NDAI_0C02590"
                     /inference="similar to DNA sequence:INSDC:YNL002C"
                     /note="similar to Saccharomyces cerevisiae RLP7 (YNL002C);
                     ancestral locus Anc_1.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669162.1"
                     /db_xref="GeneID:11496255"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:G0W808"
                     /translation="MSSSSTKPTPLNSTPEILLRKRRNADRTRLEKQELTREKQAKQK
                     KLKSQKKNRFIRAETIVATTLATTREKERIKRMSILETKKAKNDVDRLPSDKDFILKI
                     TERPHKETETEAETQTVEEEDEDDNLIKEKIEYDGKDTLLFVIRVKGPTAVNLPHKVF
                     KILSLLRLEELNTGVFVKLTKNVFPLLKLISPYIIIGTPSLNSIRSLIQKRSRILYTG
                     AKGDEEPHSIVLNDNNIIEDKLGEQGIICMADIIHEIATLGENFQTCNFFLQPFKLNR
                     EVSGFSSLNKLRKIKQRENESKIRQFSNASTAPIIQVDIDSLIAKLN"
     gap             601872..602231
                     /estimated_length=360
     gene            complement(<605643..>606554)
                     /gene="NDAI0C02600"
                     /locus_tag="NDAI_0C02600"
                     /db_xref="GeneID:11496256"
     mRNA            complement(<605643..>606554)
                     /gene="NDAI0C02600"
                     /locus_tag="NDAI_0C02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669115.1"
                     /db_xref="GeneID:11496256"
     CDS             complement(605643..606554)
                     /gene="NDAI0C02600"
                     /locus_tag="NDAI_0C02600"
                     /inference="similar to DNA sequence:INSDC:YNL006W"
                     /note="similar to Saccharomyces cerevisiae LST8 (YNL006W);
                     ancestral locus Anc_1.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669163.1"
                     /db_xref="GeneID:11496256"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G0W809"
                     /translation="MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLQITNDK
                     KLLAAAGHLNVKLYDINTTNPNPVGSFEGHKGNVTSVSFQQDNRWMVTSSEDGTIKVW
                     DVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQITPEEDV
                     SLESLSIASDGSMLAAANDRGNCYIWEMPNHTDASNLKPVKTFSAHETYVTRVLLSSD
                     VKHLATCSADQSARIWSVENGFQRECALEGHQRWVWDCAFSADSAYLVTASSDHYVRL
                     WDLSTREIVRQYGGHHKGAICVALDDV"
     gene            <606952..>607974
                     /gene="NDAI0C02610"
                     /locus_tag="NDAI_0C02610"
                     /db_xref="GeneID:11496257"
     mRNA            <606952..>607974
                     /gene="NDAI0C02610"
                     /locus_tag="NDAI_0C02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669116.1"
                     /db_xref="GeneID:11496257"
     CDS             606952..607974
                     /gene="NDAI0C02610"
                     /locus_tag="NDAI_0C02610"
                     /inference="similar to DNA sequence:INSDC:YNL007C"
                     /note="similar to Saccharomyces cerevisiae SIS1 (YNL007C);
                     ancestral locus Anc_1.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669164.1"
                     /db_xref="GeneID:11496257"
                     /db_xref="GOA:G0W810"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G0W810"
                     /translation="MVKETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEK
                     FKQISEAYEILSDSNKREVYDQYGLEAARSGGPSFGGAGGAGGFPGGAHSFSNDDAFN
                     IFSQFFSGGDPFGGHSAGGFGGMPGGMGGMGGMPGGMGGMPSMGGMGGMPGGFRSATG
                     ASQRPEEEVVTVNLPVSLEDLFTGKKKSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTK
                     ITYKNEGDFNPRTGGRKTLQFVLQEKAHPLFKRDGENLLYTVPLSFQESLLGFSKTVQ
                     TIDGRSLSLSRTQPIQPTETTTYPGQGMPNPKNPNQRGDLIITYKIDYPISLSDAQRQ
                     AIQQNF"
     gene            <608649..>609584
                     /gene="NDAI0C02620"
                     /locus_tag="NDAI_0C02620"
                     /db_xref="GeneID:11496258"
     mRNA            <608649..>609584
                     /gene="NDAI0C02620"
                     /locus_tag="NDAI_0C02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669117.1"
                     /db_xref="GeneID:11496258"
     CDS             608649..609584
                     /gene="NDAI0C02620"
                     /locus_tag="NDAI_0C02620"
                     /note="ancestral locus Anc_6.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669165.1"
                     /db_xref="GeneID:11496258"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G0W811"
                     /translation="MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLL
                     MDHFTVSHPAGFPDHPHHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIM
                     HSEIPVKMENGTPGIGIQLWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISG
                     KSYGTESVKDLAYTPIDYYIFNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPK
                     YSTVFFDTDGDSIKGKSAADEETEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNY
                     QYCINGFERARGWRSSIADGILEKDVPAFEKSSKD"
     gene            <609993..>611735
                     /gene="NDAI0C02630"
                     /locus_tag="NDAI_0C02630"
                     /db_xref="GeneID:11496259"
     mRNA            <609993..>611735
                     /gene="NDAI0C02630"
                     /locus_tag="NDAI_0C02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669118.1"
                     /db_xref="GeneID:11496259"
     CDS             609993..611735
                     /gene="NDAI0C02630"
                     /locus_tag="NDAI_0C02630"
                     /inference="similar to DNA sequence:INSDC:YOR002W"
                     /note="similar to Saccharomyces cerevisiae ALG6 (YOR002W);
                     ancestral locus Anc_6.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669166.1"
                     /db_xref="GeneID:11496259"
                     /db_xref="GOA:G0W812"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="UniProtKB/TrEMBL:G0W812"
                     /translation="MVPKKKTLMKNGSTSTVTSSSSQKSKVEDTKKSKKMNNNQPLET
                     ETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFG
                     DFEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLG
                     DSRGYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQ
                     PSLILIDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFF
                     AYLLSKSLFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIF
                     PFARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRK
                     YLLLYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFT
                     LWPLLKKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTL
                     LPSNWIWKVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNY
                     YKLFSMTKKNIHQL"
     gene            complement(<611899..>613182)
                     /gene="NDAI0C02640"
                     /locus_tag="NDAI_0C02640"
                     /db_xref="GeneID:11496260"
     mRNA            complement(<611899..>613182)
                     /gene="NDAI0C02640"
                     /locus_tag="NDAI_0C02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669119.1"
                     /db_xref="GeneID:11496260"
     CDS             complement(611899..613182)
                     /gene="NDAI0C02640"
                     /locus_tag="NDAI_0C02640"
                     /inference="similar to DNA sequence:INSDC:YOL001W"
                     /note="similar to Saccharomyces cerevisiae PHO80
                     (YOL001W); ancestral locus Anc_6.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669167.1"
                     /db_xref="GeneID:11496260"
                     /db_xref="GOA:G0W813"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G0W813"
                     /translation="MQGSSYRDESKPDNNICQDSNINVNKTSNTSSDTPSTQSHSTPN
                     VITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSNYATR
                     FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFIL
                     TAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSM
                     EYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGVQRPISPSPDAV
                     TVDYFLMRPRRISSASSIESAAATPLPKPNPPPQLTSVGESNYDNNNDSIGERSNAVT
                     FALSSTISNDSMSNSSYGDQPNLGSNIQKESSAVDNVQNNTTTISGNNSEHRMKSQHK
                     ALSPTVAYTPLMLTQESRTLSALTSKKRRLSGSES"
     gene            complement(613679..613751)
                     /gene="NDAI0Ctrna2T"
                     /locus_tag="NDAI_0Ctrna2T"
                     /db_xref="GeneID:11496261"
     tRNA            complement(613679..613751)
                     /gene="NDAI0Ctrna2T"
                     /locus_tag="NDAI_0Ctrna2T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11496261"
     gene            <614101..>615270
                     /gene="NDAI0C02650"
                     /locus_tag="NDAI_0C02650"
                     /db_xref="GeneID:11496746"
     mRNA            <614101..>615270
                     /gene="NDAI0C02650"
                     /locus_tag="NDAI_0C02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669120.1"
                     /db_xref="GeneID:11496746"
     CDS             614101..615270
                     /gene="NDAI0C02650"
                     /locus_tag="NDAI_0C02650"
                     /inference="similar to DNA sequence:INSDC:YOL003C"
                     /note="similar to Saccharomyces cerevisiae PFA4 (YOL003C);
                     ancestral locus Anc_6.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669168.1"
                     /db_xref="GeneID:11496746"
                     /db_xref="GOA:G0W814"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G0W814"
                     /translation="MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQ
                     FSLSMIWVSYLLAIFTNPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCN
                     QCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPS
                     YIFDRNEIIFLTILIPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYN
                     KKLLPMIIATLWEVYPNERTKVADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTV
                     MGSAFNWIWIFGVPDRNGLKFEKNEISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDT
                     SVESLVYDGEQVVRNRASNDTNISTINKDISREEWNNDWGESLVDFGVDIEAEVE"
     gene            complement(<615526..>620499)
                     /gene="NDAI0C02660"
                     /locus_tag="NDAI_0C02660"
                     /db_xref="GeneID:11496262"
     mRNA            complement(<615526..>620499)
                     /gene="NDAI0C02660"
                     /locus_tag="NDAI_0C02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669121.1"
                     /db_xref="GeneID:11496262"
     CDS             complement(615526..620499)
                     /gene="NDAI0C02660"
                     /locus_tag="NDAI_0C02660"
                     /inference="similar to DNA sequence:INSDC:YOL004W"
                     /note="similar to Saccharomyces cerevisiae SIN3 (YOL004W);
                     ancestral locus Anc_6.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669169.1"
                     /db_xref="GeneID:11496262"
                     /db_xref="GOA:G0W815"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:G0W815"
                     /translation="MSGIWNNPSTQDNTGSANVDRNNNRSNNSTEKRGLPGSASSDKE
                     IQDSASNRNEQITLPSINSQSFAHVVSNTNNSSNNISDNNSDNKHNKNSNNNNNGATP
                     ASITATTPSIFPANSNNINKNNMPVLHSVQTHQSPMNNPSVSPARAARAANTSTTTAT
                     ATTNNNIVESNRNNNVSQSHPQRNNSASAGFSVASFDNPLPSSNNNEVPPPVAPTVPQ
                     FQYIQPQPPVIQPPNIQQQQQQQSLPHQLIQSQQPQLQQQPQQQQSEEDPEYRPLNVK
                     DALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQGF
                     NTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVDNTNVSPTLPTVQPLLQQPQP
                     QGNNDTTNVINNAANQPQQVHAQTHLQEQTQAQTPADADAQAQAEVQAQVQAHAQAQA
                     QAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEV
                     YEQVTVLFNDAPDLLEDFKKFLPETPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPS
                     QLYPFSNNGPVPSGFYQIPQQNLPPIGSFSPPTATNANATTTPAAGTVVNNFRHGISM
                     QTALPSMMTPDTEAIPISNLRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNR
                     LPDQFPLDQQQSQQQQAQQQAQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENN
                     ITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELF
                     DWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCW
                     EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLET
                     IANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFAV
                     PIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLI
                     SEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEK
                     ERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSSTSNSTPSAKKRSLEL
                     DIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQQEQEEEDHMIDE
                     EMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDK
                     VTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFE
                     ESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSSTTTRDQ
                     IIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYYVTSY
                     ALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKLKI
                     KIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIKEKSEAFNKFLSSKRGWNNQ
                     FKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTTGVIAEPVIKPASNPIVVTPVTAA
                     IEAVATAPIPTDSGALTDNSDHKGKDDQETEGKPTPIETSAITELQN"
     gene            <621282..>621650
                     /gene="NDAI0C02670"
                     /locus_tag="NDAI_0C02670"
                     /db_xref="GeneID:11496263"
     mRNA            <621282..>621650
                     /gene="NDAI0C02670"
                     /locus_tag="NDAI_0C02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669122.1"
                     /db_xref="GeneID:11496263"
     CDS             621282..621650
                     /gene="NDAI0C02670"
                     /locus_tag="NDAI_0C02670"
                     /inference="similar to DNA sequence:INSDC:YOL005C"
                     /note="similar to Saccharomyces cerevisiae RPB11
                     (YOL005C); ancestral locus Anc_6.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669170.1"
                     /db_xref="GeneID:11496263"
                     /db_xref="GOA:G0W816"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:G0W816"
                     /translation="MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGN
                     LIRSELLNDGKVLFAAYKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILK
                     TNFETEWNLQTLASDENFGI"
     gene            complement(<621951..>624203)
                     /gene="NDAI0C02680"
                     /locus_tag="NDAI_0C02680"
                     /db_xref="GeneID:11496264"
     mRNA            complement(<621951..>624203)
                     /gene="NDAI0C02680"
                     /locus_tag="NDAI_0C02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669123.1"
                     /db_xref="GeneID:11496264"
     CDS             complement(621951..624203)
                     /gene="NDAI0C02680"
                     /locus_tag="NDAI_0C02680"
                     /inference="similar to DNA sequence:INSDC:YMR001C"
                     /note="similar to Saccharomyces cerevisiae CDC5 (YMR001C);
                     ancestral locus Anc_6.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669171.1"
                     /db_xref="GeneID:11496264"
                     /db_xref="GOA:G0W817"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W817"
                     /translation="MSLAPLQTINDKQVNTRSRAVNTPVKNALKPNTPIYSQHNNPDD
                     KENNDPSPEINANNKHKRVMTEQPQPKKKKEKLSSLCKTPPSLIKTRGRDYRREHFLG
                     EGGFARCFQIKDESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSMKHSNIVQFIDC
                     FEDDANVYILLEICPNGSLMDLLKKRKSLTEPEVRFFTTQICGAIKYLHSRRIIHRDL
                     KLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGKHSGHSFEVD
                     IWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLN
                     PLQRPTIIDIIDDVWFRGVFPARISPDVMDTVPNYEEELTLEESFINFKNCMANCGLI
                     ESGNKRRTSSSNKISSVTGNDDNGTNIEGTSNVSSSKTESNNGPSANATNTASSSNKP
                     FDYRTILPHALSPGGTKNKYKEVIDLEAQRKLNNLAREARIRRAQQSNMKNSLQPMLS
                     NVIKSEISLRILSSECLLAMNGILEAEAQKKMGGLPKLRLPKIKHPIVVTKWVDYSNK
                     HGFSYQLSTEDIGVLFNNGTTVLRLADAEEFWYISYDDREGWVAGHYLLADRPRELSR
                     HLEIVEFFAKYMSANLSRVSTFVREEYHKDDVFLRRYTRYKQFVMFELSDGTFQFNFK
                     DHHKFAISEGGKLVTYISPDHASLTYPLVEVLKNGGIPNNPGCNFMEKLYLIKEGLKQ
                     KSSILTLGQT"
     gene            <625861..>628203
                     /gene="NDAI0C02690"
                     /locus_tag="NDAI_0C02690"
                     /db_xref="GeneID:11496265"
     mRNA            <625861..>628203
                     /gene="NDAI0C02690"
                     /locus_tag="NDAI_0C02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669124.1"
                     /db_xref="GeneID:11496265"
     CDS             625861..628203
                     /gene="NDAI0C02690"
                     /locus_tag="NDAI_0C02690"
                     /inference="similar to DNA sequence:INSDC:YOL006C"
                     /note="similar to Saccharomyces cerevisiae TOP1 (YOL006C);
                     ancestral locus Anc_6.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669172.1"
                     /db_xref="GeneID:11496265"
                     /db_xref="GOA:G0W818"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:G0W818"
                     /translation="MTISPNRAHKSKNLESYTSDEEEDDMPLSQASIKKRRRVKINDI
                     LDDDEGDGDEDEDEDATLSSIAVKNKKQKISKIKVEEFDGSSSSQEKKVKKSKKKSKK
                     VSKKMISDPKNETKQESDDDDKPLKKEVSTELENDEEEEYKWWEKQNEDDSIKWTTLK
                     HNGVLLPPPYEPLPSHVKLYYEGKPVDLPLEAEEVAGFFGAMLETDHAKNPTFQKNFF
                     TDFLHVLEQNGGTKNGIEIKEFTKCDFKKIFDYYDLQREATRQKSSLEKKQIRLEREK
                     AEEKYKFCELDGRKEQVGNFKVEPPGLFRGRGAHPKTGKLKRRVQPEDIVLNLSEDAP
                     IPEAPAGHQWGEVRHDNTVQWLAMWKENIFNSLKYVRLAANSSLKGQNDLKKFEKARQ
                     LKDHIDTIRKDYRKRLKNKFMLERQKATAIYLIDVFALRAGGEKSEEEADTVGCCSLR
                     YEHVTLKPPNTVIFDFLGKDSIRYYQQVEVDKQVFKDLTIFKRPPKQPGHQLFDRLDP
                     SILNKHLQSYMPGLTAKVFRTYNASKTMQDQLDLIPNEGTVAEKLLRYNAANRTVAIL
                     CNHQRTVTKGHAQSVEKANMKIKELEWQKIRLKRGLLQLDSSELKKNKAYFKELDDLS
                     KEDEASIHAHIIERERDRLHKKFARENDKKKFMKEKELPESELKEWLDKVEEKKKQYA
                     KELKTNVVELRSSLNTVEKIKAQIEKLEQRILTATIQLKDKEENSEVSLGTSKLNYID
                     PRLNVAFCKKYNVPIEKIFTKTLRDKFKWAIESADENWRF"
     gene            <629101..>630222
                     /gene="NDAI0C02700"
                     /locus_tag="NDAI_0C02700"
                     /db_xref="GeneID:11496266"
     mRNA            <629101..>630222
                     /gene="NDAI0C02700"
                     /locus_tag="NDAI_0C02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669125.1"
                     /db_xref="GeneID:11496266"
     CDS             629101..630222
                     /gene="NDAI0C02700"
                     /locus_tag="NDAI_0C02700"
                     /inference="similar to DNA sequence:INSDC:YOL007C"
                     /note="similar to Saccharomyces cerevisiae CSI2 (YOL007C);
                     ancestral locus Anc_6.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669173.1"
                     /db_xref="GeneID:11496266"
                     /db_xref="UniProtKB/TrEMBL:G0W819"
                     /translation="MRFHKNLFRFSAMLLLSDTFVNAESDVSTLTATSKITLRRRELP
                     KLVTTTKTSTSSSSSSTHKATSTNVSSTSNSKSTVTTKTSSVTSQKSMPKIVSSSSSS
                     IDTSQTASVTTAPKISSTPVTIPATDGNYNIYRSNQLDGTVFIAFGSCLAFILVLLLS
                     LWAFLAFNAWNGARKEYQRKAIEEKYQYDPFYFNNSNNSNKSSSLSASSSSNNSNYSD
                     NESDISEKFLKPKNSRMTLYSMNSASALNLLNGKSSNTEFNSSEKTNNDLNSTFRNSM
                     FISPTEILQQETQFNNNSINGSSIFDSTNSTPKIQTFPTQIIANNNGSNFASLNTTDF
                     EGLGLKLNPGSEGTPDSNDKKKNFRPPSVHLDQLLDSED"
     gene            complement(<630301..>630969)
                     /gene="NDAI0C02710"
                     /locus_tag="NDAI_0C02710"
                     /db_xref="GeneID:11496267"
     mRNA            complement(<630301..>630969)
                     /gene="NDAI0C02710"
                     /locus_tag="NDAI_0C02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669126.1"
                     /db_xref="GeneID:11496267"
     CDS             complement(630301..630969)
                     /gene="NDAI0C02710"
                     /locus_tag="NDAI_0C02710"
                     /inference="similar to DNA sequence:INSDC:YOL008W"
                     /note="similar to Saccharomyces cerevisiae COQ10
                     (YOL008W); ancestral locus Anc_6.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669174.1"
                     /db_xref="GeneID:11496267"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:G0W820"
                     /translation="MIVTVPRSNKLLRFSLASTKRYHFTTTRTYRRTLFGFPHEFKEQ
                     KYTLHKTIHAKPRELYDIACEVSQYSKFIPYCVESFVDERNSSNNNRPTVAGLRIGFR
                     EYDEKFVCNVNCQEVINKENKDNRSFIVEADSLSQHLFDSFHSEWLIQPHPRRGSDFT
                     RVELALRFKFKSRLYNAVSSIFARSVTKVVMDAFERRVHDLKRLEMSRTISTMKTVEA
                     DKEL"
     gene            <631155..>631925
                     /gene="NDAI0C02720"
                     /locus_tag="NDAI_0C02720"
                     /db_xref="GeneID:11496268"
     mRNA            <631155..>631925
                     /gene="NDAI0C02720"
                     /locus_tag="NDAI_0C02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669127.1"
                     /db_xref="GeneID:11496268"
     CDS             631155..631925
                     /gene="NDAI0C02720"
                     /locus_tag="NDAI_0C02720"
                     /inference="similar to DNA sequence:INSDC:YOL009C"
                     /note="similar to Saccharomyces cerevisiae MDM12
                     (YOL009C); ancestral locus Anc_6.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669175.1"
                     /db_xref="GeneID:11496268"
                     /db_xref="GOA:G0W821"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027532"
                     /db_xref="UniProtKB/TrEMBL:G0W821"
                     /translation="MSFDINWDNIGNDSALNLIIKNQLSSYLQSISLPSYVRNLQITD
                     FSLGKIAPKITLKEINDPLQDFYDALNEDLDSSCDDDWVAPSPSDVQFLIEVEYTGDL
                     LISLSADLVLNYPSKEFITLPLKFGITDLGIHSLCLVAYMSKQIFISFLCDVSDPILD
                     NDTHNTESILDPNGSLMAPKRPFERISIIRSLKIDTEIGEQLQGEGSILKNVGKLEQF
                     LLEKFKDLLRQELAWPSWINLDMTGEEDVVDAHTEQND"
     gene            <632326..>633903
                     /gene="NDAI0C02730"
                     /locus_tag="NDAI_0C02730"
                     /db_xref="GeneID:11496269"
     mRNA            <632326..>633903
                     /gene="NDAI0C02730"
                     /locus_tag="NDAI_0C02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669128.1"
                     /db_xref="GeneID:11496269"
     CDS             632326..633903
                     /gene="NDAI0C02730"
                     /locus_tag="NDAI_0C02730"
                     /inference="similar to DNA sequence:INSDC:YMR004W"
                     /note="similar to Saccharomyces cerevisiae MVP1 (YMR004W);
                     ancestral locus Anc_6.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669176.1"
                     /db_xref="GeneID:11496269"
                     /db_xref="GOA:G0W822"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G0W822"
                     /translation="MNTYDEEEPDPWRSGPTTNAWSTTNPTITSNNTDRPDDSTSTRI
                     ASDLTKVSLIDRARSDLFNSSADVLEESIWNETLATQSNDSTTISAEATTTNQTFIPE
                     NILNQDTNKHIGNSMEDTNNVEEALNDWCDKIRKTYKPLDYDIIAIEEIPEREGLLFK
                     HANYSVKHLVDLPHVDSPKDKSVIRRYSDFVWLQEILLRRYPFRMVPELPPKRIGSQN
                     ADPVFLLKRKNGLRRFINLVMKHPVFKNDDLVLTFLTAPTDLSSWRKQATYDTSDEFT
                     DRKISVEFRKMWQKDISQQWNKATSSIDQSIEIWSRICILVERHSKKLNQIAHEDSIF
                     NSLIKDFTNFAPKLYPIQQSDTILDINNHFSIISTHLEKKNEITLQTIKDFSDQLIPK
                     FKIYTDVLLSLRGLFERYRIMATNTIPQLQRHVQLNLEKLESMKGKPEVSGTEYDKIK
                     ASIKRDRKSIGEQLNRTWLIRECILQEFTIFQETQFMITRAFQEWMKLNSTYNGLILN
                     EWEKLGNQTIDMPSSRK"
     gene            complement(<634086..>635192)
                     /gene="NDAI0C02740"
                     /locus_tag="NDAI_0C02740"
                     /db_xref="GeneID:11496270"
     mRNA            complement(<634086..>635192)
                     /gene="NDAI0C02740"
                     /locus_tag="NDAI_0C02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669129.1"
                     /db_xref="GeneID:11496270"
     CDS             complement(634086..635192)
                     /gene="NDAI0C02740"
                     /locus_tag="NDAI_0C02740"
                     /inference="similar to DNA sequence:INSDC:YOL010W"
                     /note="similar to Saccharomyces cerevisiae RCL1 (YOL010W);
                     ancestral locus Anc_6.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669177.1"
                     /db_xref="GeneID:11496270"
                     /db_xref="GOA:G0W823"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="UniProtKB/TrEMBL:G0W823"
                     /translation="MSTAKPKPYITFQGSQNFRLRIILSTLSGKPIKIEKIRSTDLNP
                     GLKDYEVSFLRLIESVTNGSVIEISYTGTTILYKPGIITGGAHTHNCPPSKPVGYFVE
                     PMLYLAPFSKKKFSILFKGITASHQDAGIEAIKWGLLPILEKFGCRECALHTLKRGSP
                     PNGGGEVHLVVDSLIAQPITMHELERPTIATIRGVAYSTRVSPSMVNRMIDSAKKVLK
                     DISCPVEITADVWRGENSGKSPGWGITLVAETKKGWCYLTEAIGDAGDVPEDIGQLVA
                     YRLLEEISTSAAVGRNQLALAMVYMVIGKEDIGRLRITKDEIDENFINLLRDIKKVFG
                     TEVFLKPVDDLTHPDDFIATIKGVGFTNTSKKIA"
     gap             635576..635791
                     /estimated_length=216
     gene            complement(<636211..>638538)
                     /gene="NDAI0C02750"
                     /locus_tag="NDAI_0C02750"
                     /db_xref="GeneID:11496271"
     mRNA            complement(<636211..>638538)
                     /gene="NDAI0C02750"
                     /locus_tag="NDAI_0C02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669130.1"
                     /db_xref="GeneID:11496271"
     CDS             complement(636211..638538)
                     /gene="NDAI0C02750"
                     /locus_tag="NDAI_0C02750"
                     /inference="similar to DNA sequence:INSDC:YMR008C,YOL011W"
                     /note="similar to Saccharomyces cerevisiae PLB1 (YMR008C)
                     and PLB3 (YOL011W); ancestral locus Anc_6.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669178.1"
                     /db_xref="GeneID:11496271"
                     /db_xref="GOA:G0W824"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G0W824"
                     /translation="MEIILKRSSIRVIFLFLSLLLNIQSTLAWNPSNSYAPAYVQCPA
                     FLIPSNGSSSSSSSSSSSSSSSSSSSSSSSFLSSIPSLLREASSISQNESIWLQKRLQ
                     HIKSPLKNFLNNSFTNIPSQNNTISTSTSTSTATKDDNQYIISSLISTLLGNDSNIPK
                     IGIAISGGGYRSMLTGAGILAAMDNRTNHSLSSSSHKKQSLAGLLQSTIYLSGASGGN
                     WLVGTLAYNNWTSIQDILNSWSNQDNNNKKDDDKSNDKDIWDLSDSIISPGGKNIFKS
                     AMRWNHISDDLQDKQKAGFDTSLADVWGRALSYKFFPNLYRGGAAYTWSSLRDSPVFQ
                     NGEMPFPISVADGRYPGSKVINLNATVFEFNPYEMGSWDPSLNSFTDVKYLGTDVSNG
                     IPRDYDKCVQGYDNTAFIMGTSSTLFNQFLLRINSTKINLPKFITKLATHFLKDLSQD
                     FNDVATYHPNPFKNSKFIDKSKNFSTSIVQSDSLYLVDGGEDDENIPLLPLIQHERNL
                     DIIFAIDNSVDMKLGWPDGSSLVHTFERQFVKQGDGTAFPYVPDSNTFVNLGLNEKPT
                     FFGCDAKNLTNLEYIPPLIVYLPNSKYSFESNQSAFKMSYSELQRRQMISNGYEIATR
                     NNFTDDPMFATCLACAVVKRKQESLNLTLPDHCQSCFNNYCWDGSLDITPLPEEKQDL
                     HHSFINVGLNRTDADPYVQLNHNDDYLDDQDDDDDEEDEQDIDLTKPSATGRTRNYQR
                     KSNSKNIDPKNHHPIINLKIIMVLLCIITILIGFI"
     gene            <639577..>639981
                     /gene="NDAI0C02760"
                     /locus_tag="NDAI_0C02760"
                     /db_xref="GeneID:11496272"
     mRNA            <639577..>639981
                     /gene="NDAI0C02760"
                     /locus_tag="NDAI_0C02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669131.1"
                     /db_xref="GeneID:11496272"
     CDS             639577..639981
                     /gene="NDAI0C02760"
                     /locus_tag="NDAI_0C02760"
                     /inference="similar to DNA sequence:INSDC:YOL012C"
                     /note="similar to Saccharomyces cerevisiae HTZ1 (YOL012C);
                     ancestral locus Anc_6.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669179.1"
                     /db_xref="GeneID:11496272"
                     /db_xref="GOA:G0W825"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G0W825"
                     /translation="MSGKVHGGKGKSSGTEGSNLRSQSSSAKAGLQFPVGRIKRYLKR
                     NASGKIRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DSLIRATISSGGVLPHINKALLLKIEKKKLKK"
     gene            <640635..>642527
                     /gene="NDAI0C02770"
                     /locus_tag="NDAI_0C02770"
                     /db_xref="GeneID:11496273"
     mRNA            <640635..>642527
                     /gene="NDAI0C02770"
                     /locus_tag="NDAI_0C02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669132.1"
                     /db_xref="GeneID:11496273"
     CDS             640635..642527
                     /gene="NDAI0C02770"
                     /locus_tag="NDAI_0C02770"
                     /inference="similar to DNA sequence:INSDC:YOL013C"
                     /note="similar to Saccharomyces cerevisiae HRD1 (YOL013C);
                     ancestral locus Anc_6.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669180.1"
                     /db_xref="GeneID:11496273"
                     /db_xref="GOA:G0W826"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G0W826"
                     /translation="MAIQISMLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLC
                     LKLNEGFNIMIITIFILLNSLLSWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMA
                     TMFNERFFFTLTIYGLLLISLRVYHWILKDRLEFIIQTINDSTSMTKIIFSKFSFNLI
                     SLSLINLKLIQNCLTWDDINFWKNNQNLFNSIMNYLINPISSTTISNGINNHSNPVYL
                     MLGMEFSILLLEYFNVLFHSLLSLFEFYKSKQFSIQQQQIRQNNLINRAQTTQNDENE
                     INIGLDIDIDDDEEDDDETFNGLEGKFIYEKIIDLFTRFLMTIIHVSLLLPLNIPMIL
                     VKDILWDFFSLYRNAMSLYKIWKNNQKLESALPNMTPDDLQHSDNVCIICMDDLLPSL
                     ETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGHFLHFSCLKNWMERSQTCPICRLD
                     VFDKNGNVKVYPNTNTNTNVNDSSHDQTSENRPPSTSTSNIIPGSNTNITTNTPIPRN
                     IDASNGSHEVSPAASPSPSPSPSLPILKHEQHDGNPINNFNETKNWYEFKIDSDKSTY
                     ANNSQTISFPIEFEKDNNSNNNNNNNNNNDTIIANLLIEDKIQNDSHSPVIIIPKESI
                     NYPDTN"
     gene            complement(<642977..>644176)
                     /gene="NDAI0C02780"
                     /locus_tag="NDAI_0C02780"
                     /db_xref="GeneID:11496274"
     mRNA            complement(<642977..>644176)
                     /gene="NDAI0C02780"
                     /locus_tag="NDAI_0C02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669133.1"
                     /db_xref="GeneID:11496274"
     CDS             complement(642977..644176)
                     /gene="NDAI0C02780"
                     /locus_tag="NDAI_0C02780"
                     /inference="similar to DNA sequence:INSDC:YGR180C,YJL026W"
                     /note="similar to Saccharomyces cerevisiae RNR4 (YGR180C)
                     and RNR2 (YJL026W); ancestral locus Anc_5.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669181.1"
                     /db_xref="GeneID:11496274"
                     /db_xref="GOA:G0W827"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:G0W827"
                     /translation="MAKETPSKQAAAALSDLEIKDASKNLSSTLNPVSEDLEAQEAAL
                     NKRLSEAAEKHKQYLYSHRIQRHKLKAEEKEEPLLTYDNDRHTLFPIKYHEIWQAYKR
                     AEASFWTAEEIDLSKDLHDWNNRMNANERFFISRVLAFFAASDGIVNENLVENFSAEV
                     QIPEARAFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIETIPQIKEKAEWAL
                     RWINDSESPFGERLVAFAAIEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLH
                     TDFACLLFAHLKHKIEPSTVETIIVQAVEIEKRYFLDALPVALLGMNADLMNQYVEFV
                     ADRLLVAFGNEKYYKVENPFDFMENISLAGKTNFFEKRVSDYQKAGVIAKATETETGA
                     FVISEDF"
     gene            complement(645693..645772)
                     /gene="NDAI0Ctrna6L"
                     /locus_tag="NDAI_0Ctrna6L"
                     /db_xref="GeneID:11496793"
     tRNA            complement(join(645693..645737,645693..645772))
                     /gene="NDAI0Ctrna6L"
                     /locus_tag="NDAI_0Ctrna6L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:11496793"
     gene            complement(<646177..>646794)
                     /gene="NDAI0C02790"
                     /locus_tag="NDAI_0C02790"
                     /db_xref="GeneID:11496764"
     mRNA            complement(<646177..>646794)
                     /gene="NDAI0C02790"
                     /locus_tag="NDAI_0C02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669134.1"
                     /db_xref="GeneID:11496764"
     CDS             complement(646177..646794)
                     /gene="NDAI0C02790"
                     /locus_tag="NDAI_0C02790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669182.1"
                     /db_xref="GeneID:11496764"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:G0W828"
                     /translation="MSYYPFHNFSEDFDEGFGIVDSTMSRARRPQTNRNSNIQGGLIR
                     PGNNDSMVVPRYGPSDLDNWFDTDIPLVPMGFGSTRNLTVPIDILDHDNNYEIKVNIP
                     GVRQKKNISLEYNKNKNQFSISGEIPPIITEERSGNVRVQERASGKFRRSVTLPEYPK
                     INVEQAKADYTSGILTLEVPKVKPSDADKEQVRRIEIVSDQDWEK"
     gene            complement(<647637..>649052)
                     /gene="NDAI0C02800"
                     /locus_tag="NDAI_0C02800"
                     /db_xref="GeneID:11496276"
     mRNA            complement(<647637..>649052)
                     /gene="NDAI0C02800"
                     /locus_tag="NDAI_0C02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669135.1"
                     /db_xref="GeneID:11496276"
     CDS             complement(647637..649052)
                     /gene="NDAI0C02800"
                     /locus_tag="NDAI_0C02800"
                     /inference="similar to DNA sequence:INSDC:YJR006W"
                     /note="similar to Saccharomyces cerevisiae POL31
                     (YJR006W); ancestral locus Anc_5.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669183.1"
                     /db_xref="GeneID:11496276"
                     /db_xref="GOA:G0W829"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:G0W829"
                     /translation="MDELLEKFNENRGDDKEAIDRVILNQKYDTNNPFLLSYKGRDYN
                     SQFYHIYKYRLDTFKERVTKECVKRWDNGFKLKGRSVIKKEKVLDIQGNEPCWCIGTI
                     YCEMKYKPNILEEVTNDTYGAPDIVKSYTDLEGSDEIMLEDESGRVLLVGDYIRSTPF
                     ITGTVIGILGMEADAGTFQVLDICYPAALPQKPLLLDKNRKDKGSVALVSGININSKS
                     PGHALRLQLLQEYLMGRLDSNDERVSKIGKLIICGNSVDFNAREETPGDLANSLAEFG
                     KFLGNSLQSISIDLMPGVKDPSARALPQQPFNKALFSEALRPYFDKVNNKLLNLVTNP
                     YQFNINDVDLLTVSGQSVNDIHKYVIPMKNNSLDETPKEDIEHRLDLMECTMKWQNIA
                     PTAPDTVWCYPFKEEDPFVLKEWPHVYIVANQPEYGTRDLTLNDGVNVKIISVPEFSK
                     TGSVILLDLNNLESEVVTIEL"
     gene            <649992..>650192
                     /gene="NDAI0C02810"
                     /locus_tag="NDAI_0C02810"
                     /db_xref="GeneID:11496277"
     mRNA            <649992..>650192
                     /gene="NDAI0C02810"
                     /locus_tag="NDAI_0C02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669136.1"
                     /db_xref="GeneID:11496277"
     CDS             649992..650192
                     /gene="NDAI0C02810"
                     /locus_tag="NDAI_0C02810"
                     /inference="similar to DNA
                     sequence:INSDC:YGR169C-A,YJR005C-A"
                     /note="similar to Saccharomyces cerevisiae YGR169C-A and
                     YJR005C-A; ancestral locus Anc_5.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669184.1"
                     /db_xref="GeneID:11496277"
                     /db_xref="UniProtKB/TrEMBL:G0W830"
                     /translation="MHKSGKRYSETAAKVAAGRARKRKQAYEKERAEREKAAEEEAKK
                     WEQGAREPNQKKLLEDKKSKRS"
     gene            complement(<650576..>651571)
                     /gene="NDAI0C02820"
                     /locus_tag="NDAI_0C02820"
                     /db_xref="GeneID:11496278"
     mRNA            complement(<650576..>651571)
                     /gene="NDAI0C02820"
                     /locus_tag="NDAI_0C02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669137.1"
                     /db_xref="GeneID:11496278"
     CDS             complement(650576..651571)
                     /gene="NDAI0C02820"
                     /locus_tag="NDAI_0C02820"
                     /inference="similar to DNA sequence:INSDC:YJL023C"
                     /note="similar to Saccharomyces cerevisiae PET130
                     (YJL023C); ancestral locus Anc_5.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669185.1"
                     /db_xref="GeneID:11496278"
                     /db_xref="UniProtKB/TrEMBL:G0W831"
                     /translation="MNSSRPLLHLELKFLDIGKHEVQILPVTDFTRAVSPRRAQRVGA
                     LHKIGNTFIQPFGNVDLASSLKPHSQLKGLVKEIENSFVRGSKSYTYYKCKYFTLNYY
                     PPSHFLSLFRKSKPAVSVTPTKKPPAIFNGKLLQNNIKQEDLALISRIYSDSRKQYPR
                     NYSFWRRNSRRILRDEFQMEWCALYGHIAVDEQIAMKRALTSEKTVELKDYKWLDDKG
                     RTKIGVSKDGFYSYQLHYFPVSYNWDEFLSELRKSVRVVAYLKWKKFECDPNTKKKSN
                     QNVNDSVNIDRFNRILEEIDMPIRLVRTRNIDTVTASASDDDTTNTITADNSSDL"
     gene            complement(<651724..>654657)
                     /gene="NDAI0C02830"
                     /locus_tag="NDAI_0C02830"
                     /db_xref="GeneID:11496279"
     mRNA            complement(<651724..>654657)
                     /gene="NDAI0C02830"
                     /locus_tag="NDAI_0C02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669138.1"
                     /db_xref="GeneID:11496279"
     CDS             complement(651724..654657)
                     /gene="NDAI0C02830"
                     /locus_tag="NDAI_0C02830"
                     /inference="similar to DNA sequence:INSDC:YJL020C"
                     /note="similar to Saccharomyces cerevisiae BBC1 (YJL020C);
                     ancestral locus Anc_5.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669186.1"
                     /db_xref="GeneID:11496279"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:G0W832"
                     /translation="MSEPAPPFKVVAQFPYQSGYEDDLNFEKDQVITVTSIEDDEWYY
                     GEYNDGTHVLEGIFPKSFVAVALEKEPTQKQLPTVQPVEPEHVLSKSLPQEDVITDIP
                     PVPHTVSNDQSPVKNKLARKPSLPKEFVPTNNEEHPIVKQDHAEEDLPKMSLKERIAL
                     LQEQQRLQAQQDEEKAKQQQHHHHEKAQRRQSAEVFSSMEENHSIDHASAHESINEPI
                     QESNEIDELLNDSEGKREDEVDHDSISIKKTNVESLSINQENREQEAQNDNAHENSSS
                     ADENDEESEEEDTEETRRTALRDRMAKLSGAGRFGTAVGFNPFGAPAAAAGDTTGTKK
                     KKKKEPKINEASESERENLPQAIPIMPFADPNALSFLNQKLTDEKNEEIESPPVPEEG
                     ESDKKKSDPTVSLEEETAKSHAYHKFVKPSSISSATKSIEAEENEGDFYDTESTIPNP
                     NIPKEEPHVLNAKKEVEASDHKLTESHTDLPDSKSRFNPASPDVPILPHPQKTLDPTR
                     SIPEEEIDTTVDMPPSAPPPPRKTSIDEERDDTMAIPPLPVRNYEDQSIMANIIQPHA
                     STLPSLSVETPHVPPIPSAPFPPLLGAQQGDEVAQPPLPRAPPPPPSLPEFTNRYSTA
                     FPLPVEDADDVTDKFSTPPDISIPPPPLPPSTSKAMPPPPPIPSVPAAEPRHDVNTSS
                     IGTHKDNEQNKSIHTIETQTEPFPSIMRRSTTTATEFKGSSSNMEIPFDAQATWWYEK
                     QAPPDLKYKHIFEIDDNVIHKRSNETWIVRDYYILFEDYSQLQISLIFNKSSPHESVI
                     CQQNFKESTNSNITDADLENFSKRFNGIIAQKAHSKIGSQTQGMSGKFVSLIFRDIAK
                     ESGILPPIASRTFGVSILDYKADGSTSIDGNLLKKIRSGDILVVRKGRFESHNKLGMK
                     DVISVGMDVPHSSIITEYDFTKGKFRVIEEHAGKIVQASYKVDHMKSGKLKVFRAVPR
                     KYIGW"
     gene            <655110..>656996
                     /gene="NDAI0C02840"
                     /locus_tag="NDAI_0C02840"
                     /db_xref="GeneID:11496280"
     mRNA            <655110..>656996
                     /gene="NDAI0C02840"
                     /locus_tag="NDAI_0C02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669139.1"
                     /db_xref="GeneID:11496280"
     CDS             655110..656996
                     /gene="NDAI0C02840"
                     /locus_tag="NDAI_0C02840"
                     /inference="similar to DNA sequence:INSDC:YJL019W"
                     /note="similar to Saccharomyces cerevisiae MPS3 (YJL019W);
                     ancestral locus Anc_5.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669187.1"
                     /db_xref="GeneID:11496280"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:G0W833"
                     /translation="MAHRESSYIGVPDDDGMSGEYDHTPYLIGITASPLRNKYRDMLM
                     QKVEQFDGIDSQNKENKNATDDAGNSSYDEWINFEPSFQKQRSFSGESSEEEFTINSS
                     LGDVIYTDDDDADDFTDNEEEPQEEPVYSEGSNYYYDGNENEDFAEDPMLTHLTSILS
                     HLARVSTLKKILSAKFLLMIAITMAVASGILFNHPNRSNLDSTTVNAQRFKNENNSAL
                     MLQKQLDHISRELSQRNQNIKLAMNQRITILISQLEKNIKSVIPTNEKKIAQDLDILN
                     RDLKFISSIISSRKLENKKGDRKNMLPNEIDILINNNITGKQQSSLITDPKLQDFVVN
                     TRSALKSIFRLEPNIDLLNIRAVLDNYTSSDAMDYVTREYMSNIVSKSFSKTKSDILD
                     YLNLEIHSLRGKQCDDETSIKAFISQLIDSLTVHVDNELDYGTLEQGSQILPYLTSRS
                     YRRSQYNSNPLTAFQSNELFYCKSEPSCSIAIRFKEPIYLTSLKYSHGRFTNNVHALN
                     SAPKIIVVYIKLHTKDAMILKTFVESAYKHSRSSNSEGNIFYDKDKSYIKISESVYDL
                     ANNKITQDLSLPLWFTNMKLPVRSIIFEVHENYGHTQYTAFGKVSINGITQEDLNLMI
                     GEND"
     gene            <657572..>659185
                     /gene="NDAI0C02850"
                     /locus_tag="NDAI_0C02850"
                     /db_xref="GeneID:11496281"
     mRNA            <657572..>659185
                     /gene="NDAI0C02850"
                     /locus_tag="NDAI_0C02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669140.1"
                     /db_xref="GeneID:11496281"
     CDS             657572..659185
                     /gene="NDAI0C02850"
                     /locus_tag="NDAI_0C02850"
                     /inference="similar to DNA sequence:INSDC:YJL016W"
                     /note="similar to Saccharomyces cerevisiae YJL016W;
                     ancestral locus Anc_5.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669188.1"
                     /db_xref="GeneID:11496281"
                     /db_xref="UniProtKB/TrEMBL:G0W834"
                     /translation="MKFLDSLKKPIVIKRRADSNHPSSIITSSSSSIFSDHAMTPPQR
                     TPANILKELQPTLLKSVLPILVLLNAQSSKKYFEWNNTSDTKINSKWNLVTSGNTSET
                     LPLVTIILTGTKLRIITSSRKRELTIDLLKQNIELFPTLLEFKNNDFSLSCSSPDALL
                     TLYRFCLLSIFEHFSIFKSLTGTLTSVLGLRMFDMHIILNTQFNFKDWCEIYIEGEGW
                     VKAWCVVKKKKNGNSEIRFYKNNNSLATKNLICFISPEKASIQDIMFYNDKNTEIIGD
                     DDDDVCVGNTSKFQDIHSFLNQLRTIKVIGNICFLNNDGGTSSKNSSRSSSISNMSQI
                     DGTNVSSPPKRKMFSPSNKGHARSSSHVSSMTMRSSKSIKDTDYTINSSGLLIRPTPH
                     NGVFHLEALIRVIIPMMDVMKLYGRPMRFKNARNDPDSLMFGLPRLPNIDYLAKEEID
                     SFLSEKNPEIDADEAIEDTKTSALKLLGKVLFDNLSRNENRDTELLFTRLSDLSINQP
                     NEGFNVVSAEKNGLSKESVYTLAPCSQVV"
     gene            complement(<659616..>660578)
                     /gene="NDAI0C02860"
                     /locus_tag="NDAI_0C02860"
                     /db_xref="GeneID:11496282"
     mRNA            complement(<659616..>660578)
                     /gene="NDAI0C02860"
                     /locus_tag="NDAI_0C02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669141.1"
                     /db_xref="GeneID:11496282"
     CDS             complement(659616..660578)
                     /gene="NDAI0C02860"
                     /locus_tag="NDAI_0C02860"
                     /inference="similar to DNA sequence:INSDC:YGR144W"
                     /note="similar to Saccharomyces cerevisiae THI4 (YGR144W);
                     ancestral locus Anc_5.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669189.1"
                     /db_xref="GeneID:11496282"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="UniProtKB/TrEMBL:G0W835"
                     /translation="MSTTQTSVSQLQLNSVAENPLGELAKIDNWNDFQFAPIREATVS
                     RAMTSRYYQDMDKYAISDVVIVGAGSSGLSAAYVIAKNRPDLKIAIIEQNLAPGGGCW
                     VSGQLLSAMVLRKPADLLLKEIGVEYEDQGDYVVVKHAALFTSTILSKILAFPNVKLY
                     NGTCVEDLVTKPNEHGKLTVSGVVTNWTLVTLAHDTQSCMDPNVIELAGYSDDGSRDA
                     TQKHGVILSTTGHDGPFGAFCAKRIVQLDDNMKLGGMKGLDMNSAERGVVNHAGKYPG
                     VDNIYFAGMESAELYGINRMGPIFSSMLISGVKAGLEIVKHFSD"
     gene            complement(<661583..>663355)
                     /gene="NDAI0C02870"
                     /locus_tag="NDAI_0C02870"
                     /db_xref="GeneID:11496283"
     mRNA            complement(<661583..>663355)
                     /gene="NDAI0C02870"
                     /locus_tag="NDAI_0C02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669142.1"
                     /db_xref="GeneID:11496283"
     CDS             complement(661583..663355)
                     /gene="NDAI0C02870"
                     /locus_tag="NDAI_0C02870"
                     /inference="similar to DNA sequence:INSDC:YJR016C"
                     /note="similar to Saccharomyces cerevisiae ILV3 (YJR016C);
                     ancestral locus Anc_5.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669190.1"
                     /db_xref="GeneID:11496283"
                     /db_xref="GOA:G0W836"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR004404"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR020558"
                     /db_xref="UniProtKB/TrEMBL:G0W836"
                     /translation="MGLLMKATAARQFSTTRNLAKKLNKYSYVITEPKGQGASQAMLY
                     ATGFKKDDFNKAQVGVGSCWWSGNPCNMHLLDLNNRCSASIEKANLKAMQFNTIGVSD
                     GISMGTKGMRYSLQSREIIANSFETIMMAQHYDANIAIPSCDKNMPGVMMAMGRHNRP
                     SIMVYGGSILPGHPTCGSSKIPEKIDVVSAFQSYGQYISKQFTEAERRDVVEHSCPGP
                     GACGGMYTANTMASAAEVLGITLPNSSSFPAVSQQKLAECDNIGESIKKTMELGVLPR
                     DIFTKKAFENAITYAIATGGSTNAVLHLIAVAHSAGVKITQDDFQRISDKTPLLGDFK
                     PSGKHVMADLLNVGGTQAVIKFLYDNGFMHGDTITVTGDTLAERAAKAAPLPKDQDII
                     RPLSNPIKPTGHLQILYGSLAPGGSVGKITGKEGTYFKGKARVFDEEDAFITALENGE
                     IKKGEKTVVIIRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHGFLI
                     GHIVPEAAQGGPIGLVKDGDEIVIDSDNNKIDLMVSEEEMAQRKSQWVAPAPRYTRGT
                     LAGYSKLVSDASLGCVLDADDADV"
     gene            complement(<664032..>665390)
                     /gene="NDAI0C02880"
                     /locus_tag="NDAI_0C02880"
                     /db_xref="GeneID:11496284"
     mRNA            complement(<664032..>665390)
                     /gene="NDAI0C02880"
                     /locus_tag="NDAI_0C02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669143.1"
                     /db_xref="GeneID:11496284"
     CDS             complement(664032..665390)
                     /gene="NDAI0C02880"
                     /locus_tag="NDAI_0C02880"
                     /inference="similar to DNA sequence:INSDC:YGR202C"
                     /note="similar to Saccharomyces cerevisiae PCT1 (YGR202C);
                     ancestral locus Anc_5.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669191.1"
                     /db_xref="GeneID:11496284"
                     /db_xref="GOA:G0W837"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G0W837"
                     /translation="MAKESRTSSLKKSTLLQLHLTKLFQKTRKRKHESDTDDQEQLST
                     PELRSHDNEHAHNHSHNNHNHNGQDRSDSGNVDDSSDDHSSTVSTTPNRKRRRLSNTT
                     TEKDQDLIMFEKRENELDAKLPEELRKYRPKGFPFNLPPKDRPIRIYADGVFDLFHLG
                     HMKQLEQCKKALPNVTLICGIPSDEVTHKLKGLTVLTDKQRCETLKHCRWVDEVIEDA
                     PWCVTPEFLEKHNIDYVAHDDIPYASAGSDDVYKPIKQAGKFLVTQRTNGISTSDIIT
                     KIIRDYDKYLMRNFARGATRQELNVSWLKKNELEFKKHIKDFRSYFKKNQENLNNSSR
                     DLYFEVREILLRKTLGNKLYMKLVGNSENLDDIVNGSVKGIAAKSRKLLRARSPASEF
                     ASEYTGPNLEEENHDNPFDPADAVEGTEDEGDEDDDEEEEEEEEYYDSNEDEPEDKKL
                     KK"
     gene            complement(<665859..>666377)
                     /gene="NDAI0C02890"
                     /locus_tag="NDAI_0C02890"
                     /db_xref="GeneID:11496285"
     mRNA            complement(<665859..>666377)
                     /gene="NDAI0C02890"
                     /locus_tag="NDAI_0C02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669144.1"
                     /db_xref="GeneID:11496285"
     CDS             complement(665859..666377)
                     /gene="NDAI0C02890"
                     /locus_tag="NDAI_0C02890"
                     /inference="similar to DNA sequence:INSDC:YJR017C"
                     /note="similar to Saccharomyces cerevisiae ESS1 (YJR017C);
                     ancestral locus Anc_5.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669192.1"
                     /db_xref="GeneID:11496285"
                     /db_xref="GOA:G0W838"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="UniProtKB/TrEMBL:G0W838"
                     /translation="MSSPESKEEEWKTGLPTPWTVRYSKSKKREYFFNTESKQSQWES
                     PEGTNEEELKNYLRVNPVRIRCLHILIKHKDSRRPASHRSQNITLSKEDAIKELETIK
                     LRLDDNKNTFESLAKERSDCSSYKRGGDLGWFGKGEMQPSFEKAAFALKVNQVSDIVE
                     SDSGVHLIKRVG"
     gene            complement(<666725..>667786)
                     /gene="NDAI0C02900"
                     /locus_tag="NDAI_0C02900"
                     /db_xref="GeneID:11496286"
     mRNA            complement(<666725..>667786)
                     /gene="NDAI0C02900"
                     /locus_tag="NDAI_0C02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669145.1"
                     /db_xref="GeneID:11496286"
     CDS             complement(666725..667786)
                     /gene="NDAI0C02900"
                     /locus_tag="NDAI_0C02900"
                     /inference="similar to DNA sequence:INSDC:YJR019C"
                     /note="similar to Saccharomyces cerevisiae TES1 (YJR019C);
                     ancestral locus Anc_5.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669193.1"
                     /db_xref="GeneID:11496286"
                     /db_xref="GOA:G0W839"
                     /db_xref="InterPro:IPR003703"
                     /db_xref="InterPro:IPR025652"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G0W839"
                     /translation="MSKPAVTKLSKLSNIEHILELVPVSSSKFLTKNLPAAPLGSKGT
                     FGGTLVAQSLLASLYTIPKTYVPTSMHCYFINGGDPKNNILYHVEKLRDGKNFIHRQI
                     RAYQHDKLIFQSMILFSQQNSDKDHDSLHHLDHIESLPSTPPPDKYKPAASLYTEKIM
                     AEGLLQRYARLSDRFKDINYLKRQVEVFEKGAIEYNFPNDLFYSQRRTSVLDYYVKIR
                     HKVIQSKEFSSGQTTSNHNNISSLKIITPDTDPRYNYVAFAYLSDSYLLLTLPYFHQL
                     PLYSHKFSVSLDHSIYFHQLPLVNNWIYLRIKNSRSHWDKHLVQGEYFDSNSGNIIAT
                     VSQEGLVVYDPEEEIKAKF"
     gene            <668944..>670647
                     /gene="NDAI0C02910"
                     /locus_tag="NDAI_0C02910"
                     /db_xref="GeneID:11496326"
     mRNA            <668944..>670647
                     /gene="NDAI0C02910"
                     /locus_tag="NDAI_0C02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669146.1"
                     /db_xref="GeneID:11496326"
     CDS             668944..670647
                     /gene="NDAI0C02910"
                     /locus_tag="NDAI_0C02910"
                     /inference="similar to DNA sequence:INSDC:YGR197C,YJR015W"
                     /note="similar to Saccharomyces cerevisiae SNG1 (YGR197C)
                     and YJR015W; ancestral locus Anc_5.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669194.1"
                     /db_xref="GeneID:11496326"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:G0W840"
                     /translation="MSTAINQESHNTGTSSGQNPSSDPYNEQDLSSSISHSSLSPSPS
                     TEDSIAQFDGQLQYEDRQGDITSKEEDNRSLQSDPIQDTNTSPKENNTSATHSHNNKS
                     DNSGAFNPNDEDNALQRTGTRYFSPKLKKARKDVIYSFIFTNVVLAIFAFTIFSLFWG
                     VNYKNFDRAHKVQILAVIQDEGITSPNISTIIPIAAAVPTIAESSMGTYHIYNSTGFM
                     DKFKLQSNDEIDAKVIHEVYGEKYWFAINIKPNATQALYDAIAVPNAPSFNTSQYFEA
                     VTITARDPTNYRQLILPLLQDFEARYSNYYTSTYFPQFLNNLTTFNNITTVNMTNIAL
                     AGTMNFYTNDIRSFTERVLIAPLLVGVAYCLLLTFFQFLIYSQLHQEVSALLKPNHIL
                     IYRNIMLWLTMFFASLFFCTVSAIFQIDFTPAFGRGGFVVYWMTTWLFMVACGGTNEN
                     MVSILFTLFGPRFLGIWILSFIILNITPTFYPMVMANVFYRYGYMMPVHNAIDIYRVI
                     FLDLSKHKMGRNYGLLIAWIAMNAVALPLVFKFLLMVITRREKKEKELAAAAEEAKLK
                     N"
     gene            complement(<670916..>671524)
                     /gene="NDAI0C02920"
                     /locus_tag="NDAI_0C02920"
                     /db_xref="GeneID:11496327"
     mRNA            complement(<670916..>671524)
                     /gene="NDAI0C02920"
                     /locus_tag="NDAI_0C02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669147.1"
                     /db_xref="GeneID:11496327"
     CDS             complement(670916..671524)
                     /gene="NDAI0C02920"
                     /locus_tag="NDAI_0C02920"
                     /inference="similar to DNA sequence:INSDC:YJR014W"
                     /note="similar to Saccharomyces cerevisiae TMA22
                     (YJR014W); ancestral locus Anc_5.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669195.1"
                     /db_xref="GeneID:11496327"
                     /db_xref="GOA:G0W841"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005873"
                     /db_xref="UniProtKB/TrEMBL:G0W841"
                     /translation="MSLREVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLYTKLY
                     GESDAADVDIVAGKLAESSIGEAREEKLEKDLLKLQTKEENREQRELAKKLASKVIIK
                     REARTKRKYIIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEVIVQGDVLE
                     EVEAYIHSLLKEKGLKDVKVETIDSAKRKKKPTEGAANTAGK"
     gene            complement(<671839..>672579)
                     /gene="NDAI0C02930"
                     /locus_tag="NDAI_0C02930"
                     /db_xref="GeneID:11496328"
     mRNA            complement(<671839..>672579)
                     /gene="NDAI0C02930"
                     /locus_tag="NDAI_0C02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669148.1"
                     /db_xref="GeneID:11496328"
     CDS             complement(671839..672579)
                     /gene="NDAI0C02930"
                     /locus_tag="NDAI_0C02930"
                     /inference="similar to DNA sequence:INSDC:YGR195W"
                     /note="similar to Saccharomyces cerevisiae SKI6 (YGR195W);
                     ancestral locus Anc_5.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669196.1"
                     /db_xref="GeneID:11496328"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:G0W842"
                     /translation="MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHASDGSSYLEQ
                     GNNKIITLVKGPKEPTSRSQVDTNKALLRISVNITQFSKFERSKSSHRNERRVLEMQT
                     ALVRTFEKNVMLNLYPRTLIDIEIHVLQQDGGIMGSLLNGITLALIDAGIAMYDYISG
                     ISVGLYDTTPLLDVNSLEETAMSSVTLGVVGKSEKLSLLLVEDKIPLDRMETVLAIGI
                     AGAHRIRDLMDEELRSHAEKRVANASSR"
     gene            complement(<673302..>674300)
                     /gene="NDAI0C02940"
                     /locus_tag="NDAI_0C02940"
                     /db_xref="GeneID:11496329"
     mRNA            complement(<673302..>674300)
                     /gene="NDAI0C02940"
                     /locus_tag="NDAI_0C02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669149.1"
                     /db_xref="GeneID:11496329"
     CDS             complement(673302..674300)
                     /gene="NDAI0C02940"
                     /locus_tag="NDAI_0C02940"
                     /inference="similar to DNA sequence:INSDC:YGR192C,YJR009C"
                     /note="similar to Saccharomyces cerevisiae TDH3 (YGR192C)
                     and TDH2 (YJR009C); ancestral locus Anc_5.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669197.1"
                     /db_xref="GeneID:11496329"
                     /db_xref="GOA:G0W843"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:G0W843"
                     /translation="MVTVAINGFGRIGRLVLRIAMARKNVTVAAINDPFISNDYAAYM
                     FKYDSTHGRYNGEVSHDDKHIIIDGHKIATFQERDPANLPWASLKIDIAIDSTGVFKE
                     LDTCQKHLDAGAKKVVITAPSSTAPMFVVGVNEDKYTPDLKIVSNASCTTNCLAPLAK
                     IINDNFGIEEGLMTTVHSQTATQKTVDGPSHKDWRGGRTASANIIPSSTGAAKAVGKV
                     LPELQGKLTGMAFRVPTVDVSVVDLTVKLAKETTYDEIKKVVKAAAEGPLKGVVGYTE
                     DAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLISWYDNEYGYSTRVVDLVEYVAKA"
     gene            <676753..>678582
                     /gene="NDAI0C02950"
                     /locus_tag="NDAI_0C02950"
                     /db_xref="GeneID:11496330"
     mRNA            <676753..>678582
                     /gene="NDAI0C02950"
                     /locus_tag="NDAI_0C02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669150.1"
                     /db_xref="GeneID:11496330"
     CDS             676753..678582
                     /gene="NDAI0C02950"
                     /locus_tag="NDAI_0C02950"
                     /inference="similar to DNA sequence:INSDC:YGR191W"
                     /note="similar to Saccharomyces cerevisiae HIP1 (YGR191W);
                     ancestral locus Anc_5.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669198.1"
                     /db_xref="GeneID:11496330"
                     /db_xref="GOA:G0W844"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G0W844"
                     /translation="MTKKSPLNKAYWSDMIDGFKSTPDDAHSEQEGETSFSNIRSFTS
                     SPIPEKSSDNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLI
                     TLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGG
                     FNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYS
                     VIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPG
                     SFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTA
                     SYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISI
                     VSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDK
                     QAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYG
                     VIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVK
                     LEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHVWC"
     gene            <679080..>679988
                     /gene="NDAI0C02960"
                     /locus_tag="NDAI_0C02960"
                     /db_xref="GeneID:11496331"
     mRNA            <679080..>679988
                     /gene="NDAI0C02960"
                     /locus_tag="NDAI_0C02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669151.1"
                     /db_xref="GeneID:11496331"
     CDS             679080..679988
                     /gene="NDAI0C02960"
                     /locus_tag="NDAI_0C02960"
                     /inference="similar to DNA sequence:INSDC:YJR007W"
                     /note="similar to Saccharomyces cerevisiae SUI2 (YJR007W);
                     ancestral locus Anc_5.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669199.1"
                     /db_xref="GeneID:11496331"
                     /db_xref="GOA:G0W845"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="UniProtKB/TrEMBL:G0W845"
                     /translation="MSTNQCRFYENKFPEVDDIVMVNVQQIAEMGAYVKLLEYDNIEG
                     MILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIINCEEKY
                     QKSKAVHSILRFCAEKFQIPLEDLYKTIAWPLSRKYGHAYEAFKLSIIDDTVWEGIEP
                     PSKEIFDELKVYISKRLTPQAVKIRADVEVSCFGYEGIDAIKEALKAAEDMSTEQLEI
                     KVKLVAAPLYVLTTQALDKDQGVQKLQDAIEKIEEVINKYGGVCNITMPPKAVTATED
                     AELQALLESKELDNRSDSEDEDDDSD"
     gene            <680728..>681735
                     /gene="NDAI0C02970"
                     /locus_tag="NDAI_0C02970"
                     /db_xref="GeneID:11496332"
     mRNA            <680728..>681735
                     /gene="NDAI0C02970"
                     /locus_tag="NDAI_0C02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669152.1"
                     /db_xref="GeneID:11496332"
     CDS             680728..681735
                     /gene="NDAI0C02970"
                     /locus_tag="NDAI_0C02970"
                     /inference="similar to DNA sequence:INSDC:YJR008W"
                     /note="similar to Saccharomyces cerevisiae YJR008W;
                     ancestral locus Anc_5.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669200.1"
                     /db_xref="GeneID:11496332"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:G0W846"
                     /translation="MSLSRPATHAGSWYSRNAAELSSQLQTYLNNSKKPIVKNSRIII
                     SPHAGYRYCGSTMAYSYASLDLNENIKRIFILGPSHHIFFSNEIFVSAFDSISTPLGD
                     LKVDKDLCSKLVRKKISGKKIFSFMNQDVDTDEHSLEMQFSMLVQTLNWRKVPLDNVK
                     VIPMMVSHNTKEFDMSVGKILSEYLNDPSNLFIISSDFCHWGRRFEYTGYVGSEDELK
                     EATEEETEIEMLTSRSKLKHHQIPIWKSIEILDKHAMRTLSDTQNSDRYDAWKQYLEI
                     TGNTICGERPIGVVLAALAYLPENSKVTFEWPHYSQSSQVQSLEESSVSYTSGYVTIQ
                     L"
     gene            complement(<682218..>683333)
                     /gene="NDAI0C02980"
                     /locus_tag="NDAI_0C02980"
                     /db_xref="GeneID:11496333"
     mRNA            complement(<682218..>683333)
                     /gene="NDAI0C02980"
                     /locus_tag="NDAI_0C02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669153.1"
                     /db_xref="GeneID:11496333"
     CDS             complement(682218..683333)
                     /gene="NDAI0C02980"
                     /locus_tag="NDAI_0C02980"
                     /inference="similar to DNA sequence:INSDC:YJR013W"
                     /note="similar to Saccharomyces cerevisiae GPI14
                     (YJR013W); ancestral locus Anc_5.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669201.1"
                     /db_xref="GeneID:11496333"
                     /db_xref="GOA:G0W847"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:G0W847"
                     /translation="MGSKSSQFVNGSPYQRDTYRYTPLLSWLLVPNHYFGWFHLGKLF
                     FVIYDLLTGILLLRILRKLIPDISDLKLTFLGSIWLLNPMVITISTRGNAESLLCFFI
                     MLSLYYLQEGHYWLAGVIYGLSIHFKIYPIIYCSSMAIYIFYNDSGSNKNQTVSKRFK
                     DLFVVGVSTLMTIILLGFIMYYIYGYEFLDQAYFYHLYRTDHRHNFSLWNMLLYYDSA
                     KDADSISYLSKMAFLPQLLIVFPLSYLEWINATFMNLVNVIFLQTFAFVIFNKVCTSQ
                     YFIWYLVFLPIVLSRTTITGKKGIMMLFVWVLTQAFWLSQGYYLEFEGKNAFYPGIFF
                     GAVSFFIGNVWILGQFISDAKEIPIDTCNCEERKKIK"
     gene            <683759..>684214
                     /gene="NDAI0C02990"
                     /locus_tag="NDAI_0C02990"
                     /db_xref="GeneID:11496334"
     mRNA            <683759..>684214
                     /gene="NDAI0C02990"
                     /locus_tag="NDAI_0C02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669154.1"
                     /db_xref="GeneID:11496334"
     CDS             683759..684214
                     /gene="NDAI0C02990"
                     /locus_tag="NDAI_0C02990"
                     /inference="similar to DNA sequence:INSDC:YJR012C"
                     /note="similar to Saccharomyces cerevisiae YJR012C;
                     ancestral locus Anc_5.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669202.1"
                     /db_xref="GeneID:11496334"
                     /db_xref="UniProtKB/TrEMBL:G0W848"
                     /translation="MSEELTLNELVEHITKNKPVPNIVHVDDIVLGEELTTISIMAPR
                     AKPWETACTHSPKNIQPDDNNGGSTTLDAVTYNAEDFEDLTRYYDLESRYVASLQKET
                     DAELPDRTKKRMRIKLNVGNFFLNNFKVHIMMYNSPVPSRTMYQVTIDH"
     gene            <684532..>685407
                     /gene="NDAI0C03000"
                     /locus_tag="NDAI_0C03000"
                     /db_xref="GeneID:11496335"
     mRNA            <684532..>685407
                     /gene="NDAI0C03000"
                     /locus_tag="NDAI_0C03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669155.1"
                     /db_xref="GeneID:11496335"
     CDS             684532..685407
                     /gene="NDAI0C03000"
                     /locus_tag="NDAI_0C03000"
                     /inference="similar to DNA sequence:INSDC:YJR011C"
                     /note="similar to Saccharomyces cerevisiae YJR011C;
                     ancestral locus Anc_5.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669203.1"
                     /db_xref="GeneID:11496335"
                     /db_xref="UniProtKB/TrEMBL:G0W849"
                     /translation="MKRSKETKKDASTFPRKEDENSSPDSTRKNPNKDERVPQEKFVK
                     ILNQIVPFILHTSYYMTDLVYTLYYVMNCEVEKWPKSTEEKQHLLQLKNGLSTLVVDL
                     RNNFRALLDESDIDEGETLIILRGLINKDIIYILYQVNDILKTELLLFQKKQSLMFTE
                     SGDQIEKNEQGINEQKDTNYGGLILQLQNCFIGFGNLMNFIRKIPLQNKYGVTKFQLD
                     VLINVIDTDLLPGWEVQLDLLNCKLFNDLALNKDVVRLYREKTGDNTPDLTQGEAFGN
                     FIGWLKDEIIGDFVF"
     gene            <685698..>685979
                     /gene="NDAI0C03010"
                     /locus_tag="NDAI_0C03010"
                     /db_xref="GeneID:11496336"
     mRNA            <685698..>685979
                     /gene="NDAI0C03010"
                     /locus_tag="NDAI_0C03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669156.1"
                     /db_xref="GeneID:11496336"
     CDS             685698..685979
                     /gene="NDAI0C03010"
                     /locus_tag="NDAI_0C03010"
                     /inference="similar to DNA sequence:INSDC:YJR010C-A"
                     /note="similar to Saccharomyces cerevisiae SPC1
                     (YJR010C-A); ancestral locus Anc_5.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669204.1"
                     /db_xref="GeneID:11496336"
                     /db_xref="GOA:G0W850"
                     /db_xref="InterPro:IPR009542"
                     /db_xref="UniProtKB/TrEMBL:G0W850"
                     /translation="MSELLQELQKFLILSIDFPSQRKTALLQRNILIIGGIISCIVGF
                     QTGSLSLLMGCYGVAYLITVLVVVPAYPCFNKQKLQWVQPKLTSIEINK"
     gene            complement(<686335..>687870)
                     /gene="NDAI0C03020"
                     /locus_tag="NDAI_0C03020"
                     /db_xref="GeneID:11496337"
     mRNA            complement(<686335..>687870)
                     /gene="NDAI0C03020"
                     /locus_tag="NDAI_0C03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669157.1"
                     /db_xref="GeneID:11496337"
     CDS             complement(686335..687870)
                     /gene="NDAI0C03020"
                     /locus_tag="NDAI_0C03020"
                     /inference="similar to DNA sequence:INSDC:YJR010W"
                     /note="similar to Saccharomyces cerevisiae MET3 (YJR010W);
                     ancestral locus Anc_5.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669205.1"
                     /db_xref="GeneID:11496337"
                     /db_xref="GOA:G0W851"
                     /db_xref="InterPro:IPR002650"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR024951"
                     /db_xref="InterPro:IPR025980"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027535"
                     /db_xref="UniProtKB/TrEMBL:G0W851"
                     /translation="MPAPHGGILQDLIARDASKKDALLKEVQKGKLTQWSLTARQICD
                     IELILNGGFSPLTGFLNEKDYLGVVNNSRLADGTLWTMPITLDVDEKFASSVSSNSRI
                     LLLQDNEIPIAILTVADVYKPDKQLEAKNVFRGDPEHPAIRYLNNIAGDYYIGGSLEA
                     IQLPQHYDYPGLRKTPAQLRLEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAK
                     VLIHPVVGLTKPGDIDHHTRVRVYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAI
                     IRKNYGATHFIVGRDHAGPGSNSKGVDFYGPYDAQELVESYKHELDIQVVPFRMVTYL
                     PDEDRYAPIDEIDTTKTRTLNISGTELRKRLRVGGEIPEWFSYPEVVKILRESNPPRP
                     KQGFAIVLSDSLNVARGQLSIALLSTFLQFGGGRHYKVFEHENNGKLLELIPDFIQGG
                     SGLIVPNQWSIDNYSYGASNNVYHLGTSADSDIKLEAADESIFHIVQKVVLFLEDNGF
                     LVF"
     gap             689190..689977
                     /estimated_length=788
     gene            690506..690612
                     /gene="NDAI0Ctrna3W"
                     /locus_tag="NDAI_0Ctrna3W"
                     /db_xref="GeneID:11496275"
     tRNA            join(690506..690542,690576..690612)
                     /gene="NDAI0Ctrna3W"
                     /locus_tag="NDAI_0Ctrna3W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:11496275"
     gene            <690909..>692315
                     /gene="NDAI0C03030"
                     /locus_tag="NDAI_0C03030"
                     /db_xref="GeneID:11496757"
     mRNA            <690909..>692315
                     /gene="NDAI0C03030"
                     /locus_tag="NDAI_0C03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669158.1"
                     /db_xref="GeneID:11496757"
     CDS             690909..692315
                     /gene="NDAI0C03030"
                     /locus_tag="NDAI_0C03030"
                     /inference="similar to DNA sequence:INSDC:YGR189C"
                     /note="similar to Saccharomyces cerevisiae CRH1 (YGR189C);
                     ancestral locus Anc_5.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669206.1"
                     /db_xref="GeneID:11496757"
                     /db_xref="GOA:G0W852"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:G0W852"
                     /translation="MVRLQYSTKHLLIPLILSSNLHTVLADSSTVSCNPLSATNCASN
                     PALATSFAEDFSSEPDRFIDQKHAGTITYGGDGMNMTLAKRFDNPSLKSDFYIMYGKV
                     EVILKAGSGTGIISSFYLQSDDLDEIDIEWVGGDGTQFQSNYFSKGSVVTYDRGEFHT
                     VSSPQTEYHNYTLDWAMDKTTWYLDGTPVRVLPNTTSEGYPQTPMYIMMGIWAGGDPS
                     NEPGTIEWAGGLTDYSQAPFTMGIKRVIVTDYSTGKTYSYDDQSGSWESIRAEDGTVN
                     GRYEQAQEDFALLAQDQSISGATSSSTSSSKVSSSTVSSSTSSSSISSSSVLTSAVIF
                     SSPSSSASSIPSSSSASSSSSSSSVETTTRSLTSKNSTSSSNIYVSSSPTTSSSSSMS
                     SARTVLSSSSTRITSSSSSSSSSVSISGSPTSTSTSSSHSGSSTSHSVETSSAAATAV
                     VFFNRGITFLLVFICSLI"
     gene            <692732..>693238
                     /gene="NDAI0C03040"
                     /locus_tag="NDAI_0C03040"
                     /db_xref="GeneID:11496339"
     mRNA            <692732..>693238
                     /gene="NDAI0C03040"
                     /locus_tag="NDAI_0C03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669159.1"
                     /db_xref="GeneID:11496339"
     CDS             692732..693238
                     /gene="NDAI0C03040"
                     /locus_tag="NDAI_0C03040"
                     /inference="similar to DNA sequence:INSDC:YJL011C"
                     /note="similar to Saccharomyces cerevisiae RPC17
                     (YJL011C); ancestral locus Anc_5.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669207.1"
                     /db_xref="GeneID:11496339"
                     /db_xref="GOA:G0W853"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:G0W853"
                     /translation="MKVLEARDAFLSDYEVLQFLSKLERQNHWDAETILENEKHRKSK
                     NKRKIRRPYNHPELQNITSTSLNFLNMNKNFVQQEGDEEMEDEEAKVKNLERDMKSPL
                     CRMNDAKFSEFVTRLNEYELFKVEKLQIVNQLPGNMVHLYSIVEECDSRFTNEQIETM
                     LSIIKEYS"
     gene            <693899..>696091
                     /gene="NDAI0C03050"
                     /locus_tag="NDAI_0C03050"
                     /db_xref="GeneID:11496340"
     mRNA            <693899..>696091
                     /gene="NDAI0C03050"
                     /locus_tag="NDAI_0C03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669160.1"
                     /db_xref="GeneID:11496340"
     CDS             693899..696091
                     /gene="NDAI0C03050"
                     /locus_tag="NDAI_0C03050"
                     /inference="similar to DNA sequence:INSDC:YJL012C"
                     /note="similar to Saccharomyces cerevisiae VTC4 (YJL012C);
                     ancestral locus Anc_5.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669208.1"
                     /db_xref="GeneID:11496340"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:G0W854"
                     /translation="MKFGETLRKSLIRQYSYYYIAYDDLKKELEYNLEANNDEWSQDL
                     ETSFLEALEIELDKVYSFCKVKHGEVVRRVKEVQQQVQHTVRQIDSNNPPTELDFEIL
                     EEELSDVIADVYDLAKFSRLNYTGFQKIIKKHDKKTGFILKPIFQVRLNAKPFFKEDY
                     DDLVVKISQLYDIVRSSGRPIHGDSSAGGKQQNFVRQTTKYWVHPDNITELKLIILKH
                     LPVLVFNTNKEFEREDSAITSIYFDNENLDLYYGRLRKDEGAEAHRLRWYGGMDSDTI
                     FVERKTHREDWTGEKSVKARFALKERHVNDFIKGKYTVPQVFAKMRKEGKKSLKDIEN
                     LEALASEIQYAILSRKLRPVVRSFYNRTAFQLPGDARVRISLDTELTMVREDSFDGVD
                     RTHGNWRRTDIGVDWPFKQLDDKDVCRFPYAVLEVKLQTQLGQEPPEWVRELVGSHLV
                     EPVPKFSKFIHGVATLLNDKVDSIPFWLPQMDVDIRKPPLPTNINITRPGRGEGGNED
                     DYDEDDEDDSALVAAMTDAPGNSFDIEEIIGYGSINPSTNEGPAQNAQTGSHIHTVAS
                     ANAPYYQRKIREAKNPIGKKYYETIAFFDHYFNGDQISKLPGGTVFDTQIEAPPGKSI
                     CVPVRVEPKVYFATERTYLSWVSIAILLGGVSTTLLTYGTPTTMLASIGFFVTSLITL
                     FHAVKVYATRIVNIRLKRAIDYEDKVGPPMICIFLFLSIAFSFFCNLV"
     gene            <696404..>697654
                     /gene="NDAI0C03060"
                     /locus_tag="NDAI_0C03060"
                     /db_xref="GeneID:11496341"
     mRNA            <696404..>697654
                     /gene="NDAI0C03060"
                     /locus_tag="NDAI_0C03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669161.1"
                     /db_xref="GeneID:11496341"
     CDS             696404..697654
                     /gene="NDAI0C03060"
                     /locus_tag="NDAI_0C03060"
                     /inference="similar to DNA sequence:INSDC:YGR188C,YJL013C"
                     /note="similar to Saccharomyces cerevisiae BUB1 (YGR188C)
                     and MAD3 (YJL013C); ancestral locus Anc_5.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669209.1"
                     /db_xref="GeneID:11496341"
                     /db_xref="GOA:G0W855"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="UniProtKB/TrEMBL:G0W855"
                     /translation="MPSTIKNKKREIIDFTKIELEKENILPLRQGRSAEQLTKALEAD
                     EKEKKRIKKYYERRLIDELDTFDDPLALHLEYINAINNLYPQGASSKQSGMLEIIERC
                     LMQFQNSEKYRNDIRYLEMWLWYIEIFFPDEPQEEQYIFVFMLRNKIGSGLALFYDSF
                     SSLLIEMKRYDEAAQLLRLGIREHSKPAYLLINRLQSLECELLDKNIPLNDNLPLEAY
                     FTNVNDPLILGRHKTDIITSNSANRDDSPRDSWKETLQLHEDIFQDEPVEVSNIFEDY
                     RKDITAKLEPKRARNKENKMGSIALEANINLGTLPQDESSVVTDRFKDKIPIYTDHFG
                     RTEPVYKYIETINSKAEKIDCNFGLFYEVSGNEYCIEEILAISRNLYTRDKVANSGRA
                     TESVELPTRKKNKARTMIQRRQRK"
     gap             698189..699258
                     /estimated_length=1070
     gene            complement(<699605..>700707)
                     /gene="NDAI0C03070"
                     /locus_tag="NDAI_0C03070"
                     /db_xref="GeneID:11496342"
     mRNA            complement(join(<699605..700293,700431..>700707))
                     /gene="NDAI0C03070"
                     /locus_tag="NDAI_0C03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669162.1"
                     /db_xref="GeneID:11496342"
     CDS             complement(join(699605..700293,700431..700707))
                     /gene="NDAI0C03070"
                     /locus_tag="NDAI_0C03070"
                     /inference="similar to DNA sequence:INSDC:YJR021C"
                     /note="similar to Saccharomyces cerevisiae REC107
                     (YJR021C); ancestral locus Anc_5.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669210.1"
                     /db_xref="GeneID:11496342"
                     /db_xref="GOA:G0W856"
                     /db_xref="InterPro:IPR015159"
                     /db_xref="UniProtKB/TrEMBL:G0W856"
                     /translation="MARTSTEDISTDITSSSSIVISSPVRSSHNSSPLKLNEADKEIL
                     KWAGKLELESCDLREKSSELIGLLKKNSTQLTSVISTLNEIVISTKKNAVMKLIKKLE
                     KQLTIVQNQKVQSQNVVNKTVTLRSKRQRTDTKSNLEQDELEKLTAKFRRNIDDKHRQ
                     IIKSNECTQSMLFNVNKQLQDMGDVLLSMSNDLQTLSQRQSTLENGMNSINSNISRLM
                     TRAPLTHKDLPSNGTTLDEDELKRIQNENIKASSFGPITRSRKQMNSMKNDVKFSLSP
                     FENPSGNNNEHRLPTNRDISLTRTIIPWNELIEDKKDVLAYSSEL"
     gene            <701069..>701431
                     /gene="NDAI0C03080"
                     /locus_tag="NDAI_0C03080"
                     /db_xref="GeneID:11496343"
     mRNA            <701069..>701431
                     /gene="NDAI0C03080"
                     /locus_tag="NDAI_0C03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669163.1"
                     /db_xref="GeneID:11496343"
     CDS             701069..701431
                     /gene="NDAI0C03080"
                     /locus_tag="NDAI_0C03080"
                     /inference="similar to DNA sequence:INSDC:YJR022W"
                     /note="similar to Saccharomyces cerevisiae LSM8 (YJR022W);
                     ancestral locus Anc_5.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669211.1"
                     /db_xref="GeneID:11496343"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G0W857"
                     /translation="MSPLLKDYLNKKIVIITVEGSCYLAMLEGYDKYTNLIVSDVRNR
                     FDDKLISQFQMLRGSEIVTCGLIEEETKETDEKEEFNKEATKDEQDVVIPKLKDTRNR
                     VANEHLIWQKVYEKKGLS"
     gene            complement(<701536..>702264)
                     /gene="NDAI0C03090"
                     /locus_tag="NDAI_0C03090"
                     /db_xref="GeneID:11496344"
     mRNA            complement(<701536..>702264)
                     /gene="NDAI0C03090"
                     /locus_tag="NDAI_0C03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669164.1"
                     /db_xref="GeneID:11496344"
     CDS             complement(701536..702264)
                     /gene="NDAI0C03090"
                     /locus_tag="NDAI_0C03090"
                     /inference="similar to DNA sequence:INSDC:YJR024C"
                     /note="similar to Saccharomyces cerevisiae YJR024C;
                     ancestral locus Anc_5.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669212.1"
                     /db_xref="GeneID:11496344"
                     /db_xref="GOA:G0W858"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /db_xref="UniProtKB/TrEMBL:G0W858"
                     /translation="MSNQNDDSLIHSDDPRHPANLICTLCEQFFHNNWCTGTGGGISM
                     KHPTTNHYYLAPSGVQKEQMKPEDIFVMDSQTLEYLRVPPKYKPSACTPLFLACYKKR
                     NAGGIIHTHSQNADVCSLIFKDQLKIANIEQIKAIPSGNIDPTTGKDISLSFFDTLSI
                     PIIENVAHEEDLIDSLNDVLDKNPHTCAVIVRRHGIFVWGPTIDKAKIYNEAIDYLME
                     LAIKMYQLGIPTTCGIGEEKNYLK"
     gene            <703501..>706128
                     /gene="NDAI0C03100"
                     /locus_tag="NDAI_0C03100"
                     /db_xref="GeneID:11496345"
     mRNA            <703501..>706128
                     /gene="NDAI0C03100"
                     /locus_tag="NDAI_0C03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669165.1"
                     /db_xref="GeneID:11496345"
     CDS             703501..706128
                     /gene="NDAI0C03100"
                     /locus_tag="NDAI_0C03100"
                     /inference="similar to DNA sequence:INSDC:YLR045C"
                     /note="similar to Saccharomyces cerevisiae STU2 (YLR045C);
                     ancestral locus Anc_5.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669213.1"
                     /db_xref="GeneID:11496345"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G0W859"
                     /translation="MNQQPDEDNYSELPLLERLQHKVWKARLNGYQELKTTLLNYDNI
                     ERNPNKDPELTTFWRDPSLFNKFITDSNVVAQENAILALEALILTFKPYTSTKHATTA
                     LLPTWIPSLVEKGMSSNRATTKNKSLECIMLLASLDTSISLTLELILTIFNNNSTPKK
                     IQPPKLLVGALICISELIKSYGLINVQIQTMLPQLVTPLITLANHADKNVRAETLNLI
                     VNIFNTTGRNKLVLQDLLLDHLKPIQQRDLDKLFEKSSAQPQLSTRLFEWQRREIELE
                     KQRKAKQEQLDAQSKLIDNDGDTDMDMNANTNMRSSNATNNIDPFVMLPEETILDKLP
                     EDFNSRITSSKWKDRVEVLEEFYDTTLTKVKKLRFKNQDYSHLLNIYANIIQKDPNVQ
                     AVTLASDSVFILCEKLRTPGFNKHYLSIVFLPLLERTKERKPSVIESIRKALKLLCQF
                     YNPLNSNGNNEDMLHEITTIFMKHKTPQVRLENSTLFKYVLENSFANGNNPIPLLTRH
                     LNEDIIPSVVHIVNDTQPNIRSIGFECLAILIKILGMRPLNETMEKLDNQEKEKIESL
                     IDTLPSFTIRKTSSSSLSSANANSTPTSTTLIKRPNSLVPPIIPSKRSATSPLKKTNL
                     QPKSRVLLTSRSLTMPETPSTAAPHSQPSTRMPLRSNDNGNTSKLNTELRIQLDKLEN
                     EKKKWIEERQSFLERINSLENVKLEMNKEIEILKEQSNKSQSDLYEKNLQLRSKELQI
                     NRSQDKITHLENELKRLQQQQQQQQKPQNQFNIMASPSLNNHINDNNIRTEPTVHNNI
                     SPSINNHANNSKINTTPYERRRLSTSSDDLPRRVDSLQLDSSSSDLSSNLIKEESWKR
                     AAEVTKQLKARIQRNENKE"
     gap             706698..706717
                     /estimated_length=20
     gene            <707463..>709157
                     /gene="NDAI0C03110"
                     /locus_tag="NDAI_0C03110"
                     /db_xref="GeneID:11496346"
     mRNA            <707463..>709157
                     /gene="NDAI0C03110"
                     /locus_tag="NDAI_0C03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669166.1"
                     /db_xref="GeneID:11496346"
     CDS             707463..709157
                     /gene="NDAI0C03110"
                     /locus_tag="NDAI_0C03110"
                     /inference="similar to DNA sequence:INSDC:YLR044C"
                     /note="similar to Saccharomyces cerevisiae PDC1 (YLR044C);
                     ancestral locus Anc_5.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669214.1"
                     /db_xref="GeneID:11496346"
                     /db_xref="GOA:G0W860"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G0W860"
                     /translation="MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMR
                     WAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     SVSSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQ
                     RPVYLGLPANLVDLKVPASLLETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILA
                     DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAV
                     ESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLL
                     GSVAEAAKGYKPVAVPAKPAANAAVDAATPLKQEWMWNQVGKFLQEGDVVITETGTSA
                     FGINQTHFPNNTYGISQVLWGSIGFTTGACLGAAFAAEEVDPKKRVILFIGDGSLQLT
                     VQEISTMVRWNLKPYLFVLNNNGYTIEKLIHGPTAQYNEIQSWDHLSLLPTFGAKDYE
                     NHRVATTGEWIKLTENKEFNQNSRIRLIEIMLPVMDAPSNLVAQAQLTAKINAKQD"
     gene            complement(710369..710440)
                     /gene="NDAI0Ctrna4D"
                     /locus_tag="NDAI_0Ctrna4D"
                     /db_xref="GeneID:11496347"
     tRNA            complement(710369..710440)
                     /gene="NDAI0Ctrna4D"
                     /locus_tag="NDAI_0Ctrna4D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11496347"
     gene            complement(<711081..>712079)
                     /gene="NDAI0C03120"
                     /locus_tag="NDAI_0C03120"
                     /db_xref="GeneID:11496758"
     mRNA            complement(<711081..>712079)
                     /gene="NDAI0C03120"
                     /locus_tag="NDAI_0C03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669167.1"
                     /db_xref="GeneID:11496758"
     CDS             complement(711081..712079)
                     /gene="NDAI0C03120"
                     /locus_tag="NDAI_0C03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669215.1"
                     /db_xref="GeneID:11496758"
                     /db_xref="GOA:G0W861"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:G0W861"
                     /translation="MVTVAINGFGRIGRVVLRVAMARKSMDVVAINDPFITNDYAAYM
                     FKYDSTHGRYKGEVTNDDKHIIVDGHKIATFQERDPANLPWGDLKIDTVIESTGVFKE
                     LDTCQKHLDAGAKKVVITAPSNTAPMFAMGVNEDKYSPDLKIVSNASCTTNCLAPLAK
                     IINDKFGIEEGLMTTVHSQTATQKTVDGPSHKDWRGGRTASANIIPASTGAAKAVGKV
                     LPELQGKLTGMAFRVPTVDVSVVDLTVKLAKETTYEEIKKVMKDAAEGPLKGVVCYTE
                     DAVVSSDFIGDSHSSVFDATAGIQLSPKFVKLVAWYDNEYGYSTRVVDLAEHIGKA"
     gene            complement(<713473..>714585)
                     /gene="NDAI0C03130"
                     /locus_tag="NDAI_0C03130"
                     /db_xref="GeneID:11496348"
     mRNA            complement(join(<713473..714135,714496..>714585))
                     /gene="NDAI0C03130"
                     /locus_tag="NDAI_0C03130"
                     /product="ribosomal protein S0"
                     /transcript_id="XM_003669168.1"
                     /db_xref="GeneID:11496348"
     CDS             complement(join(713473..714135,714496..714585))
                     /gene="NDAI0C03130"
                     /locus_tag="NDAI_0C03130"
                     /inference="similar to DNA sequence:INSDC:YGR214W,YLR048W"
                     /note="similar to Saccharomyces cerevisiae RPS0A (YGR214W)
                     and RPS0B (YLR048W); ancestral locus Anc_5.116"
                     /codon_start=1
                     /product="ribosomal protein S0"
                     /protein_id="XP_003669216.1"
                     /db_xref="GeneID:11496348"
                     /db_xref="GOA:G0W862"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /db_xref="UniProtKB/TrEMBL:G0W862"
                     /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNTRPDG
                     VNVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRF
                     TPGNFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNVPVIALTDLDSPSEYVDVAI
                     PCNNRGRHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEAEQTTEEAT
                     EEAGEEETKEEATEEQAGASEWAEENADTVDW"
     gene            <715356..>717473
                     /gene="NDAI0C03140"
                     /locus_tag="NDAI_0C03140"
                     /db_xref="GeneID:11496349"
     mRNA            <715356..>717473
                     /gene="NDAI0C03140"
                     /locus_tag="NDAI_0C03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669169.1"
                     /db_xref="GeneID:11496349"
     CDS             715356..717473
                     /gene="NDAI0C03140"
                     /locus_tag="NDAI_0C03140"
                     /inference="similar to DNA sequence:INSDC:YLR047C"
                     /note="similar to Saccharomyces cerevisiae FRE8 (YLR047C);
                     ancestral locus Anc_5.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669217.1"
                     /db_xref="GeneID:11496349"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:G0W863"
                     /translation="MSPLKDSNYEENTQLIDWITSRIPTFEKEVDKVVRTTQVRTWTR
                     YCLLCSTIMICILLPLRNYLILTERFFSISHRLKHHILGRQSLLHKSRLYHNRSFRIC
                     LFWFATLCFFTFYNTQQDLLQITKRMGRIAVAMMPPLLFLSLRPSPLPKTLYLSLLPI
                     HKWISRIVVLESLLHTGFYLLYMQKKNSLQKLKKLPNIYGIIAMLLFIAIGATSINPV
                     RRCNFRLFYYIHYSFTWMTVILLHFHARPGIPYYTAMNCIILSYQIYYRVSHTRQTVV
                     TTYPVSPSLTLLEFPLSDLTNKPTLPSAHVRLNICHKNFIKRIFFKIIPFQHPFTIAT
                     LPTDETIKLIIRNGQLPLRTNKSYDVTGAFDPELNFIEQPTKPSNLTNSLLETYSNYN
                     PFQVNSTSLLTSPLHYIIHAKRVLIFVGGSAISFGLPLLRILNFNGVVVRLIWVSRDY
                     RDLKLLSYFKNNFQGMEIYISGCIGKEQDIQIDYVDFDQPSRENVCDISENTFHPCQR
                     ICAEQTLHSDETKPITKGRSCKYGSIKKCSTSTNLTNMAESKEIDEIDFTSMFGSGKK
                     KSKSVVNVSELESGLTLRNEDPFRKPITINPPPCDFKPYNKLQTNMESPNNMKVKVPS
                     GVKVYFGRPTLCETDYEWCLERDCSADVQDDAGCQTNYESNEIEDLSNVWVVAAGPAG
                     LVESTRRWTNDLGLHFHAENYAV"
     gene            complement(<717726..>719450)
                     /gene="NDAI0C03150"
                     /locus_tag="NDAI_0C03150"
                     /db_xref="GeneID:11496350"
     mRNA            complement(<717726..>719450)
                     /gene="NDAI0C03150"
                     /locus_tag="NDAI_0C03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669170.1"
                     /db_xref="GeneID:11496350"
     CDS             complement(717726..719450)
                     /gene="NDAI0C03150"
                     /locus_tag="NDAI_0C03150"
                     /note="ancestral locus Anc_5.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669218.1"
                     /db_xref="GeneID:11496350"
                     /db_xref="GOA:G0W864"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:G0W864"
                     /translation="MNSTMTSESSKKDIKIINLEPRASTEEGSIELHNMASNLRSIIS
                     KTGAGEVNYINASKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVM
                     GTGISGGSVSFVWGWFIASFFILLVGISMAENASAIPTAGGLYYWTYYYAPKGYKEVF
                     SFIIGCSNSLALVAGLCSIDYGLAEEIMAAVVVTYDGDFNITDGRLYAVFLASVIVMA
                     LCTSMASGVIARLQNISIVSNLFIIVLLFIALPVGTKHKRGTFNDASFIFGGFENFSD
                     WNGGWQFCLTGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPVGIIGSISACWILGWLII
                     ICLMACIDPQLENVLDTQYGFPMAQLIYDSLGKKWTIAFLSLMAFCQFLMGCSICTAI
                     SRQIWAFSRDDGLPFSKYIKQVHNSVPFFAILAACVSSLVLGLLCLIDATAANALFSL
                     AVAGNYLAWCTPTLLRLTSGRDIFRPGPFYLGKVLSPIVSWIGVLYEVFIIIMEMFPS
                     QQHGINKTNMNYACVIGPGIWFLAWIYYLLYKKKYYHGPKTNLSDEEYSDMVGIDVID
                     GILEQKEP"
     gene            <720703..>723855
                     /gene="NDAI0C03160"
                     /locus_tag="NDAI_0C03160"
                     /db_xref="GeneID:11496351"
     mRNA            <720703..>723855
                     /gene="NDAI0C03160"
                     /locus_tag="NDAI_0C03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669171.1"
                     /db_xref="GeneID:11496351"
     CDS             720703..723855
                     /gene="NDAI0C03160"
                     /locus_tag="NDAI_0C03160"
                     /inference="similar to DNA sequence:INSDC:YGR218W"
                     /note="similar to Saccharomyces cerevisiae CRM1 (YGR218W);
                     ancestral locus Anc_5.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669219.1"
                     /db_xref="GeneID:11496351"
                     /db_xref="GOA:G0W865"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W865"
                     /translation="MERITNNDGSINVNALDQIVDTFYKGTGPEQEEAQIILDTFQKE
                     PYSWSFIDKIIQDSKNDQTKFISLSILDNTIQKQWNTLPIEQKLGIRNFLVGMIRSLC
                     QDKNRFRATKGLLQKADLTLIDILKHEWPDHWDDFIPELTVLSSQTLEVCQNNVYILR
                     LLSEEIFDLAPKRITQAKLLHLKEAISNQVDQIFQYFISILESTISPSVRRATSESIL
                     CYLQWIPLNYIYETELIELLISQVVTVAETRPITLKCLMSIIEIDIPEDDFYNERKSR
                     ALQIFDTVINMIKSSHVPNKSGLLNTNDSDEVFQESMIDFIKTFLIKYRSTLENDGRR
                     QELEITHQYLLESKNISEPELFRNILEYWKDLAFKLNILSDQHRMLVKDPVMSAEESA
                     FYQKVSFYQNYLSELSSIIIDNMEKPEEVVSIIDEDEDELITKIIVDGEENEIYLLEK
                     EVLRYTANLDRFLNIQKIFYQEFTSLDTSEGWSITKLNSLCWALGAIPKCLEYEDERK
                     LLLTFLEGLSNFSMRKADKKDKIACISNILYLSSRYPKSLNSDKVRLENIIIDIFKII
                     KAFTELQSMACDTFMKIVQQCKYDLINSIWGEPLLFMKTIIGELEQCIPVLEHDNVNI
                     LYESCGLLITEVKNAIEKEQLMEFLMAKPKAIWGEVTLKVQNDFSILLDSRFRKVVMH
                     SLQMYSAVCKTTGPDFFYQFQLIYPQLLQLYALTTSILRNKCGSIASGISTLHDLLVI
                     QKGILKLIELYISKSKSPHVIVNKFINPLFETILNDYKKEDAEMKNPEVLNCLTVIVT
                     KVGSLIQEKVTLILEFFLECTVEMIDKNFDDYSEIQHCLYEFINATVKETFQSVLELP
                     ESYVGIFFKNILWAIQDPRSEIQDIGFQLANKITSNIHSLENTTFTLQFYKYYYLEFV
                     CQTFSVMTDTCHQSEFVEQSILLMNLISMVFDNKVVIQLDSNKLLGNEGYLRKFISSL
                     ISSAFPHVEDIEITNFLNSLLVHLKDPSIFRRVLRDFLIQLKESHADLNNYLDVEQRE
                     KTLWQSHKLERQPISRLEDN"
     gene            complement(<724089..>724754)
                     /gene="NDAI0C03170"
                     /locus_tag="NDAI_0C03170"
                     /db_xref="GeneID:11496352"
     mRNA            complement(<724089..>724754)
                     /gene="NDAI0C03170"
                     /locus_tag="NDAI_0C03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669172.1"
                     /db_xref="GeneID:11496352"
     CDS             complement(724089..724754)
                     /gene="NDAI0C03170"
                     /locus_tag="NDAI_0C03170"
                     /inference="similar to DNA sequence:INSDC:YHR147C"
                     /note="similar to Saccharomyces cerevisiae MRPL6
                     (YHR147C); ancestral locus Anc_5.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669220.1"
                     /db_xref="GeneID:11496352"
                     /db_xref="GOA:G0W866"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:G0W866"
                     /translation="MKGIGRRFFSVNHFLRSHIGASPLYTTPETKITLGMLTAPKVIR
                     KGKRSLKLSQYVSIDGPKGSLRLEIPDFVDIVPEKTESESSSKYFVTVKNPSDVMQKS
                     MWGTVRSHINNNITGVNEGHMSILKFVGTGYRASIEKTDNGGNFVNVKVGASIKQGLD
                     VPDGIRVETPVPTLLIIEGCDKQQVSQFAAKIRKFHPPEPYKGKGIYVNDETVKLKNK
                     KIK"
     gene            <725089..>725640
                     /gene="NDAI0C03180"
                     /locus_tag="NDAI_0C03180"
                     /db_xref="GeneID:11496353"
     mRNA            <725089..>725640
                     /gene="NDAI0C03180"
                     /locus_tag="NDAI_0C03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669173.1"
                     /db_xref="GeneID:11496353"
     CDS             725089..725640
                     /gene="NDAI0C03180"
                     /locus_tag="NDAI_0C03180"
                     /inference="similar to DNA sequence:INSDC:YHR148W"
                     /note="similar to Saccharomyces cerevisiae IMP3 (YHR148W);
                     ancestral locus Anc_5.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669221.1"
                     /db_xref="GeneID:11496353"
                     /db_xref="GOA:G0W867"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:G0W867"
                     /translation="MVRKLKHHEQKLLRKVDFLDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNRICGDIRRLAHKLSLLPPTDPFRSKHEQLLLEKLYNMGILSTKSKISDLENKVT
                     VSAICRRRLPVILHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTW
                     TDNSKIKKTLLRYRNQIDDFDFA"
     gene            complement(<725855..>727903)
                     /gene="NDAI0C03190"
                     /locus_tag="NDAI_0C03190"
                     /db_xref="GeneID:11496354"
     mRNA            complement(<725855..>727903)
                     /gene="NDAI0C03190"
                     /locus_tag="NDAI_0C03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669174.1"
                     /db_xref="GeneID:11496354"
     CDS             complement(725855..727903)
                     /gene="NDAI0C03190"
                     /locus_tag="NDAI_0C03190"
                     /inference="similar to DNA sequence:INSDC:YGR221C,YHR149C"
                     /note="similar to Saccharomyces cerevisiae TOS2 (YGR221C)
                     and SKG6 (YHR149C); ancestral locus Anc_5.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669222.1"
                     /db_xref="GeneID:11496354"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="UniProtKB/TrEMBL:G0W868"
                     /translation="MIQMRSVDQNSLRPRTTAGSFQYLYKRADSDSSSSSKTSSSKST
                     KCTGTKAQCEKPSMNSHSTSVTVGVAVAVPVAVVIIALAAILIVVYKRSKREAQEDND
                     PDFDGDGEYLPNVHPYATQPQYYPTNDPQFATRNQNTYPPQQQQQPPIENPFSNMQRV
                     DSSWAVEPFQLPNTDDTNSLREFAKQVQNDKLGGYHLASRNGSRVELSQQSSSVSIPT
                     IKDTIKFAATDDSRFETNNNGYSNSQRTGTIDFESSSNGSPNTFLDEKLVKNSTVSIP
                     TDELPLNTTQNAIQNTLEPYNDAFEFENNREDDADENNEDDYTIPLSSSEEEDIKRMK
                     SIYQVYLDRNGTTYQKAGKMNESDTPLETATKNTNLPMEQTTYPTEVVEDVSNQYGNL
                     DFQSNHENKNTDTSATLAVPTSKTRAASSIYSEAPFQLSAQQHYQPQQSYQQPQQQYP
                     QYLQPLQQVPPQPYLQYPPQAYNPQNQYYQSQQQFNHPQTLETIGELPTPTGLMNSAS
                     SHSLTSFRNPSKQQIQLQTARLNGTALNPVDHPEMFYTSTPDAYNNGQGNGYAGTDAS
                     IQTNMKKETSTAPLPFQLRQSIVMTNPHDLQAVPTHKPAGSFRNINAANNSRNNSLTS
                     QTNPYYQQQQRQFNSRVSGILEETDTVQPPRMGAILPHSGSQEDLRRQLGSSDNYNVT
                     "
     STS             728291..729140
                     /standard_name="STS-Z40718"
                     /db_xref="UniSTS:46581"
     gene            <728685..>730247
                     /gene="NDAI0C03200"
                     /locus_tag="NDAI_0C03200"
                     /db_xref="GeneID:11496355"
     mRNA            <728685..>730247
                     /gene="NDAI0C03200"
                     /locus_tag="NDAI_0C03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669175.1"
                     /db_xref="GeneID:11496355"
     CDS             728685..730247
                     /gene="NDAI0C03200"
                     /locus_tag="NDAI_0C03200"
                     /inference="similar to DNA sequence:INSDC:YHR150W"
                     /note="similar to Saccharomyces cerevisiae PEX28
                     (YHR150W); ancestral locus Anc_5.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669223.1"
                     /db_xref="GeneID:11496355"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G0W869"
                     /translation="MSSSSSLKKGGVKSYLSKQYDRVLDSLLVMEESLSGLQPPSSST
                     KAAGPMSSKDIFHMVAGSLVNASIEKIRPEREDLLENNDLTLADTNASDELIDGLDGK
                     TASVKELPSETKDHFLEIFLDRLITRLTPTYLPEREHFHEIAKPREPPVSAAVLAGNF
                     KKLGGKMDSLLEFRDSFIRLLTWRNPSGTITMLILFTLICYNPMYLILLPLFEVMYGT
                     IIAAYSFRHPLKRDVYPTRKKYGRSLLYEIFNGGPSTAIPIPTSENQHVASIANEDHD
                     AEILHNPNEDLSGSAKVIVNLRDLQDMTTGLVELNDSITHFNTEVTGFRDEYRSTKVF
                     LKFGLLFLTLKLISPYINWSFVISALAWVTLILMHPKLRKILENSKENPESDVEEPTL
                     SSEKNYDIVLDEKPEIRTVELFEIYQQGIIPRYWRFLKFSNTVFDTSDPYRKAQQPPP
                     GVLQLDEVLPPKNWEFDKNYPWEVDHHVASWAAEKGLEMEIEGEFLYDSLFKRRRLTR
                     KVLKYANPTLNS"
     gene            complement(<730481..>732037)
                     /gene="NDAI0C03210"
                     /locus_tag="NDAI_0C03210"
                     /db_xref="GeneID:11496356"
     mRNA            complement(<730481..>732037)
                     /gene="NDAI0C03210"
                     /locus_tag="NDAI_0C03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669176.1"
                     /db_xref="GeneID:11496356"
     CDS             complement(730481..732037)
                     /gene="NDAI0C03210"
                     /locus_tag="NDAI_0C03210"
                     /inference="similar to DNA sequence:INSDC:YHR151C"
                     /note="similar to Saccharomyces cerevisiae YHR151C;
                     ancestral locus Anc_5.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669224.1"
                     /db_xref="GeneID:11496356"
                     /db_xref="UniProtKB/TrEMBL:G0W870"
                     /translation="MNFFRVWNVLLLILLSQFQFASCQNDWAVLSNQQKIALRSQRDI
                     MSNVTIDQLPIIGGDLRHVLFHENFIDPNITENDNTTNTRYLTTFIDLLSTGMQGFII
                     DIEQKNNSWVISNTSLPFGTFLNTLQIFIHTTNNNLVANMLVMFLRLPNGTIIQSTDA
                     LQRYPQLNLTYLFDQTIQSSSIYTPLDLATDRSGGNAWDTHGRSMEDGWPTFGTFIYS
                     HRKRMIIIELTDILKSTDLPYSFNRTILHYDTKNSTFECPNTESALNDISTLHWRFLN
                     SVFTPNDIGEYVSCGISPIISNNYSNSTIRNIAKLFQSTIWSWGPNQPIYTRIEHGTV
                     TKNDTLQAYNCALLKYYSTNDSITWEVANCYRNERGLCRYKDRSFIWHVTEDEDTYFE
                     FDNFKGSKCPDDYTFSLPRTPLEERALLLYLKNRTINDIDIWIDINSVSVSNCWVNGG
                     PYATCPYQKAVSTRNFVKMLTPPSVISFALLALVFYLSILPLPIHDNRKNWRRISNKV
                     SKSEAEGVPS"
     gene            <732995..>733345
                     /gene="NDAI0C03220"
                     /locus_tag="NDAI_0C03220"
                     /db_xref="GeneID:11496357"
     mRNA            <732995..>733345
                     /gene="NDAI0C03220"
                     /locus_tag="NDAI_0C03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669177.1"
                     /db_xref="GeneID:11496357"
     CDS             732995..733345
                     /gene="NDAI0C03220"
                     /locus_tag="NDAI_0C03220"
                     /inference="similar to DNA sequence:INSDC:YGR230W,YHR152W"
                     /note="similar to Saccharomyces cerevisiae BNS1 (YGR230W)
                     and SPO12 (YHR152W); ancestral locus Anc_5.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669225.1"
                     /db_xref="GeneID:11496357"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:G0W871"
                     /translation="MTTAVSIPKKIETPSSGDKLKVTTIVSTKNVKATQKPTSASLRR
                     SIFKKKTMASAIQDRNKALQLRNKFASPTDRLLSPCSQKLADHKSKFLLNKTNPTKLN
                     FATPNNNNIDSDEE"
     gene            <734531..>737635
                     /gene="NDAI0C03230"
                     /locus_tag="NDAI_0C03230"
                     /db_xref="GeneID:11496358"
     mRNA            <734531..>737635
                     /gene="NDAI0C03230"
                     /locus_tag="NDAI_0C03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669178.1"
                     /db_xref="GeneID:11496358"
     CDS             734531..737635
                     /gene="NDAI0C03230"
                     /locus_tag="NDAI_0C03230"
                     /inference="similar to DNA sequence:INSDC:YHR154W"
                     /note="similar to Saccharomyces cerevisiae RTT107
                     (YHR154W); ancestral locus Anc_5.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669226.1"
                     /db_xref="GeneID:11496358"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:G0W872"
                     /translation="MDQGITTSIKSKLFENLNFLVIATENDDINETTKVVTLLEDNGC
                     NSCLIHDTKDESTTNELTSSKDLKKWYIKTFGSKNIHFIISNTSNFRFYKIAEFDFLV
                     PIVTPKWVTACISTRRHLRTSLFSPNPNHFFRNFQICISTYSMKFSEYIFYSELINSL
                     GGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYIDE
                     SPHLITEDQNNSEHLDDIWRFVLDDVVFSDSIKYQFLKNKRFILAMNLSMNKNTYSFF
                     LQLIKNCGGSIVRYIEESDIETCDGNCYIGDKIGTKDYELSLSKGNVELGNLIWFFHM
                     WSICEFVPPNTNLLFEPFKKKIFKSSELILTYTNYFGRQRSYIQRLTEMLGGISTTEL
                     SKRNTHLVSRMPVGKKFFQAKKWKDRCQVINHLWLERTYKTGIKQDPNSSEFQDFKID
                     EDDILLTLGQYNYKLKQLEDLQALKADDIMNSNNGDMTPIKNDDDNEDYIDTILSPPI
                     KSISVSITATEANKKLLTSFEGISRGDVIDNQLKDEMVASKELSNKGKRSIETSANYL
                     KEEIRKNNDDEDKSSTQHKYEKALFDNIKEAKNGVNEVIQQQKEPTPVQCTAQDIEEE
                     TKLNINVHAAKEAENTRTLKSNEIVLKQDYSHLFDGLSQEDNDKDQLLRTNAITTTPN
                     ISRHSSKLKTPTAIESNRSRSFDTSIVASTDSSGGSGRRAARAKAEKRLHESIESLNE
                     FEKNSKKKRIGNLLPAEIAILEEKKQNEKLAKEIVSKLRRDGERENVLQFSINAISTG
                     CHEDIGILDLEILNQFGIRLYPEITSDINFNTVIAPKKMRTAKFLKSFSFHPLKNILL
                     STFIDDILKNIHIGNNDFFQGITLNDYKLKEFDNSLIEKKTRQPTKLFERAGIVTINL
                     MNDLIGGTEIISSILKCHGIKHTNVINHKKFGISDIVENKYDNTNDEGNNTGKKRKTT
                     KKRIRLNDGKFIDCPNYVIVATKPLQAKKLKKIMNADEELSNKNVLIVDWDWCVNMIF
                     NLRC"
     gene            complement(<738655..>738918)
                     /gene="NDAI0C03240"
                     /locus_tag="NDAI_0C03240"
                     /db_xref="GeneID:11496359"
     mRNA            complement(<738655..>738918)
                     /gene="NDAI0C03240"
                     /locus_tag="NDAI_0C03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669179.1"
                     /db_xref="GeneID:11496359"
     CDS             complement(738655..738918)
                     /gene="NDAI0C03240"
                     /locus_tag="NDAI_0C03240"
                     /inference="similar to DNA sequence:INSDC:YGR236C"
                     /note="similar to Saccharomyces cerevisiae SPG1 (YGR236C);
                     ancestral locus Anc_5.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669227.1"
                     /db_xref="GeneID:11496359"
                     /db_xref="UniProtKB/TrEMBL:G0W873"
                     /translation="MKLDPKVYSEATKAAKTPQFKYLMLGSVCAAILPTSIYMQQRNS
                     AKEKQKAQEQLLMEKKPERRDSLASMDPLLDDFDSFGTVSAIL"
     gene            <739350..>739976
                     /gene="NDAI0C03250"
                     /locus_tag="NDAI_0C03250"
                     /db_xref="GeneID:11496360"
     mRNA            <739350..>739976
                     /gene="NDAI0C03250"
                     /locus_tag="NDAI_0C03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669180.1"
                     /db_xref="GeneID:11496360"
     CDS             739350..739976
                     /gene="NDAI0C03250"
                     /locus_tag="NDAI_0C03250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669228.1"
                     /db_xref="GeneID:11496360"
                     /db_xref="UniProtKB/TrEMBL:G0W874"
                     /translation="MEVTSTTDQNKEIVSITDFCIRYSIPRKIQNLWGFNKCIENQTN
                     NGHQSSKDSKVIEHITNDQFEEFKKEIEGKNKEKIDKKRKQEVWDRHQSTEYKKPCLA
                     PNDIQYLQFEKASENIEVFCGNILLSSDNLEEQEQSLLNEMTFQTSLIRTSSFTDVYT
                     YGAINNNSNKFDYNNNNNNNNQGFIPVSFHSSSCSSSHSPSPFQNFGT"
     gene            <740705..>742180
                     /gene="NDAI0C03260"
                     /locus_tag="NDAI_0C03260"
                     /db_xref="GeneID:11496361"
     mRNA            <740705..>742180
                     /gene="NDAI0C03260"
                     /locus_tag="NDAI_0C03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669181.1"
                     /db_xref="GeneID:11496361"
     CDS             740705..742180
                     /gene="NDAI0C03260"
                     /locus_tag="NDAI_0C03260"
                     /inference="similar to DNA sequence:INSDC:YHR159W"
                     /note="similar to Saccharomyces cerevisiae YHR159W;
                     ancestral locus Anc_5.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669229.1"
                     /db_xref="GeneID:11496361"
                     /db_xref="UniProtKB/TrEMBL:G0W875"
                     /translation="MNNSFDEFVEETDKAIHVDTSTRNSYRNTNDNVNNLLEEVKSYD
                     DSNSDKRSKRHQPTVSLLQTTPTREECEEDHPLKNFNDIYDVAEETAEFNDFHRSLRT
                     PDVYIHTEKNPTSTKSINVISRPNSNPRSSMMPKRRSLIQPMVISPSTPEDSLDVDIY
                     QFTKAVKSSSSSTTKLQNHVPLGISTENLHSRTNSTQLITANELSKQNDIASLLTNLA
                     NKEQELLESKQKIEDLQKQLQLNEKLYKQHSIELKSLKEQVSRHFLSVKLGDPNSTGQ
                     GEYLDDNSSTPRRSGNTTMIEARNTNTSPQSNLKTTADTNVNSQSTSMWNKPLALFNQ
                     FDQIIQQELEKSLNWDDDAEEIARSNGRTSMDNKSPPNSKPETNTNRSVTSSLWSFVN
                     DVKTGILGVEIENEDSMSETLRRRNAQKGRKKVREKKPDGIKEFNTIKKQQQQQQQQQ
                     NSNRLKFIDTAADFSESSTSSSEQNNDPDNDKNIVEMETLQ"
     gene            complement(<742293..>743174)
                     /gene="NDAI0C03270"
                     /locus_tag="NDAI_0C03270"
                     /db_xref="GeneID:11496362"
     mRNA            complement(<742293..>743174)
                     /gene="NDAI0C03270"
                     /locus_tag="NDAI_0C03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669182.1"
                     /db_xref="GeneID:11496362"
     CDS             complement(742293..743174)
                     /gene="NDAI0C03270"
                     /locus_tag="NDAI_0C03270"
                     /inference="similar to DNA sequence:INSDC:YGR239C,YHR160C"
                     /note="similar to Saccharomyces cerevisiae PEX21 (YGR239C)
                     and PEX18 (YHR160C); ancestral locus Anc_5.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669230.1"
                     /db_xref="GeneID:11496362"
                     /db_xref="UniProtKB/TrEMBL:G0W876"
                     /translation="MSSSACQTNLVSKFISKHDNNLQNSVSPLSPSYTGRSKVPKFND
                     NVADKKLNSFLLNSNTNNFIRNGFPEQLPHHTKPSYFHELHDSQESKGRCLDDAPEWI
                     SEFSNLELRKKDEQNSGRFIPSKEDTPISHIDIPNLQGNIGNNIIRLNHGSFPLNHTF
                     PFKNYSLSTYEVQKYRSYNENENEAPEFLNEQFNIIEEEEQKEDSMNTGFPNKNISTE
                     QEEFKNIAKDIYDFVENKENKNVSDKIRGSKFMSMISLVNDGDVTINVQERELFSLKD
                     GDTLGNKFQHIDSDRLN"
     gene            complement(<745118..>747277)
                     /gene="NDAI0C03280"
                     /locus_tag="NDAI_0C03280"
                     /db_xref="GeneID:11496363"
     mRNA            complement(<745118..>747277)
                     /gene="NDAI0C03280"
                     /locus_tag="NDAI_0C03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669183.1"
                     /db_xref="GeneID:11496363"
     CDS             complement(745118..747277)
                     /gene="NDAI0C03280"
                     /locus_tag="NDAI_0C03280"
                     /inference="similar to DNA sequence:INSDC:YGR241C,YHR161C"
                     /note="similar to Saccharomyces cerevisiae YAP1802
                     (YGR241C) and YAP1801 (YHR161C); ancestral locus Anc_5.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669231.1"
                     /db_xref="GeneID:11496363"
                     /db_xref="GOA:G0W877"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:G0W877"
                     /translation="MTTYMKLVKGATKIKLAPPKLKYIEPILLGSADPNDFREIIRAL
                     EARISDSAWTIAYKSVIMVHLLIREGDKNVTLDYLSNDLDFFTLSSSISNNSTAETRY
                     LTRYANYLKIRCQEFGKTNKDYVREGYSNLKLSTDPSPRDLQKALQHVESLEVQISSL
                     LKLKYSQMDLNNELLLFSFKLLVQDLLALYNALNEGIITLLETFFELSHRNAEKTLDL
                     YKTFVNLTEHVVKYLKSGKSIGMKIPVIKHITTKLIRSLEEHLLEDERTHNTFSQSST
                     SIGNGTPDATIDNNNNNNNSKASESSAQVRLDQIREQKRILQEQLNNQQVLISPVSPT
                     STTNTYNPFSIDSVTLDQSQSHIQAQIPIVQSQTQIAQATSNPFMFVPQQTTSTTAFQ
                     QTAPNVSSQGPQQQPAYQPQTSAPVPAPAHAQQQGLQHINTFSASNQNQIVQLHHPFQ
                     TYETTHAFPSAQQQIPDGYINSTYNQHTTGNIQNNNNVQPQTNNNNISLNGEKILHPQ
                     ATGSKNPFSMDNITKNIEQREQINPFSTTNFEESDNNQFQPTQISSQINSQLPASSSS
                     INNINNPFSVSSPQLQSHSMNLAQTTYDIQSQMPPQMQSHQLIQHTQTAPSIPIQQHG
                     TGFMTNSNNNNNNNNNNVATIPQNNMTTDQPPQQQLPQQIQQLNTEYNPFGMQNQTAY
                     QPQMQSQMQPQPQPQMQQYNQYANNFNQQQTPNLIDI"
     gene            <748134..>748538
                     /gene="NDAI0C03290"
                     /locus_tag="NDAI_0C03290"
                     /db_xref="GeneID:11496364"
     mRNA            <748134..>748538
                     /gene="NDAI0C03290"
                     /locus_tag="NDAI_0C03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669184.1"
                     /db_xref="GeneID:11496364"
     CDS             748134..748538
                     /gene="NDAI0C03290"
                     /locus_tag="NDAI_0C03290"
                     /inference="similar to DNA sequence:INSDC:YGR243W,YHR162W"
                     /note="similar to Saccharomyces cerevisiae YGR243W and
                     YHR162W; ancestral locus Anc_5.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669232.1"
                     /db_xref="GeneID:11496364"
                     /db_xref="GOA:G0W878"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G0W878"
                     /translation="MSTTTINSAFRRFWQSQTGPKTVHFWAPTLKWGLVIAGLSDINR
                     PVEKVSGAQNLSLLATALIWTRWSFVIKPRNLLLASVNGVLGLTAGYHLLRIVDFRIR
                     NGDSMSQLMKYIINGEQTQKQKHQQTKAITSS"
     gene            complement(<748846..>752085)
                     /gene="NDAI0C03300"
                     /locus_tag="NDAI_0C03300"
                     /db_xref="GeneID:11496365"
     mRNA            complement(<748846..>752085)
                     /gene="NDAI0C03300"
                     /locus_tag="NDAI_0C03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669185.1"
                     /db_xref="GeneID:11496365"
     CDS             complement(748846..752085)
                     /gene="NDAI0C03300"
                     /locus_tag="NDAI_0C03300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669233.1"
                     /db_xref="GeneID:11496365"
                     /db_xref="GOA:G0W879"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="UniProtKB/TrEMBL:G0W879"
                     /translation="MLGLQKIIDLSMSINLSNVEPDLIKSTDEYPLEVIPGEFHEQQV
                     YITDPAMIHDISKLNYGRISRDKSMDKIEQQDLKRHIIEMATTFYRYNNKHLRDNVRK
                     PSVTTVSKYFGIARQTFDDHLKGFHKNSVIFGAASKPLLESNEILLFKAMLSIAHNNE
                     FPLPNMDDDLKYYIERFLNRKKLALNETETVDELLDKLNNATTISPSDPHNDPFTLLS
                     AYSIIHDGILIKTSDLNDHTFNSKLRNTFNALNYIKRLAKNNNVMKNRNNSNVNSGSS
                     SNNKVVSKRTITRIRQKLGISQKKRKLLINEKLHPTINNNNNDNNNRENRNCNDEDDQ
                     VKNKEWLRSNILFNQSLTEYDDRIWNCDEILIKVGEIGDRYRSPKKLKSKISTNNNNN
                     NDNNNTKNASLLHIEEQERRKQPFNIPGGHGTQIQNPEDDRRSNGSKIETKESRQNND
                     EKRNRNENENYFHKSFQSNNNTDNISESVIDTLLRTEDNRGNNDNGSYSLDGIDTVSS
                     SRIPHDLDHIGHQTVNPVDLGDHSKFAHQIHYNFDDTEKNQPSAKDGNDGEEEDEEQS
                     TGGMREDSNLQDTTTTTTTTNNNNNTVMISIADDEFSLLYTVGIDGSILKPNIILNSE
                     YDNRTNGRDSIISQIKYNRMKDDWIITIPSKEDEEERNKIEIFSKYIIECFHKQTAKF
                     LQSKGLDYHSTRRLLIINSEIIPFQMDFLRVLNELNIDLLIIPSYSSTMLQPLDFGIL
                     NFFKSELRKLNRQWYSGSLVIPKMYKDEHVDDHTTNNNEAQNNYFLNHDYEHNNNHGY
                     TIHQNLNNSISDDHQRKKAKDSNTDDMTLTDQIEIIYYLQNSLSKRIKNIHDIVRNGF
                     GRVMINVGLNHGKLMQFIYNCEENIRLKELDNGATALPGNEMSGRIRRSNIDITPPHT
                     AEERRQDEHHHIKFNDDNNDDDDEEEEEEQEEETLYHKESQRYSHKIDDDHEHNHTNN
                     HFTVPMSNHPNNHHTTTNTNHNENGNEHEAMLTNSANTEDDLRLANIVRENISDATMT
                     SVFFEPLLPVPDLEGNQSHHDFTNSDNANNNDTNNNSNNNNTNNSHGMD"
     gene            <753366..>754124
                     /gene="NDAI0C03310"
                     /locus_tag="NDAI_0C03310"
                     /db_xref="GeneID:11494736"
     mRNA            <753366..>754124
                     /gene="NDAI0C03310"
                     /locus_tag="NDAI_0C03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669186.1"
                     /db_xref="GeneID:11494736"
     CDS             753366..754124
                     /gene="NDAI0C03310"
                     /locus_tag="NDAI_0C03310"
                     /inference="similar to DNA sequence:INSDC:YGR248W,YHR163W"
                     /note="similar to Saccharomyces cerevisiae SOL4 (YGR248W)
                     and SOL3 (YHR163W); ancestral locus Anc_5.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669234.1"
                     /db_xref="GeneID:11494736"
                     /db_xref="GOA:G0W880"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:G0W880"
                     /translation="MVRAIVSNIEISLSKSLGEHILKHQDIALKSARKFNLAISGGSL
                     INVLRAAFIEDKTLASKVDWHQWNIFFVDERIVPLDNPDSNFGAFKKAVLDSLPENKR
                     PTVYTIDEQLVKDGKDSYPLIAMEYEKILPEKLDLVILGCGPDGHTCSLFPGESHRYL
                     LDEKAKKVMWCQDSPKPPSDRITVTLPLLGNSNEIFFVAEGSSKQDIMHEIFDKENLE
                     LPCALVNHLYGNKVTWFVNDEAVKKVEKDIQSIN"
     gene            complement(<754295..>758803)
                     /gene="NDAI0C03320"
                     /locus_tag="NDAI_0C03320"
                     /db_xref="GeneID:11494737"
     mRNA            complement(<754295..>758803)
                     /gene="NDAI0C03320"
                     /locus_tag="NDAI_0C03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669187.1"
                     /db_xref="GeneID:11494737"
     CDS             complement(754295..758803)
                     /gene="NDAI0C03320"
                     /locus_tag="NDAI_0C03320"
                     /inference="similar to DNA sequence:INSDC:YHR164C"
                     /note="similar to Saccharomyces cerevisiae DNA2 (YHR164C);
                     ancestral locus Anc_5.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669235.1"
                     /db_xref="GeneID:11494737"
                     /db_xref="GOA:G0W881"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W881"
                     /translation="MPKTPERTKRSAEVALSPNLKSKVIKQKVTKQGTESSRKRKRKY
                     QFAPVDNLDSKSAPPSAVLKSIPVSQVRNTIRTKRKVKTDVSIEKVPVVSKIKEENES
                     DKIKKTPTIDDNGSYKNGKSPAEQVIWKYSPAIKHKPDDFRSSPSKLDDPPLMDNNQD
                     PSSTPIIANKWKTILNFNNMKKDDNVGMRLDSPLEREKGSPKGNTVKDSLRGTLRDID
                     DILGDIEGDLSLKPNMSRIKDELPSSPSGVPTNSIYCTTKKTLGEDNDSLNEGDDSLI
                     DILTQHYTQKLGTHTPIATGKGNNADLEPLGNLAEEIIEEKKSAENTDIPNGKDTSND
                     ADFSDSLLDLMENSDGMDGNVEPESEVRILGDQISKNLKVKSDTPDQNMSEYVKLAQA
                     AVERKGVTRLVILEVRELTLPRIGIQKILSCINSQREKSSVIIRRPWSYLEYDVGDVI
                     HIIEGKNIENKRLLSDDINPKTQLANDNLLILNPDLLFSATSIGGSIDCLRRSVIQAS
                     FNDPRGEPSIAMTIGNIVHELLQDSFRYMMSHELLTIEYLDERLDFLLESFKFDIMVC
                     NESLADVKEQIVKDHAENILQFVNHFVQKSNYGCYVSVSGLKKTQPLSISDVIDIEEN
                     IWSSTYGLKGYLDLTVEANTENIKCIAPLEVKTGKYRGLSHEAQGLIYTLLLNDKYDL
                     PVDFFLLYYTRDKSMTKFPKILHSIKHILMLRNQMATTFKHQLKEITNRERLEYKLPP
                     LAGASLCENCNTKDMCMVLNKLAENGNAEDSKLRKGEYELLTNHLLTNLEKNRNFFLK
                     FNDLITKEESSVCSINAELFLFDSKTRESLNGRCLSNLIVDDIQGSSQQCGKYTYSFK
                     RQNQDETLSMLHSQIGINDYVIISDENGHFSLCQGLVTKISSDSITVAINRKLLNNKI
                     TLDNGNRTSIQSVIKPQFNLTEIMATQNLVTYRIDKNDIQQNLSSSRFNILNLFLPSV
                     QPGELLVDEKTGKSKLTKRSDGGDERMRRFIVDNESPTFVPKDKPPLISYTIPEDSSF
                     NENQIEAIDRVMRANDYALILGMPGSGKTTVISELIKMLVADNKSVLLTSYTHSAVDN
                     ILLKLKDVEFDIIRLGSKRRVHPDTQRYLPKYDSLNTYEELLETINGVSVVATTCLSL
                     RDIMFNLRSKDFDYVILDEASQISIPVALGPLRFGIKFVMVGDHYQLPPLVKNEAARS
                     GGLEESLFKYFCERQPDSVVELTYQYRMCEDIVMLSNYLIYENKLKCGTEQVKNQSLH
                     IPHLENLGQYRKADADQDWLMDVLDPQRKVIFMNYDKCVEITEQANNDTITNVGEAEL
                     TRQCVKGILTSGVSSDKVGVMTLYRAQLKLLKKVLGSAAYDGLEILTADQFQGRDKDC
                     IIISMVRSNAHLNGGSLLKELRRVNVAMTRAKSKLIIIGSQKTISSIPEIKGFMNLLQ
                     ERNWIYDLSTNCLECYDFPQNVDSQFSDSALRVGDNDVPKKGAKNITAESLIVKNKPI
                     TKQTLTEM"
     gene            complement(<759450..>761618)
                     /gene="NDAI0C03330"
                     /locus_tag="NDAI_0C03330"
                     /db_xref="GeneID:11494738"
     mRNA            complement(<759450..>761618)
                     /gene="NDAI0C03330"
                     /locus_tag="NDAI_0C03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669188.1"
                     /db_xref="GeneID:11494738"
     CDS             complement(759450..761618)
                     /gene="NDAI0C03330"
                     /locus_tag="NDAI_0C03330"
                     /note="ancestral locus Anc_5.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669236.1"
                     /db_xref="GeneID:11494738"
                     /db_xref="UniProtKB/TrEMBL:G0W882"
                     /translation="MEWKQITLKQEDQPKQNTIIHNATKPNKINTGNSNKKNRPKKNF
                     KEGKVEKGGSNNMSKRAIKKANKEYFLERQRKKAERLLQQSMNNTDNNDNNRTSIVPL
                     PNSPPPPPPPPPRQGNYNQLPILWPNFGAPRPTWLRLPPVPPVGMNYMNAFPHLNQDT
                     LQNGTPSMNYSLQDAMPLHRLPIPNKNGTLIPQQYIPQSDISHHHISTFNANVIPTSN
                     QQISKEAAKKFKGMKKKAKKAKKGQKAKKGQTAKQTNIEVPGTTFKENATQALFKDED
                     LSVSSKLLPVIRHADNTDSNLHSGVRKYGNFLTSLTNSKDRNEITKSSNISNTVQYIE
                     LDDESSVEEISNENVDNGNEHAPSEKRQELQSNNGIIDLDLIEAEGGSTEPNGRENSS
                     APTSLPGDHIFEPSDDLDTIQTKSNSNSSAQELNQKTKSTKNFDNPTNNGANPNLEKK
                     LGLMERLYKDVDTTNIPYLPNNRIPILSKSTSPQGPIWLAASKISLSSDDESSKKRVK
                     KHVVSGPNGELSQRNKESSNYLLPTTDLDNRLQNVEPNSVSVAKNTKGERNLEEMERE
                     IHFELNKFLLRTKVEIGKLSTALNDKRYHIELQGTSIEDKIVTYKDNILDEVVRSVND
                     LFLHHEGVEGYATKKPERVQINKPQRNTGVIDVEPLAPSGGSSQAAVSDEPNTNTTGS
                     VATNTYEQPKSPKTDALVDYSFVKITKVCEPNSPFYLSFA"
     gene            complement(<762096..>769340)
                     /gene="NDAI0C03340"
                     /locus_tag="NDAI_0C03340"
                     /db_xref="GeneID:11494739"
     mRNA            complement(<762096..>769340)
                     /gene="NDAI0C03340"
                     /locus_tag="NDAI_0C03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669189.1"
                     /db_xref="GeneID:11494739"
     CDS             complement(762096..769340)
                     /gene="NDAI0C03340"
                     /locus_tag="NDAI_0C03340"
                     /inference="similar to DNA sequence:INSDC:YHR165C"
                     /note="similar to Saccharomyces cerevisiae PRP8 (YHR165C);
                     ancestral locus Anc_5.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669237.1"
                     /db_xref="GeneID:11494739"
                     /db_xref="GOA:G0W883"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:G0W883"
                     /translation="MSDLPPLPPPPPPLFEDENNQEGSDHILPPAVEDNEMPDLPPPP
                     PPLFDNEEDISENPLPPPPPPMDFDEEPSTIPLPSLQPPHPHLVLTNEETNDLKRKYD
                     SNISGEDNYTSVDIQPSKKRINKKKFGGLIQSHKVDMPHEHLRKIIEGHSDMASKRFD
                     YGKRAFLVALKYMPHAVLKLLENMPQPWEQVKEVKVLYHITGAITFVNEIPRVIEPIY
                     TAQWSTAWIAMRREKRDRTHFKRMRFPGFDDDEPPLSYPEHIETIEPSDAITLPLDEK
                     DDKWVKDWLYDPRPLADDKQHVNGTSYKRWNLELETMANLYRLATPLRDEVTDNNYYY
                     LFNKKTFFTSKALNTAIPGGPKFEPLYPEEEEGDYSEFNLIDRIIFRVPIRSEYKIAF
                     PHVYNSRPRSVEIPWYNDQISCLIDNNEDPDLPPFFFNPSLNPITFTDVLEKVDMRNY
                     SDDFSLPVDCLPLLEDEDFILPELKDAMSLYHAPYPFNRRSGKTTRAQDIALVKKWYL
                     QHPDEKYPVKVRISYQKLLKNYVANELKSKKPINIKKIKLLKNLRNTKYFQQTTIDWV
                     EAGLQLCRQGHNMLNLLIYKRGLTYLHLDYNFNLKPTKTLTTKERKKSRFGNTFHLMR
                     EILKVVKLLVDAHTQYRLGNVDAFQLADGIYYILNHLGQLTGIYRYKYKVMHQIRACK
                     DLKHVVYYRFNKILGKGPGCGFWQPAWRVWIFFMRGIIPILERWLGNLLSRQFEGRSN
                     EVVKTTTKQRVEAYYDLELRASVMNDILEMIPEGIRQNKARTILQHLSEAWRCWKANI
                     PWDVPGMPEPIKNIIERYVKAKADRWVSSAHYNRERIQRGVHVEKTVMKKNLGRLTRL
                     WIKNEQERQNEIEKNGPEITPDEATSIFSTMVDWLDQRNFSPIPFPPLTYKNDTKILV
                     LALENLKDVYASKSRLNAAEREELALIEEAYDNPHDTLNRIKKYILTQRVFKPVDITM
                     MEHFQSIAPVYTVDPLEKITDAYIDHYLWYEADQRKLFPNWIKPGDSEIPPLLVYKWS
                     QGINNISDVWDVSKGQSTVLLETQLDELAEKIDFTLLNRLLRLVMDQNIADYMTAKNN
                     VILNFKDMSHVNKYGLLRGLQFASFIYQYYGFVIDLLILGPERASEMVGPVDNPNDFM
                     QFKSLEVEKKHPIRMYCRYLDRVYILLHFNERDADRLTDEYLAENPDPNFENAIGYNN
                     KKCWPRDARMRLLRQDVNLGRAVFWEIQGRVPSSLTVLDWSTSFASVYSKNNPNLLFT
                     MCGFEVRILPKHRTAEVLSTDEGVWDLINEATKQRTAKAFLKVSEEEITNFESRINGI
                     LMAAGSSTFTKIAAKWNTALISLFTYFREATVSSERLLDVLVKAETRIQNRVKLGLNS
                     KMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLNYSRQTDTGITHFRAGMTHEEEK
                     LIPTIFRYIATWENEFLDSRRVWAEYATKRQEAFQQNRRLAFEELEGSWDRGIPRIST
                     LFQRDRHTLAYDRGHRIRREFKKYSLERNSPFWWTNAHHDGKLWNLNSYRTDVIQALG
                     GIETILEHTLFKGTGFTSWEGLFWEKASGFEDSLQFKKLTHAQRTGLSQIPNRRFTLW
                     WSPTINRANVYVGFVVQLDLTGIFLHGKIPTLKISLVQIFRAHLWQKIHESVVFDICQ
                     ILDGELDILQIETVTKEAVHPRKSYKMNSSAADVTIDSTYQWEVSKPSLLHETNDRYN
                     AALTNKMWVDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGIMIGIDLAYNM
                     YDAYGNWFNGLKPLVQNSMRTIMKANPALYVLRERIRKGLQIYQSNIQEPFLNSSNYA
                     ELFNDDIKLFVDDTNVYRVTVHKTFEGNVATKAVNGCIFILNPKTGHLFLKIIHTSVW
                     AGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAMR
                     PTELRLPFSASMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLILLLRGL
                     KTDEEKAKMIILGDPTIPVKPHHLWPSFSDEQWISIESEMRDLILNEYGKKYNVNISA
                     LTQTEIKDLILGQNIKAPSVKRQKMAELEAVKTGDNADVDNIGGSTVMKTKNINAQGE
                     EIVVVTSSNYENQNFSSNNEWRKSAIADSLLYLRLKNIYISSDSFVEEKNVYVLPKNL
                     LTNFVQISDVKIQIAGVLFGASPVDHPNIKEVKTIVLIPQLGSSRGVNMSAAPNSQSH
                     PYLENLELLGWIHTQTNEIKFMSANEVMTHTQLFEENYTDVIDLSVCSVPGSISLSAY
                     NLNDEGYEWAKENRDVTSEIPEGFEPTFSSQAQLLLSDRIIGNFLVPESNVWNFAFMG
                     PSFNKEISYELKLDIPLDFYNEVHRTTHFLQFNELQGDEELEAEQQDPFA"
     gene            complement(<769764..>771713)
                     /gene="NDAI0C03350"
                     /locus_tag="NDAI_0C03350"
                     /db_xref="GeneID:11494740"
     mRNA            complement(<769764..>771713)
                     /gene="NDAI0C03350"
                     /locus_tag="NDAI_0C03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669190.1"
                     /db_xref="GeneID:11494740"
     CDS             complement(769764..771713)
                     /gene="NDAI0C03350"
                     /locus_tag="NDAI_0C03350"
                     /inference="similar to DNA sequence:INSDC:YHR166C"
                     /note="similar to Saccharomyces cerevisiae CDC23
                     (YHR166C); ancestral locus Anc_5.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669238.1"
                     /db_xref="GeneID:11494740"
                     /db_xref="GOA:G0W884"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007192"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W884"
                     /translation="MKMDDDSQLKLIQDIKINLRRSASDLSHWKLYKSAKWSSEALIG
                     MCDISPFLSNKADPVNITYESPLRNRTGMGRLGNDGKTNNNGKMAMDYDPRYGMNDDE
                     YDLYLLAVSLFDCKEFDRCCYFLKDVKHPCLKFLKLYSKFISWDKKNQESVESVLTVG
                     KSKNIPTGINDPEGASSSTAYDFTTQAKKIKTSRGVVNMGDGHQSSISLILQELNRYL
                     DDLEKHDDVVSGRGLYLGLSLLYYLKGVLLKQEGNKSSAMSSFLKSLSHYSFNWTCWI
                     ELTECLSRADEAFQLLKYLDDKFVIQSEVPFDTQHTVQYNIMLKFFKLTLSQDYKGNM
                     DELMDLIETLLAIFPNFAYIKAQNALINYHYMDYLSSEDLFEQIVKLDPYRLDDLDTY
                     SNILYVMQRHSKLAYLAQFVSQVDKFRPETCCIIANYYSARQEHEKSIMYFRRALTLN
                     KSCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSL
                     FYFQKACSLQPLDRRMWQALGTCYIKIGYKSDALKCFERALQHSGNIEQDSVLLFKIA
                     EICEQLKQMERCKLHMIRCVELEKSEDGFANEETIKARLWLAKYELKHDNYEEAYKYA
                     TAVTNGTAQEVELARSIARHCQTKM"
     gene            <771983..>772789
                     /gene="NDAI0C03360"
                     /locus_tag="NDAI_0C03360"
                     /db_xref="GeneID:11494741"
     mRNA            <771983..>772789
                     /gene="NDAI0C03360"
                     /locus_tag="NDAI_0C03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669191.1"
                     /db_xref="GeneID:11494741"
     CDS             771983..772789
                     /gene="NDAI0C03360"
                     /locus_tag="NDAI_0C03360"
                     /inference="similar to DNA sequence:INSDC:YHR167W"
                     /note="similar to Saccharomyces cerevisiae THP2 (YHR167W);
                     ancestral locus Anc_5.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669239.1"
                     /db_xref="GeneID:11494741"
                     /db_xref="InterPro:IPR018557"
                     /db_xref="UniProtKB/TrEMBL:G0W885"
                     /translation="MPGEIETTYFDSLSEQEQHLQENYSCIKDIFKTLKQLKNKDATD
                     DELKQNLDNLSIYYRDLTRSSIDLKYNKYQTREIQLSHLDKISNEAQTFKRKHKTIYL
                     REYVNTTESINGKSLEYINLLQRLSVDLVRQIEISDPNVSKINVDGWNPPKKIQVLLD
                     KFGEPDADTRELKIQVQRYLDDIKMSRAKYSLENKYSLQEKLSEVTKAVNQWRAEWDN
                     IEMMLFGDGSNSMKNMLANVESIKSKLEEEAKAESKEEEGEGEGNDVEMT"
     gene            <773080..>774723
                     /gene="NDAI0C03370"
                     /locus_tag="NDAI_0C03370"
                     /db_xref="GeneID:11494742"
     mRNA            <773080..>774723
                     /gene="NDAI0C03370"
                     /locus_tag="NDAI_0C03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669192.1"
                     /db_xref="GeneID:11494742"
     CDS             773080..774723
                     /gene="NDAI0C03370"
                     /locus_tag="NDAI_0C03370"
                     /inference="similar to DNA sequence:INSDC:YHR168W"
                     /note="similar to Saccharomyces cerevisiae MTG2 (YHR168W);
                     ancestral locus Anc_5.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669240.1"
                     /db_xref="GeneID:11494742"
                     /db_xref="GOA:G0W886"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W886"
                     /translation="MLPRYYCKVSIRLNSTFSKIVENAPKISDNENWLNSLEIPNPAS
                     SLISGNKSWKTGDKFPFEIISNNDARNFKGQRFIDLKASLRYFTSINYLQEFNKHKHK
                     RSQGNFIDVRIVKCKSGIGGNGCISFFRDANRRIGPPDGGDGGDGGSIYIQAVDSMDS
                     LAKLKTTYIAGDGENGATDQLDGAVGKDILIKVPRGTVVHWCMDPKKVREYVQGKLQD
                     SDATKDKSLRSILENNMLELKCVATDRYRQDVPHIQMFRNSYEVGEGWIYKGQTEEFH
                     TSKDWFKDLKEKVKLYDYDLENAEHYQDTIPLFGIDLDEVSNEPICLLKGGKGGLGNM
                     HFLTSLIRNPRFCKVGRNGLEQHFMFELKSIADFGLIGLPNAGKSTLLGAISNARPRI
                     GHWEFTTLCPTIGTVSLGIDEPTFTVADIPGIIEGASQDKGLGLEFLRHIERSRGWVF
                     VISLERPDPLSDLELLINEVGGLEKVETKSIMVICSKADVHPEVTAGPESTRGKYIKM
                     EEFCSRRGWETMPISALRGENLEILKMKMFQSLGGRVER"
     gene            <775093..>776709
                     /gene="NDAI0C03380"
                     /locus_tag="NDAI_0C03380"
                     /db_xref="GeneID:11494743"
     mRNA            <775093..>776709
                     /gene="NDAI0C03380"
                     /locus_tag="NDAI_0C03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669193.1"
                     /db_xref="GeneID:11494743"
     CDS             775093..776709
                     /gene="NDAI0C03380"
                     /locus_tag="NDAI_0C03380"
                     /inference="similar to DNA sequence:INSDC:YHR170W"
                     /note="similar to Saccharomyces cerevisiae NMD3 (YHR170W);
                     ancestral locus Anc_5.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669241.1"
                     /db_xref="GeneID:11494743"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:G0W887"
                     /translation="MNNTFGQHQHPHEHQQMLQTQQHQHQQVATVLCCNCGTPIDGST
                     GLVMCYDCIKMTVDITEGIPREANISFCRNCERFLQPPGQWIRADLESRELLAICLRR
                     LKGLTKVRLVDASFIWTEPHSRRIRIKLTVQGEAMSNTIIQQTFEVEYVVIAMQCPDC
                     ARSYTTNTWRATVQIRQKVPHKRTFLYLEQLILRHNAHVDTISISEAKDGLDFFYSQK
                     NHAVKMIDFLNSVVPIKSKKSEELISQDTHTGSSTYKFSYSVEIVPICRDDLVVLPKK
                     LAKHLGNISQFVLCSKISNTVQFLDPTTLQTADLSPSLYWRSPFSALADVSQLTDFIV
                     LDVDPTGISKGKRILADITIARTADLGINDQVYYARSHLGAILHAGDTVAGYFIANSN
                     YNSELFDGLNIDYVPDVVLVKKLYQRKTKKNRNWKLKRMAKEHKDIDAAQDYSSKAQK
                     QDMERAEKDYELFLQELEEDEEMRQTINLYKNNEAAAAAQIAAAANGMEEDEDPDAPQ
                     IDIDELLDELDEMTLDDPSEEQPQMQQPNM"
     gene            <777059..>779077
                     /gene="NDAI0C03390"
                     /locus_tag="NDAI_0C03390"
                     /db_xref="GeneID:11494744"
     mRNA            <777059..>779077
                     /gene="NDAI0C03390"
                     /locus_tag="NDAI_0C03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669194.1"
                     /db_xref="GeneID:11494744"
     CDS             777059..779077
                     /gene="NDAI0C03390"
                     /locus_tag="NDAI_0C03390"
                     /inference="similar to DNA sequence:INSDC:YHR171W"
                     /note="similar to Saccharomyces cerevisiae ATG7 (YHR171W);
                     ancestral locus Anc_5.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669242.1"
                     /db_xref="GeneID:11494744"
                     /db_xref="GOA:G0W888"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W888"
                     /translation="MSQGTEKEAEICSATVPLSYSAPFQSFLDTSFFQELSRLKLDVL
                     KLGSEEVPLFSSLALKNVSKSNECAHLFLNEQSFRVPMDGGKNEEELEYKKEGTIDIP
                     IQGSITNFNTFEKFKSLNKQEFLNEKALELLKSGEKNINECIKFYIISFADLKKYKYY
                     YWVCSPSFKPIDLDIKILKSQETVTNVEKYQTWFKSHKTEWIGLIDHDSTEVASYSKA
                     IAKTAKIIILRDTSNLKGTPSSLLQNLFTIYMNDQDDHIREIEVFFIRPSKESSFKET
                     FRLQLEGKSKTDYALSLTSNLKVSGWERNMQGKLMPRAVDLSELIDPMKVADQSVDLN
                     LKLMKWRIIPDIDLDIIKKQQVLLLGAGTLGCYIARALMAWGVRNITLVDNSTVSYSN
                     PVRQSLFEFADFGKPKAEAAAATMKRVFPLVNAKGVNLNVPMIGHPINNEEREKKEFY
                     QLRELIRSHDAVFLLMDSRETRWLPTVLCNIEGKIVINAALGFDSYLVMRHGNYHGDD
                     GVAVKEDDERLGCYFCHDVVAPTDSLSDRTLDEMCTVTRPGVAMMAASQSVELFVSLL
                     QHSGFTNAKTNQETILGEIPHQIRGFLNRFTTLKLETPAYKYCSACSVAVIEECKKDD
                     WEFVKKALNNRDYVEKLSGLYQMKQNIDIMDQELFEWEDDMTGEASIE"
     gene            complement(<779360..>780151)
                     /gene="NDAI0C03400"
                     /locus_tag="NDAI_0C03400"
                     /db_xref="GeneID:11494745"
     mRNA            complement(<779360..>780151)
                     /gene="NDAI0C03400"
                     /locus_tag="NDAI_0C03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669195.1"
                     /db_xref="GeneID:11494745"
     CDS             complement(779360..780151)
                     /gene="NDAI0C03400"
                     /locus_tag="NDAI_0C03400"
                     /inference="similar to DNA sequence:INSDC:YGR253C"
                     /note="similar to Saccharomyces cerevisiae PUP2 (YGR253C);
                     ancestral locus Anc_5.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669243.1"
                     /db_xref="GeneID:11494745"
                     /db_xref="GOA:G0W889"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G0W889"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSE
                     GVVLGVEKRATSPLLEADSIEKIVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLY
                     YDEDMKVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLREAEVLVLKILKQVMEEKLDENNAQ
                     LSCITKDNGFQIYDNAKTAEIIKEMKEKETQEHPEGEEEHDVEMS"
     gene            <781735..>784131
                     /gene="NDAI0C03410"
                     /locus_tag="NDAI_0C03410"
                     /db_xref="GeneID:11494746"
     mRNA            <781735..>784131
                     /gene="NDAI0C03410"
                     /locus_tag="NDAI_0C03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669196.1"
                     /db_xref="GeneID:11494746"
     CDS             781735..784131
                     /gene="NDAI0C03410"
                     /locus_tag="NDAI_0C03410"
                     /inference="similar to DNA sequence:INSDC:YHR172W"
                     /note="similar to Saccharomyces cerevisiae SPC97
                     (YHR172W); ancestral locus Anc_5.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669244.1"
                     /db_xref="GeneID:11494746"
                     /db_xref="GOA:G0W890"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:G0W890"
                     /translation="MEVVQIEDHVQLNLNDSLDTPILSKLVNYEPLSNTNLKFKSFPL
                     SELSSTESFRDQESLVIKDLLNVLLGLDGAYIRYNNSFNPVNDHIPDFRIAKKMDSTL
                     KALCNKVVKLGRQYFFVCRYMERLSDLSFGMVLQRLSFEIRQFIRLYYLRFVNSLEKE
                     FIENLNFSIRDLVQKIKDSEIVKQLELFYLICLKIDNEMNLRNNIDLMEQDFNNFIND
                     LKDETQYKSDILLATDSSILPIPRGGIILKIVQEFIEDNLGDKSSVTFLKNLLNSISV
                     NYCDMLQQWMTQGELIDPYNEFMICDAMKNADLKTNYLKYDDRLWFTRYRIRKDGLLK
                     KFELKDGNVLLFKVLMTGKLLNILRTSLNMSKLPIDSNNDLTDFVQLTEGTNLELYIN
                     KWYENANRLCLQLYFESYDLELFLNCLQREYFGYQNGNGISIFLQRNIIDLSRHYSKN
                     HKGLERKLSQYFESQKQFVPSDNLVSQRMTLQLDKNSFQQVILQYVQQDNILNDKNPL
                     QDSSDKILHAPNFENLRSILLNEASHLPKSSKESRKSNIHYLQFNLNVPYPLNIIISR
                     ICIDQYQIISRYIHLLQYHGKLLDDTWFEINKHKIWRYKGYNSNINRTIIKRCRILHN
                     KMNNFVKVVLEYFTQNVIDKEITKIINSNKATTINDLQNVLQESLTNIMTNCCLSQLI
                     EIQLQLFEIIHKFSKFIISMRQKLCRLNPTIYEHYLSRSYEENNNNAQDGYNEEEALL
                     LTSNIGAYIEQVYFGFDQHVEAFIEGLTHYYNSRTEVRDSAGNDNSGRLINSLRMLKG
                     "
     gene            <784675..>786063
                     /gene="NDAI0C03420"
                     /locus_tag="NDAI_0C03420"
                     /db_xref="GeneID:11494747"
     mRNA            <784675..>786063
                     /gene="NDAI0C03420"
                     /locus_tag="NDAI_0C03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669197.1"
                     /db_xref="GeneID:11494747"
     CDS             784675..786063
                     /gene="NDAI0C03420"
                     /locus_tag="NDAI_0C03420"
                     /inference="similar to DNA sequence:INSDC:YGR254W,YHR174W"
                     /note="similar to Saccharomyces cerevisiae ENO1 (YGR254W)
                     and ENO2 (YHR174W); ancestral locus Anc_5.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669245.1"
                     /db_xref="GeneID:11494747"
                     /db_xref="GOA:G0W891"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:G0W891"
                     /translation="MFSFFSKSFLRNQAIHCKSIHTKSIMAVSKIYARSVYDSRGNPT
                     VEVEITTENGVFRAMVPSGASTGVHEALEMRDEDKSKWLGKGVLNAVANVNNVIAPAF
                     VKANLDVKDQKAVDDFLLNLDGTANKSKLGANAILGVSLAAARAAAAEKNVPLYKHLA
                     DLSGAKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAPTGAKTFAEALRMGSEVYHN
                     LKSLTKKRYGSSAGNVGDEGGVAPNIQTAEEALDLIVDAIKAAGHDGKIKIALDCASS
                     EFFKDGKYDLDFKNPESDSSKWLSGPQLADLYHTLMKKYPIVSIEDPFAEDDWEAWSH
                     FFKTAGIQIVADDLTVTNPARIATAIEKKSADALLLKVNQIGTLSESIKAANDSFAAG
                     WGVMVSHRSGETEDTFIADLVVGLRTGQIKTGAPARSERLAKLNQILRIEEELGDKAI
                     FAGENFHTGFKL"
     gene            <786640..>787188
                     /gene="NDAI0C03430"
                     /locus_tag="NDAI_0C03430"
                     /db_xref="GeneID:11494748"
     mRNA            <786640..>787188
                     /gene="NDAI0C03430"
                     /locus_tag="NDAI_0C03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669198.1"
                     /db_xref="GeneID:11494748"
     CDS             786640..787188
                     /gene="NDAI0C03430"
                     /locus_tag="NDAI_0C03430"
                     /inference="similar to DNA sequence:INSDC:YHR175W"
                     /note="similar to Saccharomyces cerevisiae CTR2 (YHR175W);
                     ancestral locus Anc_5.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669246.1"
                     /db_xref="GeneID:11494748"
                     /db_xref="GOA:G0W892"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:G0W892"
                     /translation="MTLLPPQVRDHLMNNQKNKETNMNMIHNNHHSMESHQHMVGKDM
                     DMGEDSCSMNMLFSWSYKNTCVVFKWWHIRSFFGLIISCLSIMTLSYLYEYFKYRLNS
                     YEENELKRNSNAVNTRKFKLHTSIWYAVQVGFSFMLMLVFMTYNGWLMLAVVFGAFLG
                     HYSWNVPNSIKSTLGSQSLACH"
     gene            <787827..>789122
                     /gene="NDAI0C03440"
                     /locus_tag="NDAI_0C03440"
                     /db_xref="GeneID:11494749"
     mRNA            <787827..>789122
                     /gene="NDAI0C03440"
                     /locus_tag="NDAI_0C03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669199.1"
                     /db_xref="GeneID:11494749"
     CDS             787827..789122
                     /gene="NDAI0C03440"
                     /locus_tag="NDAI_0C03440"
                     /inference="similar to DNA sequence:INSDC:YHR176W"
                     /note="similar to Saccharomyces cerevisiae FMO1 (YHR176W);
                     ancestral locus Anc_5.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669247.1"
                     /db_xref="GeneID:11494749"
                     /db_xref="GOA:G0W893"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:G0W893"
                     /translation="MTGQERRKVAIIGAGPGGLATTRVFLENTTTFDIKIFEKDSQIG
                     GVWYYPEDNKEGRVMYDYLETNLSKELMQFSGFPFGEHIRKFPTRNDVYDYLRSYYKR
                     FIVNNERVQIHFNNEVTGIKKVKNEWEVTIKDEEDVLKFDYVVIATGHFTEPNIPKGI
                     PNLEHWFTNKHAFHAKDFQNAEIARGKTIVVIGNGSSGTDIRNQLSTVARKVYNSVND
                     PSLSSPLDNFKDIIELVPKIIKTNWESRSIELEDGRVLKNVDYLIYATGYLYAFPFFE
                     EKMKVELLGEDRTSKGVHHLWEHLFYQPDPTLAFSLLPTMVVPFPLAELQACVIVKVF
                     TNKLTVSKHTEEDFGNRHGFSFATGEDIDYYRHLQALLEMSGGNDDPFQPVKWDESHK
                     RLRIKNVKDKENRNLLLSKFASELRERKEVYRLPPPEYT"
     gene            <789514..>791844
                     /gene="NDAI0C03450"
                     /locus_tag="NDAI_0C03450"
                     /db_xref="GeneID:11494750"
     mRNA            <789514..>791844
                     /gene="NDAI0C03450"
                     /locus_tag="NDAI_0C03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669200.1"
                     /db_xref="GeneID:11494750"
     CDS             789514..791844
                     /gene="NDAI0C03450"
                     /locus_tag="NDAI_0C03450"
                     /inference="similar to DNA sequence:INSDC:YHR178W"
                     /note="similar to Saccharomyces cerevisiae STB5 (YHR178W);
                     ancestral locus Anc_5.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669248.1"
                     /db_xref="GeneID:11494750"
                     /db_xref="GOA:G0W894"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G0W894"
                     /translation="MYDAQQQHRSEPYSCSRCRRLKKKCLKEVPTCSNCMKANKECVY
                     LGRAPRRTKKEILAAALRGEYVPNKRHKSEQHVPGIDDVNSTISNQGSNNVSAGSSAS
                     QLNTSLGPPTPNFYVPINDAQRIPSPTLNSIRKLDGMDDTSPRILTSTQGASEGFNSL
                     ISALSSSDTTENTPPSYPPPQNNLMNNNNERDHQMMTSLPPILNESENPTNPMGMSLT
                     PPATNLPVSSNQLSSKHSSLTPILSQIQEQDETFKQQITTNELNYEFKGMKDINTLST
                     SLTPGPTRAMSIPIHSSALEMETIGSVFKGGRTTSWLHHDGTYKPIGRSLLDRFIAAY
                     FKHNHRLFPMIDKIAFLNDVSKISDFESLEKNIDTGSEYNILIFKIYMIMAIGCTTLR
                     RAGMLNVEEEDLSEHLSYLAMKKFSYVIQLQNIETVRCLLLLGIYSFFEPRGSSSWTI
                     SGLIMRLTIALGLNKALTPKKMKLLSAIEMEARNRVFWSAYCFERLVSTSLGRFSAID
                     DDEITIGLPRPLYDGEKDEIEVTRTMIELRKIAGRIYKQVHSVSVSRQNLSIEQKNKI
                     IEGLSTELDGIYEKESKKMQLHNSKRLAEKDQIKNQICNAISYHNSDNWLTMRYAQLQ
                     ILLFRPSTLIPKPSIESLTKLGECCLLAWRHTYLLYTKKLLPLNWITLFRTLTICNTI
                     LYCLCQWSIDLIESKIEIQQCVEILQHFGEKWIFAKRCADVFQNMSNTILEISLSHGK
                     VPNMDKLTRELFGASDAYQDILDENNVDVSWVDKLM"
     gene            <792929..>794128
                     /gene="NDAI0C03460"
                     /locus_tag="NDAI_0C03460"
                     /db_xref="GeneID:11494751"
     mRNA            <792929..>794128
                     /gene="NDAI0C03460"
                     /locus_tag="NDAI_0C03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669201.1"
                     /db_xref="GeneID:11494751"
     CDS             792929..794128
                     /gene="NDAI0C03460"
                     /locus_tag="NDAI_0C03460"
                     /inference="similar to DNA sequence:INSDC:YHR179W"
                     /note="similar to Saccharomyces cerevisiae OYE2 (YHR179W);
                     ancestral locus Anc_5.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669249.1"
                     /db_xref="GeneID:11494751"
                     /db_xref="GOA:G0W895"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W895"
                     /translation="MPFVKNFPPVALGDTNLFKPIKVGNTELQHRVVMPPLTRMRAHH
                     PGNIPNDWAVEYYSQRTQRPGTMIITEGAFPSPQSGSYDNAPGIWSEEQMKQWKKIFD
                     KIHENKSFVWVQLWVLGRQGLADVLARDGLRFDGPSDGVYMDEETEARAKKSNNPLHG
                     ITKDEIKQYIKEYVQAAKNSIASGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIE
                     NRARFTLEVVDAVVAAIGEDKVGVRFSPYGTFGKMSSGYDPTLLAQYAYVIGELEKRA
                     KAGKRIAYIHLVEPLVTNLFMTEGEGEYKDGTNDFVYSIWKGPIIRAGNLALNPQLVR
                     EMVKDERTLIGYGRFFIANPDIVDRVEKGQQFNQYDKDTFYAMSEKGYNDYPTYPEAI
                     KLGWDKK"
     gene            795042..795113
                     /gene="NDAI0Ctrna3T"
                     /locus_tag="NDAI_0Ctrna3T"
                     /db_xref="GeneID:11494752"
     tRNA            795042..795113
                     /gene="NDAI0Ctrna3T"
                     /locus_tag="NDAI_0Ctrna3T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:11494752"
     gene            <795330..>796013
                     /gene="NDAI0C03470"
                     /locus_tag="NDAI_0C03470"
                     /db_xref="GeneID:11496755"
     mRNA            <795330..>796013
                     /gene="NDAI0C03470"
                     /locus_tag="NDAI_0C03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669202.1"
                     /db_xref="GeneID:11496755"
     CDS             795330..796013
                     /gene="NDAI0C03470"
                     /locus_tag="NDAI_0C03470"
                     /inference="similar to DNA sequence:INSDC:YHR181W"
                     /note="similar to Saccharomyces cerevisiae SVP26
                     (YHR181W); ancestral locus Anc_5.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669250.1"
                     /db_xref="GeneID:11496755"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:G0W896"
                     /translation="MILQLISYLGNIFGFVFLTLSIASGLYYISEIVEEHTEPTRRFL
                     TRAIASIIILLFLLLVLDRFPVKLTLFSIASHVLYYRNLKKFPIISLSGPTFISSCIA
                     VVLNHYLWFKYFNNNEIPPQFRFDPNYIPRRRANFTEVASFFAICIWFIPFALFVSLS
                     ASDYVLPTTTEMDNKKFDTEADESVTPKLKKRTIGLARVVINGIRKRIYSIARSFGYE
                     IDPDYGRLL"
     gene            <796392..>798755
                     /gene="NDAI0C03480"
                     /locus_tag="NDAI_0C03480"
                     /db_xref="GeneID:11494753"
     mRNA            <796392..>798755
                     /gene="NDAI0C03480"
                     /locus_tag="NDAI_0C03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669203.1"
                     /db_xref="GeneID:11494753"
     CDS             796392..798755
                     /gene="NDAI0C03480"
                     /locus_tag="NDAI_0C03480"
                     /inference="similar to DNA sequence:INSDC:YHR182W"
                     /note="similar to Saccharomyces cerevisiae YHR182W;
                     ancestral locus Anc_5.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669251.1"
                     /db_xref="GeneID:11494753"
                     /db_xref="GOA:G0W897"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G0W897"
                     /translation="MSRSESNTENQTRVVKYTLRTTFWSKDYITGINTFLNQIKNDNK
                     ILTTQLTTYSNFQNECWSKFIKSLSSSVSTSDGNNPILYLFYKKLSESDIDEVMTVSC
                     LDPLRKVLKRNEEFLWVTENELKTKYDYFIKDFKSTKEAMVECEKRTEMLSNQYKTFP
                     KDIEEVKKQEHDKEDEVQGEDEVGEKIKVNDNREISLERSDTADNSPFNITYPFELDT
                     RLLFQTQVDFFTFLNKLKDTVPVEKRMISIPGLSNDGFQGSTLLHEIKKQDIKIDTSS
                     FNMDRIGQIFIDLNIIQENSLNYFTVSSSRVLFANDSYYHWVGTTFKYITASLTTLTP
                     SSSASSSIIRTNTVGTNSMEETHGRKKKTYGELEHDAIQTTTRSISSWFRKISMADGG
                     EESDTDLLRGQLLQWEHKALKRFCKLEYSRIQLEKAIFENCKKYSALTEDLIATINQT
                     HLAANHSIGGLIKIWDIDDSKRKSNYVHEFYGAKGGYLGFFSRDNCIPFNGWLTNSNH
                     IEKKAFLFGHAIDDNILDSITLILRFIENGNNNQELRSKGYLLKHVYQSWRNDIDLIR
                     VANLRRELLEEFMNNGFDNKKAIEKLTDTNHTNVNILINDWVGLIKLWLLELPNCLFS
                     SSCYDNIMNIKIPITTESINSDSFNWMDELPPYNIKLILEFSKHFGWLTDHQVQGSDV
                     VSDLFYDNMDIPLFHLFIRPLGLREPTHVVKLSPIICELFSNKMIYEKFKEKLKNEIE
                     EKGNIPALNSDKKVVEPEPEVPSIVIKQGEEKKKKKVQSILNSLLKT"
     gene            <799982..>801451
                     /gene="NDAI0C03490"
                     /locus_tag="NDAI_0C03490"
                     /db_xref="GeneID:11494754"
     mRNA            <799982..>801451
                     /gene="NDAI0C03490"
                     /locus_tag="NDAI_0C03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669204.1"
                     /db_xref="GeneID:11494754"
     CDS             799982..801451
                     /gene="NDAI0C03490"
                     /locus_tag="NDAI_0C03490"
                     /inference="similar to DNA sequence:INSDC:YGR256W,YHR183W"
                     /note="similar to Saccharomyces cerevisiae GND2 (YGR256W)
                     and GND1 (YHR183W); ancestral locus Anc_5.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669252.1"
                     /db_xref="GeneID:11494754"
                     /db_xref="GOA:G0W898"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W898"
                     /translation="MSADFGLIGLAVMGQNLILNAADHGFTVVAYNRTVSKVENFLAN
                     EAKGKSIIGATSIEDFIAKLKRPRKVMLLVKAGAPVDALIKELVPHLEKGDIIIDGGN
                     SHFPDSNRRYEELKEQGILFVGSGVSGGEDGARYGPSLMPGGAEEAWPHIKNIFQSIS
                     AKSDGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRVGNFTDKEIGDVF
                     ETWNKGVLDSFLIEITRDILKFNDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPV
                     TLIGEAVFSRCLSAIKNERIRASKTLVGPTIPKDLIKDKKQFVDDLEQALYASKIISY
                     AQGFMLIREAGKTYGWKLNNPAIALMWRGGCIIRSVFLAEITKAYREDPELENLLFHS
                     FFSDAVTKAQSGWRKSIALATTYGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFG
                     AHTFRVLPEAASETLPVDKDIHINWTGHGGNVSSSTYQA"
     gene            <801919..>803565
                     /gene="NDAI0C03500"
                     /locus_tag="NDAI_0C03500"
                     /db_xref="GeneID:11494755"
     mRNA            <801919..>803565
                     /gene="NDAI0C03500"
                     /locus_tag="NDAI_0C03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669205.1"
                     /db_xref="GeneID:11494755"
     CDS             801919..803565
                     /gene="NDAI0C03500"
                     /locus_tag="NDAI_0C03500"
                     /inference="similar to DNA sequence:INSDC:YHR184W"
                     /note="similar to Saccharomyces cerevisiae SSP1 (YHR184W);
                     ancestral locus Anc_5.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669253.1"
                     /db_xref="GeneID:11494755"
                     /db_xref="UniProtKB/TrEMBL:G0W899"
                     /translation="MVEDSENKQHTPLPFPDPPQYPLSSVQNLTQKEENGSIVNKCKN
                     ILSSLFEKTNYPDNNDTDEEDDKIRQLFPDENHDDSYSRRKIDGESQLQYLNVNDSSS
                     SSNTFLTGNDQEITNFLHFPEPKSLPIRMSVNEDINESYLDRIKHLEVSKTKIPYSEP
                     HSKVPGLFETFSLTTLQFKAVSLSTLKKRLENIYTKRKDLCKANKRFLNTLSHWSSSN
                     LAIDTDSMTLIKEIDELFRQDLLFEHKIKEKLNNLTTSLEFVCKRENELIIQKKTLIT
                     DMKKYEKMRDKKGDFNQETQFLLEKVITSRRFFDSIKVHFQNAVSVTTRQLFKELAIE
                     YYECCSDLKQHSGAFIENSLVTLERLNSEELMQTLEDLRRRRAHWVWQKLPEEQKKNP
                     RNLENMRNGIYDCNDSLLKNIYKKLPEIYTPVPVASPEEPHLNFLNGYEETNSFISKE
                     KNIGIIEATSPRKESGTTIPKNVENKPSNNAYSPSDKSSSFTKRQLRSKDTKISVLQP
                     RPMTENDINKMRQGDDLPTSEFVQIFKAHKEELNKDPWRT"
     gene            complement(<803955..>804707)
                     /gene="NDAI0C03510"
                     /locus_tag="NDAI_0C03510"
                     /db_xref="GeneID:11494756"
     mRNA            complement(<803955..>804707)
                     /gene="NDAI0C03510"
                     /locus_tag="NDAI_0C03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669206.1"
                     /db_xref="GeneID:11494756"
     CDS             complement(803955..804707)
                     /gene="NDAI0C03510"
                     /locus_tag="NDAI_0C03510"
                     /inference="similar to DNA sequence:INSDC:YHR185C"
                     /note="similar to Saccharomyces cerevisiae PFS1 (YHR185C);
                     ancestral locus Anc_5.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669254.1"
                     /db_xref="GeneID:11494756"
                     /db_xref="UniProtKB/TrEMBL:G0W8A0"
                     /translation="MPPKKQSSHCNTLQTNEKILNIESSSNDDLPKTDHGIKRGRKFK
                     RNIQKSPILETKNITELRIIREDTSDNEAIYIQQMQNEGSNNIFYPERSQQEVPSYNF
                     VKESTNVHHANCYNGVTYFENKQYLNDISVGDYYNCSGETFPPWFNPRIVQNMSHKEK
                     VNKWIEDIPIFEGGNGAWLSNCFDYDYSLDWEEEEFENFCKKSGVQISLVSQEDLLQL
                     QSRKLDVLVRAFYEQEKEVANWDYNTSFPDKN"
     gene            complement(804870..804942)
                     /gene="NDAI0Ctrna2V"
                     /locus_tag="NDAI_0Ctrna2V"
                     /db_xref="GeneID:11494757"
     tRNA            complement(804870..804942)
                     /gene="NDAI0Ctrna2V"
                     /locus_tag="NDAI_0Ctrna2V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:11494757"
     gap             805169..805188
                     /estimated_length=20
     gene            <805402..>806184
                     /gene="NDAI0C03520"
                     /locus_tag="NDAI_0C03520"
                     /db_xref="GeneID:11496747"
     mRNA            <805402..>806184
                     /gene="NDAI0C03520"
                     /locus_tag="NDAI_0C03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669207.1"
                     /db_xref="GeneID:11496747"
     CDS             805402..806184
                     /gene="NDAI0C03520"
                     /locus_tag="NDAI_0C03520"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669255.1"
                     /db_xref="GeneID:11496747"
                     /db_xref="InterPro:IPR005162"
                     /db_xref="UniProtKB/TrEMBL:G0W8A1"
                     /translation="MNNNQDVHNNLSEDVVMSDDVPNAFTTSGSAASEIPGNVPNNKD
                     FQFNGQPEANRNIKLFLGKLKNHFLLKGVREDRRKIAFLVECLTDQALIWFDQAEKDQ
                     DLYALSYEEFVRIFTDHFTKEVDAFETFSELWNLGHCANATEHAQKFKSLVSGLKPGF
                     ASDELLCNIYVMRCQPDMRIQLMLNKPWPSLEHCMLRETTLEASINSIRRSINIPRED
                     PLLVSNVQMNRGNYYNSTRRIIMKGNRIIIITITIITVIDLH"
     gene            <806284..>810075
                     /gene="NDAI0C03530"
                     /locus_tag="NDAI_0C03530"
                     /db_xref="GeneID:11494758"
     mRNA            <806284..>810075
                     /gene="NDAI0C03530"
                     /locus_tag="NDAI_0C03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669208.1"
                     /db_xref="GeneID:11494758"
     CDS             806284..810075
                     /gene="NDAI0C03530"
                     /locus_tag="NDAI_0C03530"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669256.1"
                     /db_xref="GeneID:11494758"
                     /db_xref="GOA:G0W8A2"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR024650"
                     /db_xref="UniProtKB/TrEMBL:G0W8A2"
                     /translation="MTFVETVMNMVIIRNNARNPMRGLCKANEELEATVAIPECSSND
                     DLLVCNLESHTREDPLLTCNLESHEKEDPRVTTTKINPPVEDVCIVNIGTKSRTLEAL
                     IDTGSPTHFIRSDVVTKLDLKTSQVPFRRVKGLVSDAITTCNTACRLDFRLENREFDI
                     CAYVTDIIKNDVLIGYPFVKRHPSLMESIHKNIDNVKFNNRPVSDPGRMNYEDVTYGK
                     DPIDDICNIETDENWIDIQRDASDVIIVEVTEVTNKDESKFDTIPEELQVKYRGIVRN
                     DLPPRQRDHKHVSHSIELKEGSRLPRRSPYRLTPKKQKEVDEIIKDLLDKGFIVPSKS
                     SYSSPIVLVTKHDGSYRLCVDYRELNKVTVKDPFPLPHVDELLGKVGSASVFTTLDLH
                     SGYHQIPMNPTDMDKTAFVTPTGKYEYTVMPFGLVNAPSTFARYMADLFRDLEFVNVY
                     LDDILIFSNDLESHWKHIDVVLSRLDQEKLIAKKKKCHFAQSEVQFLGYIIGRNKIKP
                     VQEKCEAINRFPVPKTIKEAQRFVGMINYYRKFIKDCSRKVRPLVDFISRNVPWGDLQ
                     DDAFATLKRDLMSEPLLVPFKRDAEYRLTTDASMDGLGAVLEEVADNKVLGVVSYYSK
                     SLNETQRRYPPGELELMAIIEGLEHFKYMLHGKHFVLRTDHISLLSIQNQKEPARRVQ
                     RWLDTLSEFDFSLAYLPGPKNVVADAISRAKLENKEVSNEPVNDYKEILTVATADTLH
                     TLDPESWTTDWRTDPWGAAVLKSLDDKFDHEIPTEQVNEFTRYLKKFERTPEYLKHFK
                     WTNDVLYYEDRICVPHIRRPLVMETYHDHKWFGGHFGEHDTFKKISEIYFWPNCYKTV
                     QDYVKSCIQCQVMKAHRPRSQGLHKPLSVPSGRWLDISMDFLTGIPTTLAGWDMIMVV
                     IDRFTKRAHFVACKKVNGSTGVFDALFRFVFSLHGFPRTIVSDRDIRFTSNAYRELTD
                     RLGIKLLMSTSNHPQTDGQTERVNRTLNQLLRMYCSNDQSCWDKLLPHVEYVYNSTYQ
                     RVLCMSPFEADLGYKPNEPRMNRDYIINARHLTSAEYARDIDALTLRIKDQLEENQLR
                     QEYDANKNRTPVNYKIGDYVLLHRDAYFTGGQYRKIQAIYLGPFQVVGVGTNCCELDL
                     PSMRKLHRMINVTWLKPYVERTNMYPKWKPRAKIERLQRLEEITSIIGYSLNDKIYYC
                     KMKDVDPRLTVEYPEEELRNLSKPRLDSLLRNFNQLETEEEKPVEWARVGCLKVWGRR
                     M"
     gene            complement(<810904..>815580)
                     /gene="NDAI0C03540"
                     /locus_tag="NDAI_0C03540"
                     /db_xref="GeneID:11494759"
     mRNA            complement(<810904..>815580)
                     /gene="NDAI0C03540"
                     /locus_tag="NDAI_0C03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669209.1"
                     /db_xref="GeneID:11494759"
     CDS             complement(810904..815580)
                     /gene="NDAI0C03540"
                     /locus_tag="NDAI_0C03540"
                     /inference="similar to DNA sequence:INSDC:YHR186C"
                     /note="similar to Saccharomyces cerevisiae KOG1 (YHR186C);
                     ancestral locus Anc_5.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669257.1"
                     /db_xref="GeneID:11494759"
                     /db_xref="GOA:G0W8A3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:G0W8A3"
                     /translation="MPVVYGPQPLRPLNTETRHGFEEQYNSEQFIQLLMNDFIFYYDD
                     KRFRTNGNPVLEEDKIRDVDGYYQAIPDWKIMKDRQKTVNAALLLCLNLGVDPPDVIK
                     THPCARLESWVDPLDFQDSKKAIEQIGKNLQSQYETLSLRCRYKQSLDPCVEDVKRFC
                     NTLRRNSKTDRILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQNWLGAPCVF
                     VYDCNSAGNIVTNFQNFVQKRIKDDEDGNHDSSAPSPTSAYQECFQLASCQVGELLLM
                     SPELPADLFTCCLTCPIEISVRVFLMQSPLKHSKYRIFFENTSAQKKRESLSDHSKLS
                     NIPTVNIPGALADRRTPLGELNWIFTAVTDTIAWTSLPRPLFIKLFRHDLMIAALFRN
                     FLLAKRIMPWYNCHPVSDPELPNSIADHPMWKSWDLAMDEVLGKLVSDLKNSPVNSEL
                     ENQLILQQQDNFQNSKPSRQQQQQQQRSESIQTQSRFAVGNLSTMSLVNLPGLNSRRQ
                     STLAAVQHPQPQSHTQQQQQQQFTGFFEQNLTAFELWLKYASNARHPPEQLPIVLQVL
                     LSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWARI
                     MSIDYKNTQAELIKEKGYLYFITILVPDWGIIPQAPLSATSSFINNGTGPITISTSIN
                     GLQNMNQQQQQQQYSLNDTTDEQKAMAVFVLASFVREFKPGQKLCFSTQLLNKLCFYI
                     ENSDIPLLRQWSVLLVGLLYSQNPLNKFICLINYSLQTIIKSLDDPVPEVRTASILTL
                     RYFISDLDEAEIIIRLQQEYSQQFQQLHAQMQHLQNNIQQQQQQQQQQQQAHQYQQFE
                     QQQLKLEQQLNQCQMMQSQLEKIDLRKLKQQELSTLTSILPLINDGSPLVRKEILLYF
                     SQVIYRYINLFIVAVFNELLEELDQLEGGHMYTDKNDVNKNAKQSISHGSIFSAVWKA
                     LLILMEDPYLENKMIAEKIVSYILLELSSHKELGTTFDKITHYLIKRNANSDINSMNF
                     ANNSQIQIGSGTYRSFQNNRKSGKKNNDMRETKSAGTYSVLSRFFSRLGFEEQNNQNN
                     ENENVQTGLTNNGGIVGKKYSKKPRTALLATSYGVSPAVKTPYMRYDEKRMTLPLESQ
                     FLEYACEYFHEPQMRKQESDEVGSKDYNGRLWRRNRNEKIIQETQKQKGLSLYGNWAN
                     KFLTLDNKTQPKILRFTQFEDYLVSADDRDNITVFDWTAKKKLSRFSNGNPFGSKITD
                     VKFLNEDDQTLLLTGSSDGIVKIYRDFHSIEEIKLISACRALTDMLLTPRSSGLLTEW
                     QQIRGSLLATGDVKIIRIWDAHTETVEVDIPAKTSSLITSLTSDQLAGDIFTAGFADG
                     TLRVYDRRMDPRDSMVRRWRAGDGSQGAWINNVQLQRGGYRELVSSTTNCVVQLWDMR
                     SEDPVLTFIDEDTNHGTQKKNTTLTCMQVHEHAPVIATGTKQIKIWTTSGDLLSSFKN
                     NHYMGSGMANTLVATGIGASLSYSSTSGTFLSSLAFHPHRMMLAANNSHDTNITIYNC
                     EGQRGR"
     gene            <816015..>816929
                     /gene="NDAI0C03550"
                     /locus_tag="NDAI_0C03550"
                     /db_xref="GeneID:11494760"
     mRNA            <816015..>816929
                     /gene="NDAI0C03550"
                     /locus_tag="NDAI_0C03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669210.1"
                     /db_xref="GeneID:11494760"
     CDS             816015..816929
                     /gene="NDAI0C03550"
                     /locus_tag="NDAI_0C03550"
                     /inference="similar to DNA sequence:INSDC:YHR187W"
                     /note="similar to Saccharomyces cerevisiae IKI1 (YHR187W);
                     ancestral locus Anc_5.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669258.1"
                     /db_xref="GeneID:11494760"
                     /db_xref="GOA:G0W8A4"
                     /db_xref="InterPro:IPR019519"
                     /db_xref="UniProtKB/TrEMBL:G0W8A4"
                     /translation="MASSTHNPAVLLKRILSLSEATPLLLCLDSIPQTANYLINEIVH
                     HSRNTLNLETIFVAFETLNKPSYATHFIDINEVSGGLPKLIETLQSYLPSPQQKHSNK
                     RLVIIDSLNYIPNDKLAQFISAVASPHCTLVGVYHKDTPEVDIPALDNYPSSLELLQF
                     MATTILNITPALPSRIDEESLKYELEKYSIPRGLNNPIFNLKLINRRRSGRSLSYDFQ
                     IDTNKHLYEHVINNPEEQENEIETPEMLQGLTTFNLSTSTKQKMAKDQVALPFLEAQG
                     LESHGGAIVYEYEKDDDYDEEDPYEDPF"
     gene            complement(<816972..>818975)
                     /gene="NDAI0C03560"
                     /locus_tag="NDAI_0C03560"
                     /db_xref="GeneID:11494761"
     mRNA            complement(<816972..>818975)
                     /gene="NDAI0C03560"
                     /locus_tag="NDAI_0C03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669211.1"
                     /db_xref="GeneID:11494761"
     CDS             complement(816972..818975)
                     /gene="NDAI0C03560"
                     /locus_tag="NDAI_0C03560"
                     /inference="similar to DNA sequence:INSDC:YHR188C"
                     /note="similar to Saccharomyces cerevisiae GPI16
                     (YHR188C); ancestral locus Anc_5.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669259.1"
                     /db_xref="GeneID:11494761"
                     /db_xref="GOA:G0W8A5"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:G0W8A5"
                     /translation="MFKRNATCLIFTTLLLFSRICYGQESNYSIYKNDNTEQLEEFRN
                     SNTTSEVESSSSTVITASEDGSFPEGIQEPPLDPSITIQEGLSYPFREKLYVKPLPNN
                     DLLTSFQFKMNSEEFAPSISSLNYGQYNHFTVFPKAIESVLHRTDTRQLHLRFTRGFW
                     DAETWGRLPHDGFKSGGNGVELWAIIEAESKDNAYSKWKTLANSLSGLFCASINFIDS
                     SKTTYPVTSFQPDNDQGLPVFANSKNQLYLIRAALANEPICTENLTPFLKLLPTKGKS
                     GISTFLDGHKVFDSSWHSLSVDVITNCDVNQDKCKYETDAVVDMVTHVPYSLARNKNP
                     IPKPLPAEQLRCDTNKPYDAFQCFPLPESTETEFDLSQIFGKTIKGSSMMSDIPSHIC
                     AIITSKWDVSIKVNGELFGTDDNCFELDGMDEYDLYLASSDTSDVTTLNEEVPLHVSR
                     SLTGYGQDHGGLRTVFQNPTPMPITAIYFESLPWYMRLYLSSLKLESIDSSNLQLEDV
                     IDSVYYNSAIDHKRPSHLEYTITIPANTTLAISCQFDKALLHFADYPPDANHGFEIES
                     AVITVIKPFKYQIRTETLLLSLSTPDFSMPYNVIIITSTVIGLIYGTLYNLLVKKVVR
                     VEQADKLIEQQAGLKKKLVAVVLKLKSKVVDRIKQKKVINFYI"
     gene            <819247..>822165
                     /gene="NDAI0C03570"
                     /locus_tag="NDAI_0C03570"
                     /db_xref="GeneID:11494762"
     mRNA            <819247..>822165
                     /gene="NDAI0C03570"
                     /locus_tag="NDAI_0C03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669212.1"
                     /db_xref="GeneID:11494762"
     CDS             819247..822165
                     /gene="NDAI0C03570"
                     /locus_tag="NDAI_0C03570"
                     /inference="similar to DNA sequence:INSDC:YMR288W"
                     /note="similar to Saccharomyces cerevisiae HSH155
                     (YMR288W); ancestral locus Anc_5.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669260.1"
                     /db_xref="GeneID:11494762"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W8A6"
                     /translation="MSRYNNGDMSRDKHQLVGNYSISQSLKESLHNEVAESEELDVLQ
                     KRMETRTIKHKESEYQARKFDRLQKEDDKANKKRPLRIEGKIEEAENKQLVKKRKSRW
                     DVQSYQIPSATKTVDELIEQKSVTDEVPGMTSLRFFKPSDREHFAMTLEKRPLESLTE
                     EEQKERALLVLLLKIKNGNAASRKAAMRTLTDKCLEFGPKLIFNHILPILLDKTLEDQ
                     ERHLMIKVIDRILFKLGAETKPYVHQILVVVSPLLIDEDPMARTTGRDIISNLASACG
                     LGTMITTLRADIDNEDEYIRNITSRTMAVVTKSFGVPNMLPFLKAVCHSTRSWRARHT
                     GIKTFLQLNILLGVGILPYLAEIVECIGDGLLDEHTPVKIMTANTLASLAETSAPHGI
                     EAFNYVLEPLWKGIRTHRSKVLAVFLKALGSIIPLMDPDYAGYYTEEVMRIVRREFNS
                     PDDEMKKVVLLVLQKCCQTEGMTPKYLRDEIAPDFFKYFWNRRIALDLPINKLVTYTT
                     VVLSEKLGCSFVVENLLQPLKNEAEPFRIMAIHAINRVVKQLGTAELSERQETRLIDA
                     LLIAFQEQKNYDPIVYQGFGTVALSLNTRMKPFLSAIISTILNLLKHKSQLARQIAAD
                     LCAILIPVIKNCNELEMLNKLNIILYESLGEIYPDVLGSIITAILNIVSVMDIEKIQP
                     PINQILPTLTPILRNTHRKVQVSTIKLIGCIARRAPSYVSPKEWMRICFELLELLKST
                     NKAIRRSANSTFGEIAKAIGPQDVLIALLNNLKVQERQLRVCTAVAIGIVAETCGPYT
                     VLPALMNEYKTPETNVQNGVLKALAFMFEYIGELAGDYVYVILPLLEDALIDRDLVHR
                     QTASDVIKHLALNCQGTGHEDAFIHMLNLLMPNIFETSPHVIVRVLEGLESLGTTIGP
                     GVYMNYLWGGLFHPAKSVRKAFWKAYNRAYIEEGDALVPYYPVNNTASIEIPELDIIL
                     "
     gene            <822627..>823751
                     /gene="NDAI0C03580"
                     /locus_tag="NDAI_0C03580"
                     /db_xref="GeneID:11494763"
     mRNA            <822627..>823751
                     /gene="NDAI0C03580"
                     /locus_tag="NDAI_0C03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669213.1"
                     /db_xref="GeneID:11494763"
     CDS             822627..823751
                     /gene="NDAI0C03580"
                     /locus_tag="NDAI_0C03580"
                     /inference="similar to DNA sequence:INSDC:YMR289W"
                     /note="similar to Saccharomyces cerevisiae YMR289W;
                     ancestral locus Anc_5.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669261.1"
                     /db_xref="GeneID:11494763"
                     /db_xref="GOA:G0W8A7"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:G0W8A7"
                     /translation="MSSKTVEKPIPTFEGSVEQFLIGYGQGADLKEPKFEVLSTIRYD
                     PNLGQSDSGKRNNNGPSEVRNNGKIELNFDPKTGSDFIELFLSDTTPSRRYISIGDSC
                     KRPPSWKYVSSLSPYYKLFYERFFLLDFHYIRINAAIAAFGWNYHITIEDLLAALIHA
                     LQEGMEYDTIQEELDYLLSRKDIYKMRVLASLGGKFKVEAHLLSQSNDDTNNDSTQEY
                     FQHTLLRGLKSNVNNWDVFINNEFINVSLFTYLKTTKREHYTKARNLMSELSKSYNKD
                     LPTTKKSEILVYNKSNELMEGSITNVAVWSEKEGTYVTPKASSGCLRGTMRKYLLQAG
                     HIKEGHIHIDSLYDGEEILLFNGIMGCVKGTIRKFSTQTV"
     gene            complement(<823972..>826218)
                     /gene="NDAI0C03590"
                     /locus_tag="NDAI_0C03590"
                     /db_xref="GeneID:11494764"
     mRNA            complement(<823972..>826218)
                     /gene="NDAI0C03590"
                     /locus_tag="NDAI_0C03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669214.1"
                     /db_xref="GeneID:11494764"
     CDS             complement(823972..826218)
                     /gene="NDAI0C03590"
                     /locus_tag="NDAI_0C03590"
                     /inference="similar to DNA sequence:INSDC:YGR264C"
                     /note="similar to Saccharomyces cerevisiae MES1 (YGR264C);
                     ancestral locus Anc_5.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669262.1"
                     /db_xref="GeneID:11494764"
                     /db_xref="GOA:G0W8A8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:G0W8A8"
                     /translation="MPAQISFDKVKDHSHAISFANNLKIALAIEYATKDLKLTINDDS
                     NIAQLVVSDSYQLFNPNAILRYALNDFTDQESEANQFAVTIVEKALISSETSSKEVVT
                     KTLEQYLPYPIEEPVSATKLILLADILALDPTTVKSKFTALPEKILKAIIEAEKATPR
                     SPSMFKNTGAVNVEQNFKVKQQAQEIVPEKGERNILITSALPYVNNVPHLGNIVGSVL
                     SADIFARYCKTRNYNTLFVCGTDEYGTATETKALEEGCTPRELCDKYHKIHSDVYKWF
                     QIGFDYFGRTTTEQQTEIAQDIFKKLDKNGYLEEQSMKQLYCPVHNSYLADRYVEGEC
                     PKCHYEDARGDQCDKCGGLLDPFELINPRCKLDNATPIPKFSDHIFLSLDKLEPSIAK
                     WVEKSSEEGQWSKNSKTITNSWLKDGLKPRCITRDLVWGTPVPLEKYKDKVLYVWFDA
                     TIGYVSITANYTKKWEQWWKDPENVKLYQFMGKDNVPFHTVVFPGSQLGTGDEWTMLH
                     HLNTTEYLQYEGGKFSKSRGVGVFGNNAQDSGVSPSVWRYYLASVRPESSDSHFSWDD
                     FVARNNSELLANLGNFVNRLIKFVNAKYNGVVPKYDHKQVPNYDGLKKDIDVILKSYV
                     EKMEYGHERSGLELAMSLSARGNLFLQENKLDNSLFSQFPAKSDAVVGVGLNIIYTVT
                     SLIYPFMPETAEKIYKMLNAPALKIDEEFHLAILEGHNINKAEYLFHRIDEKQVEQWR
                     NLYGGKQV"
     gene            complement(<826718..>828277)
                     /gene="NDAI0C03600"
                     /locus_tag="NDAI_0C03600"
                     /db_xref="GeneID:11494765"
     mRNA            complement(<826718..>828277)
                     /gene="NDAI0C03600"
                     /locus_tag="NDAI_0C03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669215.1"
                     /db_xref="GeneID:11494765"
     CDS             complement(826718..828277)
                     /gene="NDAI0C03600"
                     /locus_tag="NDAI_0C03600"
                     /inference="similar to DNA sequence:INSDC:YMR290C"
                     /note="similar to Saccharomyces cerevisiae HAS1 (YMR290C);
                     ancestral locus Anc_5.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669263.1"
                     /db_xref="GeneID:11494765"
                     /db_xref="GOA:G0W8A9"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8A9"
                     /translation="MSSPSTKRPRDASDDGETSTSVKTTQNQESTLKLQVEKENSTTS
                     TTTAIPTNFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKT
                     LAFLIPAIELLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGG
                     ANRRQEAEKLMKGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDE
                     MKQIIRILPNEDRQSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQG
                     YVVCDSDKRFLLLFSFLKRNQKRKSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQ
                     QKRTNTFFEFCNADKGILVCTDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTARG
                     TKGKGKSLMFLTPNELGFLRYLKAAKVPLNEYEFPTNKIANVQSQLEKLIKSNYYLHQ
                     TAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFSIPPKVNITIGASGKTDKTN
                     TKRRKTNNQRH"
     gene            <829317..>831476
                     /gene="NDAI0C03610"
                     /locus_tag="NDAI_0C03610"
                     /db_xref="GeneID:11494766"
     mRNA            <829317..>831476
                     /gene="NDAI0C03610"
                     /locus_tag="NDAI_0C03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669216.1"
                     /db_xref="GeneID:11494766"
     CDS             829317..831476
                     /gene="NDAI0C03610"
                     /locus_tag="NDAI_0C03610"
                     /inference="similar to DNA sequence:INSDC:YMR291W"
                     /note="similar to Saccharomyces cerevisiae YMR291W;
                     ancestral locus Anc_5.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669264.1"
                     /db_xref="GeneID:11494766"
                     /db_xref="GOA:G0W8B0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="UniProtKB/TrEMBL:G0W8B0"
                     /translation="MLHIQPLTSMDDPSNLNTGSKEANSLPKNNHLPTPPTSSDGTTT
                     TEVMTWPNLSHNEKAFKCKYVTKHNSQLGDGNFSIVKECINIQTKDHFAMKLINKKIV
                     KGKIKLIQREFKLLKFISEEIRSVERVNMKSQTQPSSLRINSNKYTNANANVNTNMYD
                     TFDGHHHILQLFDFFETKDSIVLITQLCQKDDLYELIIQNEKLDLKRQVVPFTACLLS
                     ALQFLHSHGIVHRDIKAENVLFRLNPTNTNGDMKIDQGYDLMAHDLILADFGLATQLD
                     SSSLKEYVGTISYIAPEIVKCKGVEKMNADELNSLTKYSYPVDIWALGVLTYFMALGF
                     TPFDCENDEETLDCISKCDYYVDDDMLHDPTLKEFWSFIQCCFTKDVANRPTAFDLKY
                     HPFLMDHFKSSLNKNLMKRPQALLGSQFHSQSQLNLRARGNGNDNSSTTTSNINLQNI
                     LVVEDQQGEELLDTPAFLFSSLPMVRNKSSSSLHSLKSPSRSKINSNSSSTTSLSSLI
                     SATSESFNNGNSSSSSCSMTTTHPKVQKKVTKVHPAKITNTTPSKFELSDMHVKHNLI
                     QASTNKQEKNLDKIRDTLRRTLSMTSLRQPLPPPSASSNNKAGTLTSSTSSKLLKKNS
                     TFVLDPKPPASSLMNGCFSTTPEAISNFTTPKELSRQSSFVNNHKSMTANIVANSNLK
                     QENKKYNANDNANANDNDNDDEDEDEDDDNDDAGIYI"
     gene            <831662..>832382
                     /gene="NDAI0C03620"
                     /locus_tag="NDAI_0C03620"
                     /db_xref="GeneID:11494767"
     mRNA            join(<831662..831698,831988..>832382)
                     /gene="NDAI0C03620"
                     /locus_tag="NDAI_0C03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669217.1"
                     /db_xref="GeneID:11494767"
     CDS             join(831662..831698,831988..832382)
                     /gene="NDAI0C03620"
                     /locus_tag="NDAI_0C03620"
                     /inference="similar to DNA sequence:INSDC:YMR292W"
                     /note="similar to Saccharomyces cerevisiae GOT1 (YMR292W);
                     ancestral locus Anc_5.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669265.1"
                     /db_xref="GeneID:11494767"
                     /db_xref="GOA:G0W8B1"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:G0W8B1"
                     /translation="MLGNFIKKDRNAQFGVAFTFGGFLFFLFGIVTFFDRALLALGNI
                     LFLIGVLLIIGPHKTYNFFNRPTKRRGSICFLIGISLILSKWTFIGFIIESLGIVGLF
                     GDFFGIIVQFLRSLPIIGPILSNPAIAPFIDRLAGISVLPV"
     gene            complement(<832525..>833994)
                     /gene="NDAI0C03630"
                     /locus_tag="NDAI_0C03630"
                     /db_xref="GeneID:11494768"
     mRNA            complement(<832525..>833994)
                     /gene="NDAI0C03630"
                     /locus_tag="NDAI_0C03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669218.1"
                     /db_xref="GeneID:11494768"
     CDS             complement(832525..833994)
                     /gene="NDAI0C03630"
                     /locus_tag="NDAI_0C03630"
                     /inference="similar to DNA sequence:INSDC:YMR293C"
                     /note="similar to Saccharomyces cerevisiae YMR293C;
                     ancestral locus Anc_5.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669266.1"
                     /db_xref="GeneID:11494768"
                     /db_xref="GOA:G0W8B2"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:G0W8B2"
                     /translation="MSQAKSIDHVIKALPKLQSRYNIFAHLEPSTKILQRYNDIQKNQ
                     PNSTLAGTISAIKDNIVTQDSNTTCASQMLKEYKSPFTATIVKLLSNAGTTIVGKTNM
                     DEFAMGSLGIHSCYGPTINPSRAFFANDDMGKREMVTGGSSSGSAAAVSATIDGDNII
                     DFALGTDTGGSVRLPASYCSVLGFKGSYGRISRYGVVSFAQSLDTVGIFAKDLPILRG
                     VFDVLNKYDRKDPTSLNDLLRNEIIELSDKCLHRLQNPLRIGIVQEFNQESVDKDIKS
                     AFHDFIGQLMEKGYTVVPISIPSIKYSLPIYYTLAPSEAVSNLSRYDGIRFGTRDPNE
                     DVNNEAFFSKTRSNFGTEVRNRLILGNYNLSSSFAHNNYIQAQKLRVNLINEFDFMFK
                     FPNVLTRNKANVGDDNGIDFIISPTSLNKPTFVRRAMSDKIATDEYFNDIFTIPASLA
                     GLPTMTIPIRGNEPIGIQIMGQYGDDQGVLDFTSTLMKK"
     gene            <834228..>835439
                     /gene="NDAI0C03640"
                     /locus_tag="NDAI_0C03640"
                     /db_xref="GeneID:11494769"
     mRNA            <834228..>835439
                     /gene="NDAI0C03640"
                     /locus_tag="NDAI_0C03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669219.1"
                     /db_xref="GeneID:11494769"
     CDS             834228..835439
                     /gene="NDAI0C03640"
                     /locus_tag="NDAI_0C03640"
                     /inference="similar to DNA sequence:INSDC:YMR294W"
                     /note="similar to Saccharomyces cerevisiae JNM1 (YMR294W);
                     ancestral locus Anc_5.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669267.1"
                     /db_xref="GeneID:11494769"
                     /db_xref="UniProtKB/TrEMBL:G0W8B3"
                     /translation="MEVFDFTDNVEDVSYEFMSALDDTQPKIFESEGTELLPENGLQN
                     EYRSTNDTLELYPSNDIDHQGEKSTIIYENTPDMMKVAEQLESQLKKYNATKSTKEDL
                     RKMQIDKPEISTLKKELDKISLQELDDMKRESTMEDKLLFEKIQKSMQSDEKTLLKGL
                     HDKLSEHVSEESNHDNNNNNNDKYILKLPNIEFNSTELYRILNLEERIHKLESSLGHI
                     KDEPNICQSSFEEPIMTQLNKIYRQLILIENNEPVLNNFQKSLTEINKKYEDSLLGKN
                     INKNNDLQELAINNIVNQKTKIDNLYKFYDENKHYADILPKLSERMKLFKKVNMKVSE
                     SFQMLQNIDRMIADVASTTEEWNCTINKIVEKISSQEIIVNKNFEKLNDKIQNLEAKL
                     ETLTRDKEAFE"
     gene            complement(<836110..>836697)
                     /gene="NDAI0C03650"
                     /locus_tag="NDAI_0C03650"
                     /db_xref="GeneID:11494770"
     mRNA            complement(<836110..>836697)
                     /gene="NDAI0C03650"
                     /locus_tag="NDAI_0C03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669220.1"
                     /db_xref="GeneID:11494770"
     CDS             complement(836110..836697)
                     /gene="NDAI0C03650"
                     /locus_tag="NDAI_0C03650"
                     /inference="similar to DNA sequence:INSDC:YGR273C,YMR295C"
                     /note="similar to Saccharomyces cerevisiae YGR273C and
                     YMR295C; ancestral locus Anc_5.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669268.1"
                     /db_xref="GeneID:11494770"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:G0W8B4"
                     /translation="MMHFRKKSGVSNKSNSDDPNHIAKVEVSKEDAQRLKVRTASVND
                     PILDAVNEAQPFEQAADAFHDNMNRQSYFSTDGGNVLRDVFGQPIQNADISNPTRARD
                     ERPLDTIRSFEYAVSGDPVWAQQLETPQYGFRVRPDFPSFGDSNPYDANGMPVQANQM
                     YGEQGVYQAPVRQQTDEKKKKKRGFFGRKKKKNSD"
     gene            complement(<837166..>838833)
                     /gene="NDAI0C03660"
                     /locus_tag="NDAI_0C03660"
                     /db_xref="GeneID:11494771"
     mRNA            complement(<837166..>838833)
                     /gene="NDAI0C03660"
                     /locus_tag="NDAI_0C03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669221.1"
                     /db_xref="GeneID:11494771"
     CDS             complement(837166..838833)
                     /gene="NDAI0C03660"
                     /locus_tag="NDAI_0C03660"
                     /inference="similar to DNA sequence:INSDC:YMR296C"
                     /note="similar to Saccharomyces cerevisiae LCB1 (YMR296C);
                     ancestral locus Anc_5.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669269.1"
                     /db_xref="GeneID:11494771"
                     /db_xref="GOA:G0W8B5"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W8B5"
                     /translation="MSHIPQVLPTSIPIPSFVITAFSYIWYYLSAILTRIPGGPYVIP
                     YIQKSHHDDPYRTTVEIGLILYGIYFYLSKPQQKKGLQSNRPKLSPQEIDSLIDEWQP
                     EPLVDPSVLDEQSWRLSSIPVIENSGPSNHVNISRNDGKETFNDLFNLSSNNFLQLTS
                     DEELVQVAKKTIKNYGVGACGPAGFYGNQDVHYALEYDLAQFFGTEGAVLYGQDFCVA
                     SSVLSAFNKRGDVIVADDQVSLALQNALQLSRATVYYFEHNNMQSLENLLAELTEMEA
                     NDKPPAIPRKFIVTEGLFQNSGDIAPLPELTNLKEKYKFRLFVDETFSIGVLGETGRG
                     LPEHFGMIRASSIDVTVGSLATAIGSSGGFCLGDAVMAHHQRIGSNAYCFSASLPAYT
                     TTTASRVLQILNTDKVIVSKLQQFSKMVFDFFVNDLDLQKIIKVTSFELSPVLHFRLL
                     PEIRKAKFNYTAEELFETISRLQKRNATTKYIEPYENEERFLQSVVDAAIKKHGILIS
                     RNTIILQHETLPIVPSLKICCNAKMDEEELRKACVAVKDVLIEACQN"
     gene            <839647..>841254
                     /gene="NDAI0C03670"
                     /locus_tag="NDAI_0C03670"
                     /db_xref="GeneID:11494772"
     mRNA            <839647..>841254
                     /gene="NDAI0C03670"
                     /locus_tag="NDAI_0C03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669222.1"
                     /db_xref="GeneID:11494772"
     CDS             839647..841254
                     /gene="NDAI0C03670"
                     /locus_tag="NDAI_0C03670"
                     /inference="similar to DNA sequence:INSDC:YMR297W"
                     /note="similar to Saccharomyces cerevisiae PRC1 (YMR297W);
                     ancestral locus Anc_5.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669270.1"
                     /db_xref="GeneID:11494772"
                     /db_xref="GOA:G0W8B6"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR008442"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G0W8B6"
                     /translation="MKLNITPQAALVSGLTLSSTLVNGLSFQHPFAFDQDLLNIAIKT
                     LGFDRNEILGSLSQDIKSAWEDLPRLFPKQVAELQYFTKPKFPQKINKKSHWDFVVQN
                     DQITDYQLRINKIKDPKLLGVDPDVKQYTGYLDVKEDDKHFFFWFFESRNAPKNDPII
                     LWLNGGPGCSSMTGLFFELGPSSIGNKIKPIYNNHSWNSNASVIFLDQPVNVGFSYSG
                     GSGVSNTVAAGKDVYSFLQLFFEQFPEYASGQDFHIAGESYAGHYIPVFASEILSHDV
                     EERNFNLTSVMIGNGLTDPLTQYKFYEPMACGKGGEPAVLSPQECDAMTDSLDRCLSL
                     IDSCYKSESVWSCVPASIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPGLQNIDDY
                     LNLDYVQEAIGAEVDHFESCNFDINRNFLFNGDWMKPYHKAVTGILNQGLPVLVYAGD
                     KDFICNWLGNRAWTDVLPWKDSEEFAKQPVRNWTASITDEVAGEVKNFGNLTYLRVFN
                     GGHMVPYDVPRNALSMLTEWVSGNFTL"
     gene            <841790..>842245
                     /gene="NDAI0C03680"
                     /locus_tag="NDAI_0C03680"
                     /db_xref="GeneID:11494773"
     mRNA            <841790..>842245
                     /gene="NDAI0C03680"
                     /locus_tag="NDAI_0C03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669223.1"
                     /db_xref="GeneID:11494773"
     CDS             841790..842245
                     /gene="NDAI0C03680"
                     /locus_tag="NDAI_0C03680"
                     /inference="similar to DNA sequence:INSDC:YMR298W"
                     /note="similar to Saccharomyces cerevisiae LIP1 (YMR298W);
                     ancestral locus Anc_5.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669271.1"
                     /db_xref="GeneID:11494773"
                     /db_xref="UniProtKB/TrEMBL:G0W8B7"
                     /translation="MVDPKLEKVLEERKPRFWTLFQCVVGALTLMAAVEYFKYSTRIH
                     YEWFHCTPVIETVGGPSSSVIKLYSRGGPSCDKRGEFKTIVKRITRDYEPAEGAISFC
                     INENVNVPAVHYPIDENKGAPGYVAFVGYDSDGKDLIEQMCEGSTILHM"
     gene            complement(<842417..>845785)
                     /gene="NDAI0C03690"
                     /locus_tag="NDAI_0C03690"
                     /db_xref="GeneID:11494774"
     mRNA            complement(<842417..>845785)
                     /gene="NDAI0C03690"
                     /locus_tag="NDAI_0C03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669224.1"
                     /db_xref="GeneID:11494774"
     CDS             complement(842417..845785)
                     /gene="NDAI0C03690"
                     /locus_tag="NDAI_0C03690"
                     /inference="similar to DNA sequence:INSDC:YGR274C"
                     /note="similar to Saccharomyces cerevisiae TAF1 (YGR274C);
                     ancestral locus Anc_5.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669272.1"
                     /db_xref="GeneID:11494774"
                     /db_xref="GOA:G0W8B8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:G0W8B8"
                     /translation="MSTSTPPNGNKKSTKNKSKESKTSDLTNEEDAYNAIFGGDFGSL
                     EIGSLIAKEENGDGATEHLPDAMDFEDEEELAEEEEEEGGEGEGEGEDSSSGSEEETT
                     SEEEEEEDEGEEQEEEQKKGSIPLSLPTTSPNAIPSNDPFTRDLNDDNLILDHNFLNA
                     LPTNLNDTNNPMGPEDDNDFQYMDDNNALFNLGVDNTIPNSSIITSNNNVNNNNNTTI
                     FMDHNPSFDDTFSLNNTQSSQQMQQQPPPLQQQQQPNGLPMLMLGQQLKQHTHMSNMI
                     SKEDSIKREREKIANEEKFLLKTYFPTFKKGKILKWNKFIYRSKGRYNWHRDYSLANK
                     QLSVLFPINLKLKVQTDQRKLFMSSSSNPWQYSLMSSTNIRKKNGIISVTLDEIDPQP
                     IKREKIIRESYNIPEDLLIATDDWDQEKIINGDDANGKGALLSEESTGIPSSLKNILE
                     QNDEDWNWNEENLINVNLKQAKTAELNMNDENLLLIRNESRTSMINDTKLLPPLNERS
                     ILTKIYISNDNEYDILKRTHQPKVRSTISNLNIEHSLPALKLQSPYYKVSIPKSQVRY
                     FHRPHFGNNIRPGTNIVFSKLKIRKRKRDKGKDIKESFASTQDLTIGDTAPIYLMEYS
                     EQTPLALSKFGMANKLINYYRKTSDQDTLRPKLPVGETHVLGVQDKSPFWNFGFVEPG
                     HIVPTLYNNMIRAPVFKHDVSGTDFLLVRSSGHGVSNRFYIRGINHLFAVGQTFPVEE
                     IPGPNSRKVTSMKTTRLRMIVYRLLNKAQGRSISIDPVNKHFPDQDYGQNRQKVKEFM
                     KYQRDGPDKGLWKLKEGETLLDNEHTRKLITPEQVSEVETTSQGIQFQEDNEWFNFDD
                     KLKRLEENLLPWNATKNFINATQMRAMIQIHGAGDPTGVGEGFSFLKTSMKGGFIRSG
                     SHMDGKRSGGHTYNVAEQQKAYEGEISKTWYTHAKSLSVTNPFEEIDDPDIVNPTNKH
                     VKTHRDDNKVLKIVRKRRDANGIIQRQTIIVRDPRVIQGYLKGKEKKKAENLDVNKLL
                     EQETTNIGNMEDIEMQKKLLQNELANLEKSQQRRTARQNSKKKTLQDGKVTKNKNTTR
                     RCATCGQVGHIKTNKACPMYNSGVNDDASTPSAT"
     gap             845904..845923
                     /estimated_length=20
     gene            <846179..>847261
                     /gene="NDAI0C03700"
                     /locus_tag="NDAI_0C03700"
                     /db_xref="GeneID:11494775"
     mRNA            <846179..>847261
                     /gene="NDAI0C03700"
                     /locus_tag="NDAI_0C03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669225.1"
                     /db_xref="GeneID:11494775"
     CDS             846179..847261
                     /gene="NDAI0C03700"
                     /locus_tag="NDAI_0C03700"
                     /inference="similar to DNA sequence:INSDC:YJL006C"
                     /note="similar to Saccharomyces cerevisiae CTK2 (YJL006C);
                     ancestral locus Anc_5.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669273.1"
                     /db_xref="GeneID:11494775"
                     /db_xref="GOA:G0W8B9"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:G0W8B9"
                     /translation="MSPGTTTTTSRPGTSSSSSPSSSSLASFESELYLSRPYFTRRQI
                     SKLQSKTITDHRSYNSKKLTIVRYLSDLCVHLSFPRKTLETAIYYYQRYHLFHPFETE
                     LTYTLALGCLILSCKQVETITKINDIVNLSFVLRNGKPLPMTSPSSAVELENMKKRIF
                     NLELKVLKSCSFDYRINNYIHIDEFIIKFGQKLNFHFQICHLAWIIEYDVFKLDLLLI
                     IPQHVIALATLKLATELYGQDLEIWNKLETFTNLQVEKLSFKQAYFDILNFYINTFDL
                     CDLKDNLPTDVPPISINEFMALKKRAGSEVGLEDITNNTSKFQQEIVDADPYLNINQN
                     EFKMAREKRYVLSQDLIEQEVISLKK"
     gene            complement(<847460..>848557)
                     /gene="NDAI0C03710"
                     /locus_tag="NDAI_0C03710"
                     /db_xref="GeneID:11494776"
     mRNA            complement(join(<847460..848455,848555..>848557))
                     /gene="NDAI0C03710"
                     /locus_tag="NDAI_0C03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669226.1"
                     /db_xref="GeneID:11494776"
     CDS             complement(join(847460..848455,848555..848557))
                     /gene="NDAI0C03710"
                     /locus_tag="NDAI_0C03710"
                     /inference="similar to DNA sequence:INSDC:YJL031C"
                     /note="similar to Saccharomyces cerevisiae BET4 (YJL031C);
                     ancestral locus Anc_5.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669274.1"
                     /db_xref="GeneID:11494776"
                     /db_xref="GOA:G0W8C0"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:G0W8C0"
                     /translation="MHGTKRKQWSKEALNRKRLNDVKKIKDYRKLVDKVLTLKESQVY
                     DLKSLKSTTELLEINPEFNTAWNFRRDIIDNIRNELDSEFWDNELKFTMKTLKRFPKV
                     YWIWNHRVWVLSHHVDSSIKIWQKELFIVNQMLELDSRNYHGWHYRRIVIQNMERLGN
                     KSLNHQEFQYTTEKINQNISNFSAWHQRVQLISMMFDHDEIANKLDLLKDELDYITNA
                     MFTGADDQAVWDYICWFIEYDNVFKTLELKEYTKMLNDLQTNIVMINDDDKDFSGKEN
                     PWCLKVLILIENLQCKRGIKKSDDVLKSKEWLAKLIEVDPLRANRYRYLLDSQYHE"
     gene            complement(<849504..>852158)
                     /gene="NDAI0C03720"
                     /locus_tag="NDAI_0C03720"
                     /db_xref="GeneID:11496465"
     mRNA            complement(<849504..>852158)
                     /gene="NDAI0C03720"
                     /locus_tag="NDAI_0C03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669227.1"
                     /db_xref="GeneID:11496465"
     CDS             complement(849504..852158)
                     /gene="NDAI0C03720"
                     /locus_tag="NDAI_0C03720"
                     /inference="similar to DNA sequence:INSDC:YJL029C"
                     /note="similar to Saccharomyces cerevisiae VPS53
                     (YJL029C); ancestral locus Anc_5.245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669275.1"
                     /db_xref="GeneID:11496465"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:G0W8C1"
                     /translation="MISASLEYDPFEDITSLFSSKDSLNDIDVILERTRNYKLSLQKT
                     ITENNSKTKSQDGTENDPIIMEKVFKDFVETQTISARTEATISNLTQRISYLDNGKNN
                     ITKSLTIFQNLKTLVDSYCQCKLLIQSNSYIEMVSPYRIMCSLAENTFIPFKSVDEIN
                     RLLISISRLKNDTVEKIKSSYSTLFQGNFTSPVEINRLEGQLKNGASVLVDSDSNMRS
                     KFIDWIIDKKLLYELTEIFQVDDEAGSLENLSRRFIYFKKILNNFNTNFNNSFPDDWK
                     IPSKLTLHFLNLTARDLKILLKRELHDKSTSASSSSSSSANASNSIDLFMNALQSTLD
                     FEKYINIRFSNKFKDESKKLSGCFEPYLSIWVSHQDKIMKDKMINYLSSPKISSSITD
                     SLIVPSSIDLFRTYRSILSQTLELLEGNNNENTDDNKNGNSNSILLTLAIFFNKWLTE
                     YSIKILNPLILPDNIEIPNKLECSKYTVLLINTTDYVSTTISQLEDKLSEFSSSPDRI
                     SHVFEKTKNTYNDLLARATNLLIYRVIAQDISFVWKEFNNVDWIHVRMEDYSRYMTTL
                     RDTLITPDSRDDNTDDNDHETKRTTLEYIISLFNRDVYKWNFLDKIIELIANDFITRI
                     IKLLEPQTPFLITNTNVIKKRKYDVQHTITIGEQLLLDIELLKFTLHSLSNCIVNDRS
                     DVKTSSSMTISTSRKRFENHVDVNVEQLLSFVKLLVAPLNSPDDYFETYRRLCPNNNR
                     NIIWAYCFVLKGVEWDLPLWKNYFSSFHLGLVEEVAPEEGNRGDQEKKQEKTNHATNK
                     YFIFQWNKKLLFDFERNLLQINEPNWVNFIRNDLNIKSPPQTTNSRAAMSNRGRPETF
                     RGSEDQETKKPLSVKDLMSTTRFFNRGL"
     gene            complement(852437..852509)
                     /gene="NDAI0Ctrna3M"
                     /locus_tag="NDAI_0Ctrna3M"
                     /db_xref="GeneID:11496466"
     tRNA            complement(852437..852509)
                     /gene="NDAI0Ctrna3M"
                     /locus_tag="NDAI_0Ctrna3M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11496466"
     gene            <852765..>854480
                     /gene="NDAI0C03730"
                     /locus_tag="NDAI_0C03730"
                     /db_xref="GeneID:11496753"
     mRNA            <852765..>854480
                     /gene="NDAI0C03730"
                     /locus_tag="NDAI_0C03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669228.1"
                     /db_xref="GeneID:11496753"
     CDS             852765..854480
                     /gene="NDAI0C03730"
                     /locus_tag="NDAI_0C03730"
                     /inference="similar to DNA sequence:INSDC:YJL008C"
                     /note="similar to Saccharomyces cerevisiae CCT8 (YJL008C);
                     ancestral locus Anc_5.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669276.1"
                     /db_xref="GeneID:11496753"
                     /db_xref="GOA:G0W8C2"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G0W8C2"
                     /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQINKSIAAVRELHQMCLT
                     SMGPCGRNKIIVNHMGKITITNDAATMLRELEIVHPAVKVLVMATEQQKIELGDGTNL
                     VMVLAGELLNVCEKLIALGLSAVEIIQGYNMAKNFTLQELDKLVVDDIVDKNDKSQLI
                     KIIKPVIASKQFGFEDLLSDLVADAVSHVLPKTSQSTNPYFNVDSIRVVKIMGGSLSN
                     STVIKGMVFNREPEGHVKSLEGGEQHKVAVFVCPLDIANTETKGTVLLHNAQEMMDFS
                     KGEEKQIDAMMKEIADMGVKCIIAGAGVGELALHYLNRYGILVLKVPSKFELRRICRV
                     CGATPLPRLGAPTPEELGVVETVKTMEIGGDRVTVFKQESNEISKTATIILRGATQNN
                     LDDIERAVDDGVSAIKGLMKPSGGKLLPGAGATEIELVSRITKFGEKTPGLLQLAIKQ
                     FALAFEVVPRTLAETAGLDVNEVLPNLYAAHTMTDDEANEPSSQNDCLFKGIDTLGET
                     SEGVKDIREDGVYDMLATKKFAINVATEAATTVLSIDQIIMAKKAGGPKPPQGPRPGN
                     WDQDD"
     gene            <854925..>856958
                     /gene="NDAI0C03740"
                     /locus_tag="NDAI_0C03740"
                     /db_xref="GeneID:11496467"
     mRNA            <854925..>856958
                     /gene="NDAI0C03740"
                     /locus_tag="NDAI_0C03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669229.1"
                     /db_xref="GeneID:11496467"
     CDS             854925..856958
                     /gene="NDAI0C03740"
                     /locus_tag="NDAI_0C03740"
                     /inference="similar to DNA sequence:INSDC:YJL010C"
                     /note="similar to Saccharomyces cerevisiae YJL010C;
                     ancestral locus Anc_5.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669277.1"
                     /db_xref="GeneID:11496467"
                     /db_xref="GOA:G0W8C3"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W8C3"
                     /translation="MAKTKSRGRKLLKKQQKDEFHPSTISHEDKDNHQEEEYTNGHEE
                     TDSSSHSNQQMFFGVLDREELEYFKQAESTLSLDAFESPDEKFQFISSIIDEAKGKEL
                     KLVTSQICSKLMERLILECDDTQLKTLFQAFNGVFFNMACHKYASHVLETLLVRSTAL
                     VEKELLTPSFDTDNNDNDDGAVFVSMENLFLFMLNELKPHLKDMVNHQYASHVLRLII
                     LILSSKVLPNTTQNNSIVRSKKSKIARKMINIKDNEDFNKVYQTPESFKNELRNLVNT
                     LYKDFTNNAESRSAITMTQVTKFREYCVDKVASPVIQLIIQVEGIFDRDRSFWRLVFN
                     TNDEKDSKEEAFMEYLLSDPVGSHFLENVIGFARVKYVERLYNLYMKDRILKLAKRDT
                     TGSFVIQSLLQHLKSKEVKEILDAVVPELSMLLNSNMVFGTTIIDSSIKQDNYLRDDI
                     IEQLLKKYYPRESLEKNILESCLNLSSSTLGNTRDDWPTAEERRRSIFLEKLIDYDDK
                     FLEITIDSMLKLPEQRLSQMCYHGVFSHVVEHVLQTKRVKVVKRKQLLNVLCKDVVNM
                     ACNAYASHIMDKLWEFTAKLTLYKERIANALRSESEKVKNSTYGRQVWKNWNLELYVR
                     KNRDWKRLVKEQELEIFPDSRPLQPKGTFSTKRENDGSADSQQYKRHRNNERS"
     gene            complement(<857141..>857788)
                     /gene="NDAI0C03750"
                     /locus_tag="NDAI_0C03750"
                     /db_xref="GeneID:11496468"
     mRNA            complement(<857141..>857788)
                     /gene="NDAI0C03750"
                     /locus_tag="NDAI_0C03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669230.1"
                     /db_xref="GeneID:11496468"
     CDS             complement(857141..857788)
                     /gene="NDAI0C03750"
                     /locus_tag="NDAI_0C03750"
                     /inference="similar to DNA sequence:INSDC:YKL142W"
                     /note="similar to Saccharomyces cerevisiae MRP8 (YKL142W);
                     ancestral locus Anc_5.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669278.1"
                     /db_xref="GeneID:11496468"
                     /db_xref="InterPro:IPR012917"
                     /db_xref="UniProtKB/TrEMBL:G0W8C4"
                     /translation="MTTELEQLKKKVNDLEALVKKQTLLISTTGKNVMQLQLNQQRND
                     VQKFDETFNAKNNVPPIDPTDFATNGDLVELVAELQGELNRIEERSIRRVVNSTKLDG
                     NDTLAPMPNPDGEIPSLEQKDWFPISLSDFENIPDVKLYKLAKFYERLPEKVKEEEDY
                     ENLLKRQNETVQINDLDEKEIMKELKKFSEEEINEMFNEVARFLGVRSRRGTNIW"
     gene            complement(<858113..>859564)
                     /gene="NDAI0C03760"
                     /locus_tag="NDAI_0C03760"
                     /db_xref="GeneID:11496469"
     mRNA            complement(<858113..>859564)
                     /gene="NDAI0C03760"
                     /locus_tag="NDAI_0C03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669231.1"
                     /db_xref="GeneID:11496469"
     CDS             complement(858113..859564)
                     /gene="NDAI0C03760"
                     /locus_tag="NDAI_0C03760"
                     /inference="similar to DNA sequence:INSDC:YKL143W"
                     /note="similar to Saccharomyces cerevisiae LTV1 (YKL143W);
                     ancestral locus Anc_5.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669279.1"
                     /db_xref="GeneID:11496469"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="UniProtKB/TrEMBL:G0W8C5"
                     /translation="MSKRFSKKNAQKYVVVHRPHDDPHFYDEDASAHVLVSVSNPNDG
                     HKQQQQLQQQQGQYIPKLTTTKTKEDLKLENKNVGEAALYGINFDDSKYDYTQHLKPI
                     GTDPNAVFVPAKSSTVDKNEKKKDIEDLFVEPEYKDTKNAPVTSVFQRGVAKPDYLLH
                     QQEVTEDIAGFKPDMNPALREVLEALEDEAYVVNDDVEVVKSKKNKKVVEPEEELEED
                     DVFAQLLGSGEVKDDEEFEDGFDEWDMDEIDNYEDEHYRKEMSQFDNIENLEDLQDID
                     YQADVIRFQKEKSKYNEYDSDEGLANESVAPSDFQDEEEEEENDVLGDLPNITAKNAK
                     KGGKKRKDRRKKGAMSDISGFSMSSSAIARTETMTVLDDQFDNVIGSYENYEDEIEED
                     EENYKPFDMKAERSDFESMLDDFLDNYELESGGRKLAKKDEEIDRLKKAADEVSKGKL
                     SQRRNREREEQEAQKAKNTSLHKVTNSLSSLHF"
     gene            <859873..>860550
                     /gene="NDAI0C03770"
                     /locus_tag="NDAI_0C03770"
                     /db_xref="GeneID:11496470"
     mRNA            <859873..>860550
                     /gene="NDAI0C03770"
                     /locus_tag="NDAI_0C03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669232.1"
                     /db_xref="GeneID:11496470"
     CDS             859873..860550
                     /gene="NDAI0C03770"
                     /locus_tag="NDAI_0C03770"
                     /inference="similar to DNA sequence:INSDC:YKL144C"
                     /note="similar to Saccharomyces cerevisiae RPC25
                     (YKL144C); ancestral locus Anc_5.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669280.1"
                     /db_xref="GeneID:11496470"
                     /db_xref="GOA:G0W8C6"
                     /db_xref="InterPro:IPR004519"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:G0W8C6"
                     /translation="MFILSKISDLVRIPPDQFHRDTLSCITHELNNKYANKIVPHIGL
                     CITVYDILEVDEGQLKPGDGASYISVIFRGLIFKPFVGEIITGWISKCTAEGIKVSLL
                     GMFEDIFIPKKMLFEGCYYSPEDSAWVWPMEEDTKLYFDLNEKIRFRVEQEVFVDVKP
                     KSPKEREMEEQEQQLQLQKQEERKANGGDVKEEQEEIVKVEKPPAYALLGSCQTDGMG
                     LVSWWEE"
     gene            complement(<860828..>861985)
                     /gene="NDAI0C03780"
                     /locus_tag="NDAI_0C03780"
                     /db_xref="GeneID:11496471"
     mRNA            complement(<860828..>861985)
                     /gene="NDAI0C03780"
                     /locus_tag="NDAI_0C03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669233.1"
                     /db_xref="GeneID:11496471"
     CDS             complement(860828..861985)
                     /gene="NDAI0C03780"
                     /locus_tag="NDAI_0C03780"
                     /inference="similar to DNA sequence:INSDC:YKL145W"
                     /note="similar to Saccharomyces cerevisiae RPT1 (YKL145W);
                     ancestral locus Anc_5.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669281.1"
                     /db_xref="GeneID:11496471"
                     /db_xref="GOA:G0W8C7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8C7"
                     /translation="MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTS
                     TSNNSNAENAEEDEEDNKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE
                     LPLPPRIDPSVTMMTVEEKPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDP
                     PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
                     KKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP
                     NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG
                     AELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN"
     gene            complement(<863178..>865343)
                     /gene="NDAI0C03790"
                     /locus_tag="NDAI_0C03790"
                     /db_xref="GeneID:11496472"
     mRNA            complement(<863178..>865343)
                     /gene="NDAI0C03790"
                     /locus_tag="NDAI_0C03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669234.1"
                     /db_xref="GeneID:11496472"
     CDS             complement(863178..865343)
                     /gene="NDAI0C03790"
                     /locus_tag="NDAI_0C03790"
                     /inference="similar to DNA sequence:INSDC:YKL146W"
                     /note="similar to Saccharomyces cerevisiae AVT3 (YKL146W);
                     ancestral locus Anc_5.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669282.1"
                     /db_xref="GeneID:11496472"
                     /db_xref="GOA:G0W8C8"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G0W8C8"
                     /translation="MSSNTSKASIGNGSKSLSIQPGDQKPIQQSQNNKRRKGSTTSTI
                     INDNTTNDNNRNRSRKSSATIALKMRPALSSSQIDKDSSSSIDVNNPGPEVVDAVARH
                     LVSTPNDLKLQGGDITRDLYKWTNEHPGIINNDTNPNINNSNNNNLISSIQQQPQLQS
                     QIHRPPVGIPNSPSMNNYEARRKRSMSFSAISITSLNNNNNANNNTSNNIHGTNKIGT
                     ILPGPIMTPEEMRAPGGFRRSFILQKHRKNNTPIPNFFTRNFIEFLTLYGHFAGEDLS
                     ESEEEEEEEENEVEEEEQEEEAIESERTSLISYHVPSVTTSHKSSTFKAILLLLKSFV
                     GTGVLFLPKAFHNGGWAFSSLCLLLCAIISYWCFLTLIVTKDKIHVDGYGDMGERLYG
                     HPMKLAILWSIVLSQIGFSAAYTVFTATNLKVFVENVLVRTATMNPTGYNLVWYIILQ
                     QLIFIPLSLTRKIAKLSGTALIADLFILLGLIYVYYYSSYYILSNGIASESMLWLNKA
                     DWSLFIGTAIFTFEGIGLLIPIQESMQNPQVFPKCLSLVMCIVTIIFISCGLICYSAF
                     GEKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFPAIKILENWTFPIHASGKH
                     NSRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGSFACIPLIYIYPPLLHFKAF
                     LNDTSKTMRFRLGLDMLVFVFGIIIMVYTSWETISMWVH"
     gene            <866392..>868419
                     /gene="NDAI0C03800"
                     /locus_tag="NDAI_0C03800"
                     /db_xref="GeneID:11496473"
     mRNA            <866392..>868419
                     /gene="NDAI0C03800"
                     /locus_tag="NDAI_0C03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669235.1"
                     /db_xref="GeneID:11496473"
     CDS             866392..868419
                     /gene="NDAI0C03800"
                     /locus_tag="NDAI_0C03800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669283.1"
                     /db_xref="GeneID:11496473"
                     /db_xref="GOA:G0W8C9"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:G0W8C9"
                     /translation="MQKFRSNQTFNYKYASTLLKRNIITKRLFCNLTTSTSTANPTSI
                     STSTSLVSNSNLFYSTQKNSYSLAIKRFYTSSTDSSNNILTPLTTTNNTKNIRRNDKN
                     PTVTSASFSSLPTKEIATTTLKNIDTAHQTGKIQNVDFPFNSTISNPFENILMDLDGT
                     TTLKPTQTTNPYQSLSTPKIDLASSTSTTPSSTISKSANASLELSNDTIVNEKNTSAT
                     PTSTTKTSITKDNYNKGNIEFDNEKDWENFQFEQPNSTTYLRTLSKMELFSLTCISLV
                     TINKLILNIVIKLFPIIPTPLIQLFVSKLYCWWVLTPKEVLKCGKNLQKRGISNMMLS
                     LTIENSEGDKNIDTDMIINETIESIHTILKPNLIKQLEDPALTNVNDVAPGYIALKPS
                     ALIERPNEVLMNFNNIGDEYWRAQREKLIDSCCKINQIIFDLNEELLQRYPERKAPFF
                     VCTIDAEKFELQTKGVYDLQRILMKKFNTVESKLISCVGTWQLYLRHSRKEIDKEVEL
                     AKSGGYRLGLKLVRGAYMHSEPNRKSVIHETKFDTDVNYDQIMINIIKDMKIEGENSV
                     YGHLMVASHNYKSQMIATQLLFKNKYANDIEYAKSNVVLGQLLGMADDLTYDLIHHHG
                     ATNIVKYVPWGPPRETKDYLLRRLQENGDAVRNDNGWPLLKNILKSLFFKN"
     gene            <869132..>871060
                     /gene="NDAI0C03810"
                     /locus_tag="NDAI_0C03810"
                     /db_xref="GeneID:11496474"
     mRNA            <869132..>871060
                     /gene="NDAI0C03810"
                     /locus_tag="NDAI_0C03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669236.1"
                     /db_xref="GeneID:11496474"
     CDS             869132..871060
                     /gene="NDAI0C03810"
                     /locus_tag="NDAI_0C03810"
                     /inference="similar to DNA sequence:INSDC:YJL045W,YKL148C"
                     /note="similar to Saccharomyces cerevisiae YJL045W and
                     SDH1 (YKL148C); ancestral locus Anc_5.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669284.1"
                     /db_xref="GeneID:11496474"
                     /db_xref="GOA:G0W8D0"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G0W8D0"
                     /translation="MLSLRTRVATLPIKRTLLLQKSFFSTTRSCKLATTTTDTTTPFD
                     NKDYHIIDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINA
                     ALGNMHPDDWKWHMYDTVKGSDWLGDQDSIHYMTREAPHSIIELEHYGMPFSRTEEGK
                     IYQRAFGGQTKEYGKGEQAYRTCAVADRTGHAMLHTLYGQALRHDTHFFIEFFAMDLL
                     THNGEVVGVIAYNQEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNAMVSRA
                     GFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRD
                     VVSRAITLEIREGRGVGNEKDHMFLQLNHLPPSVLKERLPGISETASIFAGVDVTKEP
                     IPILPTVHYNMGGIPTKWNGEALTIDEETGEDKVIPGLMACGEAACVSVHGANRLGAN
                     SLLDLVVFGRAVAHTVADTLQPNTPHKPVPADIGKESIANLDKIRNANGSRTTAEIRM
                     NMKKTMQKDVSVFRTQESLDEGVSNITAVDKTFDDVKISDRSLIWNSDLVETLELQNL
                     LTCATQTAVSAAARKESRGAHAREDYPDRDDENWMKHTLSWQSKAGAPVELKYRNVIS
                     TTLDEAECPSVPPTVRSY"
     gene            <871538..>872950
                     /gene="NDAI0C03820"
                     /locus_tag="NDAI_0C03820"
                     /db_xref="GeneID:11496475"
     mRNA            <871538..>872950
                     /gene="NDAI0C03820"
                     /locus_tag="NDAI_0C03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669237.1"
                     /db_xref="GeneID:11496475"
     CDS             871538..872950
                     /gene="NDAI0C03820"
                     /locus_tag="NDAI_0C03820"
                     /inference="similar to DNA sequence:INSDC:YKL149C"
                     /note="similar to Saccharomyces cerevisiae DBR1 (YKL149C);
                     ancestral locus Anc_5.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669285.1"
                     /db_xref="GeneID:11496475"
                     /db_xref="GOA:G0W8D1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G0W8D1"
                     /translation="MSKLRIAVQGCCHGELNAIFNEVNRLNNKEKIDLLIILGDFQSL
                     RSRDDFNSISIPPKYQKLGDFRQYYIDSNKRAPVPTIFIGGNHESMKHLMLLPYGGYA
                     ANEIYYLGYSNVIWFKGVRIGSLSGIYKKWDVDRVRPNYSDLERFNTWQKNVRNLYHV
                     RKHDLVPLFMIRQNVDLMLSHDWPSGVVYYGDMQRLLKFKPFFKNDIQAKELGSPLNW
                     QLLKDLQPKWWLSAHLHCRYEARIRHTKRKTQEDTNVEKRTVLKNNAEIDLGLSSDED
                     TDAIENKQSTGEMKQKGVIQKNSAEISLDLSSDEEHASTTNTLGHIQVPGNENPTTTE
                     EDKEILYAENSDHNKDRIDETVFLSLDKCLPRRKWLEIIEVDANEKHPSYKSDNVYWD
                     CEFIRNLQYLEKHKEKIRERPFNTLNWHEMIKERSIGLNNDEEIDWSNFIIPRYEFDI
                     QKKEVEQTRFFKDKFLRLHK"
     gene            complement(<873163..>874068)
                     /gene="NDAI0C03830"
                     /locus_tag="NDAI_0C03830"
                     /db_xref="GeneID:11496476"
     mRNA            complement(<873163..>874068)
                     /gene="NDAI0C03830"
                     /locus_tag="NDAI_0C03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669238.1"
                     /db_xref="GeneID:11496476"
     CDS             complement(873163..874068)
                     /gene="NDAI0C03830"
                     /locus_tag="NDAI_0C03830"
                     /inference="similar to DNA sequence:INSDC:YKL150W"
                     /note="similar to Saccharomyces cerevisiae MCR1 (YKL150W);
                     ancestral locus Anc_5.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669286.1"
                     /db_xref="GeneID:11496476"
                     /db_xref="GOA:G0W8D2"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G0W8D2"
                     /translation="MGLCCLSSSTPGFIPMVLGALLVGFSIYYFIRRHGLYLQKTNYV
                     LKGDGAWEEVTLYKVQKEAHNVKRFIFKLPEDMTLGLPLCGNILTKFVTEKGYNVVRP
                     YTPISDIHAKGSFELCIKRYPDGKMGTHMHSLKPGDKLSIKGPIKKWPWKPNQFKEIT
                     LLGAGSGTTPLYQLASHVVKNRKDKTKVNVYYGNKTVGDILLKKEWKELEEQHPGQIN
                     VQFFVNEVSGEGKDKFNGHVGFITKDYIKNHAAGPDQKTHIFICGPSGFMKAFSGEKS
                     NSKEQGPLTGILKELGYSADQVFKY"
     gene            complement(<875020..>875817)
                     /gene="NDAI0C03840"
                     /locus_tag="NDAI_0C03840"
                     /db_xref="GeneID:11496477"
     mRNA            complement(<875020..>875817)
                     /gene="NDAI0C03840"
                     /locus_tag="NDAI_0C03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669239.1"
                     /db_xref="GeneID:11496477"
     CDS             complement(875020..875817)
                     /gene="NDAI0C03840"
                     /locus_tag="NDAI_0C03840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669287.1"
                     /db_xref="GeneID:11496477"
                     /db_xref="GOA:G0W8D3"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G0W8D3"
                     /translation="MSLRSRSTSRYIPVAIGAVAVAISAYYLARKRGSLIGPEVVLKG
                     DGQWVDIPLYKIEKESHDVDRLIFKLPKEDAVLGLPLCGAVFAKYVTEKGNNVVRPYT
                     PISDIHAKGFFELCIKKYPGGKMSGRMHSLKPGDTMTFKGPIKKWQWEPNSFEEITLL
                     AAGTGTTPLYQLASHIAKNPKDTTKVNIFYGNKTPGDILLKKEWKELEEKYPDQINVQ
                     CFVDEVRDAEKDNFKGHIGFITKEFIEKMHQALIKTRIFSFVDHQDL"
     gene            <876190..>877227
                     /gene="NDAI0C03850"
                     /locus_tag="NDAI_0C03850"
                     /db_xref="GeneID:11496478"
     mRNA            <876190..>877227
                     /gene="NDAI0C03850"
                     /locus_tag="NDAI_0C03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669240.1"
                     /db_xref="GeneID:11496478"
     CDS             876190..877227
                     /gene="NDAI0C03850"
                     /locus_tag="NDAI_0C03850"
                     /inference="similar to DNA sequence:INSDC:YKL151C"
                     /note="similar to Saccharomyces cerevisiae YKL151C;
                     ancestral locus Anc_5.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669288.1"
                     /db_xref="GeneID:11496478"
                     /db_xref="GOA:G0W8D4"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR017953"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G0W8D4"
                     /translation="MLPKLSHNELIKLISKRCIPPLLPRFYKGQAGGRVCIIGGCEDY
                     TGAPYFSANATALMGCDLTHVICEKDAATVIKSYTPNLMVHPYLRTSKDKHEEEFEKI
                     EMLLKRIHVIVIGPGLGRDKGMLDSIKKIIKLVLEKHEGMIPIVIDADGLFLISQDEE
                     VREMLKKFPMGRIILTPNVVEFKRLSESVGHDPEEKDEEKDISSNEVTGATIAKRLNC
                     IVVQKGREDRIFSPQSDSFVLKNDREGSCKRVGGQGDTLTGTIACMLAFSRSMHDFKL
                     CEDENNGKNKKGHDELKLEWIDFGVLSCYAGCTVTRECSRLAFKEKGRAMQTSDINER
                     VGQVYAKVFPL"
     gene            <877801..>878589
                     /gene="NDAI0C03860"
                     /locus_tag="NDAI_0C03860"
                     /db_xref="GeneID:11496479"
     mRNA            <877801..>878589
                     /gene="NDAI0C03860"
                     /locus_tag="NDAI_0C03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669241.1"
                     /db_xref="GeneID:11496479"
     CDS             877801..878589
                     /gene="NDAI0C03860"
                     /locus_tag="NDAI_0C03860"
                     /inference="similar to DNA sequence:INSDC:YKL152C"
                     /note="similar to Saccharomyces cerevisiae GPM1 (YKL152C);
                     ancestral locus Anc_5.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669289.1"
                     /db_xref="GeneID:11496479"
                     /db_xref="GOA:G0W8D5"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G0W8D5"
                     /translation="MSFLKKPYIKNQLKMPKLVLVRHGQSEWNEKNLFTGWVDVRLSA
                     VGEKEAARAGELLKEHNVHPDVLYTSKLSRAIQTANIALSKSDRLWIPVKRSWRLNER
                     HYGALQGKDKAETLEKYGEEKFTTWRRSFDVPPPPIEDDSEFSQKGDARYHNVDPNVL
                     PQTESLALVIDRLLPYWQDVIAKDLLAGQTVMIAAHGNSLRALVKHLEGISDADIAKL
                     NIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAVAAQGKKK"
     gap             878856..878875
                     /estimated_length=20
     gene            complement(878877..878949)
                     /gene="NDAI0Ctrna5D"
                     /locus_tag="NDAI_0Ctrna5D"
                     /db_xref="GeneID:11496480"
     tRNA            complement(878877..878949)
                     /gene="NDAI0Ctrna5D"
                     /locus_tag="NDAI_0Ctrna5D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11496480"
     gene            complement(<879232..>879993)
                     /gene="NDAI0C03870"
                     /locus_tag="NDAI_0C03870"
                     /db_xref="GeneID:11496762"
     mRNA            complement(<879232..>879993)
                     /gene="NDAI0C03870"
                     /locus_tag="NDAI_0C03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669242.1"
                     /db_xref="GeneID:11496762"
     CDS             complement(879232..879993)
                     /gene="NDAI0C03870"
                     /locus_tag="NDAI_0C03870"
                     /inference="similar to DNA sequence:INSDC:YKL154W"
                     /note="similar to Saccharomyces cerevisiae SRP102
                     (YKL154W); ancestral locus Anc_5.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669290.1"
                     /db_xref="GeneID:11496762"
                     /db_xref="InterPro:IPR019009"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8D6"
                     /translation="MTMLDLNNAILVSLLVIALTTLLLFVSLRKATTSAAGKEGIISN
                     KKPIFVIAGPSNSGKTSLFTLLSNNKQRPTVTSLDVSKLENLDNRINVIEFPGHFKLR
                     YKLIDFLKKNPKIAGVIYVVDSTVDPKELTKTAEFLLDVLLITESKKNMEPNILIACN
                     KSESFSSRPPLRIKEALETEISKIIVRKKKSIGDVNIITQDGTDESNELEMLKELSSS
                     GKFSFNLLEGSVDAISGSVLKKDIVKWQEWIEEQL"
     gene            <880229..>882052
                     /gene="NDAI0C03880"
                     /locus_tag="NDAI_0C03880"
                     /db_xref="GeneID:11496481"
     mRNA            <880229..>882052
                     /gene="NDAI0C03880"
                     /locus_tag="NDAI_0C03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669243.1"
                     /db_xref="GeneID:11496481"
     CDS             880229..882052
                     /gene="NDAI0C03880"
                     /locus_tag="NDAI_0C03880"
                     /inference="similar to DNA sequence:INSDC:YKL155C"
                     /note="similar to Saccharomyces cerevisiae RSM22
                     (YKL155C); ancestral locus Anc_5.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669291.1"
                     /db_xref="GeneID:11496481"
                     /db_xref="GOA:G0W8D7"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="InterPro:IPR016522"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W8D7"
                     /translation="MLNVRQIPFRLIFQRYNSTSSKFLPETVIGQCYRPQIVLNPDVT
                     KAINNNILSLDHPKNLRRVAKNYFVDLHRNNLHKAPLTPLQVDAHIASIFLQNYGAIY
                     QTLMELKKRASTKGEEWVPNRVLDVGFGPATGIIALNDIFQNMEKKPTVKDAVIMGSL
                     DMQRKAKIILSRQIDEIVDPTSLNASEESAEVSERIDILKADNEIMTDTEEVYEEELV
                     GEVMTKKIKIKTNLRDDLPLNKEYDLIILTHQLLHDESKFHTQVDENLTRYLKLLAPG
                     GNIVIIERGNPLGFEITVKARQLMIRPENYPNEHGKIPRPWIRGATLKDKTVPENIDY
                     YLKIIAPSPHHRACPLQTDNPNYYSFPEGKNLKICTFQKSIERPKFSLELKKGRLLSA
                     PWDDVEGINHDRSYKPTPDMKGKGRPYGKNYEIINYSYLIAERSLNDPETLAHIKKLR
                     EEQPFNFQIGSLGDGSPDTWPRIISQPIKRKGHVILDVCGPSGELEKWTIPKSFSKEI
                     YYDARKAMKGDLWGLDAKVKIKGRGRLNVEKFERLEKERIRVSKKETRKHEREVLQTF
                     NKLNNEDIPDNSEATETVQQLSEVYGHYFKHREPNNTKRKY"
     gene            complement(<882487..>883180)
                     /gene="NDAI0C03890"
                     /locus_tag="NDAI_0C03890"
                     /db_xref="GeneID:11496482"
     mRNA            complement(join(<882487..882732,883178..>883180))
                     /gene="NDAI0C03890"
                     /locus_tag="NDAI_0C03890"
                     /product="ribosomal protein S27"
                     /transcript_id="XM_003669244.1"
                     /db_xref="GeneID:11496482"
     CDS             complement(join(882487..882732,883178..883180))
                     /gene="NDAI0C03890"
                     /locus_tag="NDAI_0C03890"
                     /inference="similar to DNA sequence:INSDC:YHR021C,YKL156W"
                     /note="similar to Saccharomyces cerevisiae RPS27B
                     (YHR021C) and RPS27A (YKL156W); ancestral locus Anc_5.265"
                     /codon_start=1
                     /product="ribosomal protein S27"
                     /protein_id="XP_003669292.1"
                     /db_xref="GeneID:11496482"
                     /db_xref="GOA:G0W8D8"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:G0W8D8"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQAPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<883841..>885310)
                     /gene="NDAI0C03900"
                     /locus_tag="NDAI_0C03900"
                     /db_xref="GeneID:11496483"
     mRNA            complement(<883841..>885310)
                     /gene="NDAI0C03900"
                     /locus_tag="NDAI_0C03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669245.1"
                     /db_xref="GeneID:11496483"
     CDS             complement(883841..885310)
                     /gene="NDAI0C03900"
                     /locus_tag="NDAI_0C03900"
                     /inference="similar to DNA sequence:INSDC:YHR030C,YKL161C"
                     /note="similar to Saccharomyces cerevisiae SLT2 (YHR030C)
                     and YKL161C; ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669293.1"
                     /db_xref="GeneID:11496483"
                     /db_xref="GOA:G0W8D9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G0W8D9"
                     /translation="MPNFDSRHSFLVLNQPFIVDKGFEIVKAIGKGSFGLICSAKYTE
                     AVDSTMVAIKQIDSAFQNSRTAKRALRELKLLRHFRNHKNITCLYDTDIVMHPDGVAR
                     LYIYEELVDCDLYQILHSGQSLTDSHYQCFIYQILCGLKFIHSANVLHRDIKPGNLLV
                     NADCQLKICDFGLSRGYSNNMTENEQFVTEYVPTKWYRAPEIMLSYQGYSTAVDVWST
                     GCILAEFLNGKPMFEGDDYVNQLNKILQVLGSPNIETIKKINSKNVQDYILQLGNIPK
                     IPFPVLFPNATKNAIDLLEKMLTFDPAERITVESALAHPYLSVWHDSDDEPVCPQKVD
                     FMFEKVDDLDLLKEMIINEVNDFRRFAREPFAEMEDLLLEDQEDALEMQDDNKSLVLN
                     GDIKTRPQVGSSFSDLSLTGMHDLNVERNSQEPFTTETTARKSSSTTGDSIQPSVTML
                     AEPDTNISFLQSRSSDSSNDNKFSDLEKELQTGLDGKSF"
     gene            complement(<888565..>889191)
                     /gene="NDAI0C03910"
                     /locus_tag="NDAI_0C03910"
                     /db_xref="GeneID:11496484"
     mRNA            complement(<888565..>889191)
                     /gene="NDAI0C03910"
                     /locus_tag="NDAI_0C03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669246.1"
                     /db_xref="GeneID:11496484"
     CDS             complement(888565..889191)
                     /gene="NDAI0C03910"
                     /locus_tag="NDAI_0C03910"
                     /inference="similar to DNA sequence:INSDC:YKL159C"
                     /note="similar to Saccharomyces cerevisiae RCN1 (YKL159C);
                     ancestral locus Anc_5.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669294.1"
                     /db_xref="GeneID:11496484"
                     /db_xref="GOA:G0W8E0"
                     /db_xref="InterPro:IPR006931"
                     /db_xref="UniProtKB/TrEMBL:G0W8E0"
                     /translation="MDSIENNSSVTDTVIVTSDKVNVTDRDIVEVIQKWLTDTVLLEF
                     DVLPDLPIEIVILGSMKRLLIICPNHAISKYIKEMEPKPDNLPLNIGYSLVDGRATAA
                     PKKYLELPPHETLFLVSPPASPPPEFDYSKCEGPPSSLTHPSHDEKQQHTTLREETLK
                     EPGTYTLIDSKSGRITVDTCAQADRPVHMTLEQVRTAFPPKSMFDDED"
     gene            <890187..>892775
                     /gene="NDAI0C03920"
                     /locus_tag="NDAI_0C03920"
                     /db_xref="GeneID:11496485"
     mRNA            <890187..>892775
                     /gene="NDAI0C03920"
                     /locus_tag="NDAI_0C03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669247.1"
                     /db_xref="GeneID:11496485"
     CDS             890187..892775
                     /gene="NDAI0C03920"
                     /locus_tag="NDAI_0C03920"
                     /inference="similar to DNA sequence:INSDC:YHR047C,YKL157W"
                     /note="similar to Saccharomyces cerevisiae AAP1 (YHR047C)
                     and APE2 (YKL157W); ancestral locus Anc_5.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669295.1"
                     /db_xref="GeneID:11496485"
                     /db_xref="GOA:G0W8E1"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G0W8E1"
                     /translation="MSSKIIDREVLPTNVTPLHYDLQIEPNFKDFTFKGIAKIELKIN
                     DKNVDSIQLNALDIEIQSSKLASNIEPSQIVPNKETQVVDFIFPDGTLSKVGESTTLE
                     LNFTGILNDQMAGFYRAKYEDKLTGEIKYMATTQMEPTDARRAFPCFDEPNLKASFGI
                     TLVSDPSLTHLSNMDVKEEHVENGKKFTTFNVTPKMSTYLVAFIVAELKYVECKDFRI
                     PVRVYATPGSEKDGQFAADLTAKTLDFFENTFGIKYPLPKMDNVAVHEFSAGAMENWG
                     LVTYRVVDVLLDEKNSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATW
                     MSWYSCNEFQPTWNVWQQYVTDTLQHALNLDSLRSSHPIEVPVKRAEDINQIFDAISY
                     SKGASLLRMISKWLGEDVFIKGVSQYLSQFKYGNAKTEDLWTALSKASGKDVSSVMNI
                     WTKKVGFPVISVKEENNKITFTQNRYLSTGDVESKEDKTLYPVFLALKSKDGVDNSLV
                     LNERSTSVVLKDADFFKANSDQSGIYITSYSDERWAKFSKQAHLLSVEDRTGLVADAK
                     SLSASGYTSTTNFLNLVANWKDEESFVVLDQIINSISSLKATWAFEPEEVRDSLDAFT
                     RSLVSEKAHTLGWEFNDSDSFATQRTKVALFSASCAARDPVTERSAIEMFEKYVAGDK
                     KAIPALIKPSVFNTAARVGGEENYEKIYQIYKNPSNNDEKIAALRTLGRFKDAKLLER
                     TLGYLLDGTVLNQDIYIPMQGMRAHKEGIVALWGWLQANWTEVSKRLPPGLSMLGSVV
                     TICTSGFTSFKAIDEIKAFFDKISTKGFDQGLAQSLDTIKSKAQWVNRDREMVKQYLK
                     TNGYSK"
     gene            <893392..>894324
                     /gene="NDAI0C03930"
                     /locus_tag="NDAI_0C03930"
                     /db_xref="GeneID:11496486"
     mRNA            <893392..>894324
                     /gene="NDAI0C03930"
                     /locus_tag="NDAI_0C03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669248.1"
                     /db_xref="GeneID:11496486"
     CDS             893392..894324
                     /gene="NDAI0C03930"
                     /locus_tag="NDAI_0C03930"
                     /inference="similar to DNA sequence:INSDC:YKL107W"
                     /note="similar to Saccharomyces cerevisiae YKL107W"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669296.1"
                     /db_xref="GeneID:11496486"
                     /db_xref="GOA:G0W8E2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G0W8E2"
                     /translation="MFFGTKKDNSVKWEHKDISQLDLCKVNAVVFGGTSGIGRAISHQ
                     LADRGANVLVVGRHFKDEDMKKIKFLHADLSLITEADRIANEIPAKDITHMIFTTGIV
                     AAPQREQTPEGIERDMAVSYLSRYMLIRELAGKMGKGLPHNASKPRIFIMGFPGSGQL
                     GDPENLNSDKKKYNALSTHSNTVAANEALVLDSKDRYKNVEVFGLNPGIIKTEIRNNY
                     LGKDSIFSKAVEWVVGWTCQTPEDYAKNICPLLVSPDLDNKSGTMFDNKGNAILQSAG
                     LAPEVVHNFIHNSAVLVTKVLAMKPNETTSKLPV"
     gene            complement(<896084..>898120)
                     /gene="NDAI0C03940"
                     /locus_tag="NDAI_0C03940"
                     /db_xref="GeneID:11496487"
     mRNA            complement(<896084..>898120)
                     /gene="NDAI0C03940"
                     /locus_tag="NDAI_0C03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669249.1"
                     /db_xref="GeneID:11496487"
     CDS             complement(896084..898120)
                     /gene="NDAI0C03940"
                     /locus_tag="NDAI_0C03940"
                     /inference="similar to DNA sequence:INSDC:YHR042W"
                     /note="similar to Saccharomyces cerevisiae NCP1 (YHR042W);
                     ancestral locus Anc_5.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669297.1"
                     /db_xref="GeneID:11496487"
                     /db_xref="GOA:G0W8E3"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G0W8E3"
                     /translation="MNSTDLLTVAVICILFFIYKKWDVIKELIFSNDDHISAVNSGSR
                     DIVQVVLENNKNYLVLFGSQTGTAEDYAKKFSKELSSKFNLNVLCADLELYDYDTLSE
                     LPNNVLVSIFMSTYGEGDFPDGAIPFETFLTTTGENSLTNLNFSIFGLGNSTYEFYNG
                     AARKVLKYLQSAGGNLLGSIGEGDDATGSTDEDYLTWKESIMAELKNKLHLEEQEHKF
                     KSTFKYETLPEINSHVSLGEPTSKYLPSEPAFTGPFTAAQPFIAPIIKSHELFTSVER
                     NCIHSEFDISSSNISYSTGDHLGIWPSNATEKVQQFLNVFNLNPDTIFNLVSQDKTIK
                     VPFPCPTTVGAVIRHYLEITGPVSRQFFEHLIQFAPNSSIKEKLTKLAKDKDAFQQEI
                     TSKYFNLADALLYLSGGSKWESIPWEFLIENIPKLQPRYYSISSSSLSERNTIHVTSV
                     VENTPNPKTGSNIVGVTTNLLRNIQLAQNKQLQSTEINPLPVHYDLNGPRDLFANYKL
                     PVHVRQSTFRLPQNIETPVIMIGPGTGVAPFRGFIRERVAQVEKDNSIKLGKHILFYG
                     CRNEQDYLYQEEWSKYATVLGESFEMNVAFSRVPGTKKVYVQDKLNEMSSDIWDLLKK
                     GAYIYVCGDAGRMAKDVSRTFINILQKGHGINEAEALEMVKALKTAGKYQEDVW"
     gene            complement(<898818..>899750)
                     /gene="NDAI0C03950"
                     /locus_tag="NDAI_0C03950"
                     /db_xref="GeneID:11496488"
     mRNA            complement(<898818..>899750)
                     /gene="NDAI0C03950"
                     /locus_tag="NDAI_0C03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669250.1"
                     /db_xref="GeneID:11496488"
     CDS             complement(898818..899750)
                     /gene="NDAI0C03950"
                     /locus_tag="NDAI_0C03950"
                     /inference="similar to DNA sequence:INSDC:YDR288W"
                     /note="similar to Saccharomyces cerevisiae NSE3 (YDR288W);
                     ancestral locus Anc_5.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669298.1"
                     /db_xref="GeneID:11496488"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="UniProtKB/TrEMBL:G0W8E4"
                     /translation="MSDSEEYIEQSATPTYGQNKTNTVAIMAVRYLLSSAESQNTIIT
                     QSKLKTVLRDIYSQQKISNIPFNKVFAEINNILGDVYGYELKGLPSKIVNNNVTNSNN
                     NSNKNPGNRTKEVEEALGYRATCYILVNKMPYLKNFDEFKLLQSIRTYEDLVVDGQYV
                     GDDVGLENLNTLENKLSVDQDLVFKGLLSVILCIVLFSKNNILHQELLSALEKFGVPT
                     DGTKIPILKWSIDDLMKNLEKKEYLVKLEEKSDIEGSLILYRIGRRTQAEFGLDSLLM
                     LVQEIMNLDGPEAEGLKEDIQKSIGDAYGPAVHV"
     gene            complement(<900121..>900996)
                     /gene="NDAI0C03960"
                     /locus_tag="NDAI_0C03960"
                     /db_xref="GeneID:11496489"
     mRNA            complement(<900121..>900996)
                     /gene="NDAI0C03960"
                     /locus_tag="NDAI_0C03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669251.1"
                     /db_xref="GeneID:11496489"
     CDS             complement(900121..900996)
                     /gene="NDAI0C03960"
                     /locus_tag="NDAI_0C03960"
                     /inference="similar to DNA sequence:INSDC:YDR287W"
                     /note="similar to Saccharomyces cerevisiae YDR287W;
                     ancestral locus Anc_5.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669299.1"
                     /db_xref="GeneID:11496489"
                     /db_xref="GOA:G0W8E5"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G0W8E5"
                     /translation="MVLSKEELKEIELTLVKLVQEEIGPIIKEHTGTKFDTYEDKANQ
                     VDLVTVVDKKVESIIKEALNKKYPTFKFIGEESYVPGQTKISKDPTFIVDPIDGTTNF
                     IHGYPYSCTSLGLAEDGKPVVGVVFNPHLNQLFHASKGNGAYLNSFKINVPKRPLTLQ
                     KSVVGLEGGAERSEGSGNFDKKMATYKNLLSDKGGYIHGFRSVGSAAMNMCYVANGML
                     DSYWEGGCWAWDVCAGWCILEETGGKMVGGNPNEWEIPIDRRCYFAVRGGCTKEEQKD
                     YVESFWPHVAGPLEY"
     gene            <901418..>901783
                     /gene="NDAI0C03970"
                     /locus_tag="NDAI_0C03970"
                     /db_xref="GeneID:11496490"
     mRNA            <901418..>901783
                     /gene="NDAI0C03970"
                     /locus_tag="NDAI_0C03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669252.1"
                     /db_xref="GeneID:11496490"
     CDS             901418..901783
                     /gene="NDAI0C03970"
                     /locus_tag="NDAI_0C03970"
                     /inference="similar to DNA sequence:INSDC:YDR286C"
                     /note="similar to Saccharomyces cerevisiae YDR286C;
                     ancestral locus Anc_5.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669300.1"
                     /db_xref="GeneID:11496490"
                     /db_xref="GOA:G0W8E6"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G0W8E6"
                     /translation="MIRNLQSISSKVSIRPFSRASILYKISDIRLTLYSKPNCGLCEE
                     AKEIIQEDILSQEKFKRYKVKLKIVNIDDLKNKKWWIKYCFDVPVLHIENESKKGQLE
                     RVFHKMDEKEILDKIEKMR"
     gene            complement(<901982..>904702)
                     /gene="NDAI0C03980"
                     /locus_tag="NDAI_0C03980"
                     /db_xref="GeneID:11496491"
     mRNA            complement(<901982..>904702)
                     /gene="NDAI0C03980"
                     /locus_tag="NDAI_0C03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669253.1"
                     /db_xref="GeneID:11496491"
     CDS             complement(901982..904702)
                     /gene="NDAI0C03980"
                     /locus_tag="NDAI_0C03980"
                     /inference="similar to DNA sequence:INSDC:YDR285W"
                     /note="similar to Saccharomyces cerevisiae ZIP1 (YDR285W);
                     ancestral locus Anc_5.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669301.1"
                     /db_xref="GeneID:11496491"
                     /db_xref="UniProtKB/TrEMBL:G0W8E7"
                     /translation="MSNFFRDSSLGFKARSNNIFSKLRGKETDLNDQGVNLSLTGGEG
                     SSSILDDLLLNDKQEDGQSYGTNTTDLTSLMESNGSYTDSNYEFQKNHQKSFKHSINN
                     VRTTSKRIVNEEAGDGQDQIDDTEHDDDEDEDDGDFEITEVRSVSIPPKENKTTSKSK
                     NKNPDNGDIKAKLSSSKSKLNVAQLNKSNTTNTTENATSNDVLLEAFTNTQKICANLK
                     HEVQLQQTENNKLKSQLRNYENDSKKISEKVNQFKRLLSNLEESSKYLKSKKTVNDQQ
                     LSDFKKSHESIQRRIYQYNTDIEELKSSMNKLQVSKKQTDIEIIKKNKEIEYLKREVD
                     DYSGQLSEEKIKNSSLFQEFIELREEFKHLLEIQGKNYMDRNNLLEENLQTMLQTELS
                     SQLLEQYGKYENILVGKLSDANKXVTIHLIRHFYSKFEAMEFFVTNLYFKYSLSTKLN
                     QLWTETTDRSEKAGIETHKEILEQFLEQKVNISQLLNNLQGKICDGNETTQEALSKIV
                     KDIKETIFISNSEPVQLVNDLNKLIQEYQLQLTTSEKYKSDIGELQNQVASLQQQKTE
                     NIRELGTKEAQYDELVKSLEEKTIELSRHVDKNQKLNDTIQELQENVRSYKEQLEKVQ
                     EVSKIEKSNCENKILSQNEITNVLNSKNEMLKKRVEQLEASKASYEKDHNDRLDKFQK
                     NNEQVQRLNVELVQLKAQELELEEDNRKLKRALEEKSFGDEENVNELRVLKEKIISLN
                     CEKQNLVAEKLEIRDKKEEIESLVKSKNQRIIMLETKLKQQLEINEKLKIPTRTNDSP
                     PVSITKGNMRTFNEDNKDENNLRNNKHKEDILSQSISVNHSDEFDLSSSSNDDLELTN
                     PSPIQIKTVKTQTKRSNTSMKPPGHGRKKLLLLEDEEFSKADTRRKKRRH"
     gene            <906344..>907273
                     /gene="NDAI0C03990"
                     /locus_tag="NDAI_0C03990"
                     /db_xref="GeneID:11496492"
     mRNA            <906344..>907273
                     /gene="NDAI0C03990"
                     /locus_tag="NDAI_0C03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669254.1"
                     /db_xref="GeneID:11496492"
     CDS             906344..907273
                     /gene="NDAI0C03990"
                     /locus_tag="NDAI_0C03990"
                     /inference="similar to DNA sequence:INSDC:YDR284C"
                     /note="similar to Saccharomyces cerevisiae DPP1 (YDR284C);
                     ancestral locus Anc_5.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669302.1"
                     /db_xref="GeneID:11496492"
                     /db_xref="GOA:G0W8E8"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G0W8E8"
                     /translation="MAVNRLTLGGNPNSFSNRNPKWRITDVIVLLIFMIISYPVYYQE
                     PFQRQFYLNDLTISHPYALNQRVSDTMLFVYTLVIPLIAIVIMTLILAHPHHRWFLLY
                     ISVLGLFLAWFATSLFTNFIKNWIGRLRPDFLDRCQPKPGLPVDMLFTASEVCTTDNK
                     EILLDGFRTTPSGHSSESFAGLGYLYLWTCGQLLTENKEMGYWRKLVALLPLLGASLI
                     ALSRTQDYRHHFVDVLLGSIFGYVVAYFNYRRNFPPINDPIPFKPILDDSDVTLEEEE
                     QELTTHTTTPAGPEFRRIPLQHTDEEALPLTGN"
     gene            <907842..>912812
                     /gene="NDAI0C04000"
                     /locus_tag="NDAI_0C04000"
                     /db_xref="GeneID:11496493"
     mRNA            <907842..>912812
                     /gene="NDAI0C04000"
                     /locus_tag="NDAI_0C04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669255.1"
                     /db_xref="GeneID:11496493"
     CDS             907842..912812
                     /gene="NDAI0C04000"
                     /locus_tag="NDAI_0C04000"
                     /inference="similar to DNA sequence:INSDC:YDR283C"
                     /note="similar to Saccharomyces cerevisiae GCN2 (YDR283C);
                     ancestral locus Anc_5.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669303.1"
                     /db_xref="GeneID:11496493"
                     /db_xref="GOA:G0W8E9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="UniProtKB/TrEMBL:G0W8E9"
                     /translation="MPKCLTLNEYYDIQSNELEAMRSIYMDDFVDLTKKKSKWDKQPQ
                     IIFEVNVCSTDKEPVESSLTLHFAMTPMYPHTMPEIKFLNVKNVLDYQLKQLSESFKQ
                     IHESAKGQEYIFEVISLVRERLDEFQNEANGHSLEEDRLQRIREAEAKLEKEEKERKQ
                     KIEQEKVSEQKLIDEIVKKEMEKRKDDDDMLFNPTSQIELMPPSEWITSGEAIVFSKP
                     IKAKLPNNLLFKFKAVVNPTPIKLNSDLFNFGKQFLVKPFIHPESPLADALMSSELMG
                     NFYYLLTEIELTNSYFNTSNGKKEISNLEKVLESLLKVKHDNVNRLYGYTVERMGKNN
                     TNFVWKIRLLTEYSSSSFLIGELIQSVGFINLATARVWMIRILEGLEALHKIGIFHRC
                     VCLQTVTMSKDSDFGTTIPKLIHSSYGYGIINMLARYPNRNGPRIELPNSSWIPPECE
                     NNTTNKYNRMTDIWQAGVLFMQIINGVETTIDFGSPQEFLNSTDMDESLYDLLSKMTA
                     TDPKKRLGTLELLPMKFLRTNIDPTFNKFNVSNDESTAVTIPSEESSVGLTMKSRKFS
                     ESSNRRRSFNVGSRFSSINPATKSRYASDFEEIAVLGKGAFGQVVKARNALDSRYYAI
                     KKYRHTEEKLSTILSEVMLLASLNHQYVVRYYAAWLEEDTQNDNAISLSDSDDHEEED
                     ETSDDSESDIFNQSSLLKEKSSLEVDNSNWDFISNSGYPDIVFANSTTGGDSFNELEN
                     GSEEESDDDYEGEVSDSETRSTNKTNTRRSKTPFITAKRKSTLFIQMEYCENRTLYDL
                     IHAENLSKQRDEYWRLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLA
                     KNVHRSADILRMDSQSAVGSSENLTSAIGTALYVATEVLNGKGHYNEKIDMYSLGIIF
                     FEMVYPFSTGMERVNILKDLRLPSVDFPSDFDYTKMKTEKKIIKLLLDHDPTRRPGAR
                     KLLDSGWLPVKHQEEVIKEALKSLADPSSPWQQQVRESLFNQPYSVTNDILYDNSQSQ
                     SNPFSQILRSQMQEEVVKIFRKHGGIENNSPPRIFPKAPIYSTQNVYEVLDKGGTVLQ
                     LQYDLTYPMARYLSKNPNCVAKQFRLQHVYRPPTKSNSSLEPRKFGEIDFDIISGSSS
                     DSPFYDAENIKIIDEVLTIFPVFEKTNTLFVMNHSDILESVFNFSNIDKAQRPLVSRM
                     LSQVGFAKTFKDVKNELKSQLNISSTSLNDLELFDFRVDFDDAKRRLHKLMVDSPYLR
                     NIDDALSHILKVLNFLKPLEVTRNMVISPLSNYNSAFYKGGIMFQAVYDDGMTRNLIA
                     AGGRYDTLISYFARPSSGKSTNTQRAVGFNLAWETIYSIGQNYFKLASRNRLKKRNRF
                     LKDSAIDWKPSRCDVLISSFSKSLLDTVGVSLLNKLWKMGIRADFLRTCYTVDDVVTR
                     AQQDGVEWIILIKQQTYSMSSHKRKYKPLKVKRVSSNGDIDLDIDEFLMLYQQETSSS
                     TLINDSLSIDDKHDDSGNWDENSSASGSQDEKEETSNTTTNQKVTYIPNMATRAKKAS
                     KREKWVYEDAARNASNIIIGSLSSAPVFTVDALRDETLEIISITSLAQKEEWLRKVFG
                     SGNNSTPRSFATNIYNNLSKEAGKGTKWAILHCHKTGKSCVIDLQR"
     gene            complement(<912963..>914075)
                     /gene="NDAI0C04010"
                     /locus_tag="NDAI_0C04010"
                     /db_xref="GeneID:11496494"
     mRNA            complement(<912963..>914075)
                     /gene="NDAI0C04010"
                     /locus_tag="NDAI_0C04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669256.1"
                     /db_xref="GeneID:11496494"
     CDS             complement(912963..914075)
                     /gene="NDAI0C04010"
                     /locus_tag="NDAI_0C04010"
                     /inference="similar to DNA sequence:INSDC:YDR289C"
                     /note="similar to Saccharomyces cerevisiae RTT103
                     (YDR289C); ancestral locus Anc_5.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669304.1"
                     /db_xref="GeneID:11496494"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:G0W8F0"
                     /translation="MSFSTQQFVNKLNNLEDTQESISSAAKWLVSQYREASEVANCWK
                     GYMLKSSINTRRKLLALYLANHVVQQAKSQQITQFQESFGKVSAEAIGSIYSTFPSDL
                     KKKVKRVTNIWKERRIFSPDILKEIDRALEQGSSSTDNVALPPHVKAIADNYIQLDNN
                     KHHIQAVKARFDKSVQELDPSSMVYEENYKTVSKIGQLTKDTITKSLKLREENISKLE
                     KMLEGERKGLEQEKMLLSEVEFSLLSKNPETMRKGTDEEDVLPSYEVDENDNDDNDSE
                     DIEASSDNDDKIKEKEESKETDNVKRTINDSSSELNDESSHDNHKRAKIGENNTSESN
                     SEDVTSQTGTPESGNDIAANAGMTSSIQDLLSRLAN"
     gene            <914384..>917575
                     /gene="NDAI0C04020"
                     /locus_tag="NDAI_0C04020"
                     /db_xref="GeneID:11496495"
     mRNA            <914384..>917575
                     /gene="NDAI0C04020"
                     /locus_tag="NDAI_0C04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669257.1"
                     /db_xref="GeneID:11496495"
     CDS             914384..917575
                     /gene="NDAI0C04020"
                     /locus_tag="NDAI_0C04020"
                     /inference="similar to DNA sequence:INSDC:YDR291W"
                     /note="similar to Saccharomyces cerevisiae YDR291W;
                     ancestral locus Anc_5.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669305.1"
                     /db_xref="GeneID:11496495"
                     /db_xref="GOA:G0W8F1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8F1"
                     /translation="MEPANKKIKLEDKDNNAIDEYKNIRSLFFRLNTIYTFLICRKHV
                     IPTFKTLTEPISAALKRPVTELDLAKIAVLMPRGCVFRYIDENQIHTETKVFDWNNGG
                     YQQKENDIFQLKEVADQFSDSKSTQVLIFEFIDGNMKRSWTSGDPNSQVKLPTYSTEE
                     MKKMISKREDFFRINLDAFIDKALKEGFDPYKHLTALAEKVLPKEKSYEDPIEQMMKI
                     KAEQNNENVLDEETGLTRPSIDNMIKKLMKLDWYTDQIKEHYTIPERSAAYGELDFEL
                     SPNIYSILEHERFYSHQAHAINAIHAGQNVIITTSTSSGKSLIYQLSAIDILLKDPEA
                     TCMYIFPTKALAQDQKRAFEDLISKIPELREMRVDTYDGDTEQHERSVIRKNARVIFT
                     NPDMIHASILPNHTNWRHFLYNLKIVVVDELHVYRGLFGSNVALVMRRLLRLSKCFYE
                     NKSIRFISCSATLREPIQHMKNMFGIEDVKLVHEDGSPRGTKHLVVWNPPVLSQHERK
                     RENFIRESAKNLVELILRNIRTIAFCFVRRVCELLMKEVRNILSDMGREDLLVDVMSY
                     RGGYSASDRRKIEREMFHGNLKAVISTNALELGIDIGGLDAVLMCGFPLSMANFHQQS
                     GRAGRRNQDSLTLVVASDSPVDQHYVAHPDILLHGDDPESYQDLVLDFDNLLVLEGHV
                     QCAAFELPIDIERDKVFFKEEHLIKICQERLQYNKEGYHANNRFLPWPPKEVSLRGVE
                     EDKYAVIDITNGRNIVIEEIEASRTSFTLYDGGIFIHQGYPYLVKEFDTDERYALVQR
                     VDVDWVTNQRDFTDVDPQLIEMVRSLDDSDVPVYYGKIRTTIIVFGFFKIDKYKRIID
                     AVETNNQPIVFYSKGLWIDIPAKALEICEAKQLNAPGAIHAAQHAIMGLFPRFIVSGV
                     DEIQTECKAPEKEFAERQTKRIRPARLIFYDSKGGEYGSGLSTKAFEHVDDILEATLE
                     RIDECTCEDGCPDCVAATYCKERSMVLSKPGAQVLLRCILGKDDSMYIDKIKDGPEPN
                     LPDIKVQTIAPVREHVKFSKELKIIDSRNVDTN"
     gene            complement(<917726..>919561)
                     /gene="NDAI0C04030"
                     /locus_tag="NDAI_0C04030"
                     /db_xref="GeneID:11496496"
     mRNA            complement(<917726..>919561)
                     /gene="NDAI0C04030"
                     /locus_tag="NDAI_0C04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669258.1"
                     /db_xref="GeneID:11496496"
     CDS             complement(917726..919561)
                     /gene="NDAI0C04030"
                     /locus_tag="NDAI_0C04030"
                     /inference="similar to DNA sequence:INSDC:YDR292C"
                     /note="similar to Saccharomyces cerevisiae SRP101
                     (YDR292C); ancestral locus Anc_5.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669306.1"
                     /db_xref="GeneID:11496496"
                     /db_xref="GOA:G0W8F2"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR015284"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8F2"
                     /translation="MFEQLAIFTLQGIILYQYNCQGKKFSEHQINAFISKLITAPATR
                     DTTTAGGKFTILNVTNDSTLSTTNAYSRSFCSMFYKTKQPEIYFVITYAEQTIELDKE
                     AEKTLDLATKLWNSLEINKSIQENLNSRDHIDILDGVNDGISKFDQYFKAKYEESIKS
                     VAFTPVDEVPGKEASPKTINPKKKNQAKNRTLNNGGGRKWGRNGIMEETTALDSSVLD
                     FSESSNNVSGNERTIDPAFNKEAFGNRTIKGEFLIKEIDDLLSSATDGDSSNETENEQ
                     TYLGSLTSFLRRNFTGNKTISASDLKSVLDKLKQKLITKNVAPEAATFLVEQVSKDLV
                     GTKTANWTSVEITARKSLTKALTQILTPGVSVDLLHEIQKKTSVKDSEGKKQPYVFSI
                     VGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFRSGAVEQLRVHVENLAQLMDESHV
                     RGSKNRRGKSGNDYVELFEAGYGGSDLVTKIAKQAIKYAHDQDFDIVLMDTAGRRHND
                     PTLMSPLKSFAEQAQPDKIIMVGEALVGTDSVQQAKNFNNAFGKVRNLDFFIISKCDT
                     VGEMLGTMVNMVYATGIPILFVGVGQTYTDLRTLSIKWAVNTLMA"
     gene            complement(<919998..>921176)
                     /gene="NDAI0C04040"
                     /locus_tag="NDAI_0C04040"
                     /db_xref="GeneID:11496497"
     mRNA            complement(<919998..>921176)
                     /gene="NDAI0C04040"
                     /locus_tag="NDAI_0C04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669259.1"
                     /db_xref="GeneID:11496497"
     CDS             complement(919998..921176)
                     /gene="NDAI0C04040"
                     /locus_tag="NDAI_0C04040"
                     /inference="similar to DNA sequence:INSDC:YHR040W"
                     /note="similar to Saccharomyces cerevisiae BCD1 (YHR040W);
                     ancestral locus Anc_5.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669307.1"
                     /db_xref="GeneID:11496497"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:G0W8F3"
                     /translation="MSSKCEICHEIEFKYKCPKCLKKTCSLKCSQAHKKDDNCSGIAH
                     DPTVYIPHDTLKEADDENHESNVLVQRDFNYLTNLKRVVELQKVDGKTKNKRTLQSFN
                     NNNTNKRARFNNGPVSESNRVVRRGVNCLLLPRGMQRSVQNRSKWDKPLDVFVWSIEW
                     IICSVGKNDQSKEDTSNNLSKEKSVVKYVSHRFKETDSIVGGMSNIVFEKCCNEFGIP
                     TPEKGSNTPDVDKAAIIKENNWKFYIKWFPYNNTMVMDSKNLIQIDASEKCIGEILRD
                     KTVIEYPTIFISQTEANLPNDFTVIEEPKYEERTRTFGSESTVSSSNENRKHITKKLN
                     IQVNDADDNEPPEEEAIRIGHKNTENDVAKEKKSIIAPVSDEDSDDYEPGLNIDFLAS
                     "
     gene            complement(<921707..>925489)
                     /gene="NDAI0C04050"
                     /locus_tag="NDAI_0C04050"
                     /db_xref="GeneID:11496498"
     mRNA            complement(<921707..>925489)
                     /gene="NDAI0C04050"
                     /locus_tag="NDAI_0C04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669260.1"
                     /db_xref="GeneID:11496498"
     CDS             complement(921707..925489)
                     /gene="NDAI0C04050"
                     /locus_tag="NDAI_0C04050"
                     /inference="similar to DNA sequence:INSDC:YDR293C"
                     /note="similar to Saccharomyces cerevisiae SSD1 (YDR293C);
                     ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669308.1"
                     /db_xref="GeneID:11496498"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:G0W8F4"
                     /translation="MSKNSNNNNYQENVYVKTTGGGKNVPKQIHVAHRRSQSELTNLM
                     IEQLTLQKQLEAVQAQQQQLLAQQQQLAQQTGQFIATNNNTNNNNKNQGFIPPSHYNT
                     PNMSAGNRSRSHSRDNSGYYQNSYDNNNNPNNLGVNTHRKTGSQSSVYGHSRRHSLVL
                     NEAKRAAAEEQAKRGGSSSFNGNEFNPKSKDESASPEELPIEQSSFKFPPAPVQLQQQ
                     QQQQQQGSGQSHRRSNSNLSPPTFKFPPTPTSYNNNNQDDDFTPTSSTHRRSKTRNNE
                     FSSPGINSNWRNQSQTQSQIQQQQQQSPFRHRQTNSRDYNSSNNLEPPAFFQGHHPRG
                     SNASVQSFSSNSGGNQNQSTRKSLFAPYLPQANIPGLIQEGKLVAGILRVNKKNRSDA
                     WVSTDGALDADIYICGSKDRNRALEGDLVAVELLVVDDVWDSKKEKEEKKRRKDASLQ
                     QDIIPLNGNDDYHNDASANALSSNFLASNFNSSSTSNEDNILSTPNRSRGMDNDKSPT
                     KSSLKRKGSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDKYKPLYAGHVVAVLDRIPG
                     QLFSGTLGLLRPSQQNHSDDKPPKAPKIAWFKPTDKKVPLIAIPTELAPKDFVENADK
                     YSDKLFVASIKRWPITSLHPFGILVSELGEINDPNTEIDSILRDNNFLSNEYLDNKDP
                     TKEKAMFQALPIPENELAVRTDFTDPSEYSILAIAENDSLSEFALHVKNNNDGTFELG
                     CHVVDATAHIEENSSLDRRARKRSSGVFMPQKVVNLLPKALNESLSLKKDKKSATLSV
                     IYTLNAETLEIRSTTVCESIILPSRFMTAKEIDDNLASDDVDPYLSIVEKIATSFYAT
                     RIEYPEAKLMPTLSLFESIDDEKVNVDLNILDRTLGYVVINEIQHKVNSTIAEKIYTK
                     LGDSSFLRREAQPVITKMSLFKNKIQKFGLDIDITSIATIIQSILKIEDSDVRVGVEI
                     LLFKTMSRAKYFVAGKVDPDQYSHYSLNLPIYTHFTSPLRRYADHVVHRQLRSAIRGV
                     PYTEDIDALKITSEYCNFKKDCAYQSQEQAIHLLLCKTINDMGNATGQLLTMATVLQV
                     YESSFDVFIPEFGVEKRVHGDQLPLLKAEFDGVSRVLELHWQPGVDSATFVPADEKNP
                     KSYRNSIKNKFRSTTAEIAAMEINSNSEDFISDSLSKELSNLNLDVPRLRLPENEKAT
                     DPLDKFISSTITRREGDNCIQEIHELQKIPILLRAEIGMALPCLSVRALNPFIRRE"
     gene            complement(<926575..>928452)
                     /gene="NDAI0C04060"
                     /locus_tag="NDAI_0C04060"
                     /db_xref="GeneID:11496499"
     mRNA            complement(<926575..>928452)
                     /gene="NDAI0C04060"
                     /locus_tag="NDAI_0C04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669261.1"
                     /db_xref="GeneID:11496499"
     CDS             complement(926575..928452)
                     /gene="NDAI0C04060"
                     /locus_tag="NDAI_0C04060"
                     /inference="similar to DNA sequence:INSDC:YDR294C"
                     /note="similar to Saccharomyces cerevisiae DPL1 (YDR294C);
                     ancestral locus Anc_5.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669309.1"
                     /db_xref="GeneID:11496499"
                     /db_xref="GOA:G0W8F5"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G0W8F5"
                     /translation="MDVQLDNSAFIGTSATTTAAAATGTSRQLLNLQWLQGKVIDPII
                     ESCPPLYLMSKNPATIDLKVLAYCLIDCIQRYVKRTPWYSLVKDYLFIMFLLKILSTI
                     WFHVRVYGVIGSLRRTYKSNCKFLFKKLLNSPFLKSKVDKQVLKVTSSIEESLIKNDS
                     TISQFPQLPSLGLTQDSVISQLDLLNEVLTHTEWEQGKVSGAVYHGGSDLIHLQSVAF
                     EKYCVANQLHPDVFPAVRKMEAEVVSMILKLFHGPEETSCGTTTSGGTESLLLACLSA
                     KMYGYEHKGITEPEMIIPKTAHAGFDKAAYYFGIKLHHVELDPVTFKVDLKKVEKFIN
                     KNTVLLVGSVPNFPHGIADDIEGLGKLALLNNIPLHVDCCLGSFIVAFMEKAGFNEDG
                     QLPLSDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNEDLRMHQYYINSEWTGGLYGSP
                     TLAGSRPGALVVGCWATMINIGENGYIESCRSIVTATRKLKRYIDEKLPDLEILGDPK
                     FSVLSFSSKVIDIYELSDRLTKKGWHLNSLQNPPALHLAVTRLTVNSIDSLCQLLSEE
                     VNTMKLEVNSKPSPDGTSSLYGVAGSVQTAGVADRLIVAFLNALYKLKPDNDTHNDFE
                     K"
     gene            complement(<928988..>931270)
                     /gene="NDAI0C04070"
                     /locus_tag="NDAI_0C04070"
                     /db_xref="GeneID:11496500"
     mRNA            complement(<928988..>931270)
                     /gene="NDAI0C04070"
                     /locus_tag="NDAI_0C04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669262.1"
                     /db_xref="GeneID:11496500"
     CDS             complement(928988..931270)
                     /gene="NDAI0C04070"
                     /locus_tag="NDAI_0C04070"
                     /inference="similar to DNA sequence:INSDC:YDR295C"
                     /note="similar to Saccharomyces cerevisiae HDA2 (YDR295C);
                     ancestral locus Anc_5.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669310.1"
                     /db_xref="GeneID:11496500"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="UniProtKB/TrEMBL:G0W8F6"
                     /translation="MNKQSPTKLDTKIFYLPVGLTTFQRDLIEILISLHSESFKLELD
                     KISSSSSSAATKPQILKSNTSNAFSTRQMTYLLNSNIKAVINHPSLLVDHYMPRQYLR
                     MEPNESLISTSDKFQKLQNLLFILQNYPNLQILLTSHNIKELDIVEGLLLGQNFKLKR
                     FSGTSLYDEEHIYPIEEEPENLQLQQKQTQKQEYDSSTTRSKSTTTTNGKKLKKNNVN
                     KLSKNTRNNSRENSMTPYSSASSSSSTTSSSSIVNPIASSINPATFGILKNSGHHNNH
                     HPTPSSSTSTSTYARDDYDYSMKRNSRKRKLEHEHGNVTRDKNWIFLTTTTHLKNDPS
                     LLSNYKINLIISFDPMLDPHLSAIQNIRSPQRYLLHEQNHFIPIIKLLVNDSPDHYIL
                     SQTNPQEEGQEEHYNNDDLQYSNMIKSLDHFLKTRSSSSSSSSSSSSNTTAQQNAPIK
                     TFVQNIFNNESNSPETIPKLSHLPIGTEQEYLTPHLSYLAHTRTPNATNPNGNEHNVT
                     MTISQYQTALMQMALKRYHDLQNEHSVNERLLYDERINESERQNKIDSIKFDIGRTFK
                     LLKDKNEKEEIESDKRKNKVIFDFLKTKDQFEALKAKELELVSTQDVGGKLQELERDR
                     TFKNIKLNELQMENEKKNQLNDELRSQYQLKSTLAADMGHSLEKLKDDLKNVQKREKD
                     PISLKVDLELLSDRERILKMELDSWKRKTIFLKSLVESLNNKYPVDLTTKKNTKKSTR
                     ESSNNGRYRSTRSNTPNYTR"
     gene            <931757..>932458
                     /gene="NDAI0C04080"
                     /locus_tag="NDAI_0C04080"
                     /db_xref="GeneID:11496501"
     mRNA            <931757..>932458
                     /gene="NDAI0C04080"
                     /locus_tag="NDAI_0C04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669263.1"
                     /db_xref="GeneID:11496501"
     CDS             931757..932458
                     /gene="NDAI0C04080"
                     /locus_tag="NDAI_0C04080"
                     /inference="similar to DNA sequence:INSDC:YDR296W"
                     /note="similar to Saccharomyces cerevisiae MHR1 (YDR296W);
                     ancestral locus Anc_5.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669311.1"
                     /db_xref="GeneID:11496501"
                     /db_xref="InterPro:IPR024629"
                     /db_xref="UniProtKB/TrEMBL:G0W8F7"
                     /translation="MNKLKVSTASSRFRPATWLKKSGYAPHVYLFRNLEQGQVLYSQL
                     PQVTNHMIEKTFKKKVDSWMYKKPSTRRDLWKCMCVVNMKDYDDGVLLFQNLQRLRFL
                     RDFAQLDKANEFRKKDSNGHVWYSGKFRPTFAQEAVADLRESLIKMQKHDKIEQEKDT
                     NEIDIYWEDPWRMGDLDKYWTPVLSNVNHKLINNSGNTAREESVILKEISTQTLNELS
                     ISSSSSSKVPFSPVL"
     gene            complement(<932653..>933348)
                     /gene="NDAI0C04090"
                     /locus_tag="NDAI_0C04090"
                     /db_xref="GeneID:11496502"
     mRNA            complement(<932653..>933348)
                     /gene="NDAI0C04090"
                     /locus_tag="NDAI_0C04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669264.1"
                     /db_xref="GeneID:11496502"
     CDS             complement(932653..933348)
                     /gene="NDAI0C04090"
                     /locus_tag="NDAI_0C04090"
                     /inference="similar to DNA sequence:INSDC:YDR298C"
                     /note="similar to Saccharomyces cerevisiae ATP5 (YDR298C);
                     ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669312.1"
                     /db_xref="GeneID:11496502"
                     /db_xref="GOA:G0W8F8"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:G0W8F8"
                     /translation="MMMMMMSMNRRLLTSKSATTLLARSLWTTPIKYQQQSKTFVPPI
                     QLFGLEGTYATALFKAAYMDSTIDSTASSLNSIQNLIHKDSSLKSILENPALSPDDRV
                     SIVNSLLKGINGKSNKDVDNFLKVLADNNRLNLLSVICEQYNKLNDAQQGIVQGNIIS
                     SKQLDDKVMKRLHNGILQSKSIVKEGQVLKLNNLVRPDILGGLIVEIDDKTVDLSLST
                     KIQNLNKILNETI"
     gene            <933968..>935650
                     /gene="NDAI0C04100"
                     /locus_tag="NDAI_0C04100"
                     /db_xref="GeneID:11496503"
     mRNA            <933968..>935650
                     /gene="NDAI0C04100"
                     /locus_tag="NDAI_0C04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669265.1"
                     /db_xref="GeneID:11496503"
     CDS             933968..935650
                     /gene="NDAI0C04100"
                     /locus_tag="NDAI_0C04100"
                     /inference="similar to DNA sequence:INSDC:YDR299W"
                     /note="similar to Saccharomyces cerevisiae BFR2 (YDR299W);
                     ancestral locus Anc_5.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669313.1"
                     /db_xref="GeneID:11496503"
                     /db_xref="GOA:G0W8F9"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="UniProtKB/TrEMBL:G0W8F9"
                     /translation="MTKKQVLLADKIASKINRPKIQDFDIEDEEHFTTSKSKDVFQHK
                     SDDGSSNSDSDIDNEGEDELEKAHYLEVGKSKLRADTLELNDTKYHGAVGSRKDLFNN
                     EEPSRDELSEQDDEENSSDALSFKTDSEDEIMDVNDNGNDSESSNNEEEEEREDNDEE
                     LQRLRLAKLIKQETKQSMNKLSQSIQRDASKGYSITKQNKLFDNIIDLRIKLQKAVTN
                     ANKLPITKESWEQYEQDNNKSNSLLTENSNLLTKVLSQLIDFRKDIQKFDNINQNNGE
                     EHEEMKATDKKRTFKSLTNETNQLDSNLQKYRKVVLHKWSKKIDATSGNSALSSNKFK
                     SINQPTDIQVENQLSDLTRLRKRTLLNRRNVIPLGFQSDLKANRLQYFNEMTNQEGNN
                     DKEEEDENLDIPKNYDPRRKDNNAIDTTENPYIFDDEDFYRVLLNDMVDKKIANVQNN
                     NGSANNNSANVAVTLTSRSNNKLKKNIDTKASKGRKLNYSIQESIANYETPINNGNYK
                     WNDDQIDEFFAGLLGQRINFNEDDEEEEENNNDEEQQEDVEAIKNDDIQIFG"
     gene            complement(<935792..>936862)
                     /gene="NDAI0C04110"
                     /locus_tag="NDAI_0C04110"
                     /db_xref="GeneID:11496504"
     mRNA            complement(<935792..>936862)
                     /gene="NDAI0C04110"
                     /locus_tag="NDAI_0C04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669266.1"
                     /db_xref="GeneID:11496504"
     CDS             complement(935792..936862)
                     /gene="NDAI0C04110"
                     /locus_tag="NDAI_0C04110"
                     /inference="similar to DNA sequence:INSDC:YDR279W"
                     /note="similar to Saccharomyces cerevisiae RNH202
                     (YDR279W); ancestral locus Anc_5.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669314.1"
                     /db_xref="GeneID:11496504"
                     /db_xref="GOA:G0W8G0"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:G0W8G0"
                     /translation="MTVEKLEPKHIVILPKSITQLNDAETEKDIEIFTLPHPTNNPTK
                     SRIPIIQNITTNETFQLISHSFSKGSKYTHQFDLANGKYHYTNDDSPIKSTFLIDEND
                     RSQGYIMESSYFQFSTKYDITYNLIGFLYRKTEVVENENDYVKALPSNDNENNMESIT
                     SDRFLTLRDFHDTLVDSHDKNWSKISLNVLENALNKICDCIQEAGDTYYKINPVKITE
                     FLVRKVEKINDNFPKSIPIPYDYREDIKESMKTVLSCNLLISLIPKRVYDDLIQFHPD
                     ENSTVQLSIKDAHASYIKYKEERRVTSREKEILLKSVTTVGLNNGTTTKGKIVKKKTT
                     IVKKKVAKGKGAIDGFFKAKKK"
     gene            complement(<937489..>938775)
                     /gene="NDAI0C04120"
                     /locus_tag="NDAI_0C04120"
                     /db_xref="GeneID:11494695"
     mRNA            complement(<937489..>938775)
                     /gene="NDAI0C04120"
                     /locus_tag="NDAI_0C04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669267.1"
                     /db_xref="GeneID:11494695"
     CDS             complement(937489..938775)
                     /gene="NDAI0C04120"
                     /locus_tag="NDAI_0C04120"
                     /inference="similar to DNA sequence:INSDC:YDR300C,YHR033W"
                     /note="similar to Saccharomyces cerevisiae PRO1 (YDR300C)
                     and YHR033W; ancestral locus Anc_5.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669315.1"
                     /db_xref="GeneID:11494695"
                     /db_xref="GOA:G0W8G1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:G0W8G1"
                     /translation="MTMNKTYTLVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRL
                     GHKVIIVSSGGIAVGLKTLNLDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFNQRIA
                     QILITRNDIVDWTQYKNAQNTINELLKMGVVPIVNENDTLSISEIKFGXNDTLSAITS
                     ALVGADYLFLLTDVDCLYTDNPRTNPDAKPILVVPDLTKGLPGVTTTNGAGSDVGTGG
                     METKLIAADLATNAGVHTIIMKSDVPANILKIVEYMQTLDLDGDSRKLKFGTTNIDLA
                     ALQEKELTKLNSLNVPLHTKFIANDNLHHLKNREFWILHGLVTRGSIIIDQGAYNALT
                     RKNKAGLLPVGIIDIEGTFHELECVDLKLGKKLENGELDPSVPLVTVGRARCNYTSIE
                     LSKIKGLQSDQIEDVLGYADSEYAAHRENLAFPPHT"
     gene            <939878..>944044
                     /gene="NDAI0C04130"
                     /locus_tag="NDAI_0C04130"
                     /db_xref="GeneID:11494696"
     mRNA            <939878..>944044
                     /gene="NDAI0C04130"
                     /locus_tag="NDAI_0C04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669268.1"
                     /db_xref="GeneID:11494696"
     CDS             939878..944044
                     /gene="NDAI0C04130"
                     /locus_tag="NDAI_0C04130"
                     /inference="similar to DNA sequence:INSDC:YDR301W"
                     /note="similar to Saccharomyces cerevisiae CFT1 (YDR301W);
                     ancestral locus Anc_5.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669316.1"
                     /db_xref="GeneID:11494696"
                     /db_xref="GOA:G0W8G2"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:G0W8G2"
                     /translation="MNVYDDVLDPTVVSHSITGHFTTRAELELLVIRTNILSIYHLET
                     ILSPRSNTSSSQLETIEDATVTTSKQAKLFLINEFKLNGKVQDIASIPLGNSSSLECI
                     LLSTGTAKLSILNFDPSINSFETLSLHYYEEKFKDISLVSLAKKSQLRMDPLNRCLLM
                     FNNDVMALLPLHSNNEDEEEEEEDENEEDEVLDNYEANLSKTSPNKRIKYNNNQFEGK
                     SKIFNINKLHEDVKNISDIQFLNNFNKPTIAVLYQPTLTWAGNVQLNPLPTHFMIFTL
                     DILSENSTNNANHTTENNNNDLNLIIIAKLKELAWDWFKIIPISNGCVVIGNNEIAYI
                     DNTGVLQSIILLNSFADKNLKKTRIIDESKFQIFFNENVTHVWSPSTSKNKTTEDDET
                     LLLMDAQSNLYYVRLEAEGRLLTKFDIINLPIVNDVLRENCNPTCISRLDSNATNSTM
                     DLFIGFLSGDSLVVRLNNLKSAIDTRDEHSESNEHTQLNGFDEEDEDNLYSDDEVDVE
                     DARSKRDMETIIHTVQPFDIEYLTSLKNIGPITSLTVGKVSSLDLNVKGLQNPNKNEF
                     SIVTTSGNSTGSHLNVIQQTVQPIVEKALKFISVTQIWNLKIKNKDKYLVTTDSTKSK
                     SDIYDIDNNFSLHKEGRLRRDATTVYIAMFGDGKRVVQITTNHLYLFDTNFRRLTAIK
                     FDFEVVHVSVMDPYILITVSRGDIKIYELDATHKRKLFRVDLPDILKEMVITSGVILK
                     SNMCNEFLNPSDDSDEEHLLFTFVTADNQIIFFTRQHNDRIFQLNGVDQLKESLFVST
                     YQLPDEVIPDPSIKQVMINKIGQNNKEEYLTILTFGGEIYQYKKSSSRHSRFFKSITR
                     SGLAITGAPNNAYAKGVSSIERVMHYISDYNGYSVIFITGSVPYMLIREDDSVPRIFQ
                     FANLSIVSMARWGKNSIMCVDNLKNARIYGLDHANIYYGNKLSIRKIKISDSLEDYMT
                     LTKITYHEKTQMFLVSYAKETEYDALGEDDERIVGYDEDVPHAKSFQSGVLLINPLTW
                     NVIDSKTFGKNTLVNDMRSMLIQVNSKARRKREYIIAGVTHIGTEDLPPTGAFHIYDI
                     TEVVPEPGKPDTNYRLKEVFKEEVRGIVSTVCEISGRFLVNQSQKVMVRDAQEDNSVV
                     PVAFLDIPVFINDAKSFGDFLILGDAMQGLHFIGFDAEPYRMINLGKSVTKFETVSVE
                     FVVNGGDLYFALTDRNNILHVLKYAPDELNSLSGQKLVHCSSFNLFSGNSSLLLLPKN
                     EEFEDTKNAPLTFQTIGGQVDGSIFKVIPLREDTYRRLYVIQQHMNDKEPQLGGLNPR
                     MERLSNEYYQLCHVMRPMLDFNIIRRFSELPIDRRTRVAKRAGQRAHYEIWRDMINVE
                     FSLRSLRAND"
     gene            <948364..>948978
                     /gene="NDAI0C04140"
                     /locus_tag="NDAI_0C04140"
                     /db_xref="GeneID:11494697"
     mRNA            <948364..>948978
                     /gene="NDAI0C04140"
                     /locus_tag="NDAI_0C04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669269.1"
                     /db_xref="GeneID:11494697"
     CDS             948364..948978
                     /gene="NDAI0C04140"
                     /locus_tag="NDAI_0C04140"
                     /inference="similar to DNA sequence:INSDC:YOR279C"
                     /note="similar to Saccharomyces cerevisiae RFM1 (YOR279C);
                     ancestral locus Anc_8.738"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669317.1"
                     /db_xref="GeneID:11494697"
                     /db_xref="UniProtKB/TrEMBL:G0W8G3"
                     /translation="MLSADVDKVLSLELPSSTELDWSPLALLEEKKRDLNMKIKELLS
                     TIHERQFQSFDDYFLMHYHKYELTANTEPCVDETSVVEEDEHKNPMMIDTSDLQKNRV
                     TAGLSMDSIIPDMVQRRSAKSIVKDNEEISGKIRKLKHIPSLPSVVVPKIRKPYRISD
                     TLLPGNAKSKLEHDTTLLYPINNPVSLEEVFSNDKIKLLLSKFP"
     gene            complement(<949316..>950659)
                     /gene="NDAI0C04150"
                     /locus_tag="NDAI_0C04150"
                     /db_xref="GeneID:11494698"
     mRNA            complement(<949316..>950659)
                     /gene="NDAI0C04150"
                     /locus_tag="NDAI_0C04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669270.1"
                     /db_xref="GeneID:11494698"
     CDS             complement(949316..950659)
                     /gene="NDAI0C04150"
                     /locus_tag="NDAI_0C04150"
                     /inference="similar to DNA sequence:INSDC:YMR220W"
                     /note="similar to Saccharomyces cerevisiae ERG8 (YMR220W);
                     ancestral locus Anc_8.737"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669318.1"
                     /db_xref="GeneID:11494698"
                     /db_xref="GOA:G0W8G4"
                     /db_xref="InterPro:IPR005916"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR016005"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G0W8G4"
                     /translation="MDTNARVFSAPGKALLVGGYLVLDPRYKSYVVALSARMHAMVST
                     ARPMDQNKTSITVCSPQFNNEKWTYNLLQGQLSVDGTNKSKNLFIECGIRNALDYFDI
                     QNSMGFDINIDIFSDPAYHSSQGSIMKQNGMKRFNFFNSSISEVPKTGLGSSAGLVTV
                     LTTALFSVFDPNLDLTIDITLRKIHNLSQVSHCQAQGKIGSGFDVAAATFGSIAYQRF
                     EPNLISDLPERNLSAKDYNVSLQHLINDTDWKFTVEPVKLPDQLRLFLGDVNSGSETV
                     KLVTKVKNWYNLNLPKSQEIYKEINAGNMAFIASLNEMNQLSLTNPEKYKVLINNLNK
                     SNKYEDPIVLQMRESIAKIRDNFRLITRESGAEIEPPVQTELLDTCMNLNGVLVACIP
                     GAGGYDAIALLTTEMTNLDSQTKGKEEFSNVTWLDLQQVDIGLKEEEVVAYLNLQ"
     gene            complement(951833..951904)
                     /gene="NDAI0Ctrna3E"
                     /locus_tag="NDAI_0Ctrna3E"
                     /db_xref="GeneID:11494699"
     tRNA            complement(951833..951904)
                     /gene="NDAI0Ctrna3E"
                     /locus_tag="NDAI_0Ctrna3E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11494699"
     gene            <952186..>952830
                     /gene="NDAI0C04160"
                     /locus_tag="NDAI_0C04160"
                     /db_xref="GeneID:11496751"
     mRNA            <952186..>952830
                     /gene="NDAI0C04160"
                     /locus_tag="NDAI_0C04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669271.1"
                     /db_xref="GeneID:11496751"
     CDS             952186..952830
                     /gene="NDAI0C04160"
                     /locus_tag="NDAI_0C04160"
                     /inference="similar to DNA sequence:INSDC:YDR302W"
                     /note="similar to Saccharomyces cerevisiae GPI11
                     (YDR302W); ancestral locus Anc_5.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669319.1"
                     /db_xref="GeneID:11496751"
                     /db_xref="GOA:G0W8G5"
                     /db_xref="InterPro:IPR009580"
                     /db_xref="UniProtKB/TrEMBL:G0W8G5"
                     /translation="MSGKAKKQVKKRVTFSDDNTIVRQSHRKKNIGHEHPPVYVRKSL
                     LTIPFHLIVLLYLYIYHSDYSTELLLLGLIPSQVFYLVLQFNKCTVYGNKIIKINYPL
                     VFISLGGALLLSVPTLIIIILFGAPFLEHIKESWLLASHCCFLAYPAMYSVFNCDFKV
                     GMWKRYYVMIVLGGWLSCVVIPLDWDRPWQAWPIPVVIGSYLGAFVGYTLGSYI"
     gene            complement(<953071..>955548)
                     /gene="NDAI0C04170"
                     /locus_tag="NDAI_0C04170"
                     /db_xref="GeneID:11494700"
     mRNA            complement(<953071..>955548)
                     /gene="NDAI0C04170"
                     /locus_tag="NDAI_0C04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669272.1"
                     /db_xref="GeneID:11494700"
     CDS             complement(953071..955548)
                     /gene="NDAI0C04170"
                     /locus_tag="NDAI_0C04170"
                     /inference="similar to DNA sequence:INSDC:YDR303C,YHR056C"
                     /note="similar to Saccharomyces cerevisiae RSC3 (YDR303C)
                     and RSC30 (YHR056C); ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669320.1"
                     /db_xref="GeneID:11494700"
                     /db_xref="GOA:G0W8G6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G0W8G6"
                     /translation="MDIRGRKMRKPPACVQCRKRKIGCDRVKPICGNCSKTNKGDCFF
                     PDVPGRYVPAHAKGPAKLLTPPQGGSSSRGDSLSSTLHHNPELASLEQLREYNTRLQL
                     LNGSQDQTDSPMSTNFTQFLPRSIPNMDNKTVSSINDNSANLNWIQGPALFDEMPTPY
                     TQEEVVMKEIDFLKSRLLELQDITGKKIPGLNLSWKDLSRKQNNNGTIDSIGNEKKRK
                     LETEDNLHFDILYNTIDEFRDLDPQFLDFNQIFNVFDLNDSQFKSSIPMRDLPNSIFT
                     SNFLISRDTFLKGFHNTFENIVTSKFEKNHQKWLENLENSPILQLTKHDEIKFPELSL
                     IKHLITKYTSIVLESEALIPNLKPNELLQALDTLFVSNSFNPDSLSIEKLVTYGRLSI
                     LLLLTYNSLVSTVIVPLQPTELENVKALKDSLNDLKKNLYLIKIELQMRNTSKNYEDV
                     IKFEALLKYYQTVTSIEMQTVGTSVDYDEDVHLSQHISLNHEQTNESLILFWNFIYRE
                     YCYRHLFKGEIPLLTQGQRSNSAPILDPILTVDYPLLNITSEIVRYLQTKDQLISLEK
                     VLHLKDIFKLKYDEAQKKAGTLPTLIDGIVNSLLYRNTTLYLTYYLLLQYEKLKDSGR
                     YFETYKEFLNFSQETLFFIFSNLANLRFAGYEFIYTNKAFVLVESLSEMLLSLIQRSF
                     YAFDTNSEAIPLNESLRTETKNHSAALSLIVRKILMLLQDYSKNCREVNPYINRLFIR
                     LTSMLEYISLLEATQNPENSGSGNESVKSIKAGLLGEVNAFEQLEQSDIARATARLQA
                     ISESLIKAVLLFYKTTIQSKQCSKLSV"
     gene            complement(<956606..>957292)
                     /gene="NDAI0C04180"
                     /locus_tag="NDAI_0C04180"
                     /db_xref="GeneID:11494701"
     mRNA            complement(<956606..>957292)
                     /gene="NDAI0C04180"
                     /locus_tag="NDAI_0C04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669273.1"
                     /db_xref="GeneID:11494701"
     CDS             complement(956606..957292)
                     /gene="NDAI0C04180"
                     /locus_tag="NDAI_0C04180"
                     /inference="similar to DNA sequence:INSDC:YDR304C,YHR057C"
                     /note="similar to Saccharomyces cerevisiae CPR5 (YDR304C)
                     and CPR2 (YHR057C); ancestral locus Anc_5.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669321.1"
                     /db_xref="GeneID:11494701"
                     /db_xref="GOA:G0W8G7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G0W8G7"
                     /translation="MAFMFNVLLLPLVVTFLTFIPTVEAKKRVITHKVYFDINHGEDH
                     IGRIEFGLFGVVVPKTVENFYELTISEDPKMGYVDSIFHRVIPDLMIQGGDFTNRDGT
                     GGESIFGSTFEDENFEITHDEAGLLSMANRGEDTNGSQFFITLSPTPWLNNKHVVFGK
                     VINGMEVVEYIARVDRDMKTNKPLKDVTIVECGELETVPLKQDDAKELHSVLEEEAAK
                     EQQRQKHDEL"
     gene            complement(<957715..>958395)
                     /gene="NDAI0C04190"
                     /locus_tag="NDAI_0C04190"
                     /db_xref="GeneID:11494702"
     mRNA            complement(join(<957715..958221,958324..>958395))
                     /gene="NDAI0C04190"
                     /locus_tag="NDAI_0C04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669274.1"
                     /db_xref="GeneID:11494702"
     CDS             complement(join(957715..958221,958324..958395))
                     /gene="NDAI0C04190"
                     /locus_tag="NDAI_0C04190"
                     /inference="similar to DNA sequence:INSDC:YDR305C"
                     /note="similar to Saccharomyces cerevisiae HNT2 (YDR305C);
                     ancestral locus Anc_5.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669322.1"
                     /db_xref="GeneID:11494702"
                     /db_xref="GOA:G0W8G8"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:G0W8G8"
                     /translation="MLLREMTAKPIYFSKFLVTGQVFYKSKYSYALVNLRPIVPGHVL
                     VVPLRTTAYELNDLTLEESQDYFRTVQLIHGFIKWHYKADSLNISIQDGPEAGQSVPH
                     LHTHIIPRYRLNNCGDLIYEKIDDWTFDEIWEKKRMEYLGLGGRNQRKQAMKPDDQRV
                     NQTKQAMFEESKELRLAFETYLEENPKWKAWL"
     gene            complement(<959059..>960636)
                     /gene="NDAI0C04200"
                     /locus_tag="NDAI_0C04200"
                     /db_xref="GeneID:11494703"
     mRNA            complement(<959059..>960636)
                     /gene="NDAI0C04200"
                     /locus_tag="NDAI_0C04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669275.1"
                     /db_xref="GeneID:11494703"
     CDS             complement(959059..960636)
                     /gene="NDAI0C04200"
                     /locus_tag="NDAI_0C04200"
                     /inference="similar to DNA sequence:INSDC:YDR306C"
                     /note="similar to Saccharomyces cerevisiae YDR306C;
                     ancestral locus Anc_5.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669323.1"
                     /db_xref="GeneID:11494703"
                     /db_xref="UniProtKB/TrEMBL:G0W8G9"
                     /translation="MANKTRPKKIKAPYRKYVGGQGYVTQTQQSSPSLSSNFIETTLA
                     KTDITTNQELSQTADDSIQEDPKSQDHQHIVDFIKEKNKNKSDIIETPQGLYYYDEDT
                     DTIIHIKNSDDITLPNSKLDRSERAKHFKLMMKNNKKYSKHIHHNSHNHQQDNSSTIA
                     LTNDANEIIKKEQVPVLKMKLPWEIQKLVLFYSETIDPNFLLVCQTWYFLSMPLLYHS
                     PQLTSRNFNKFVDTIISNKKKKLGESIIELDLSTILQSGKNSFVSKLLRRSSINLQKF
                     IAPQTSFGYAPLVSLKSCHQLKYLDLGLVSETVKLQELLSAIKNFTKLTHLSFPRSSI
                     DCEGFREFVWPQNLEYLKLSGGITNEFVSETKWPKTIKFLEFSYCPQVDEHSIYTVLS
                     QIGDNLTHLYIHYPMPALRENSLDYVFRYCSNLIVIQLMVDYVSKWAFSEYMLTKLTP
                     KQRPLKTIYLQSSGSLGLGAKIHPDDFTIALWEKRLPCLKNISVSSKLGWNTESDGVE
                     DLVSAIEEQDGSLYISY"
     gene            complement(961401..961473)
                     /gene="NDAI0Ctrna3V"
                     /locus_tag="NDAI_0Ctrna3V"
                     /db_xref="GeneID:11494704"
     tRNA            complement(961401..961473)
                     /gene="NDAI0Ctrna3V"
                     /locus_tag="NDAI_0Ctrna3V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:11494704"
     gene            <961952..>964123
                     /gene="NDAI0C04210"
                     /locus_tag="NDAI_0C04210"
                     /db_xref="GeneID:11496756"
     mRNA            <961952..>964123
                     /gene="NDAI0C04210"
                     /locus_tag="NDAI_0C04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669276.1"
                     /db_xref="GeneID:11496756"
     CDS             961952..964123
                     /gene="NDAI0C04210"
                     /locus_tag="NDAI_0C04210"
                     /inference="similar to DNA sequence:INSDC:YDR307W"
                     /note="similar to Saccharomyces cerevisiae YDR307W;
                     ancestral locus Anc_5.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669324.1"
                     /db_xref="GeneID:11496756"
                     /db_xref="GOA:G0W8H0"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G0W8H0"
                     /translation="MEGPFRKFIPSNLYRNYGIGKLNTLDYIISLLIPLICYLINYQL
                     LFQERSYNLLTPNEKDLYQAITYYKEKKFFLNEHPLLGIQLYSLLSNNIKHMTWLSSM
                     SGLISLSFVYLTQRKMSNSTLISTLGALSISILPVYQSELSMISLNTIQWFFLSITLF
                     SMTNMLSSKQLSKNWYYHLLALSVSLGCNMSTKLIGIMTWFFIFFVICKHSWQLITDI
                     RISTYEIMKYIIITSLSLIIIPVSIFLGSYFIFLNNSQTDSVQFSSMMSPFFQSYLRE
                     PTWQPTELLNGTVIQIRHSNMQANPSASLFSFSSSITLGEYLTTRNNSNYPEGSNEQI
                     VSLTNDESNPETHWILEFIDNPLRTLPSSLSGLLSNETNHENEWPLEDLQKIRIRNKL
                     TGKLLRSSSAKAPVSEQEYNSEISCTGDSSYLGDSDETWQVDYFGMKLSKNIRKKKRR
                     DGFEGALIIPPRISLLKLDNVGQGCTLLGHDTKLPEWGQFNQEVICIRSPNLERTLFQ
                     FIPVEKYNSPSSSNDNKQFELVSFLDIVKNSDKKNIIHYYLRLVSELLEKQYKYNYFV
                     RLEKVKDMNTYDEDADNNHLAPEKWAFHTFSHDESDNFGLLGNIIWLSSIVGIITFII
                     NVDFQIMKWNPWKKVAHTPSINKLIYYQFGIECLFGWFIHFYIFTKSPHQILNIELYF
                     PSFLFGYLLFTETISRLYNWSVMKSSIIMVLYYGGFYYLLK"
     gene            complement(<964194..>964802)
                     /gene="NDAI0C04220"
                     /locus_tag="NDAI_0C04220"
                     /db_xref="GeneID:11494705"
     mRNA            complement(<964194..>964802)
                     /gene="NDAI0C04220"
                     /locus_tag="NDAI_0C04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669277.1"
                     /db_xref="GeneID:11494705"
     CDS             complement(964194..964802)
                     /gene="NDAI0C04220"
                     /locus_tag="NDAI_0C04220"
                     /inference="similar to DNA sequence:INSDC:YDR308C"
                     /note="similar to Saccharomyces cerevisiae SRB7 (YDR308C);
                     ancestral locus Anc_5.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669325.1"
                     /db_xref="GeneID:11494705"
                     /db_xref="InterPro:IPR021384"
                     /db_xref="UniProtKB/TrEMBL:G0W8H1"
                     /translation="MTDRLTQLQICLDQLVEQFCATLNYIDKNHGFEPLNTSEPLMSD
                     KHATVAPPDEFSNTIDELSTDIILKTRQTMKLIDSLPGVDVSAEEQLHKIDSLQKKLV
                     QVEEAKIQAIKEKENLLTQVDGLIDYFVTGIASTRHNNVGEVADSMTTPATTTTGTAN
                     TEMNTEVNTTDISINNATLPTNQNNVENTIQRLNTTEINVEK"
     gene            <965070..>966062
                     /gene="NDAI0C04230"
                     /locus_tag="NDAI_0C04230"
                     /db_xref="GeneID:11494706"
     mRNA            <965070..>966062
                     /gene="NDAI0C04230"
                     /locus_tag="NDAI_0C04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669278.1"
                     /db_xref="GeneID:11494706"
     CDS             965070..966062
                     /gene="NDAI0C04230"
                     /locus_tag="NDAI_0C04230"
                     /inference="similar to DNA sequence:INSDC:YDR313C"
                     /note="similar to Saccharomyces cerevisiae PIB1 (YDR313C);
                     ancestral locus Anc_5.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669326.1"
                     /db_xref="GeneID:11494706"
                     /db_xref="GOA:G0W8H2"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:G0W8H2"
                     /translation="MTEQESITSTQQEREPEPSQEVLNVPTQLTALPCDSSTIDELSP
                     YVNEVAIWQPDEKFNRCFNCSRKFTFLLRRHHCRCCGNIYCESCCSNFVDFDKSKVKL
                     LRRFEEPPYRICDLCFKDLMKLAYITRGSGESDDSMSENSENNDSDSQQSHQMSTVNS
                     HLVAVPSAGEETFCPVCNLILSQFQNEELAAAHVEDCIRNAELAHKASSSSSSPSRAK
                     SRNRPKMLVYKVSATSGKNHILDTDHTIPDNNKVGNRNEAERTEGNLQECPICFEDIE
                     IGEKVARLECLCVFHYHCIKSWIKKKEHQLKESPQPNGTAEINRNFCPFHDAIL"
     gene            complement(<966340..>967737)
                     /gene="NDAI0C04240"
                     /locus_tag="NDAI_0C04240"
                     /db_xref="GeneID:11494707"
     mRNA            complement(<966340..>967737)
                     /gene="NDAI0C04240"
                     /locus_tag="NDAI_0C04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669279.1"
                     /db_xref="GeneID:11494707"
     CDS             complement(966340..967737)
                     /gene="NDAI0C04240"
                     /locus_tag="NDAI_0C04240"
                     /inference="similar to DNA sequence:INSDC:YDR312W,YHR066W"
                     /note="similar to Saccharomyces cerevisiae SSF2 (YDR312W)
                     and SSF1 (YHR066W); ancestral locus Anc_5.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669327.1"
                     /db_xref="GeneID:11494707"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G0W8H3"
                     /translation="MAKRRTKKRTHVQQTEEDLKGIPKSMVIRVGQTSLSNHSLNQLV
                     KDFRQIMQPHTAIKLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKIARTP
                     QGPTITFQVTDYSLGRDIKKYLRRPKSLNKEDVLDPPLLVLNGFNTIKKKDDESNAAK
                     ENAEKVVVSMFQNIFPPLNPARTQLNTIKRVFMINKDQETGEITMRHYFIDIKDVDIS
                     KNLNRLYKSKHNLSKSVPNLHRKEDISSLILDHDLNAYTSESEVDDDAIVRVVDKKDI
                     RGKNINMVQKKQSSPENNDEDGDINMDGNAIEENHDEEESIVKKVVVEDDTPVVPRKK
                     AIRLTELGPRLTLKLVKIEEGICSGKVLHHEFVEKSSAEVRILEKRHAAKMKLKEERK
                     KEQEANIAKKKAVKEAKKQRKLERRKARELEQENEDGENKQSVESSDESDSDSSDHYS
                     DVPEDLDSDLYSDVE"
     gene            <968216..>969730
                     /gene="NDAI0C04250"
                     /locus_tag="NDAI_0C04250"
                     /db_xref="GeneID:11494708"
     mRNA            <968216..>969730
                     /gene="NDAI0C04250"
                     /locus_tag="NDAI_0C04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669280.1"
                     /db_xref="GeneID:11494708"
     CDS             968216..969730
                     /gene="NDAI0C04250"
                     /locus_tag="NDAI_0C04250"
                     /inference="similar to DNA sequence:INSDC:YHR065C"
                     /note="similar to Saccharomyces cerevisiae RRP3 (YHR065C);
                     ancestral locus Anc_5.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669328.1"
                     /db_xref="GeneID:11494708"
                     /db_xref="GOA:G0W8H4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8H4"
                     /translation="MSGKVDKKVQKKSSNNELTSLAAKIKIRALENQKKLKEQSEQES
                     SKESEDEEQDENAKTNKRSHKSKQEEEDEDENSTSYETFETFSELNLVPELIQACKNL
                     NYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNSLWHDQQPYYACILAP
                     TRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHVIIATPGRLMDHLE
                     NTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKL
                     QRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEYIGKSTIIFTRTK
                     ANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVAARGLDIPS
                     VDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKE
                     TVDKEMILTLRDSVDKADGEVIMELNRRNKEKVARGRGGRRGRMQSRQNMDRGD"
     gene            complement(<970167..>971063)
                     /gene="NDAI0C04260"
                     /locus_tag="NDAI_0C04260"
                     /db_xref="GeneID:11494709"
     mRNA            complement(<970167..>971063)
                     /gene="NDAI0C04260"
                     /locus_tag="NDAI_0C04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669281.1"
                     /db_xref="GeneID:11494709"
     CDS             complement(970167..971063)
                     /gene="NDAI0C04260"
                     /locus_tag="NDAI_0C04260"
                     /inference="similar to DNA sequence:INSDC:YDR309C,YHR061C"
                     /note="similar to Saccharomyces cerevisiae GIC2 (YDR309C)
                     and GIC1 (YHR061C); ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669329.1"
                     /db_xref="GeneID:11494709"
                     /db_xref="UniProtKB/TrEMBL:G0W8H5"
                     /translation="MHQPTKININHSRMNSIWIDEDQEAEKIYTFQTHRFSESDDEDE
                     ALGVALLNSDQPVLGSKRNISLPPLLSFSSTDDSLSFDSSDNSLFDSPIKKSPAKRFI
                     SLFNIKQPVVAPKKMHITTPFGFQHISHGSFKPTSPDETGLTSNTKYNGQSTPTTPTP
                     SYPLNCAFRTESIPDTSYNSDHTSIQSRSRSITPIQLNSSKKCVRYKSCKRQKPLQMP
                     ISARNVPNLNEASNTRPVILPPARNPTRLLKSKLKENTNSYEDISPDFLKEYDFPSLL
                     ENYTEADNLDDDPFYLTPKTPK"
     gap             971082..971101
                     /estimated_length=20
     gene            complement(<972383..>975667)
                     /gene="NDAI0C04270"
                     /locus_tag="NDAI_0C04270"
                     /db_xref="GeneID:11494710"
     mRNA            complement(<972383..>975667)
                     /gene="NDAI0C04270"
                     /locus_tag="NDAI_0C04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669282.1"
                     /db_xref="GeneID:11494710"
     CDS             complement(972383..975667)
                     /gene="NDAI0C04270"
                     /locus_tag="NDAI_0C04270"
                     /inference="similar to DNA sequence:INSDC:YDR310C"
                     /note="similar to Saccharomyces cerevisiae SUM1 (YDR310C);
                     ancestral locus Anc_5.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669330.1"
                     /db_xref="GeneID:11494710"
                     /db_xref="GOA:G0W8H6"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:G0W8H6"
                     /translation="MENFTVQNGFNSSSGMTDNNNNIDNNKETTTYHIQDQIATNETS
                     NNCNETTNQAAENISIDSTNINNNTNELQPNSDAFSDNTDPKKEENQQENENPDSFKD
                     EVNEISQKYKEIESLLLSKDKSWTTSIDELVKTLKTVSHNQSVLENKLEDAMKNQMNT
                     DLLVNSINERLNTLSMSLKKNLIPSHTGALTINSAPHGTTSSSSTSRRGPGRPRKDAR
                     SQGSLLANNSIHLPTGSVKTSKSKRYFIDPGTNELASVPSSAHSNNNNTTTTAANASQ
                     TKPKKRRGRPPKQRTVETVIINDPVNGPHDQEEGDETVDSSMLDNTTIQSPVKKNKED
                     NNKGNKSTIATTTTDKSTLINGVHTDEEEEDVDYDESSVDEGNRTKRDRGNDEYTEGE
                     EEEDEEEDEDDDDAQKSLKGLTSQNVAHAAAVHSEISRQQKELDKRRDDREKMLVNLK
                     YNDRNSAKNFMDSNKQLLQAMKEEERRRRMTSIASDPNRPKNSRQSPNNYPNSNSTSM
                     VINTNQNNMTNTSSSPNQVHLNDSQNNLPPNISVQHLSSQLQSLNDANVLLDDNAFSN
                     FAHANNQHNSLASVSSSSSHPNPAGTVELNNTQIDAALAEFTKTTNFDHTKNQLATFE
                     SLANDVMQHQEDNKLPVHQLQSLSAPTTSGMIANESNTKDGLAQQHEQTMENKKRSRT
                     LDETRDDDLNDEGQTNEEEDSEYLANSHSHMDFNDSSLPLRKKKRTYAPTVVASTVND
                     KEAQTALLVASPIELVCKDGFFYRRNMPQTPITTGTYLEFKFKHKEDELLKNGAAAGY
                     RNDPLRKKYERNNAHFLKADIETETEFAFYILSKTTLTEKYVNSLEYFLMEFRWENKL
                     IGLGLKLRESKRTWQRRKALFALFEFWRDQSVEKRGFPNYSMLHAVKEMENYRIFINR
                     SVSWFYNHITLLKMILYDLCDNTDTQWREWMFPKGKVLPTLESEGVTPDNLNEAIDDV
                     LGFDFLDDGTWNKEVKSSKVILPTSFDKSDSRDPSITNEPLGGLPSVPAQNIAQQVPE
                     EQQKQQQQQQQQQQQQQQQQQHQQQEQKQHQMLESPHDNEETQVSSNDPTQGLVQVSI
                     TEEPTN"
     gap             976057..976076
                     /estimated_length=20
     gene            complement(<976492..>977448)
                     /gene="NDAI0C04280"
                     /locus_tag="NDAI_0C04280"
                     /db_xref="GeneID:11494711"
     mRNA            complement(<976492..>977448)
                     /gene="NDAI0C04280"
                     /locus_tag="NDAI_0C04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669283.1"
                     /db_xref="GeneID:11494711"
     CDS             complement(976492..977448)
                     /gene="NDAI0C04280"
                     /locus_tag="NDAI_0C04280"
                     /inference="similar to DNA sequence:INSDC:YDR315C"
                     /note="similar to Saccharomyces cerevisiae IPK1 (YDR315C);
                     ancestral locus Anc_5.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669331.1"
                     /db_xref="GeneID:11494711"
                     /db_xref="GOA:G0W8H7"
                     /db_xref="InterPro:IPR009286"
                     /db_xref="UniProtKB/TrEMBL:G0W8H7"
                     /translation="MEIIGKGNANILIRFPNENDDKNDEYLYRFCIRPFQSLESYNSY
                     TMTNHEFIKRELVPLLGEEYVCSLELVSLPICDDLKRILGPYCKSFITKNMIPASDSI
                     MGLKVLNLKPSRLSMDILQEDHQLKVYVDATGDKIVLEVKPKWLYNPDTLGFCRNCVH
                     NSFKKRENIKYCMASMVKARTHHQVNIMDLFHENTVKCLPEIFIDDLNNYFQNDDNVL
                     KRLYYLQRNLSDKTVSIEKINSDDDVTTGLMILMILRDVTVFISWDKQDGDTDGNHIS
                     SHIIDLDLKPRSKWKHWQETERLLSKQSNNNNNNNCILHSNV"
     gene            <978634..>980028
                     /gene="NDAI0C04290"
                     /locus_tag="NDAI_0C04290"
                     /db_xref="GeneID:11494712"
     mRNA            <978634..>980028
                     /gene="NDAI0C04290"
                     /locus_tag="NDAI_0C04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669284.1"
                     /db_xref="GeneID:11494712"
     CDS             978634..980028
                     /gene="NDAI0C04290"
                     /locus_tag="NDAI_0C04290"
                     /inference="similar to DNA sequence:INSDC:YDR316W"
                     /note="similar to Saccharomyces cerevisiae OMS1 (YDR316W);
                     ancestral locus Anc_5.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669332.1"
                     /db_xref="GeneID:11494712"
                     /db_xref="GOA:G0W8H8"
                     /db_xref="InterPro:IPR027034"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G0W8H8"
                     /translation="MRSFSSSITKLHYLNGINSQRSSLIISSRIPYLSQNRCRYKSTL
                     SSRYDASINRRNNTKKPTTKEEIAREKYEEMLKSPYRIVRWGAFVRSDSFSKKLTKYL
                     IVLYIIFLVNGVQYMKKMYSKEKELERLIKKRDEEGGCNEFELLRIKELNGKLRTRDV
                     LKLKEYRRLQEEENVSNLDGIVLDNNDENKLNEMILPARDTTEFYEHKAEEYDKSISF
                     EERMIGMGKRRKWLMKHCHGDVLEVSSGTGRNIKYINPEKISSITFLDSSEKMMEITV
                     EKFKKRFPWYKKVAFVVGKAENLLNLAGQKMIDDDIKKVNDIQPEQPDVKVKYDTIIE
                     TFGLCSHEDPVKALNNFSKLLKPGGRVILLEHGRGEYDFINKILDKRSEKRLKTWGCR
                     WNLDLGEILDDSELEIVEEKRSHLGTTWCIVAKHKGDSKKKEEIGFLEKYFSSAVKNK
                     IEAASTSVPVNDKN"
     gene            <981107..>981829
                     /gene="NDAI0C04300"
                     /locus_tag="NDAI_0C04300"
                     /db_xref="GeneID:11494713"
     mRNA            <981107..>981829
                     /gene="NDAI0C04300"
                     /locus_tag="NDAI_0C04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669285.1"
                     /db_xref="GeneID:11494713"
     CDS             981107..981829
                     /gene="NDAI0C04300"
                     /locus_tag="NDAI_0C04300"
                     /inference="similar to DNA sequence:INSDC:YHR071W"
                     /note="similar to Saccharomyces cerevisiae PCL5 (YHR071W);
                     ancestral locus Anc_5.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669333.1"
                     /db_xref="GeneID:11494713"
                     /db_xref="GOA:G0W8H9"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G0W8H9"
                     /translation="MQQVTPKYSVTSYSKLIFPTPRSCKSTQTKTSSNNIHSQQTSTP
                     PSSPTSYSSKLDQKTLESIPLTLFTNKIASFLSETAKKYSTTRINNDVQSLKSFINEI
                     TKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEFAFCAKRSFLTCIIIAHKYLNDS
                     TFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDDLQFGSWQRKCLFQLPQTANLL
                     NKKRSAEVCVADDIVSMKRLHC"
     gene            complement(<982580..>983359)
                     /gene="NDAI0C04310"
                     /locus_tag="NDAI_0C04310"
                     /db_xref="GeneID:11494714"
     mRNA            complement(<982580..>983359)
                     /gene="NDAI0C04310"
                     /locus_tag="NDAI_0C04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669286.1"
                     /db_xref="GeneID:11494714"
     CDS             complement(982580..983359)
                     /gene="NDAI0C04310"
                     /locus_tag="NDAI_0C04310"
                     /inference="similar to DNA sequence:INSDC:YDR319C"
                     /note="similar to Saccharomyces cerevisiae YDR319C;
                     ancestral locus Anc_5.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669334.1"
                     /db_xref="GeneID:11494714"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:G0W8I0"
                     /translation="MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVL
                     NSKNIFNQVMAYNGNKVWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLI
                     KQYVIKFVLKNVLLAFLFLIIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDIS
                     GHFCFLINISLILWSELSLLNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFV
                     TAVYYHTLLEKILGCILGFVCPIVMYYFIPNNVKLKQTLYK"
     gene            complement(<983914..>986034)
                     /gene="NDAI0C04320"
                     /locus_tag="NDAI_0C04320"
                     /db_xref="GeneID:11494715"
     mRNA            complement(<983914..>986034)
                     /gene="NDAI0C04320"
                     /locus_tag="NDAI_0C04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669287.1"
                     /db_xref="GeneID:11494715"
     CDS             complement(983914..986034)
                     /gene="NDAI0C04320"
                     /locus_tag="NDAI_0C04320"
                     /inference="similar to DNA sequence:INSDC:YDR320C"
                     /note="similar to Saccharomyces cerevisiae SWA2 (YDR320C);
                     ancestral locus Anc_5.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669335.1"
                     /db_xref="GeneID:11494715"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015228"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G0W8I1"
                     /translation="MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQF
                     NLNKASTPSLDTFALAPLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPP
                     APKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLG
                     LSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYAN
                     KRFNESQNNTGNLFSMATDILYKGKELVDQLTAYPEENNRLYKYREPIDNEENPFLQE
                     GSRSPASARSPSLSGSHVASASAKPSSKPSYVERNSLKYEDNNTTLIDDFDYKLTINS
                     KEPSMAKNIPPSITPDTTETNNNNALLDFDGLSTVTAPGSSNISVNKKNTSSSSATSP
                     SPSPASITIATVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPL
                     RIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIW
                     SKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSK
                     SPTPTPVSILKHKEKDTTTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKD
                     TDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENK
                     MIAENVFSILSLAWDKFKLDNNMN"
     gene            complement(<986358..>986576)
                     /gene="NDAI0C04330"
                     /locus_tag="NDAI_0C04330"
                     /db_xref="GeneID:11494716"
     mRNA            complement(<986358..>986576)
                     /gene="NDAI0C04330"
                     /locus_tag="NDAI_0C04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669288.1"
                     /db_xref="GeneID:11494716"
     CDS             complement(986358..986576)
                     /gene="NDAI0C04330"
                     /locus_tag="NDAI_0C04330"
                     /inference="similar to DNA sequence:INSDC:YDR320C-A"
                     /note="similar to Saccharomyces cerevisiae DAD4
                     (YDR320C-A); ancestral locus Anc_5.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669336.1"
                     /db_xref="GeneID:11494716"
                     /db_xref="GOA:G0W8I2"
                     /db_xref="InterPro:IPR013959"
                     /db_xref="UniProtKB/TrEMBL:G0W8I2"
                     /translation="MENPYEQVQSNILSRIIRNVERLNQSVNTLNQELEIINKKHKNL
                     EIMGQISENYHNGMQFNLEATGNKKPPI"
     gene            <987226..>988404
                     /gene="NDAI0C04340"
                     /locus_tag="NDAI_0C04340"
                     /db_xref="GeneID:11494717"
     mRNA            <987226..>988404
                     /gene="NDAI0C04340"
                     /locus_tag="NDAI_0C04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669289.1"
                     /db_xref="GeneID:11494717"
     CDS             987226..988404
                     /gene="NDAI0C04340"
                     /locus_tag="NDAI_0C04340"
                     /inference="similar to DNA sequence:INSDC:YDR321W"
                     /note="similar to Saccharomyces cerevisiae ASP1 (YDR321W);
                     ancestral locus Anc_5.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669337.1"
                     /db_xref="GeneID:11494717"
                     /db_xref="GOA:G0W8I3"
                     /db_xref="InterPro:IPR004550"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR020827"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="InterPro:IPR027475"
                     /db_xref="UniProtKB/TrEMBL:G0W8I3"
                     /translation="MPNGSVEIHTICEDVENSQFTVQSKNTNNMTIPEFDSELETLSS
                     APILPNLVKPTKRIRLPRIKIVGTGGTIASKGSDSSQTAGYHVDLTIQDMLDSIPDIS
                     QICEIEYEQLCNVDSKDMTEHLLLKIYKAVSEALQGFDGIVITHGTDTLSETAFFIES
                     TIDAGDVPIVFVGSMRPSTSVSADGPMNLYQAICIASNPKSRGRSVLVSLNDQISAGY
                     YITKTNANSLDSFNVRQGYLGNFVNNEIHYYYPPVKPQGCHKFKLKLNDLSSGSFKLP
                     MVCIIYGHQAITPKILTLLAEEYEGIVFATMGAGSLPVSMNEMCLTLNKPIIYSKRSM
                     DGMIPVANLPKDSNGSNGNIIASGYLNPEKSRILLQLCLAGNYGVEEIRHVFGGVYGG
                     "
     gene            complement(<988524..>989477)
                     /gene="NDAI0C04350"
                     /locus_tag="NDAI_0C04350"
                     /db_xref="GeneID:11494718"
     mRNA            complement(<988524..>989477)
                     /gene="NDAI0C04350"
                     /locus_tag="NDAI_0C04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669290.1"
                     /db_xref="GeneID:11494718"
     CDS             complement(988524..989477)
                     /gene="NDAI0C04350"
                     /locus_tag="NDAI_0C04350"
                     /note="ancestral locus Anc_5.358a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669338.1"
                     /db_xref="GeneID:11494718"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G0W8I4"
                     /translation="MSHVLKRSISSNAINNLKRRPSLPTIHRTLSQTSNFSTGSTIAV
                     TPSYQVQNESFNEFMYFLSGEDYYNKVNSLWDNLPKETKDVFIARVLIKKENNHRKEL
                     NYNDIKELFQGQGTPTKGSFLHYRKKIGPYIRQEAPGLKEQTISKIIGQLYNNELTGV
                     DREILKREAEEIYEREMKQRLEVARDYIDDSTKMFDKDPYIEEIRHWKEKKELANKVK
                     ELNSLMERLESYSQSGNATPMNATTSKEMCQKEGDIVKTTTKTKTKTKTKTKPEEENS
                     KQEKREKVSFATAISNQSRKLVRKFKRKKRPSKLDLYRKPE"
     gene            <990092..>991204
                     /gene="NDAI0C04360"
                     /locus_tag="NDAI_0C04360"
                     /db_xref="GeneID:11494719"
     mRNA            <990092..>991204
                     /gene="NDAI0C04360"
                     /locus_tag="NDAI_0C04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669291.1"
                     /db_xref="GeneID:11494719"
     CDS             990092..991204
                     /gene="NDAI0C04360"
                     /locus_tag="NDAI_0C04360"
                     /inference="similar to DNA sequence:INSDC:YDR322W"
                     /note="similar to Saccharomyces cerevisiae MRPL35
                     (YDR322W); ancestral locus Anc_5.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669339.1"
                     /db_xref="GeneID:11494719"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:G0W8I5"
                     /translation="MTLLTPRRTFHLAKPLRQNAGIWSDFSKRSESLRIPSERIRKYI
                     LEGGDNKDNITLNGPPSLKRKFSRLKYKSPEFIDDAFQTSYLYLQEKAKIYYEKSLQD
                     TELSPEGKEKYEILTDINNPEVQYNFQFHNKLENNPKFINYELPVYRELGKKHWESYS
                     QMLLMQRLETLQVIPDTMPTLVPRMEVNIKFPISTSVNKWIEPGESLSSNVTSFEPIF
                     KLQEYDSLDIENQKYTILIVNPDEPDLENDTFKTSLCYGLMNIQISYNDNIVDLRKLK
                     GKENILMSYLPPVPEKNVGKQRFAVWVFRQENEFTELPSIPGRDRFNIRDFVEENKLD
                     PVGAHVWRSEWDSNVKNIRELYGLPTGRVFTRTRTI"
     gene            complement(<991475..>991765)
                     /gene="NDAI0C04370"
                     /locus_tag="NDAI_0C04370"
                     /db_xref="GeneID:11494720"
     mRNA            complement(<991475..>991765)
                     /gene="NDAI0C04370"
                     /locus_tag="NDAI_0C04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669292.1"
                     /db_xref="GeneID:11494720"
     CDS             complement(991475..991765)
                     /gene="NDAI0C04370"
                     /locus_tag="NDAI_0C04370"
                     /inference="similar to DNA sequence:INSDC:YDR322C-A"
                     /note="similar to Saccharomyces cerevisiae TIM11
                     (YDR322C-A); ancestral locus Anc_5.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669340.1"
                     /db_xref="GeneID:11494720"
                     /db_xref="GOA:G0W8I6"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="UniProtKB/TrEMBL:G0W8I6"
                     /translation="MSTLNVLRYSALGLGLWCGFRNDLSLKNVAAEREQQKKYDEEVK
                     LINEAKQEYAKLRPIEKKPETVSLENVQLDDPKLDFAELILNAVDSMKDTTS"
     gene            complement(<992011..>993573)
                     /gene="NDAI0C04380"
                     /locus_tag="NDAI_0C04380"
                     /db_xref="GeneID:11494721"
     mRNA            complement(<992011..>993573)
                     /gene="NDAI0C04380"
                     /locus_tag="NDAI_0C04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669293.1"
                     /db_xref="GeneID:11494721"
     CDS             complement(992011..993573)
                     /gene="NDAI0C04380"
                     /locus_tag="NDAI_0C04380"
                     /inference="similar to DNA sequence:INSDC:YDR323C"
                     /note="similar to Saccharomyces cerevisiae PEP7 (YDR323C);
                     ancestral locus Anc_5.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669341.1"
                     /db_xref="GeneID:11494721"
                     /db_xref="GOA:G0W8I7"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR021565"
                     /db_xref="UniProtKB/TrEMBL:G0W8I7"
                     /translation="MSTVGSANSSSRTSIVNAFDLIVCPICSKEFHNLQNLNNHLDVD
                     HNLADHANTTSPSIPTNGLGETPKKKRGIKRSHWKTPRRDKDNLCHDCGGTLTKPTGM
                     VNCPKCGELYCKRHCKNIMKLNLDAEYDVNNGSWYNCCYACFSSRPGYNDFGASVDLT
                     FKFEKLRSSKSEDKRLRLLQLENRLVRLIDGIISIYENYKGSLLMQFRMNTAIFNFEC
                     SVAPWKDDLATTECNICGQKFTVLLRKHHCRLCGNVVCDDESTNCSTNIPITSLIQQA
                     QNLPFQKANATDLSDADLKLRICRQCIETVFIGRKFALDIQAAKSAILQKYESISNLS
                     GAIVASLPEFMSLLRKIEGNKEENELSNENDLRNLSKLREKLLKLFATYSTLNRQINA
                     CYPKNNSERRIQEAIQITASQFINDNVLPLKAIPSALNPAAYDARQDQNFGESKKLSS
                     VLNKLTIKEVKEYREELMVLKEQIFILEESLTNAKIQRKFDEVTILHTNLKELNDRVK
                     EIQDMLGDEGFL"
     gene            complement(<993861..>996212)
                     /gene="NDAI0C04390"
                     /locus_tag="NDAI_0C04390"
                     /db_xref="GeneID:11494722"
     mRNA            complement(<993861..>996212)
                     /gene="NDAI0C04390"
                     /locus_tag="NDAI_0C04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669294.1"
                     /db_xref="GeneID:11494722"
     CDS             complement(993861..996212)
                     /gene="NDAI0C04390"
                     /locus_tag="NDAI_0C04390"
                     /inference="similar to DNA sequence:INSDC:YDR324C"
                     /note="similar to Saccharomyces cerevisiae UTP4 (YDR324C);
                     ancestral locus Anc_5.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669342.1"
                     /db_xref="GeneID:11494722"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G0W8I8"
                     /translation="MESNISVHTTTIMTEEETNHTTMTNSHQELLVHRSRFVDLTPGN
                     ITALSFSHKSTTNKLTPSSLRLAVGRSNGNIEIWNPRNDWFQELIIQGGKDRSIEGLC
                     WYNVPGEPLRLFSIGGSTMVTEWNLATGLPLKNYDCNAGVIWSLAINESQDKLAVGCD
                     NGTVVVIDISGGPGSLEHDTILMRQEARVLSLAWNKDDFVIGGCSDGRIRIWNVQKTT
                     TTTTTATEHRGRLLHTMKVDKAKRESTLVWCVIYLPHTNQIVSGDSTGSVKFWDFQYA
                     TLTQSFKSHEADVLCLTTDASNTHVFTAGVDRKIFQFSQNSSSNQLSGKDSNAIKWVN
                     ASNRLFHGNDVRALCSYQSKGADFLVSGGIEKSLVISSLLSFSDGNYKKMPVVVPYMK
                     NILINKAKRLVVMWHESIIKIWTIGEDINSEKNYKLVCKLTLKDDQNINTCALSPDGE
                     VLIVGRPSTTKLFHLQTMLNKLKVTKLDNDYLLKTGTKFVKFIDNSKMVMCSTDDEIF
                     SLDLEADNDEDPEIFELPDLQTTKSSIKIPYINKVNHLDVSTTHAVVSRTCGAVDVVD
                     LTTGKSTPIVRLMNFITAVSFNIKRNTTIVVTAENKIYEFNNPATQTEEDGTLLTQWS
                     KNNTENLPKQIKNLKEKCLGIFIEENNADKVWFWGSTWVSRFDFSIDLPINKRRKVKK
                     HTRDGLTVTDGSNFMNDDEEDEDVDMDLEYSENLSHLLELEPRIKSNGGNKHDQNAFF
                     ITDKYKPLLFAGLLSDNELIVVERPTIMLAGQPKAFNLPKLMF"
     gene            <996584..>999703
                     /gene="NDAI0C04400"
                     /locus_tag="NDAI_0C04400"
                     /db_xref="GeneID:11494723"
     mRNA            <996584..>999703
                     /gene="NDAI0C04400"
                     /locus_tag="NDAI_0C04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669295.1"
                     /db_xref="GeneID:11494723"
     CDS             996584..999703
                     /gene="NDAI0C04400"
                     /locus_tag="NDAI_0C04400"
                     /inference="similar to DNA sequence:INSDC:YDR325W"
                     /note="similar to Saccharomyces cerevisiae YCG1 (YDR325W);
                     ancestral locus Anc_5.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669343.1"
                     /db_xref="GeneID:11494723"
                     /db_xref="GOA:G0W8I9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025977"
                     /db_xref="InterPro:IPR027165"
                     /db_xref="UniProtKB/TrEMBL:G0W8I9"
                     /translation="MTAIRNDIEINDENDVNTKIFRSVADVFQKAQSTYAGHRKHIAV
                     LKKIQLKAIDQGYEDAFNYWFNKCVTKILPLKKNETVGDRIVKLIAAFVASLDRENDL
                     INQTRGNEDTDENEEPTMFARFIDQFVRHILRGIESKDKNVRFRVIQILVVIMDNIGE
                     IDEELYNLLIWSLKKRIYDKEALVRIQTIFCLTKFQDDSPSSPDGTLSEDDMSEATLI
                     LMKAIQNDSSPEVRRACMLNLVNNSVTRPYILERARDVNAINRRLIYSRVLKGMGKNV
                     FEDINTSIIDKLIEWGLDDRETHVSKECGKLISHHWLNSLDGDLIQLLENLNVTTSSV
                     TAKAMNSLFQTRPDIITKIKFPQDIWQDFTVETAFLFRCFYIYCLDNNLNEILEENFP
                     EASKLADHLNFYITKRFRDKPDQNITAEQETETLDFVIEQLLITSNKYDFSDEVGRRA
                     TLNVIRNMLHLTGLPDELIKIGLEVLKSLSINERDFITMGIEIINDIRDDDIELQEQR
                     EQQSKNKDALEGNDDDDDGSLESFHSAVENLVNGDGTPSEQLINNLLPEREATPKTMV
                     VCLTRSAAMLELVHTPIDQNVLITSLIDTLITPAVRNNETTIRELGIRNLGLCCLLNK
                     DLAIENLYILGMCISKGNSTLKTLALQIIVDLFCVHGTAIVDGEGKVDSVSLHKIFYK
                     VLKNNEAPECQVVAAEGLCKLYLADIFTDDDLFEALVLAYFSPENSHNERLVQVFAFC
                     IPVYCFSHVSHQERMSKAAADILWRLCMKWDHIENTNHDNEGQSTAMMKPNVILQQLV
                     YWTDPRKVVGKQQDEISKINYQLGFLLDILKSLATIEKKVIKKMLIINLNIFFITSNQ
                     NYATLKNLLELLEDIIENDPMDTTCRNSLDKLHRHLSDVIQEAMERNLSIEKSEDVDT
                     EDNTTYSKILETTETVSNDKTADYSTIVNNTDENKGSLEANTEESITRTSEQANSRKR
                     TRSEIEDSSVVEKNTNDSQSQISEAGEVHAKTVSFAADVSMLSNDEISIINEEDDRDN
                     SDDSYSISS"
     gene            complement(<1000064..>1004365)
                     /gene="NDAI0C04410"
                     /locus_tag="NDAI_0C04410"
                     /db_xref="GeneID:11494724"
     mRNA            complement(<1000064..>1004365)
                     /gene="NDAI0C04410"
                     /locus_tag="NDAI_0C04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669296.1"
                     /db_xref="GeneID:11494724"
     CDS             complement(1000064..1004365)
                     /gene="NDAI0C04410"
                     /locus_tag="NDAI_0C04410"
                     /inference="similar to DNA sequence:INSDC:YDR326C,YHR080C"
                     /note="similar to Saccharomyces cerevisiae YSP2 (YDR326C)
                     and YHR080C; ancestral locus Anc_5.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669344.1"
                     /db_xref="GeneID:11494724"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G0W8J0"
                     /translation="MGEESTGRESRSLSNNSFLKKLKFVTKKSKRKSSKSDKIKRSSL
                     SLSRSGKGKNEIAKRRIMTDTPRPESKTYIDSQFDLPDIVSIRSAKSHKSKNKHQNKK
                     NLSNHNSRNGTTLAIEPRRSLQNSVAGMKNANTAQGMFNIPVPIDNQGTEGNLSKIET
                     PSMAKHITTQSQEFPNRLPTPESALVQEPTQESIFTSIFNIAHNVVSHVPLLGSSEYL
                     DANEHTHHNKYENANRDNLTINPRNSNMTSTTGSKSGKQDDDMTNETLNSNPNGSRNK
                     SNHNNDTVIHSPPGNVNRSTSFLKHLDNLLSPSSLKDEKVLMNLPQSVPTLKDAYSNM
                     SRHSQTPMSLGYHTNNGSASNTNPKRNSRKKFSRFSLNSTIDNNDDDLDDEDEYMGDD
                     YSELINGDTADVETQAGRVKFQALHVQQPPAISTFGKGNLTLDAFASSPSIDEHSSFH
                     ALEESDDYDINNKHTRALNGMENKNIESIRNSSYIDLAHHAKEVLNNTVANNSHSTAN
                     LRARSKTVPASEHVSAKDKDADNEDDKITKRNSRYLTLTNDEISNLDLISDERKPRSG
                     SRNFLNRRSFSPSHFGKVIPSIALRTSLNRTRNSTDLSGTQRPRMSTNMSGSLTQIDA
                     IMPEKKFKLHGIEYVSEKRNTDFHNLFKDSGINQTERLIVDHSCALSRDILLQGRMYI
                     TDQHICFYSNILGWVSSVVIPFKEIVQIEKKTTAGIFPNGIVIDTLHTKYIFASFISR
                     DATFDLITDVWNQIILGRRHLAKSSEVINSNMESPFSSDDENNNGLSDSSGFYDEDED
                     DTDFTDMTSSNELADGTAATLTTSKPTRKNTASSTGPLKHAPTTIDYTPADNERQMTD
                     TTFDAPLGKVVNILFGPDTSYLEGIIKAQKNYAISPIPNLLETKHREYSYTKPISFSI
                     GPSKTECLITDDLDHYDLNDSVKVTSYSKTPDVPSGSAFSVRSVYLLTWAKNNKTRLI
                     VYLSVVWNSKSWLKGPIEKGTFDGVAETTRVMVDQVTKYLNEEDKTTRPKPRKSNENH
                     ELALHDADEEKDETLPALPTMGPATHPPTEPAFTKVKDETIIEDSANIKAPLGTVYQL
                     LFGDDPSYVKRILEKQNNINISEIPKFVDDKREITYTKKLNNSMGPKQTRCVVTEEIE
                     HMDIQNYIMVRQIVKSLDVPSGNNFSVHTKTYLSWGSNNTTNMKVVTNVVWTGRSMIK
                     GPIEKGSIDGQKGSTKIILEELDDIINNAGTKKKSQKRSKTIVSNKTPMMNTSQQEQI
                     SEANAMKGGILSTIVSTVTDLVDFTSIKGIFTVIMAFIFFIFLLKSLFGGRSNQHQIE
                     LIRPGRLLIDGNEYNYVPNFKTLYQVYEDDVRGNNARYSQTHNNVVTDSEGLIWDWLD
                     DRGNGLPIQDKPMIDEKYSKHQRENRHKLQQLKESIDITEQKLEEMKRMLRKVGA"
     gene            complement(<1005259..>1005810)
                     /gene="NDAI0C04420"
                     /locus_tag="NDAI_0C04420"
                     /db_xref="GeneID:11494725"
     mRNA            complement(<1005259..>1005810)
                     /gene="NDAI0C04420"
                     /locus_tag="NDAI_0C04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669297.1"
                     /db_xref="GeneID:11494725"
     CDS             complement(1005259..1005810)
                     /gene="NDAI0C04420"
                     /locus_tag="NDAI_0C04420"
                     /inference="similar to DNA sequence:INSDC:YDR328C"
                     /note="similar to Saccharomyces cerevisiae SKP1 (YDR328C);
                     ancestral locus Anc_5.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669345.1"
                     /db_xref="GeneID:11494725"
                     /db_xref="GOA:G0W8J1"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="InterPro:IPR016897"
                     /db_xref="UniProtKB/TrEMBL:G0W8J1"
                     /translation="MALSKNQHVVLVSGEGEKFTVDRKIAERSLLLKNYLNDMHDSNL
                     RGDVSSDSEDEEDDDDDDEIVMPVPNVRSSVLQKVIEWAEHHKDSNFPDEEDDDSRKS
                     APVDAWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFN
                     IVNDFTPEEEAAIRRENEWAEDR"
     gene            complement(<1006621..>1008027)
                     /gene="NDAI0C04430"
                     /locus_tag="NDAI_0C04430"
                     /db_xref="GeneID:11494726"
     mRNA            complement(<1006621..>1008027)
                     /gene="NDAI0C04430"
                     /locus_tag="NDAI_0C04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669298.1"
                     /db_xref="GeneID:11494726"
     CDS             complement(1006621..1008027)
                     /gene="NDAI0C04430"
                     /locus_tag="NDAI_0C04430"
                     /inference="similar to DNA sequence:INSDC:YDR329C"
                     /note="similar to Saccharomyces cerevisiae PEX3 (YDR329C);
                     ancestral locus Anc_5.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669346.1"
                     /db_xref="GeneID:11494726"
                     /db_xref="GOA:G0W8J2"
                     /db_xref="InterPro:IPR006966"
                     /db_xref="UniProtKB/TrEMBL:G0W8J2"
                     /translation="MVPPSSNPRRNLLQRHRGKLIFSIAGIATLFTTGSIALYLLKRW
                     LYKQQLKITRAHFLREQMKRRFNQTQEDSLHTVYELLPVVEMVLDQNGLQLDSIIYDI
                     KNVKKNVKGGSEVEPTNKELKFLSKAELWNQLTLKSIIKLVTISYMTSSLFLLTRLQL
                     NILTREYLEDTIKISAENEIIPKENDTSCSVTGWISNAWSVWTGQRSSESTTVKQNDD
                     TELLQHDKTQVAYINEQAFLSLSWWLLNKGWFNYEQTIETIIREEFSNLKPKDEITLI
                     EFSSKLTNVFQKINRIILSTDGSNLNLKAVLLPDITMEQFLLQQTLPSKSLVVLKDNK
                     ELFHKLVGETKKCLGTSASLIVFETLINECFQYIMADVESSVIKKKKRKPTTPDAPAA
                     SAEALQNNEGEEEEKQKDMLSEDTFQVAAYAISCKDCSNVMVKKPERNEENKFLTRLD
                     SLNVLDDLSAGVFSNLSM"
     gene            <1008509..>1010077
                     /gene="NDAI0C04440"
                     /locus_tag="NDAI_0C04440"
                     /db_xref="GeneID:11494727"
     mRNA            <1008509..>1010077
                     /gene="NDAI0C04440"
                     /locus_tag="NDAI_0C04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669299.1"
                     /db_xref="GeneID:11494727"
     CDS             1008509..1010077
                     /gene="NDAI0C04440"
                     /locus_tag="NDAI_0C04440"
                     /inference="similar to DNA sequence:INSDC:YDR330W"
                     /note="similar to Saccharomyces cerevisiae UBX5 (YDR330W);
                     ancestral locus Anc_5.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669347.1"
                     /db_xref="GeneID:11494727"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G0W8J3"
                     /translation="MSQEQIDNFMAITSAETPELATQFLDMAGGNLDIAISLFFEHGG
                     NAQLKQSTPAPTTTANINSSNMGNSGDNDEELAQRLQNEAYNEGQAVRAPDEARHETL
                     TETHVFPGTYGGIGGSFNPLRGIGSGVNDMFDNSTPPGIFNQRLTTVNGVDEDAYGTF
                     EPDSNSDISDLNEDDDDEDDDYELVEEPVVELDEDGTVQESTKWVRRPKGKTKEERLA
                     ILFRPPFKIMSKLNLEGARMKARKKNKWIMINIQDSGVFQCQALNRDLWSSKDVKRLL
                     KKNFIFLQYQYESRNAEPYLNFYPLPNKKDDLPHIAILDPITGERVKQWNQDVPKISS
                     FIKDINQFLSDYSLDPKSTNPTVKEPTPELDPTTLTEEQQMELAIQQSLGNSSSKPIT
                     FDDKEIGLDNDGNGGEEDDTAIGEAEETHESIFENIRPVHHMEPLNKPGITTRIQIRT
                     GDGKRIVRRVNAMDDKVRTLYEIVKSEIEGYDSCAFTLSDHQRNDLIDKVDMSISDAG
                     LKNSSLLLEKVIED"
     gene            <1010623..>1011810
                     /gene="NDAI0C04450"
                     /locus_tag="NDAI_0C04450"
                     /db_xref="GeneID:11494728"
     mRNA            <1010623..>1011810
                     /gene="NDAI0C04450"
                     /locus_tag="NDAI_0C04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669300.1"
                     /db_xref="GeneID:11494728"
     CDS             1010623..1011810
                     /gene="NDAI0C04450"
                     /locus_tag="NDAI_0C04450"
                     /inference="similar to DNA sequence:INSDC:YDR331W"
                     /note="similar to Saccharomyces cerevisiae GPI8 (YDR331W);
                     ancestral locus Anc_5.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669348.1"
                     /db_xref="GeneID:11494728"
                     /db_xref="GOA:G0W8J4"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="InterPro:IPR028361"
                     /db_xref="UniProtKB/TrEMBL:G0W8J4"
                     /translation="MRFSTSLITLLCAMLLNHLVIAEHTNNWAVLVSTSRFWFNYRHM
                     ANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGTVFNNKDHAIDLYGENVEVD
                     YRGYEVTVENFIRLLTDRWSEDQPKSKRLLTDENSNIFIYMTGHGGDDFLKFQDAEEI
                     ASEDIADAFEQMHEKKRYNEIFFMIDTCQANTMYSKFYSPNILAIGSSRLDESSYSHH
                     SDVEIGVAVIDRFTYYTLEFLEKIEKNSTLTLKDLFDSYTLENVHSHVGVREDLFDRD
                     PAETLITDFFGNVQNIIPDDMSRKDFAGKYNYDGGNEKLSRNVLNLAIEKATEEREVS
                     EKAISPTSLRIVNSVNQNARKISNDTQQKNGSYSIVILGLSTLLGILYFIMRNDNQAL
                     KTI"
     gene            <1012182..>1014188
                     /gene="NDAI0C04460"
                     /locus_tag="NDAI_0C04460"
                     /db_xref="GeneID:11494729"
     mRNA            <1012182..>1014188
                     /gene="NDAI0C04460"
                     /locus_tag="NDAI_0C04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669301.1"
                     /db_xref="GeneID:11494729"
     CDS             1012182..1014188
                     /gene="NDAI0C04460"
                     /locus_tag="NDAI_0C04460"
                     /inference="similar to DNA sequence:INSDC:YDR332W"
                     /note="similar to Saccharomyces cerevisiae YDR332W;
                     ancestral locus Anc_5.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669349.1"
                     /db_xref="GeneID:11494729"
                     /db_xref="GOA:G0W8J5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8J5"
                     /translation="MLKRLFGVSSIKYYQYSLTRKYSSITLRDYQQDAIDACVKSIQS
                     GQRRVGVSLATGGGKTVIFSNLINQMMNLNPGTQFKTLILVHRRELALQATNTIKKFF
                     PNLRVQIEMGKYHSEINDSDVVVASVQSIIRRLDKYKSDDINLIIIDEAHHAVANSYI
                     KILEHFHSNNQSSKIPVVGFSATFERADKKALSDVMDKIVYHRGIMEMIDDKWLCEGK
                     FTSVNIDVDLSKVDRTSGSQNGDFQIDSLSKVMNTEEVGNVIINTYLHQKKEHNLKST
                     LLFGVDIAHVESLYEIFKKNGINARYVVSNTKNDLRDEIIREFREGKVSVLMNCGIFT
                     EGTDIPNIDSIMLCRPTRSRSLLVQMIGRGLRLHHSKNYCHIIDFIAASDVGVVSVPT
                     LAGVENYRGQLDDATLSDLHEIKKEMDLKQKQREENKHLEELQEKQIQQQFSEKMRNT
                     DAWELTLTTYEDFKSFCGANNVDINGMSNAQKEVELIHNSSYPWVKFSKSAWALSLKH
                     GHHLRIYKEPSKYDPKGSNYILKLYRKIPGWINQTGASYSTRILITSSDLFKIAANVE
                     EVLVNLSNGSGTSTEGPIRITKFARWRAEPATPRQSSAIKVKLEKELAKCEKDYKYLD
                     LSDIDKYIKSLTKGNASNILFAMSLAPSYPLRSLLKAIQYKKTI"
     gene            <1014614..>1016494
                     /gene="NDAI0C04470"
                     /locus_tag="NDAI_0C04470"
                     /db_xref="GeneID:11494730"
     mRNA            <1014614..>1016494
                     /gene="NDAI0C04470"
                     /locus_tag="NDAI_0C04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669302.1"
                     /db_xref="GeneID:11494730"
     CDS             1014614..1016494
                     /gene="NDAI0C04470"
                     /locus_tag="NDAI_0C04470"
                     /inference="similar to DNA sequence:INSDC:YHR084W"
                     /note="similar to Saccharomyces cerevisiae STE12
                     (YHR084W); ancestral locus Anc_5.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669350.1"
                     /db_xref="GeneID:11494730"
                     /db_xref="GOA:G0W8J6"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:G0W8J6"
                     /translation="MKTMKIQLSNNRTQEILNYNDVNDKELQRTTQEVEEALNFIEDL
                     KFFLTTAPVDWQENQIIRRYYLDGNQGFISCVFWDNLYYITGTDIVKICMYRMQKFGR
                     IIVQKKKFEEGIFSDLRNLKCGVDATLEQPKSEFLAFLFKNMCLKTQKKQKVFFWFSV
                     PHDKIFADALERDLKKEIQGQPATTKALHEPALSFQYDSQQGRTLYEQLLNHMDTQRI
                     LTTQSTEMELEDPISNPVKINEIKSEQEKVTNINDSNNSLNTANDLPSTFPIQDTELE
                     SQNLEPVSEIKNDGGEQMKDDDFPLSYFPISVEYPNQQEIIPPLLSSTIPQQLAYDDR
                     YFELPPDPNYNPHMAMPVPFPYQMTTPFIQHPKSSGRSKFNAKKNAGKSQKQTIEVSN
                     NGKIERITSASLNTYQKYPKSARITEYPSFPTLDAFYQPLPNMSPRYQSYGNMPMNNY
                     HMPSSEYGSYSQNFMSRLLDQPDYEYDNFSPFQNGPVEDYSMQQDFPILNQSLAQQTV
                     SNAPSYHPNNQFKMGSPSSSMNPYMWAPRAGSHLQYPLYTQYPQVLPQRTGQVSSGKH
                     QKMNLSNIQFSDSRTHIIKSGKISKKSTNKKPKPHSTKDVEKLSKVDCDIDESFNTIE
                     NI"
     gene            complement(<1016662..>1018845)
                     /gene="NDAI0C04480"
                     /locus_tag="NDAI_0C04480"
                     /db_xref="GeneID:11494731"
     mRNA            complement(<1016662..>1018845)
                     /gene="NDAI0C04480"
                     /locus_tag="NDAI_0C04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669303.1"
                     /db_xref="GeneID:11494731"
     CDS             complement(1016662..1018845)
                     /gene="NDAI0C04480"
                     /locus_tag="NDAI_0C04480"
                     /inference="similar to DNA sequence:INSDC:YDR333C"
                     /note="similar to Saccharomyces cerevisiae YDR333C;
                     ancestral locus Anc_5.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669351.1"
                     /db_xref="GeneID:11494731"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:G0W8J7"
                     /translation="MSSRALRKLQNDDELLESILRSNNSSASTSKKSTPKPHVNIFAL
                     MNDNEDDDEGSDNTSDIAEKEQIDNGVSETEAHEGEDGDKMVKLPTKSQKKKNKKKNK
                     TSKKTTNIDTVTANEDENDEEFDKLLQQFQRENIRKNTANDFELGNVGAYDDEDEFFT
                     ASESEDIATVTLTERIENDLRKDNAFSRFPVSYFKYAKKFFNDDFKKLDPHSEFKLLF
                     DDISAEALEDIDEMSSTSISPQQLKQIQRMKRLVRNWGGKDHKSVPNGPGSSLHRLQF
                     TKVRNDWIPTQRGELTMKSLNLEELVDWQLWQRPIDWKDVIEEDVKRWKSKITFFKFE
                     PLNDDINRKAITEFYLSVVLHPDHEALINLIASKYPYHVPGLLQVALITIRQGDKSNT
                     NGLLQRALFVFDRALRSSINFDGTSCQLPYIYFYNRQFYLAIFRYILALAQRGAVATA
                     SEWCKVLWSLSPLEDPLGCRYFMDHYLLLNNDYQYLIELSKSPLMNTYKQWNTLGFSL
                     GVVLSYLHLNEKDLARKELIKCFKNHPLKLAQLFQEKLLGDPSLIANMDISEQKADIL
                     ESKAYMARFPILWKNAEDVSFLHSELTKILHDHKTGNLTVELDNNAEEDETEDITSPF
                     FIEGIPINLLRFAILSEESSVMAAIPPSIWSDYEVFEFDVLPPTPTTKESIDVLETVK
                     SYIHEKDLVTSQAALMQDEDILNQIRQLSLQQYIQENETENNQGA"
     gene            <1019130..>1020134
                     /gene="NDAI0C04490"
                     /locus_tag="NDAI_0C04490"
                     /db_xref="GeneID:11494732"
     mRNA            <1019130..>1020134
                     /gene="NDAI0C04490"
                     /locus_tag="NDAI_0C04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669304.1"
                     /db_xref="GeneID:11494732"
     CDS             1019130..1020134
                     /gene="NDAI0C04490"
                     /locus_tag="NDAI_0C04490"
                     /inference="similar to DNA sequence:INSDC:YHR085W"
                     /note="similar to Saccharomyces cerevisiae IPI1 (YHR085W);
                     ancestral locus Anc_5.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669352.1"
                     /db_xref="GeneID:11494732"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:G0W8J8"
                     /translation="MTKSRKQKQKKQDFLKQKLKVGKTKPKASNLTDTSFVSRTISIR
                     NQHLEHDNDLSKKLTLLKHHNSTVRKETLGLFQKSLPKIINSKLISPLVTQSIPLICD
                     DSRDVREGLISLIKEIGKLEPQVLRLHCKVFVLYINMAMTHIITQIQNDSTKFLQCLL
                     EDCQEEIIRQAWVKMMNGLFCVLGWGAIGNNISAGVAQSKKRNAPTLKIHLDTLYELI
                     KSGCLEIEDNTEEEAQLEGDDRNSHHITRNQHLIPDYPQPYDYLKLFARELKNKDATD
                     SLLQSGNLAAQDVDTRQRIFEEQYLKTLEKELDLLVKDGGVCGRSANNIKQLLTTISA
                     "
     gene            complement(<1020217..>1020462)
                     /gene="NDAI0C04500"
                     /locus_tag="NDAI_0C04500"
                     /db_xref="GeneID:11494733"
     mRNA            complement(<1020217..>1020462)
                     /gene="NDAI0C04500"
                     /locus_tag="NDAI_0C04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669305.1"
                     /db_xref="GeneID:11494733"
     CDS             complement(1020217..1020462)
                     /gene="NDAI0C04500"
                     /locus_tag="NDAI_0C04500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669353.1"
                     /db_xref="GeneID:11494733"
                     /db_xref="GOA:G0W8J9"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G0W8J9"
                     /translation="MLLLTLLVKTKFGIRLSPYGTFGTMSGGADPTLLAQYAYVLGEL
                     EKRAKAGKRLAFVHLVEPRVTNPFMTEGEGEYNDGTI"
     gene            <1021740..>1026254
                     /gene="NDAI0C04510"
                     /locus_tag="NDAI_0C04510"
                     /db_xref="GeneID:11494734"
     mRNA            <1021740..>1026254
                     /gene="NDAI0C04510"
                     /locus_tag="NDAI_0C04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669306.1"
                     /db_xref="GeneID:11494734"
     CDS             1021740..1026254
                     /gene="NDAI0C04510"
                     /locus_tag="NDAI_0C04510"
                     /inference="similar to DNA sequence:INSDC:YDR334W"
                     /note="similar to Saccharomyces cerevisiae SWR1 (YDR334W);
                     ancestral locus Anc_5.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669354.1"
                     /db_xref="GeneID:11494734"
                     /db_xref="GOA:G0W8K0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8K0"
                     /translation="MTKQRKDNKQNPKKKYELVADLKFKHDLLTNELFHLQKFISLVE
                     FDPSYSNESESYKEFIDKNGLALEITEINGKIADGPNNIDGNTQTGKNTKIRRRQLRD
                     TTLSKDPKLTTTSQVHLSAINILDEIEPLVQERYRQLENSFKTKDNSKVEHVIVKKEK
                     TSKVTEPILPPHPTPVSKAKRSYRKMKKESNDNTHKDINSPLTTEQTPKQSRKPSKTS
                     IQIIENENNQQEDEDSESDSYDFTSSDEEDFKAKRGRKKKLPRLNLIVHPPQQTITNP
                     TNIIKPKFPTLSAYLNSFKSLDDDITIPEYEKYIIEQKDLVAKIKKGVENGALVYDKD
                     TDSLQPITTKETKLVQLSKPDPISFLYKEQNLHVHQDYLINQGIYMSKLFHSSRRARM
                     ARAKKVSQMIDSHFKHIAGAEERKLKEEERNRKLLARTTMQIVKKRWNLAEKAYRVLK
                     KNEEEQLQKIKGKEHLSKILEKSSQLLGAQLNQPADEDLSISSDNNDTSSKSDTDSDD
                     DMLSSSSSAHSASSDNEIETHGTKLSLGSVKADSTMDEALSVEELRRKYSGLKDLKLD
                     NNKDSDDESILDESESETGPSHITDESSSDDSISENEVEEGKVETQEQEVGLHSLFTT
                     DLDEDNDHDDSEDFQMSESDEEMKQENDSLDEADAREDSNRETSDKYSGYDSQLSVVD
                     VPVPPLLRGTLRVYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKQ
                     IWGPHLIVVPTSVLLNWEMEFKRFAPGLKVLTYYGSPQQRKEKRKGWNKPDAFHVCIV
                     SYQLVVQDQHSFKRKRWEYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLLTGTPLQNN
                     LAELWSLLYFLMPQTIINGKKVSGFADLDAFQQWFGRPVDKLIETGGGYAQDEETKKT
                     VAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSKTKATLA
                     SGNFMSIVNCLMQLRKVCNHPDLFEVRPILTSFELGASVSSHYTTMNKFMHKMLASSD
                     DSRVDLKNLNLVFSENDNNLTSYHSDSISKLKCIKSFVKEIDILKEEITKAKIENTIM
                     NFDNASDFYKNYKRTSIQTKIDALMGLWYINTLKSDRKPVYGNNLIKLVTVDSISAKI
                     NSPSLEPLIKPLQTRFFSENDTIEKYAVLTPKAVALDMRYLELGLDDSSILDETTKMT
                     VSEQLYNMQSPFHHLQTKLSIAFPDKSLLQYDCGKLQKLAILLQNLKDNGHRALIFTQ
                     MTKVLDVLEQFLNYHGYLYMRLDGATKVEDRQILTERFNTDSKVTVFILSSRSGGLGI
                     NLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQK
                     RELDKVVIQKGDFTTDYFSKLSVKDLLGPDVPVEGINENAPLLADDPSASKDPRRLEK
                     LLAQAEDEDDVRAANLALKEVAIDDEDFTEDVEKKENSLNDAGSVDEYEGTGHVEEYM
                     IRFIANGYYH"
     gene            <1026605..>1027615
                     /gene="NDAI0C04520"
                     /locus_tag="NDAI_0C04520"
                     /db_xref="GeneID:11496584"
     mRNA            <1026605..>1027615
                     /gene="NDAI0C04520"
                     /locus_tag="NDAI_0C04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669307.1"
                     /db_xref="GeneID:11496584"
     CDS             1026605..1027615
                     /gene="NDAI0C04520"
                     /locus_tag="NDAI_0C04520"
                     /inference="similar to DNA sequence:INSDC:YDR336W"
                     /note="similar to Saccharomyces cerevisiae YDR336W;
                     ancestral locus Anc_5.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669355.1"
                     /db_xref="GeneID:11496584"
                     /db_xref="GOA:G0W8K1"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8K1"
                     /translation="MNVICGRLFASSSSRLDNVSLAKRIISQTKVKDTKNAGESDNIL
                     NETKKVIASKRTTKVVTKNNFLEWVSFNSSYNSHYHYPGEKEMNPINHFFNTASVKYE
                     WGVSAFGDIPNEHLNKLYGNTISNAGNSKQFPGRTYVPYDIVKSLPEVIFISRTNAGK
                     STLLNNLTTSFNQNRLDVSAKMSKSAGFTKTLNCFNIGNRFRLVDSPGYGFGSDIKQG
                     IITMDYLKNRKELMRSYLLVPGHKGFNELDLQMVDFMVANGISFEVIFTQMDRVKDIE
                     TFRKMLDASNVRNLSTLPQLIFVNSTLSKHCRKRFGIAYLRYSLFQSCSLEPGIRPLR
                     KK"
     gene            <1027895..>1028680
                     /gene="NDAI0C04530"
                     /locus_tag="NDAI_0C04530"
                     /db_xref="GeneID:11496585"
     mRNA            <1027895..>1028680
                     /gene="NDAI0C04530"
                     /locus_tag="NDAI_0C04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669308.1"
                     /db_xref="GeneID:11496585"
     CDS             1027895..1028680
                     /gene="NDAI0C04530"
                     /locus_tag="NDAI_0C04530"
                     /inference="similar to DNA sequence:INSDC:YDR337W"
                     /note="similar to Saccharomyces cerevisiae MRPS28
                     (YDR337W); ancestral locus Anc_5.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669356.1"
                     /db_xref="GeneID:11496585"
                     /db_xref="GOA:G0W8K2"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:G0W8K2"
                     /translation="MLNIIRRNTISPLGENLIFSRAFVSTSKLYSAKAAKFLKAQRRR
                     QKNEEKQATIKNSLERVDPVFGKKNVPFIARISAELKEPLVLSSGYNVEEVEKFLAAI
                     ETTKKKQLADRGINVDMIVSENEKELEEKRQVILRILSMRNANNKSSIKLALKLAREE
                     FQRFPGDTGSSEVQAACMTVRILNMAHHIQEHRKDYSNTRHLRMLVQQRQSILRYLKR
                     NNAERYYWVIQKLGLTDTAVTEEFNMDRQYMKDYKFFESAAVN"
     gene            complement(<1028907..>1030964)
                     /gene="NDAI0C04540"
                     /locus_tag="NDAI_0C04540"
                     /db_xref="GeneID:11496586"
     mRNA            complement(<1028907..>1030964)
                     /gene="NDAI0C04540"
                     /locus_tag="NDAI_0C04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669309.1"
                     /db_xref="GeneID:11496586"
     CDS             complement(1028907..1030964)
                     /gene="NDAI0C04540"
                     /locus_tag="NDAI_0C04540"
                     /inference="similar to DNA sequence:INSDC:YDR338C"
                     /note="similar to Saccharomyces cerevisiae YDR338C;
                     ancestral locus Anc_5.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669357.1"
                     /db_xref="GeneID:11496586"
                     /db_xref="GOA:G0W8K3"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:G0W8K3"
                     /translation="MAGILSKTLSEVHPTLRTNGMGVGNTHRRISLGFFPPNKKNPLV
                     RKFSRRSRPTDQRSFRSLGDDFGSNVHEPHHYMDEIMEEPEMHYNEEDGGELSRTVSL
                     PSRVSETPELSSPGVDWILQEHERRYSSVYNSDNEEGEEDMEQYEPRELGYDEFINRI
                     QVQKQTHESMMQRTGITPRRPSFVSVTSKGSVPAIYQEDVHSAELAQLAKEKVTFKSE
                     SKVLASYSFPLIFTFLLEQIFPMVCSLTVGHLGKNELAAVSLASMTSNITLAIFEGIA
                     TSLDTLCPQAYGSGRYYSVGIHLQRCITFSLIIFVPFAFFWFYSESILYMVVPEKELI
                     ALTSQFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNILISYTLVWNK
                     YIGMGFIGSAVAVVINFWMMFFLLLLYTLYVEGRKCWGGFSSKAFTHWKDLSHLAISG
                     IIMLEAEELSYELLTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISTSTRIANFI
                     GAKSSEHAHISSKVGLTFSFGAGLTNCLLLVLGRNFIASVFSRDEDVKKLISGLLPLV
                     GLVQNFDSLNAVAGSCLRGQGMQSLGSVVNLLSYYLFGIPLALILSWYFNMKLFGLWI
                     GIGCAMLLIGLIESYYVLFPNWDAIMNYAELLKESEDDDSDDEEYFTDSDEPTEYSPL
                     LSA"
     gene            complement(<1031852..>1032421)
                     /gene="NDAI0C04550"
                     /locus_tag="NDAI_0C04550"
                     /db_xref="GeneID:11496587"
     mRNA            complement(<1031852..>1032421)
                     /gene="NDAI0C04550"
                     /locus_tag="NDAI_0C04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669310.1"
                     /db_xref="GeneID:11496587"
     CDS             complement(1031852..1032421)
                     /gene="NDAI0C04550"
                     /locus_tag="NDAI_0C04550"
                     /inference="similar to DNA sequence:INSDC:YDR339C"
                     /note="similar to Saccharomyces cerevisiae FCF1 (YDR339C);
                     ancestral locus Anc_5.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669358.1"
                     /db_xref="GeneID:11496587"
                     /db_xref="GOA:G0W8K4"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G0W8K4"
                     /translation="MGKAKKTRKFALTKRTLNAKKDQRLKANQDKIREKEDPELTRNI
                     PQVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCV
                     MAELEKLGPKYRIALKLARDPRIKRLSCSHKGTYADDCIVNRVLQHKCYIVATNDAGL
                     KQRVRKIPGIPLMSVGGHSYVIEKLPDVF"
     gene            complement(1032638..1032701)
                     /gene="NDAI0Ctrna6S"
                     /locus_tag="NDAI_0Ctrna6S"
                     /db_xref="GeneID:11496338"
     tRNA            complement(join(1032638..1032683,1032638..1032701))
                     /gene="NDAI0Ctrna6S"
                     /locus_tag="NDAI_0Ctrna6S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11496338"
     gap             1032812..1033481
                     /estimated_length=670
     gap             1033888..1034322
                     /estimated_length=435
     gene            complement(<1036823..>1038535)
                     /gene="NDAI0C04560"
                     /locus_tag="NDAI_0C04560"
                     /db_xref="GeneID:11496765"
     mRNA            complement(<1036823..>1038535)
                     /gene="NDAI0C04560"
                     /locus_tag="NDAI_0C04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669311.1"
                     /db_xref="GeneID:11496765"
     CDS             complement(1036823..1038535)
                     /gene="NDAI0C04560"
                     /locus_tag="NDAI_0C04560"
                     /inference="similar to DNA sequence:INSDC:YDR343C,YHR094C"
                     /note="similar to Saccharomyces cerevisiae HXT6 (YDR343C)
                     and HXT1 (YHR094C); ancestral locus Anc_5.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669359.1"
                     /db_xref="GeneID:11496765"
                     /db_xref="GOA:G0W8K5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W8K5"
                     /translation="MSDVQGDQTADNQSASPLENESHSITSTPSNKAERDDQKDFTSD
                     LEPADEGMDIPKKPSSAYVTVSIMCIMVAFGGFVFGWDTGTISGFVAQTDFLRRFGQK
                     HHDGTHYLSKVRMGLIVSIFNIGCAIGGIILSKAGDMYGRKMGLIIVVIIYIVGIVIQ
                     IASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRGTLVACYQLMITLGIFL
                     GYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEVGKIDEAKRSI
                     SISNKVGIDDPSVIAEVEVVQAGVEAEKLAGNASWGELFQTKNKIFQRLIMGCVIQCL
                     QQLTGDNYFFYYGTIVFKSVGLEDSFQTSIIIGVVNFASTFVGIYVVERFGRRRCLLW
                     GAATMTACMVVYASVGVTRLWPHGQGNGSSKGAGNCMICFTCFYIFCFATTWAPIPFV
                     VNSETFPLRVKSKCMSVAQACNWLWGFLISFFTPFITGAINFYYGYVFMGCLCFSFFY
                     VFFFIPETKGLTLEEVNTMWEEGVLPWKSTSWVPPSKRGADYDAAALAQDDKPMFKRM
                     FARD"
     gene            complement(<1042623..>1044329)
                     /gene="NDAI0C04570"
                     /locus_tag="NDAI_0C04570"
                     /db_xref="GeneID:11496589"
     mRNA            complement(<1042623..>1044329)
                     /gene="NDAI0C04570"
                     /locus_tag="NDAI_0C04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669312.1"
                     /db_xref="GeneID:11496589"
     CDS             complement(1042623..1044329)
                     /gene="NDAI0C04570"
                     /locus_tag="NDAI_0C04570"
                     /inference="similar to DNA sequence:INSDC:YHR096C,YDR345C"
                     /note="similar to Saccharomyces cerevisiae HXT5 (YHR096C)
                     and HXT3 (YDR345C); ancestral locus Anc_5.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669360.1"
                     /db_xref="GeneID:11496589"
                     /db_xref="GOA:G0W8K6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G0W8K6"
                     /translation="MNSTPDLLTPQKSSSSNSQNEIQSQNANVMNIPEGMGKEGSEDL
                     EIVTELSNPNTGKSAYIGVSISCAMVAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHH
                     DGTHYLSKVRMGLIVSIFNIGCAIGGIVLSKLGDTRGRKQGLIIVVVIYIVGIIIQIA
                     SVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKDMRGTLVSCYQLMITLGIFLGY
                     CTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEVGKIDEARASLST
                     VNKVAGDHPFIQQELDLIEASVEEARAAGSATWGELFTGKPAMLQRTMLGIMIQSLQQ
                     LTGDNYFFYYGTIVFNAVGMTDSFETSIVFGVVNLFSTGCSLYTVDRFGRRNCLLYGA
                     IGMICCYVVYASVGVTRLWPNGQGNGSSKGAGNCMICFACFYIFCFATTWAPIAYVVI
                     SETFPLRVKSKAMSVATAANWIWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVF
                     FFVPETKGLTLEEVNEMYSEGVLPWKSASWVPPSKRGADYDANAFAHDDTPLYKRIFS
                     RN"
     gene            complement(<1046583..>1047947)
                     /gene="NDAI0C04580"
                     /locus_tag="NDAI_0C04580"
                     /db_xref="GeneID:11496590"
     mRNA            complement(<1046583..>1047947)
                     /gene="NDAI0C04580"
                     /locus_tag="NDAI_0C04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669313.1"
                     /db_xref="GeneID:11496590"
     CDS             complement(1046583..1047947)
                     /gene="NDAI0C04580"
                     /locus_tag="NDAI_0C04580"
                     /inference="similar to DNA sequence:INSDC:YDR346C"
                     /note="similar to Saccharomyces cerevisiae SVF1 (YDR346C);
                     ancestral locus Anc_5.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669361.1"
                     /db_xref="GeneID:11496590"
                     /db_xref="GOA:G0W8K7"
                     /db_xref="InterPro:IPR013931"
                     /db_xref="UniProtKB/TrEMBL:G0W8K7"
                     /translation="MLKWIQGGISAVTGIAEPVYGKDCIHSVTSRVKDQQPYRETDRE
                     DLYWIAPDHTNVETLTFYFSDLNTGIVGFAQIIHSNIVGLHTQAQFTFRIFDSKNPKE
                     LNLWTSTKLENFRIEGPNFYADNLSVELNDENTTYHFISEVCEQSKIDLIVTRLTPGA
                     KAGDDPTTYYGNDMDEPWGTMRHVFWPRNSCHGSINLKIKQENEEKTETEADKKDEQE
                     ELNEQTEEQEQEQEQEQEQEEEEDHITYKDRLITFGENEPVYSMFVMAFQGMKPHHAA
                     KAWNFIYFHSEKHTAVLMEFTTPKSYGNTKVSVGILTSDKDILAVTTDNQVTHLDAEI
                     DSVGWNIPKNFRVDFNGVKSTVTDDEVKNNEVKDDDRIAATVEGPLNNLVERIDVMGE
                     VPGFVKNIVSGVAGTKPYIYQYASDDEFTLKVNDEEVKGLAWAEVTFISESDVVTEES
                     YNEN"
     gene            <1048881..>1049699
                     /gene="NDAI0C04590"
                     /locus_tag="NDAI_0C04590"
                     /db_xref="GeneID:11496591"
     mRNA            <1048881..>1049699
                     /gene="NDAI0C04590"
                     /locus_tag="NDAI_0C04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669314.1"
                     /db_xref="GeneID:11496591"
     CDS             1048881..1049699
                     /gene="NDAI0C04590"
                     /locus_tag="NDAI_0C04590"
                     /inference="similar to DNA sequence:INSDC:YDR347W"
                     /note="similar to Saccharomyces cerevisiae MRP1 (YDR347W);
                     ancestral locus Anc_5.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669362.1"
                     /db_xref="GeneID:11496591"
                     /db_xref="GOA:G0W8K8"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:G0W8K8"
                     /translation="MLNNFTRSQGNTNDNNYLSLIQQFSNTVTKRDVVNYASLLYNLN
                     FAFSSLKGCDRELPKILRGSESLLQIPDFSQDMDVAHSKNSNNILSQTNNDTFCKILE
                     SSFGSIEEFKTLFMNSCSAISGDGFTWLIAKRNSSNMMMESLTNSKNNLDKLFVLNTY
                     NAGSPYINDRLEMMKMLANKANKMQEGKMEMETDDVNSEKVPIFEGMMSVEEARETHS
                     VDVKAQYVPLLAIDGSPKSWLMDYGVFGKEQYLNHVWDSIDWYVVANRLPKSVE"
     gene            complement(<1049919..>1051412)
                     /gene="NDAI0C04600"
                     /locus_tag="NDAI_0C04600"
                     /db_xref="GeneID:11496592"
     mRNA            complement(<1049919..>1051412)
                     /gene="NDAI0C04600"
                     /locus_tag="NDAI_0C04600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669315.1"
                     /db_xref="GeneID:11496592"
     CDS             complement(1049919..1051412)
                     /gene="NDAI0C04600"
                     /locus_tag="NDAI_0C04600"
                     /inference="similar to DNA sequence:INSDC:YDR348C,YHR097C"
                     /note="similar to Saccharomyces cerevisiae YDR348C and
                     YHR097C; ancestral locus Anc_5.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669363.1"
                     /db_xref="GeneID:11496592"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:G0W8K9"
                     /translation="MQGRSNTGGGSRPFSTTNPFRTAAADPSLNQYKADQQFQDWAAS
                     QLGNSTHSSFSGSYNIDDDFNGIGRGQTSPSRSGHLSPRVLKQPSTNPFLDDLESIPD
                     SPPIGRNTQRQQQAPPPPPPPSQSVSKNNFSTSTEEKERLRQRYLTEERTIPSSNPTI
                     PPPPSYEEAAGRQKAKDNIYPQEKSSSDRSHRSHRSHSHHHRDREHERGTTDRKKSTS
                     QSKKEKRKSKMPKNVDTIDKMDVTALFGGSFHHDGPFDACTPHRNKNNKAAPVMAFPV
                     DGPNSTIGGASSKQSAMDEVFGRDDVDDDNDLYKLKGGNSTKDAIRTNIGDFKQMDAK
                     NKATLVHGPITGALGSTTFLDGAPVDGGYSDNAGLQRNKSISYRMRDSNNNNKTSNGN
                     LRRNMTTNTHSSSRYNSDLNYSNSNNNTSRFNGGGGAATRNMRTTGNVPRITRTQSDN
                     ADMGSVIGNQDDNEDVYLGVRFDPSAKKKSTGSKLLSRVKSLKVGRK"
     gene            complement(<1052297..>1054126)
                     /gene="NDAI0C04610"
                     /locus_tag="NDAI_0C04610"
                     /db_xref="GeneID:11496593"
     mRNA            complement(<1052297..>1054126)
                     /gene="NDAI0C04610"
                     /locus_tag="NDAI_0C04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669316.1"
                     /db_xref="GeneID:11496593"
     CDS             complement(1052297..1054126)
                     /gene="NDAI0C04610"
                     /locus_tag="NDAI_0C04610"
                     /inference="similar to DNA sequence:INSDC:YDR349C"
                     /note="similar to Saccharomyces cerevisiae YPS7 (YDR349C);
                     ancestral locus Anc_5.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669364.1"
                     /db_xref="GeneID:11496593"
                     /db_xref="GOA:G0W8L0"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G0W8L0"
                     /translation="MYLISYLILISSLIFRRTLCATTATSSIEKPFPTINIGTTGSGI
                     YYINITMGTPEQQQELMIDTSQPYTWLLSGSQDLQCNRLNSGCLSGSLYYVKESTSAI
                     CINPNRTYHMAFIDQSEINGTHVIDMMNFTNVDVNTAYAHSTYNTKNNKGLINLGTNY
                     LGVSNVSFINADDTVPYAMGSLGLSGKITGTGTDIDSSNFDNSYDFLDRLYQTNLIDS
                     HSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFTGSFLQFEMLPALESDSAT
                     ETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIG
                     AMYVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGD
                     EACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQATQEEELQAKENVLDEE
                     EDFTFASGLVKRANSNNNTINASITTIATRRSSSSSGVLAISSGYIPYATSLNMSKVY
                     TRLFASTVSSKRVAIPGPYTASVYSNGIVVGPGRSFYVTSTSSATTRSSTTHFDSFVV
                     TAMDNSTDAQYTMSAMGSPSGLQRCTLTMLVVLVSGFFLNLFL"
     gene            <1055407..>1066674
                     /gene="NDAI0C04630"
                     /locus_tag="NDAI_0C04630"
                     /db_xref="GeneID:11496594"
     mRNA            <1055407..>1066674
                     /gene="NDAI0C04630"
                     /locus_tag="NDAI_0C04630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669317.1"
                     /db_xref="GeneID:11496594"
     CDS             1055407..1066674
                     /gene="NDAI0C04630"
                     /locus_tag="NDAI_0C04630"
                     /inference="similar to DNA sequence:INSDC:YHR099W"
                     /note="similar to Saccharomyces cerevisiae TRA1 (YHR099W);
                     ancestral locus Anc_5.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669365.1"
                     /db_xref="GeneID:11496594"
                     /db_xref="GOA:G0W8L1"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G0W8L1"
                     /translation="MSLSEQLEQFSKRFSDESTSLQEKHSIISGICDVLELIVLPDDY
                     ALFIEKLVPVLLNQLKTIKISFDETSNENKLRNSILNVLNRYLVNQPSESQLFYIVDT
                     LTETLPKENDENGVLCMRILTALFKAFKNLLVDKVEQFVKIIIQIYENSPELIRREFD
                     TNISNESSRSPSIEDDKYEQLLDPIENDNQGQDQDNDTIIKNSNGKTTTTTVTNDQQP
                     VETSLNKKLRPTLFSLKILAECPITMVTLYSSYKQLTGTSLLCFTPLVMDLLKIEIPQ
                     QKTAREQAESQGNRYTSVSPEIKSREIYCEFIRAQIKATSFLAYVFIRGYAPDFLQNH
                     AEFVPDLIIRLLQDCPSELASARKELLHATRHILSTNYKTLFLPKLDYLFDEDVLIGN
                     GFTTHEILRPLAYSTVADFIHNIRSELTLDDVEKTIKLYTGYLLDESLALTVQIMSAK
                     LLLNLVERILKLGKENPQEAPRAKKLLMVIINSYLHRFKILNRDYHSIHRLHKKCEKK
                     KMLKLKNMKNEVGAEKIDPDTYMKEVFHIDLESFDPSFGNSKQVKKENTDAEKNDDVN
                     MDCNEDIPTSFFEIKEHAPILLAPASTGDPVKDSFYLYRTLMSFLKTIIHDLKVFNPP
                     SNEYTTINPKIWLSVSRVFSYEEVVMFRDLVHECIIGLKFFADESEQAKVTSKKHFDI
                     ASPSLPVPTTKDGRELMDYLAFMLMQLDSSTFNEILEAEIGFIYDRMLEDPSILHLAQ
                     SFLTNEMTSPNFCSIVLRFLRKKLETLGNASVNESNVLIRLFKLSVMSVNIFPNTNEL
                     VLLPHLNPLILDSLKFSTTTEEPLVYFYLIRTLFRSIGGGRFENLYRTIKPILQVLLQ
                     SLNELIITARLPHERELYVELCITVPVRLSVLAPYLPYLMKPIVYALKGYPELVSQGL
                     RTLELCIDNLTSEYFDPIIEPVIDEITKSLFKLLQPQPFNHTISHTTVKILGKLGGRN
                     RRFLQPPSDLKSETELDIEIDALFKVNGFAEDVPLSITPGITSALEIMEDYRIGIHYK
                     KSAFKYLSSILLLILKSSVQFPDDFDKIITQASNIPLKEKVDIVSNFEQLPTFNRDLF
                     TKQEKLLTRLIEIVFFATSIDELKDDAKTLMSHIVDHFCLLQTSNTVVNKLNYTNMFN
                     IDVKQPEVSINSNVLVDALSNSLSCYIKDVQQSAIDAVKQIYERSALIYNEELLFTHS
                     LLFDLMNQFMHFCYKESFYDKNTGILGIRTLLQDIKPPLELLKRLQPELVACFLFVLK
                     DTMTEAPVTITNDAQESLIDLLKTTCADVTQEKLTSKYLQNSLTDIVCELSNPNARVR
                     EACQLCLKTLHELTNIPIVDLMEHSKNFLLSPIFAKPLRALSFTMQIGNIDAVAYCMG
                     LPNSFLVFNEELFRLLQEVIVLADAEDESLSSLQRVTEYKTSEQLIQLRVSCIKLLAL
                     SLKNKVFASAQQGNLRIRVLAVFFKTMLNNSPKIIDSTYEALKTALEENPKLPKELLQ
                     NGLKPMLMNLSDHQKLSVPGLKALSRLLELLIAYFKVEIGKKLLDHLSAWCRLEVLDT
                     MFGQDIMDQTPIKIITSIVNVFYLLPPKADIFLNDLFLKVMVLERKLRIQLDSPFRLP
                     LAKYMNRFHTSVMDYLKDRLGLRQVILFMCDIIQLPEAKDLSDDFEKNMGNFFEYYMS
                     NIPSNQVRVVSFFANTTDLFDTLIKVRGMDWLRSQREMVFKLKDMLTLTMKTIRENKF
                     YIDDLLLGQTIEKFQAFYLKFVEFYPSEKQLFFDFLTFLLHNKIKLSDGVFNFIFKNI
                     ISSPDVDEQNKYLHAALSVALSQDLQVNIFFARNIINATLIYEGVKTNSLLKFCKNDI
                     KPDWLDLIYNRIWTSKNGMLLDCVDGEYDIYRFELLQLSDILIKWMPSVLSEMKKDII
                     KFNWHFIKLEDTLVKQTAYLVTSNFILQYDFPLKVITQIFVALLRCPPTEARFIVRQS
                     LDIMAPVISRKMSKEGTPNEWVNWVKRVMFENSAGQNNTLYQFLVNHPDLFYSSRDLF
                     VSNIIHHMNKITFLPNSSLDNHILALDLANLILHWEKKTLELNGTKAKDADGDIPMTD
                     TDKATSINDQPESSDELNLDYAIPMNLRESCISFLIRYICASDHRASENELGIKALAI
                     LSSLLSAQYWSNVNVKLTYFEKFLANLELGSENIVYYCINTLDVLYIFFQNKKGDWII
                     ENLATIQALLANSIQANHHDMQEALQKVLNLVLKAIKSKGPLVSLNEATTPSKAFVDY
                     LVTTINQDLQNTASVAAGVTLAWTLFVNFPDAIDSLLNPIMKTFNKLCKDHLTTSQPK
                     DAVTMEEAKITTTLMEKLHCLLSAKVVSLGDARRPFLSTIALLIDRSMNQQFLCRIVS
                     MSRIWVFNHELFPTVKEKAAILTKMLAFEVRGEPSLSKLFYEIVLELFERKAYNNTEI
                     IVRLEQLFLVGTRTQNVDIRRRFMKILDNSLETDVKERLYYIIRDQNWEFIADYPWLN
                     QATQLLYGSFDKKHKLFLEKPLPITDPKNLKELLSEDVPSSHIAVKEDLSSFIKKHTD
                     SISKLCDIDSSDILEPLVELFYQNPKSIQKTWINLFPQIYKCIPRNEKYGFVRSLIAI
                     LSKPYHTKYSRVNIISILLDSISKVPSLELPPHLVKYLATSYGSWYQSIKILEMFQNN
                     TMIDNSKIIEANNDALLELYRNLQEDDMYYGLWRRRAKYNETNVALSYEQVGLWDNAQ
                     KLYEAAQVKARSGALPYSESEYALWEDNWILCAEKLQQWDVLTELAKHEGFTDLLLEC
                     GWRVADWHADREALEQSVKSVMDVPTPRRQMFETFLSLQQFADTGKGDQDVRRLCDEG
                     IQLSLHKWASLPERYTSAHKWLLHGFQQYLEFLEAIQIYNNLHTTTVQNIDAKAQEVK
                     RVFQAWRDRLPNIWDDIDIWNDLVTWRQHTFQIINAAYLPLIPALQQTNSNNTINTHV
                     YRGYHELAWIINRFAHVARKHNMAEVCINQLTRIYTLPNIEIQEAFLKLREQAKCHYQ
                     NANELTTGLDVISNTNLVYFGTGQKAEFFTLKGMFLSKLKANEEANQAFATAVQIDLN
                     LAKAWAQWGYFNDRRLSEEPNNIGFASNAISCYLQAAGLYKSSKTRNLLCRILWLISM
                     DDASGSLSKAFDSFRGEVPVWYWITFIPQLLTSLSHKEANMVRQILIRIAKSYPQALH
                     FQLRTTREDFAVIQRRTMAVLADKGEAVSQSGPGTRQPWEYLQELSSILKTAYPLLAL
                     SLESLVAQINERFKNNTDEDLFRLINVLLIDGTFNYNRLPFPRNNPPLPSSTANNLAR
                     LSETLLAPHIRPKFNADFIDEKPDFETYIKRLRYWRRRLENKLDRAPHVESLEKICPH
                     LSNFHHQKFEDIEIPGQYLLNKDSNLHFIKIARFLPSVDFVRTTHSSYRRLNIRGHDG
                     TIYSFAVQSPAARHSRREERMFQFYRLLNKLLVKNVETRRRNVQFTVPIAIPLSPQVR
                     IMNDSSSFTTLHQIYDKYCAQVGFDPDTLEGFISDQLRIAHDKSLPNPDLTLVNIEIL
                     SSIQSMFLPNTVLRDHFATKFTEFEEFWLFRKQFTSNYSTFTFLSHMMTINNRTPSKI
                     HIDEKSGDVFTLEMLPSRYPFERIKPFLKNYDVNLPPDAPIFHNQEPIPFRLTPNIQK
                     LIGDTGLEGIFSVILFVISNALIEHENELNTYLTLFIRDEIISWYSNLHRPIVENPQL
                     REMVKSNVDLIVRKVSQLSHLSSTTSTVTTQYILDMLSAAVNPRNLTKTDVSYMAWF"
     gene            complement(<1067359..>1069692)
                     /gene="NDAI0C04640"
                     /locus_tag="NDAI_0C04640"
                     /db_xref="GeneID:11496595"
     mRNA            complement(<1067359..>1069692)
                     /gene="NDAI0C04640"
                     /locus_tag="NDAI_0C04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669318.1"
                     /db_xref="GeneID:11496595"
     CDS             complement(1067359..1069692)
                     /gene="NDAI0C04640"
                     /locus_tag="NDAI_0C04640"
                     /inference="similar to DNA sequence:INSDC:YDR350C"
                     /note="similar to Saccharomyces cerevisiae ATP22
                     (YDR350C); ancestral locus Anc_5.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669366.1"
                     /db_xref="GeneID:11496595"
                     /db_xref="UniProtKB/TrEMBL:G0W8L2"
                     /translation="MLCQSRITWKPILSISTRLIHNQQVPTIRDNDSQLTDDNKKGQK
                     IYSIIQRKKIDYFYKQTTSLTPRLVNLIDSIQNPFKLKAVIKHLQNHYGKERWPSFLS
                     HLTKFSKDPDLFILKTHTHLNRKQYSIFIQKLRTIITTNDLPSEKKRQELYKLINLQY
                     ILFSRKEPFHCFILPDDIHKWFFENINKKGNEIFNHYKFLIDNDIHLSSSLHVQLLLR
                     KLLQGSELDIQLVTFRMFFQFNSNRSKYVNSKTRDIHFIKFVKLYDLNFMILLINKYI
                     QRNDFRLINLYLKALLEKLRLHRTINNDKHPNFKELEQKRQLAFIKFNNMLIHIVSKI
                     GNIHLFTSIITFQIKYLQDFVPNSLKGNDSTILNLLHKPIHDFIRLLKSNGNQDDVFK
                     LCVQLQKINAFQINKSYRFKNLILFELISSLKSLKDPKLSTQYLLSIYPLHESEKLAI
                     LLNNLNLWGWIFHDQPIKLSNSKLQSELQNIMNTSLLSDDMKLKKITPNIISPFISQI
                     YSVLIETKFELMGETIYGKENYKAFLLNIYSNYKSYLQHSIIPNVASSSKNKLLLWKH
                     NTSILNIILTAIKSKLYDTKLAYNVLLDFTSNSHFLKKIKMKNNNSFCPFSTVIYNSD
                     QILTEHDLFKLFQIMEDNNVPLSFKTCVAMVFRYLKIDNKPLAKQWYDKILRVGFPIN
                     HFSLIKIIKENGWDFPLGFDKSLLEKLQQNEQSLSQSSSISETDQALLLDSNINALED
                     IEETASFPDSYLQNVQHKKTDNSQIDELLGLIATLKD"
     gene            <1070676..>1073291
                     /gene="NDAI0C04650"
                     /locus_tag="NDAI_0C04650"
                     /db_xref="GeneID:11496596"
     mRNA            <1070676..>1073291
                     /gene="NDAI0C04650"
                     /locus_tag="NDAI_0C04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669319.1"
                     /db_xref="GeneID:11496596"
     CDS             1070676..1073291
                     /gene="NDAI0C04650"
                     /locus_tag="NDAI_0C04650"
                     /inference="similar to DNA sequence:INSDC:YDR351W,YHR103W"
                     /note="similar to Saccharomyces cerevisiae SBE2 (YDR351W)
                     and SBE22 (YHR103W); ancestral locus Anc_5.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669367.1"
                     /db_xref="GeneID:11496596"
                     /db_xref="UniProtKB/TrEMBL:G0W8L3"
                     /translation="MSAPQIFTKLDTLKEEDSSNLTSPIEPTATTLNSPSLPSKPLNL
                     GRIGKNRPSDSVLLLSSSKIGARTNVTAAAAAAAAVTVPRHDHDYHNPRPISEESILT
                     RTTDIFSSDTNSESFSSISNELENTTYDDQSMDNIDMHVVNQLEATINNMEFLSINND
                     NGDKSMDMDMNMDMDLSFGTQSFSTIGPISRNSTIRQQSSLIHENTRYSYKSNITSRQ
                     NSINSKYSTTSSASASASASTSTSASAFAFALPSSAPTAANLPKACNRSNSYSQASQT
                     KFQNNRNKNNNRKKSNSNNNNNNNNNTVKTLYPLKHSHSMIINNSLPMYDNNIDNTTN
                     KSSFMTPSQKFRLRKEQKGKELRKIIKEKEQFYEESEKISDLEIIDGDINDSLIWNIP
                     TASISTTSFISDNNNNKNKTRAKKNLNRPLMHSQFSLSTTSIPGINSVSDTQYFQETT
                     NDLSSLYVNDSKTITKSKLQKRHYSADHLPLSMKHASDSGLEDLLLVSNDKLKFISSS
                     RPSWLPPKDPIEMTFHNLCISENLNRLSNDQLKLNQANDELLKIDQLNISTYERLLKN
                     DNYNHHHHHHHHHHDLKTLKKIIWQTKLPNNLITNLFLMTFKNVEEEHSFDSFENVLR
                     LLNKMKFPTDKEFQINQLIENNINNKLSGYIQPISDQLHSNLMLLLQLKSISQHGLVI
                     GDDLLFYHFLLLIHNNNNDDGQEQELDVNDLSTIWNIVNKIQVTCFNEHYKEQYDINV
                     LKKAQSLSFLNKPEFKNELNSNCLNFNTIWNVFERLDHDLFLWIISIIFTLTMYQNLK
                     SKRKSNYKISISFTINILINYHFGFNDFQHLNDLEDANFCIPMPIPITRDSNDEQLNS
                     NRTFIKKWLHYYETI"
     gene            <1073895..>1074863
                     /gene="NDAI0C04660"
                     /locus_tag="NDAI_0C04660"
                     /db_xref="GeneID:11496597"
     mRNA            <1073895..>1074863
                     /gene="NDAI0C04660"
                     /locus_tag="NDAI_0C04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669320.1"
                     /db_xref="GeneID:11496597"
     CDS             1073895..1074863
                     /gene="NDAI0C04660"
                     /locus_tag="NDAI_0C04660"
                     /inference="similar to DNA sequence:INSDC:YDR352W"
                     /note="similar to Saccharomyces cerevisiae YDR352W;
                     ancestral locus Anc_5.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669368.1"
                     /db_xref="GeneID:11496597"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G0W8L4"
                     /translation="MTELDNCAQSIWPLISNINGSLSFISSFISLLPQIIETYHDKTV
                     IGLSPYFLLAWLCGDITSLIGAILTDQLSFQIILAIYFLFNDLFVCGQYYYYGIIHKN
                     KLATMSHEPKPLLTTIDIDMDNNTNSNTNGDDDHSSNSNGLEAIRSRDSSQRRAALIT
                     ALTIANSINSAEAQSLPPPSSSPVLRNNRIGTILSWMGASFYVGARIPQLYRNYKRKS
                     TDGLSPFLFATTLLGNITYNVSIFTSCNVLMNDDKIGFIKNEMPFIFGSAGTIIFDLI
                     YFYQYYVLYADDLKLRELEREIMEECSNEDVDGQGVEVSERTALLL"
     gene            <1076017..>1077057
                     /gene="NDAI0C04670"
                     /locus_tag="NDAI_0C04670"
                     /db_xref="GeneID:11496598"
     mRNA            <1076017..>1077057
                     /gene="NDAI0C04670"
                     /locus_tag="NDAI_0C04670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669321.1"
                     /db_xref="GeneID:11496598"
     CDS             1076017..1077057
                     /gene="NDAI0C04670"
                     /locus_tag="NDAI_0C04670"
                     /inference="similar to DNA sequence:INSDC:YDR353W,YHR106W"
                     /note="similar to Saccharomyces cerevisiae TRR1 (YDR353W)
                     and TRR2 (YHR106W); ancestral locus Anc_5.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669369.1"
                     /db_xref="GeneID:11496598"
                     /db_xref="GOA:G0W8L5"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G0W8L5"
                     /translation="MYKTIQTNTLIQSLYKSTPNILSLQRMAHSKVTIVGSGPAAHTA
                     AIYLARAEMKPTLFEGMLANGIAAGGQLTTTTEIENFPGFPKALTGSELMDKMREQSI
                     RFGTDIITETISKIDLSTRPFKLWSEFNEDGEPTMTSDAIVFATGASAKRLHLPGEDQ
                     YWQKGISACAVCDGAVPIFRNKPLAVVGGGDSACEEAQFLTKYGSKVFMIVRKDYLRA
                     STIMQKRAEKNDKIEILYNTVSLEAIGDGKLLNALRIKNVKTNEESELQVNGLFYAIG
                     HTPATKIVQGQVDTDEAGYIKTVPGSTLTSAPGFFAAGDVQDARYRQAVTSAGSGCMA
                     ALDAEKYVSELD"
     gene            complement(<1077391..>1079541)
                     /gene="NDAI0C04680"
                     /locus_tag="NDAI_0C04680"
                     /db_xref="GeneID:11496599"
     mRNA            complement(<1077391..>1079541)
                     /gene="NDAI0C04680"
                     /locus_tag="NDAI_0C04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669322.1"
                     /db_xref="GeneID:11496599"
     CDS             complement(1077391..1079541)
                     /gene="NDAI0C04680"
                     /locus_tag="NDAI_0C04680"
                     /inference="similar to DNA sequence:INSDC:YDR194C"
                     /note="similar to Saccharomyces cerevisiae MSS116
                     (YDR194C); ancestral locus Anc_8.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669370.1"
                     /db_xref="GeneID:11496599"
                     /db_xref="GOA:G0W8L6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8L6"
                     /translation="MLLRIHRRSNLPSRLLLSSLSKVAGITTSNDNSSATTVFTEARR
                     HYYQEGGSKNSSNNNNRGSKRRDWDSDSRGPRYSKHYNNNNDRGSSNSGYFNTKNYGG
                     NRGGRSSGGRGGSSSRQYPPRRYDTMEDAEPTLETNSKFTKKVVRLDSTNNNEEVTLD
                     QLHEEGIIDTMLHKSISRMGFPGLSPVQQRTIKPILSSTTNDDVIARAKTGTGKTFAF
                     LIPMFQHLINTQLDSRYMVKCVIVAPTRDLALQIEAEVKKIHDHNYGLKKFGCVSLVG
                     GTNFGMAMRRMDQIRPNIVIATPGRLIDVLQKYGNKFFKYVDFKILDEADRLLEIGFK
                     EDLEFVSGYLNDINAKAKDHIRTLLFSATLDEKVQVLANEIMNKDQCLFLDTVDKNEP
                     EAHEKIDQAVVVTNHFAESVYATLDHLQKQIVADPGYKGILFAPTVKFTRFIAKLLQK
                     EFTNDLPVLEFHGQLDQRRRTNLVNNFKKMEKGLLVCTDVGARGMDFPNVKEVLQVGV
                     PSELPNYIHRIGRTARSGKEGSSTLFICKDELPFIDRLKFEKNIIIENSRDFQPDEEM
                     RTEFAKKIEENSSLGFGEVLISVISFYRSCIKEYGFRERDILPEIASSYAVLLNKPDA
                     KIPVESFSFLEKMGLARNGRVRDMFEVKPRNYDEEGDGNDEFNGEDNDSFGDGGNYRY
                     NNNNRRGNYGHSNNRRNNYNSNRRRTYDNNNSFE"
     gene            <1080596..>1082740
                     /gene="NDAI0C04690"
                     /locus_tag="NDAI_0C04690"
                     /db_xref="GeneID:11496600"
     mRNA            <1080596..>1082740
                     /gene="NDAI0C04690"
                     /locus_tag="NDAI_0C04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669323.1"
                     /db_xref="GeneID:11496600"
     CDS             1080596..1082740
                     /gene="NDAI0C04690"
                     /locus_tag="NDAI_0C04690"
                     /inference="similar to DNA sequence:INSDC:YDR195W"
                     /note="similar to Saccharomyces cerevisiae REF2 (YDR195W);
                     ancestral locus Anc_8.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669371.1"
                     /db_xref="GeneID:11496600"
                     /db_xref="UniProtKB/TrEMBL:G0W8L7"
                     /translation="MSSPIPQLVNISHALQSATIQQIRSDVISYNSSPVLSQDQSNKI
                     DYYLQSLNFALQQFQNDNRHIENNVNGVTQADIQLYNGLKSMYSDYLYQLLNLKNNKS
                     VSIPFTTTNTITPITPSINNNIPPINYNNNNNYNNNNNNTTQNNSFNNFIQNDNLNSN
                     PTIIQQTPVSTNAPSTNVPASASLPAPAPAPAPAPVPPRDIFEDPFNFISKEFEDLTP
                     NQRKNYINIVLKNEKHLKKFIKNPLLLETIANLCILDSENGDNILAYITLLKKIGYSD
                     KEIKGNMNRSSNSLSSSSSSSSSGRLSKKLSSSTASSRTKKRVAPTTTTTTTSTKSSL
                     KSTKPTSSTLATSKSSSLKVPKMKEKDKEKEKRKDKEKLSSSSSKKQTIVPHIHIANN
                     HSPNKTSNKETTTSTEITRRNVNGAMTSQETNSKSISDTKDNSNTDNQDTKKKISFSK
                     YLKNDTVNDNNKRPHPSDSNDKIETSSSSSSSSSSLLSDTPTLKKRKSDVKLVSILKN
                     PQPSTEERPISTTSSGSPSSPKPKSNIKFKDDSKLITVYGDDLPNKGLKVSPIELKKI
                     LKPFNEGEPNEYIHIENFQSIPIPINLSELQDSNLYSDIVDVKGGPLTSNSCVSQFYK
                     SDFKNLNPNLKTQIPLDPIPMDEHEIIENSKKKTMNHGIKLYNKPIIGKAFGRNSLLL
                     RKDRGGLPYKHVPVVRSDRRTSIEFTRLDRNK"
     gene            complement(<1083135..>1083893)
                     /gene="NDAI0C04700"
                     /locus_tag="NDAI_0C04700"
                     /db_xref="GeneID:11496601"
     mRNA            complement(<1083135..>1083893)
                     /gene="NDAI0C04700"
                     /locus_tag="NDAI_0C04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669324.1"
                     /db_xref="GeneID:11496601"
     CDS             complement(1083135..1083893)
                     /gene="NDAI0C04700"
                     /locus_tag="NDAI_0C04700"
                     /inference="similar to DNA sequence:INSDC:YDR196C"
                     /note="similar to Saccharomyces cerevisiae YDR196C;
                     ancestral locus Anc_8.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669372.1"
                     /db_xref="GeneID:11496601"
                     /db_xref="GOA:G0W8L8"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G0W8L8"
                     /translation="MLVVGLTGGIGCGKSTVSKRLAENHDIPVIDADKIAREVVEPGQ
                     DAYNKIVKYFTDKIDYLLLDDGHLNRAELGKWVFSHPNDLKILNNITHPAVRYSIFKN
                     MGYYYVKGYRLVILDVPLLFEAKLDMFCGVTISVICERDIQIERLKIRNPVMTTEEIE
                     NRINSQMSMDERVKKSDYILQNNGTLTELYEQINNVVMKIKPSLMRTSIEYFPLFGLV
                     SATAIVLSKVIYAKFDANFSESGENDKKKGKKVA"
     gene            <1084157..>1085320
                     /gene="NDAI0C04710"
                     /locus_tag="NDAI_0C04710"
                     /db_xref="GeneID:11496602"
     mRNA            <1084157..>1085320
                     /gene="NDAI0C04710"
                     /locus_tag="NDAI_0C04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669325.1"
                     /db_xref="GeneID:11496602"
     CDS             1084157..1085320
                     /gene="NDAI0C04710"
                     /locus_tag="NDAI_0C04710"
                     /inference="similar to DNA sequence:INSDC:YDR197W"
                     /note="similar to Saccharomyces cerevisiae CBS2 (YDR197W);
                     ancestral locus Anc_8.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669373.1"
                     /db_xref="GeneID:11496602"
                     /db_xref="GOA:G0W8L9"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:G0W8L9"
                     /translation="MSTIIYPRIYLLGNSPISPLLAYEISRLPTQPKVPDVVLLLQDS
                     KKLQRFLDNDSKVCIHKQDGTINEQQFMASCNLPIYSTGEIAQINNLIACETSSKSLT
                     SSLFKYRKSIKDSTNLLLVNPPFGSIQYILDNVWKSNASNKPNIFIGMNKFNQLETKF
                     GRLYNEFHLKLRANSLNLLISQLPTNFNVGVSTLTDHDEDAAGTGNELMKTLKETERN
                     SRRERSDRTSLEFQMVPFEKLYQIRLERLIVQSCIDSLSLLYDCQLNNELLHIIAQPN
                     SILMDLLNEQINILKKSYPFLENQNYSNILLSQNRLFNVVVGLLEKNATKQPMVLHLK
                     NQLNQTPINELTGVFTRLAYTNNINCKWNKMVTELVRGKLSLLKKRSLNYHYL"
     gene            complement(<1085473..>1086891)
                     /gene="NDAI0C04720"
                     /locus_tag="NDAI_0C04720"
                     /db_xref="GeneID:11496603"
     mRNA            complement(<1085473..>1086891)
                     /gene="NDAI0C04720"
                     /locus_tag="NDAI_0C04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669326.1"
                     /db_xref="GeneID:11496603"
     CDS             complement(1085473..1086891)
                     /gene="NDAI0C04720"
                     /locus_tag="NDAI_0C04720"
                     /inference="similar to DNA sequence:INSDC:YDR198C"
                     /note="similar to Saccharomyces cerevisiae RKM2 (YDR198C);
                     ancestral locus Anc_8.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669374.1"
                     /db_xref="GeneID:11496603"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G0W8M0"
                     /translation="MDRKVDALISWLKESDGFYLNEKINVSEIENAGRGVVLVKDQLS
                     KNERVVSIPPSHQLNFHTVIYHISKFNPSLDIPGVTYPHDEAVEINPENEDDPRYKIY
                     GDFSKYYLLSLNSFQLLSLYVLIEKVLLPLWSDNQVESFWKPFFDVWPTKDELFTMPC
                     IWVEDKSGQYKNTMIAHPPHSLKLMEKRRKVYHKDTVNLVPKIMEIKDKYFNDKPFPD
                     SVLLNEEILNIYFNINSRCLYVNIPLKKFQNNDDHFTLAPFVDFLNHTPETDLHCYPA
                     RPKDLLGNKISNFTIMSGEYQYKKINEELFLNYGPHSNEFLLNEYGFVLPENKWNSVD
                     LTAELEEQLISSGCKPFLRKHGYWGNYIMSLETIGFTTLVAFSFLVTKDVRRVERLIE
                     GHISEDYFKPIIARKFKDFLSYLLQKNLKNSEKIKQQRERVTSEKEKICLDNVIQLYL
                     DEYKIVSSHLEDFKRIIDEDDI"
     gene            complement(<1087078..>1088739)
                     /gene="NDAI0C04730"
                     /locus_tag="NDAI_0C04730"
                     /db_xref="GeneID:11496604"
     mRNA            complement(<1087078..>1088739)
                     /gene="NDAI0C04730"
                     /locus_tag="NDAI_0C04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669327.1"
                     /db_xref="GeneID:11496604"
     CDS             complement(1087078..1088739)
                     /gene="NDAI0C04730"
                     /locus_tag="NDAI_0C04730"
                     /inference="similar to DNA sequence:INSDC:YDR200C,YLR238W"
                     /note="similar to Saccharomyces cerevisiae VPS64 (YDR200C)
                     and FAR10 (YLR238W); ancestral locus Anc_8.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669375.1"
                     /db_xref="GeneID:11496604"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:G0W8M1"
                     /translation="MKRRPPPHTSSPNTRRMSPNNKASPSIKTALSSPLADRRTRTRS
                     NSRSTGSRSGIDFVPDQIIDSPSLQLPQQIEDQDQDQDQEQEQDHGNSTAANTDQLQR
                     NEPLENSMRNKYTHIVILKPLNNTFETKFLVIPFKPDVLKLGRPVANNNNITNSNGII
                     RSVQSPASLVRTDNGNFDSRVLSRNHASLTCDPESGKILLRDLNSSNGTFLNNVKISS
                     DKEVELNIGDVIDLGTDIDNKFEHRKISAFVEDISVIPLINGNPNHIVTRNDDLHVQK
                     MQSPTTAKQRQNNSYGNNPRMNMAMNAQRAAFEAAMFGDVNNSDLDESILGEETEILS
                     GIFINNSVGTSPNLINIIKTLNTEISLEKKENDKLNAMQTFLEYYVGDLDNIQKGIIT
                     SHDKQLNKFTASLKKSLAEKHGILIQDCKDQMDKVSTERDTVYDLIKVQRMENDKYLQ
                     KMEQELLSARNLLQREKDKNLLLMNKKRSSSSKNTLTPIEDSTHTASEDDTLNLNKTE
                     NDFDTIKNTSTTANDGTIMSNWKVNVSIGAVAIGLVAIGAKLYPK"
     gene            <1089213..>1089695
                     /gene="NDAI0C04740"
                     /locus_tag="NDAI_0C04740"
                     /db_xref="GeneID:11496605"
     mRNA            <1089213..>1089695
                     /gene="NDAI0C04740"
                     /locus_tag="NDAI_0C04740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669328.1"
                     /db_xref="GeneID:11496605"
     CDS             1089213..1089695
                     /gene="NDAI0C04740"
                     /locus_tag="NDAI_0C04740"
                     /inference="similar to DNA sequence:INSDC:YDR201W"
                     /note="similar to Saccharomyces cerevisiae SPC19
                     (YDR201W); ancestral locus Anc_8.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669376.1"
                     /db_xref="GeneID:11496605"
                     /db_xref="GOA:G0W8M2"
                     /db_xref="InterPro:IPR013251"
                     /db_xref="UniProtKB/TrEMBL:G0W8M2"
                     /translation="MTDALEESVKSFERMIGLLQTTVDTLKHDSEDNTHLTETLLMSR
                     RVFELVPEYDVQRAKLSLIEEVDPIVKTLEDKLQKSTGKLQRELDTIQQTCELNKLRL
                     NNNHRTNLTTGTSNEMDAGNLSTDVVVMGSSTNEELDTLRALKNRKQELEERLAQLQS
                     "
     gene            <1090180..>1091205
                     /gene="NDAI0C04750"
                     /locus_tag="NDAI_0C04750"
                     /db_xref="GeneID:11496606"
     mRNA            <1090180..>1091205
                     /gene="NDAI0C04750"
                     /locus_tag="NDAI_0C04750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669329.1"
                     /db_xref="GeneID:11496606"
     CDS             1090180..1091205
                     /gene="NDAI0C04750"
                     /locus_tag="NDAI_0C04750"
                     /inference="similar to DNA sequence:INSDC:YDR204W"
                     /note="similar to Saccharomyces cerevisiae COQ4 (YDR204W);
                     ancestral locus Anc_8.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669377.1"
                     /db_xref="GeneID:11496606"
                     /db_xref="GOA:G0W8M3"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /db_xref="UniProtKB/TrEMBL:G0W8M3"
                     /translation="MLHQQSVLFLSRYCHNYFLKPQRRNVMLSALTALTSTATIGNYL
                     FGKDIKLADAMDKGELHNINEDYASKANETMLNRLKKLRNSRPMEPRYEGHVPLYLHE
                     KLLLFLSSGISSFLHPENGMNIVKLGEATAIPPFLESLKRTMLSDETGRRILRDKPYV
                     HTSILHFDKLSKLPENSFGYTFYKWCQTEKVSPDTRAPVTYIDDPIHAFIFQRYRQCH
                     DFYHALVNMPIIIEGEITIKALEGANMGVPMAILGAIFAPLRLKPIQRKRLREIYLPW
                     AVKTGLNCKPLVNVYWEELLEKDVNELREELGIKMPPNLREMRKKRAEMVKSLKHKYE
                     ENPSKAN"
     gene            complement(<1091447..>1093228)
                     /gene="NDAI0C04760"
                     /locus_tag="NDAI_0C04760"
                     /db_xref="GeneID:11496607"
     mRNA            complement(<1091447..>1093228)
                     /gene="NDAI0C04760"
                     /locus_tag="NDAI_0C04760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003669330.1"
                     /db_xref="GeneID:11496607"
     CDS             complement(1091447..1093228)
                     /gene="NDAI0C04760"
                     /locus_tag="NDAI_0C04760"
                     /inference="similar to DNA sequence:INSDC:YLR237W"
                     /note="similar to Saccharomyces cerevisiae THI7 (YLR237W);
                     ancestral locus Anc_8.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003669378.1"
                     /db_xref="GeneID:11496607"
                     /db_xref="GOA:G0W8M4"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G0W8M4"
                     /translation="MTTLTKRILKVLEVPVGDRETISFLKNPDLQPIKLKNQTWGFWS
                     NFSYWSVVSFSVVSWISASSALSVGLSYGETIGTFIIGDVVAIIFTLANSYPGLDWKV
                     GYTINQRFVFGIYGSWFGILIRVLMSIVNYGSNAWLGGLCINMILDSWSHHYLHLPNT
                     LSKHVAMTTKELIGFILFHVITAFCYLMRPYHMNYILIISCTATCFSMLGMVIYLTHQ
                     AGGVGDYFTAKGTATGSTKAWAWVYMISYWFGAVSPAACNQSDYSRFGSSQTAIWLGT
                     ILALLIPTTIVPVFGVIGASAGMKLYNIEMWQPMDFFTYWLKGNYSSGARAASFFCGV
                     SFSMSQMAYTISNAGFASGMDLAGLLPKYLNIKRGAILTAMVSVAVQPWNFYNSSSVF
                     LTVMSSFGVVMTPIIAVMICDNFLIRKRNYSVSEAFVLKGEYYFNKGANWRAMVAWVC
                     GMAPGLPGIAWQVNNNYFHNKGIVNFYYGDSFFSFAISFFLYWFLCIVVPVKVNILHD
                     DKDYYGAFTDEVARSKGLIPFSEISEEELNIHQSGEEAMDEVKLTITTGTEDEKITKK
                     TVNADSISISTTTEHSSRCKSSTDIPN"
     gene            <1094314..>1096755
                     /gene="NDAI0C04770"
                     /locus_tag="NDAI_0C04770"
                     /db_xref="GeneID:11496608"
     mRNA